2V1BA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (room temperature (293k) light structure of lov2 (404-546))
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
144
structure length
144
Chain Sequence
FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase
total genus 49
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v1bA00
3H7WA 5HSQA 3NOUC 2KDKA 1KOUA 4GS9B 2H28A 4HP4A 2VV7A 4LRXC 1XJ4A 5F68A 3F1OA 1OTDA 4WN5A 2PYRA 3P7NA 4I3IA 1F98A 1S1YA 2PDRA 1N9NA 5I5LA 1UWNX 2VV6A 2K7SA 4HHDA 3MXQA 1EW0A 5F6AA 2P7JA 5AVFA 2BASA 3NOPC 4WLAA 4DJ3A 3E4OA 1TS6A 1V9YA 3GECA 2PD8A 4L9GA 2INWA 3SW1A 4L9FA 4I39A 1DP6A 4HY8A 1G28A 1WA9A 3H7WB 4LPZA 4GCZA 1OJGA 1D7EA 4EEUA 3GDIA 3IS2A 1S67L 3NHQA 2GJ3A 5J3WA 2A24B 3C8CA 3ZQ5A 4NXEA 3B33A 5DJUA 3PHYA 3C2WA 1X0OA 4I3AA 3MR0A 4HI4A 1OJ5A 4NXGA 3E4PA 4PKYA 1DRMA 4F3LA 1LSWA 3E4QA 4K08A 1OTIA 4GS9A 3UB8A 2PD7A 1TS0A 2ZBBA 4L9EA 4GHIA 2QWSA 3H9WA 3VE4A 1S1ZA 2D01A 3BY8A 2V9AA 1TS8A 4HQAA 2OWJA 3IS2B 3LI9A 3MQQA 2W0NA 4JGRA 4KUOA 3UMDA 2PYPA 1GSVA 1S66L 3RTYA 4F3LB 4JGPA 3HJIA 5HWVA 4BBUA 1LT0A 5F5YA 4HJ6A 3UB6A 1XFNA 1F9IA 1OTAA 1Y28A 2WKPA 2A24A 4EQ1A 4GHIB 2HV1A 2V1BA 2J80A 5HZHA 2V0UA 3H82B 4YWZA 4HIAA 3LIDA 2V0WA 2JN7A 4EXOA 5A8BA 4HH3A 5HDDA 1OT6A 4HOIA 4H6JA 2WKRA 2EA9A 1OTBA 1V9ZA 4JGQA 1XFQA 2PR6A 2QJ5A 1LSXA 1T18A 2QHKA 4RQ9A 5F69A 4BBVA 3LICA 2PHYA 3K3CA 2JHEA 1NWZA 2R78A 1T1AA 3KX0X 1UWPX 4M4XA 3BWLA 3EWKA 5DJTA 3LUQA 5HWWA 3IBRA 4WL9A 4EERA 3PYPA 4EW7A 3OLOA 1LSVA 1GSWA 4H6JB 2B02A 4R6LA 2V1AA 3F1PB 2QKPA 4R38A 2L1MA 3FC7A 4B9OA 3H82A 2YKHA 3D72A 3FG8A 5EFWA 5J7EA 1DP8A 3LIEA 1JNUA 4I38A 1BYWA 2M1CA 3CAXA 3BY9A 2I9VA 2D02A 4DJ2A 4HJ3A 1T1BA 2ZOHA 4EESA 3VE3A 5HD5A 2WKQA 3K3DA 1S4RA 1XJ3A 4HH2A 4EEPA 1N9LA 2ZOIA 2VV8A 1T1CA 4WUJA 1P0ZA 2VLGA 4PKYG 3UE6A 2OOLA 4I5SA 3CWFA 5HWTA 1ODVA 4R3AA 5KIZA 4LRYC 3G6OA 4I3JA 3UB7A 1D06A 3RH8B 4MN6A 2VEAA 5TBMB 4XT2B 3F1NB 4WF0A 2L0WA 1MZUA 3F1PA 4EETB 2OWHA 1UGUA 5IS1A 2PR5A 1DP9A 1TS7A 3LIBA 1VB6A 4JGOA 3ULFA 5HDCA 3T50A 5HDSA 1OT9A 4BBTA 4NXFA 4KUKA 3A0SA 4LLOB 4MN5A 3NOTC 5G4YA 3F1OB 3MJQA 1OTEA 2W27A 5DKKA 4HP9A 3LYXA 5HD3A 2L4RA 3HJKA 1N9OA 4E04A 2CMNA 1T19A 3UMEA 3LI8A 3NJAA 2YKFA 4KQDA 1XJ6A 5TBMA 4XT2A 3F1NA 3CLOA 3LIAA 3ICYA 5AVEA 3A0RA 3A0VA 2Z6CA 4LRZE 3MQOA 4R70A 5J4EA 4GW9A 2QJ7A 2Z6DA 5DKLA 4HNBA 1S4SA 1XJ2A 3EEHA 4HJ4A 3LIFA 5G4ZA 3MFXA 1LL8A 1P97A 2KX6A 3VOLA 4NXBA 3UB9A 1GSXA 5IU1A
chains in the Genus database with same CATH superfamily
1WYCA 4S2NC 2H28A 2VV7A 5F68A 1L0FA 1G68A 1OTDA 4WN5A 4EBNA 2BLSA 2PYRA 3BQ8A 3G30A 5FQJA 4GB7A 1JWPA 3S1YA 1TEMA 5L8MA 5A90A 1MKMA 3IH8A 4JXWA 1ZG4A 4HHDA 1BLHA 3LFVA 4MEZA 2X01A 4G3KA 3UPOA 4Y2FA 4DJ3A 4PHTA 3ZVWA 4P6BA 3SH7A 4L9FA 1ZG6A 2J3TD 4OPRA 1PIOA 4LV3A 1G28A 3KSHA 3IF6C 3OCNA 3U4LP 3FKVA 1NYMA 2PAVP 3PBOA 1D7EA 2V8CA 4S2LA 3PHYA 3JVUA 2OAQ1 4NXGA 3E4PA 4EBLA 3ZG0A 3UE1A 3MKFA 1LSWA 3M2JA 4FOFA 1BLSA 3UB8A 1TS0A 2B5RA 2ZBBA 1M40A 4LV1A 3O5YA 4E3MA 2QWSA 3H9WA 1DY6A 3OC2A 5HL1A 3LEZA 3BY8A 4OOYA 1S6RA 2V8FA 1SKOB 3NY4A 4K91A 5M1AA 3PR6A 3T4OA 3QP4A 4ZJ3A 3QNCA 1L0DA 3TE8A 4KUOA 3UMDA 1F2KA 1YLYA 1MBLA 4P85A 2PYPA 3HUNA 4UQIS 3RTYA 4F3LB 4P0MA 3HJIA 3MZDA 2ZQ9A 2J3TC 1YMXA 1XFNA 2C6WB 3JPUA 5HAPA 4YFMA 3GSGA 1Y28A 2WKPA 2VJWA 3ITBA 4O01A 4EQIA 2A24A 4EWFA 3V39A 3DTIA 1YSQA 3DTKA 2ZL1B 2V0UA 3LR4A 4Y13A 4KZ4A 4GZBA 4Q0JA 2R9XA 5DF9A 4HEFA 1PWGA 1FIKA 3T1RA 2HZ5A 5HPIA 1W5DA 5FI6A 1YKDA 3T4TA 2ZC7A 3VP1A 3E0YA 2PR6A 2QJ5A 3Q07A 4GOGA 2ZM0A 2JKRM 4Y0UA 4UAAA 3MSHA 2EX9A 1T18A 4JF6A 1HVBA 1L0EA 4RQ9A 3T1QB 4BLMA 5BOHA 4XUXA 4BBVA 3OPRA 2PHYA 4GD8A 4E3KA 1IYQA 4OPQA 3TW8A 4OP5A 4XUZA 2OV5A 3VP4A 1ZHHB 2EX6A 4MMNA 4LENA 3EWKA 4OQ0A 3UE3A 2O0YA 1Q2QA 4EUZA 1BUEA 4R1GA 4KQQA 4CLCB 3IBRA 5F83A 4EERA 4D60A 5CEDA 1Q2PA 4CQHA 3MZEA 3Q7VB 2Z2LB 2HPBA 1AXBA 2B02A 3M6HA 3F1PB 4R38A 1BTLA 1NZUA 3FC7A 2YKHA 3FG8A 4MDZA 5EVID 3S7OA 1VETB 3BY9A 2I9VA 4Q0HA 4MCWA 1MPLA 1PI5A 4Y15A 4WEKA 2WKQA 1E4DA 3W8KA 3DW0A 2J7VA 3IF5A 4O8GA 4G3VA 1N9LA 2MJ6A 5FAQA 2ZM2A 1IYPA 2NUTC 3FPVA 5FA7A 1T1CA 3V3RA 3O88A 1P0ZA 2OLVA 2Y2LA 1MKIA 2VLGA 3I7JA 3OZHA 1A0KA 4QB8A 2EX2A 1GCEA 3HCYA 3CJMA 5KIZA 2ZQAA 3HLDA 1M6KA 4LRYC 3NC8A 1KGEA 2JKFA 3F1NB 4LCMA 4WF0A 4GDNA 1ALQA 2FH5A 4KENB 3KSGA 2O9BA 1W79A 3CUEA 4K0XA 2RCXA 4ZJ2A 2OSUA 4N1XA 4OQHA 2XRNA 1TVFA 3UDIA 2JKRI 3L7HA 2WGWA 1TS7A 3CPTA 3G2ZA 5EVIC 3LY4A 5M19A 5HDCA 2OLUA 3QP6A 2Y2HA 3V50A 2WK0A 4KQOA 3A0SA 4GNUA 4BD1A 1CJFA 5CHMA 4FH2A 1HD8A 4DXCA 5G4YA 3Q7ZA 1YPRA 4JPMA 3F1OB 3C7UA 3ZG5A 4C6YA 1OTEA 4BJPA 5DKKA 4UA6A 2ZC5B 2K31A 4QWOA 1YQSA 2WAFA 4S2IA 4X1LA 4IVIA 5AQAA 1S0WA 1PWCA 4UEYA 3UMEA 4KQDA 3K2NA 3Q82A 2Y91A 5TBMA 3UPNA 3VOYA 5FASA 1TD5A 4OKPA 4FCFA 3ICYA 4WMCA 4BWIA 1IYOA 3HUOA 1CEFA 3ZG9B 1ZC2A 3FPWA 2Z6CA 3A3JA 3MQOA 5TFQA 3R7WA 3WS4A 1K6SA 2PBYA 5J4EA 4GW9A 2QJ7A 4HNBA 4N9LA 3MFXA 1K55A 1P97A 1FOFA 2LB5A 5L10A 4NXBA 1EROA 4M3KA 1J9MA 5IU1A 4ME4A 5HSQA 1KDSA 5EVEA 3KO6A 2M7VA 3IWIA 1KOUA 4R23A 3WS0A 4DDSA 3IBJA 3U2AA 4LCLA 1KE0A 3NDEA 4I3IA 1IKGA 1S1YA 4X69A 1XX2A 4OONA 3MXQA 5DFYA 3E4OA 2G2UA 4IVKA 3NECA 5TR7A 2W1RA 1DP6A 4OPYA 3W4PA 5CX7A 4KZAA 1RGYA 1K6RA 1WA9A 4DE2A 1MWUA 3H7WB 1K55C 2ZM8A 5CECA 1YLWA 2KLIA 4EEUA 3GDIA 2QZ6A 3NHQA 2ZC6B 3ZQ5A 3PAGA 4NXEA 4S2KA 1E3UD 3A3EA 3C2WA 2Q9NA 3CI6A 2B95A 1ZKJA 3MR0A 2Y2NA 3GMWA 5DF8A 2ZQCA 3C30A 1K57A 5GLBA 1ZTUA 5FATA 4F3LA 4R4SA 4X56A 4FTXA 2QMIA 1QMEA 4HBTA 1KE3A 1E3UA 1KGGA 4GS9A 3IHAA 3W4OA 1G5UA 3IWOA 1TF1A 2G2WA 2ZL1A 1GHIA 1BLCA 5CGSA 2Q0OA 4OVDA 3D9YA 2OWJA 4RX2A 3WS2A 3QP5A 1FSYA 2HP5A 4S2OA 1NLZA 3MQQA 3B42A 4JGRA 3D3OA 1H8MA 1PWDA 1VM1A 3EEAA 2EWVA 4R0QA 2H0TA 1K0KA 1ES5A 1E25A 2NUPC 1LT0A 2DNSA 3T12B 3UB6A 3EGXC 3C5AA 2XH9A 1EI5A 4EQ1A 2WKHA 1FQGA 3H82B 1XPBA 2WYXA 3ZGAB 3ITAA 4YWZA 4CJNA 1ES3A 3Q1FA 3LIDA 2V0WA 2JN7A 4CLCA 3SH8A 1LI9A 2DCFA 4HH3A 4X53A 3PBSA 1ACFA 3S7PA 3RXWA 1SZVA 2QPNA 1OTBA 3MQ0A 1LLBA 5HPFA 4JGQA 5DTSA 4WM9A 2XFSA 4IBXA 2EFUA 5FI2A 4ARZB 4XXRA 2EFXA 5F69A 5I94A 2ZLYA 2XQZA 5CGXA 1VETA 1Z6FA 2R78A 2Y4AA 2M7UA 2UV0E 2OAP1 3KX0X 3SS4A 4S2PA 1SKFA 4M4XA 3ZDJA 2JKTM 5HFOA 2PBDP 3LUQA 2EX8A 3KSIA 5HWWA 4WL9A 3B47A 2G7UA 1NXYA 3PYPA 5DVAA 4EW7A 3WWXA 3TOIA 2WAEA 3OLOA 1LSVA 4H6JB 2W3GA 4R6LA 3PBRA 2ZQ8A 1TDGA 1XA1A 2WZZA 1PW1A 1FR6A 4UA9A 2X02A 2L1MA 3D72A 5J7EA 3LIEA 3FV7A 5FEFA 1JNUA 5F1GA 4MLLA 1GHPA 2M1CA 2GDNA 3JYIA 4B88A 4DRTA 4ZBEA 5F1FA 3EQVA 1FR1A 4IUKA 3VSLA 2W3DA 3CHWP 3GQZA 4YOFA 3VE3A 2VK3A 4A5RA 2Y2JA 2EXAA 4ZTKA 1YLPA 2A49A 3GR2A 5EECA 3TJZC 4JKTA 4JXVA 5HARA 4JBFA 2VV8A 2VGJA 4WUJA 2HGVA 4DKIA 3GVBA 1YT4A 3P09A 3VOZA 4GKUA 1YLZA 3HLWA 1ERMA 5FAPA 5GLAA 5LBRA 4KZ6A 3UB7A 3BRMA 5FL3A 1KVLA 1D06A 2VEAA 4XT2B 4RVAA 1MC0A 3KYZA 3W4QA 3RFBA 4AFIA 4X6TA 1MZUA 4N1HA 2OWHA 4Y17A 5AQ7A 3E98A 1PZOA 1UGUA 5FI7A 5IS1A 2PR5A 1DP9A 2PU2A 1IKIA 3T4SA 3ZYTA 3LIBA 3IF6B 1PNEA 3PTEA 2Y2MA 3G2YA 2ZQDA 3SZTA 1P9RA 3VV4A 2HDUA 1HLUP 4JXSA 4KUKA 2BG1A 4MNRA 4PM9A 3CZDA 4PAUA 4LLOB 1MWTA 2VA0A 3NOTC 4EU0A 3UDFA 3NULA 3MJQA 2KOIA 2W27A 3HLEA 1PI4A 4HP9A 3LYXA 2V20A 4B4ZA 2L4RA 1PRQA 3UO9A 5GHYA 4JLFA 1N9OA 1J3WA 1YSPA 3N8SA 3VP2A 3PBNA 3CLOA 2VGLM 3OOVA 3SS3A 1MWSA 4S2MA 2I72A 3MXSA 2J9PA 1SDNA 4LRZE 4Y7PA 2ZQ7A 3VP3A 2FFFB 4EBPA 3T4KA 4S2JA 2IWCA 1XJ2A 3HLCA 1NLYA 1RP5A 1IOUA 3LIFA 5G4ZA 5AQ9A 4DE1A 2C5WB 4Z1WA 1BLPA 2JC7A 3VOLA 1KGFA 4OP8A 1RGZA 2V1ZA 3H7WA 3VSKA 1Y54A 3NOUC 4PPRA 4K0WA 3QP2A 1YM1A 1WE4A 3E2KA 4Q0IA 1XJ4A 2XSSA 3KYQA 1SDEA 2W3EA 1N4OA 4H8RA 3PAEA 1FCNA 3MF0A 3BFCA 1ES2A 3MKEA 3P7NA 2XK1A 3UE0A 3FWLA 5HAQA 3IXHA 3UDXA 1F98A 2PDRA 1N9NA 2VV6A 2K7SA 2CC1A 4GDBA 4QU3A 3UB5P 2P9VA 5F6AA 4P6ZM 4IHQA 2BASA 3NOPC 4GJ4A 3OPLA 4WLAA 3DWZA 1V9YA 4RYEA 1F5MA 2PD8A 2XD5A 4I39A 3VMAA 4B4XA 4OQIA 1Z09A 2ZMVA 4KQRA 5M18A 3T4JA 2XROA 4JF5A 3N4IA 4F94A 4LPZA 4NK3A 4B93A 4GCZA 4PM6A 4X55A 1S67L 5E2FA 3NDGA 2W1TB 3HUMA 5GHZA 5J3WA 2A24B 3C8CA 4G3WA 2J8YA 1JTDA 3SH9A 5DJUA 1NZOA 1L3LA 3BM6A 3OPHA 4HI4A 1OJ5A 1OMEA 3QP1A 5D3OA 1JTGA 3E4QA 4WMCD 3BLSA 4K08A 3CUEC 2PD7A 2RL3A 2Y2IA 3PBQA 4L9EA 2JBFA 4KZ9A 1PZPA 4DXBA 3VE4A 1S1ZA 2V9AA 4QD4A 2XEPA 1TS8A 2HJ9C 1W7FA 3PBTA 3IS2B 5EM0A 5CHUA 2AVXA 3LI9A 4OOMA 4WZ5A 3ZCZA 3V5MA 4YINA 3C4PA 4C75A 1ES4A 1DJAA 4HJ6A 3M6BA 2QYBA 4NKPA 1OTAA 4GHIB 2HV1A 1MWRA 5HZHA 1YAXA 3IXBA 4P87A 1K25A 4HIAA 2BTFP 1C3BA 1GA9A 5A92A 4EXOA 5HX9A 4OLGA 4JXGA 5HDDA 1OT6A 4HOIA 1G6AA 4D2OA 2VKSA 4GLQA 5CXWA 4H6JA 1V9ZA 1XFQA 5JYPA 1PFLA 2Y2OA 5EVIB 3FKWA 4FUWA 1LSXA 3O87A 1SKOA 1XP4A 4WZ5C 1K4EA 4OPZA 1LL9A 3LICA 1K56D 3LCEA 3PXPA 3K3CA 2JHEA 1NWZA 2WUQA 1T1AA 2H0YA 1K54A 5DTTA 3GTCA 3QP8A 4OOLA 5DTKA 3S7QA 3BWLA 3O3VA 1ONHA 5DJTA 4PM5A 4ETZA 4IUHA 5MC7A 5U47A 1HZOA 1K56A 5FDSA 1XGIA 3EOIA 5EOOA 3IX3A 1LL5A 4E3OA 2ZMFA 3D4FA 3ZNYA 3Q81A 4MN7A 3N7WA 4S2NA 3RXXA 2H10A 4KG6A 2Y2PA 5FEGA 4GN2A 4B9OA 2PRFA 5EFWA 5CEBA 1DP8A 3BW6A 2XGNA 2WGWB 2VGLS 5FQQA 5EE8A 4I38A 3IX4A 3CPTB 3CAXA 2D02A 1T1BA 2VGKA 3OPPA 4KG5A 3NBLA 2ZOHA 5HD5A 2IWBA 5FQIA 1XJ3A 4HH2A 3S7NA 3V67A 5DFXA 5TGFA 4CLCD 1K57C 5HAIA 3TRCA 1FILA 3N8RA 2OOLA 3LR0A 4MBFA 4I5SA 3W2ZA 2X71A 5FQ9A 1ODVA 2HP9A 3HLBA 4CLCE 3CITA 4YNRA 4MN6A 5TBMB 4QHCA 2XA7M 3S22A 3G31A 3MZFA 4ZJ1A 3Q7VA 3UN7A 2L0WA 3LR5A 5E2EA 1IEMA 3F1PA 4EETB 4BL2A 3R7WB 2P04A 1JWZA 1NY0A 4P6ZS 4Y5FA 1ONGA 1STZA 5K5BA 4PM7A 5EPHA 3HREA 5FQMA 1VB6A 4JGOA 2HP6A 1O07A 2J9OA 5IT5A 3T1SA 5HDSA 1H8ZA 4QPRA 4NXFA 1IFQA 5CGWA 4WEJA 5A93A 3BEBA 1G6OA 2H5SA 3SOIA 1CEGA 4X1MA 3B3XA 1BT5A 3LGOA 1U60A 4E3LA 3HLFA 2XF3A 5HD3A 3WS1A 2WGIA 4CLCC 3NIAA 2Z2MB 1YLTA 4E04A 2HJEA 5GL9A 3LI8A 3NJAA 1EWZA 5F82A 3WRTA 1XJ6A 4Y0OA 3F1NA 4X25A 3LIAA 1GHMA 1CF0A 2IWDA 5HW3A 3P01A 4Q8IA 4QJGA 2A3UA 4U0XA 5AVEA 1QMFA 3ZG8B 3OBFA 3ZG7B 5GHXA 2XR0A 2J3WA 4DN0A 4NEED 4BQMA 1AWIA 4R70A 3GRJA 1S4SA 4RX3A 3EEHA 1KE4A 3RJUA 3V3SA 5CHJA 1LL8A 2Y79A 4OH0A 4WBGA 2KX6A 1YMSA 3A3IA 2ACGA 3AGDA 3N8LA 5AJGA 3UB9A 3IXDA 2E8IA 2XDMA 4FD8A 2HF6A 4KZ3A 2XD1A 1K4FA 2KDKA 3CG5A 4GS9B 4HP4A 4LRXC 2W1TA 3E2LA 3NI9A 3F1OA 3DAVA 3TG9A 3ZFZA 1YLJA 3AGEA 4BENA 3ZHHA 1TDLA 3HVFA 3MBZA 3JVVA 4LV0A 2R9WA 5I5LA 5CERA 1LHYA 1UWNX 2HDRA 3N6IA 1O7EA 2DRWA 2A2LA 5E2HA 1EW0A 2P7JA 5AVFA 2B18A 1VEUB 4E3NA 3C4OA 1BSGA 1KVMA 1WYBA 1TS6A 3GECA 4L9GA 3SW1A 2INWA 3IQAA 4ID4A 4HY8A 2HDSA 3S4XA 1H5XA 2GZAA 3A3DA 4NETA 2JKTI 3IH9A 2VX8A 3AGFA 1OJGA 3IS2A 3T1XA 3BECA 4KZBA 2WKIA 2GJ3A 4BL3A 3B33A 3SS5A 1X0OA 1XKZA 2VZWA 3UY6A 4Y0TA 4I3AA 5TJJA 3EQUA 1BULA 5IHVA 4RA7A 4PKYA 1DRMA 4LGWA 5EV0A 3G4PA 4R3BA 2Y2KA 3ISGA 1OTIA 4Z9QA 5GLDA 4U3TA 2WZXA 1SCWA 3C38A 4GHIA 4E3IA 2D01A 4R4RA 5G18A 2EWWA 3T4LA 4E3JA 2JKGA 3BQAA 4E6XA 4HQAA 2UWXA 2ZC3B 4QY5A 2GNXA 5CTNA 3LY3A 4EV4A 2O99A 1I2WA 4BMWA 2JE5A 2W0NA 2V2FF 5JYOA 1NYYA 3WS5A 4L0LA 3HBRA 1GSVA 1S66L 5EVIA 4JGPA 3G35A 4N92A 5HWVA 4BBUA 5F5YA 4KZ7A 1VQQA 4O0PA 4PM8A 1F9IA 4IEDA 5FQKA 3VP0A 1NRJA 1HTZA 1JWVA 4U0TA 2PT7A 2V1BA 2J80A 5HL6A 2Y2GA 2W3FA 4O7DA 2XA7S 3MXRA 1BZAA 2FZ0A 1ESIA 4CPKA 5A8BA 2P74A 2WKRA 3DBAA 3A3FA 2EA9A 2O9AA 3QNBA 3IT9A 1XGJA 1ESUA 3O86A 1Y4OA 4WYYA 4NG2A 3VFHA 2QHKA 5J8XA 4EUVA 4Y3IA 4LV2A 2Y55A 5AQBA 2WADA 1SHVA 1VHMA 1I2SA 5L09A 3EGDC 1UWPX 3BFDA 1L0GA 5FDHA 4WELA 1JVJA 3OCLA 5EUAA 4LFUA 1MY8A 1K38A 2XLNA 3QHYA 4QY6A 1KDWA 3GV9A 1FSWA 1GSWA 3MS6A 3ZVTA 4UA7A 4ZDXA 2V1AA 2Q9MA 2QKPA 1W8YA 5L2FA 3H82A 1OPXA 2DMWA 1W8QA 2Y2QA 4DE3A 1RCJA 1N9BA 4KZ8A 1BYWA 1ERQA 5L07A 2O9CA 4DJ2A 5DF7A 4HJ3A 4EESA 3HLGA 1PYYA 5KZHA 2FFYA 1LI0A 3K3DA 1S4RA 4DE0A 4ARZA 3UPPA 4JF4A 3WRZA 4UQIM 4EEPA 2K2NA 4UHUA 1CQAA 3VFFA 4DMZA 5FSRA 1PW8A 2ZOIA 3BFFA 3KYEA 3FZCA 4PKYG 4IBRA 4ETXA 4OQGA 3UE6A 4II7A 5FAOA 1D1JA 3CWFA 1CI9A 5HWTA 4X68A 1FCMA 5CTMA 1H8YA 4R3AA 3G6OA 4I3JA 3IX8A 2E8JA 3RH8B 2Y8HA 1L2SA 3UNWA 4KZ5A 5E43A 2IA2A 4N9KA 5CRFA 1DJBA 3G34A 2ZC4B 5E2GA 2Y59A 2ZJ9A 3IWQA 3BYDA 3LR3A 3T4QA 3TSGA 1NJ4A 3CMZA 1IELA 4DF6A 3IHBA 2ZMAA 5KSCA 4ZRRA 4E6WA 3C7VA 3P98A 3DTEA 1I5QA 4C3QA 3ULFA 3T50A 3HL9A 1OT9A 5EM1A 4BBTA 3FYZA 4FH4A 1W63M 4DDYA 4PMAA 3DWKA 3MFDA 3R4KA 3BFGA 5GLCA 2JCHA 4HESA 4GD6A 4KG2A 1P9WA 4MN5A 4MBHA 5EOEA 1GA0A 4ESPA 4IJGA 1FCOA 3BFEA 3HJKA 1DJCA 3KSFA 2WGVA 2GX5A 2WKEA 4R3JA 3ZNTA 1W63Q 1CI8A 3LEQA 5C5KA 2CMNA 1H0MA 1T19A 2P08A 1XA7A 2YKFA 2P9VB 5KMWA 3NCKA 4XT2A 2HDQA 3BJNA 4BD0A 2W3HA 2XFTA 3IXGA 1XXMA 4FSFA 4MBKA 1NRFA 1MXOA 3A0RA 3LO7A 3A0VA 2LB9A 2ZD8A 3MMHA 4WZ4A 3BLMA 1H3QA 1K54C 5KSHA 4HBUA 2EXBA 2Z6DA 5DKLA 2PU4A 5EVLA 1VEUA 3G32A 3IF6A 4HJ4A 4OLDA 4ZAMA 3M2KA 5A91A 1CK3A 1GSXA 3DTMA 3L9KA 1IYSA
chains in the Genus database with same CATH topology
3H7WA 2HF6A 5HSQA 3KO6A 3NOUC 2KDKA 2M7VA 1KOUA 4GS9B 2H28A 4HP4A 2VV7A 4LRXC 4Q0IA 1XJ4A 2XSSA 5F68A 2W1TA 3KYQA 3F1OA 3IBJA 3U2AA 1OTDA 2W3EA 4WN5A 3MF0A 2PYRA 3BQ8A 3P7NA 4I3IA 1F98A 1S1YA 2PDRA 3JVVA 1N9NA 5I5LA 1UWNX 5L8MA 2VV6A 1MKMA 2K7SA 4HHDA 2A2LA 3LFVA 3MXQA 1EW0A 4G3KA 5F6AA 2P7JA 4P6ZM 5AVFA 2B18A 4IHQA 2BASA 5DFYA 4Y2FA 3NOPC 4GJ4A 4WLAA 4DJ3A 4PHTA 3E4OA 1TS6A 1V9YA 3GECA 1F5MA 2PD8A 2INWA 4L9GA 3SW1A 2W1RA 4L9FA 4I39A 1DP6A 4HY8A 2J3TD 2GZAA 5CX7A 1G28A 3KSHA 1WA9A 2ZMVA 3OCNA 3T4JA 2XROA 3H7WB 3PBOA 2JKTI 4LPZA 4B93A 2VX8A 4GCZA 1OJGA 1D7EA 2KLIA 4EEUA 3GDIA 3IS2A 1S67L 3NHQA 2W1TB 2GJ3A 5J3WA 2A24B 3C8CA 3ZQ5A 4G3WA 4NXEA 3B33A 5DJUA 3PHYA 3C2WA 1X0OA 2VZWA 3JVUA 3CI6A 2OAQ1 4I3AA 3MR0A 5TJJA 3EQUA 4HI4A 1OJ5A 4NXGA 3E4PA 3C30A 4PKYA 1DRMA 1ZTUA 4F3LA 1LSWA 4FOFA 3E4QA 4K08A 3CUEC 1OTIA 4GS9A 3UB8A 2PD7A 1TS0A 2ZBBA 3PBQA 4L9EA 3O5YA 3C38A 4GHIA 2QWSA 3H9WA 1TF1A 3VE4A 3OC2A 1S1ZA 2D01A 3BY8A 2EWWA 3T4LA 2V9AA 1TS8A 2HJ9C 3BQAA 4HQAA 2OWJA 3IS2B 3PBTA 3PR6A 2GNXA 3T4OA 3LI9A 1NLZA 4OOMA 2O99A 3MQQA 3B42A 4BMWA 3TE8A 2W0NA 4JGRA 4KUOA 3UMDA 3D3OA 1H8MA 4L0LA 2PYPA 1GSVA 4UQIS 1S66L 3EEAA 3RTYA 4F3LB 4JGPA 2EWVA 3HJIA 2NUPC 2J3TC 5HWVA 4BBUA 1LT0A 5F5YA 4HJ6A 4O0PA 3UB6A 1XFNA 1F9IA 3EGXC 2QYBA 4NKPA 1OTAA 1Y28A 2WKPA 2VJWA 4O01A 1NRJA 2A24A 4EQ1A 4GHIB 2HV1A 2PT7A 1YSQA 2V1BA 2J80A 5HL6A 5HZHA 2V0UA 3LR4A 1YAXA 3H82B 2W3FA 4YWZA 4HIAA 2XA7S 3LIDA 2V0WA 4Q0JA 2JN7A 4CLCA 4EXOA 5DF9A 2FZ0A 5A8BA 4HH3A 5HDDA 1OT6A 4HOIA 3PBSA 3S7PA 2VKSA 4GLQA 5HPIA 4H6JA 2WKRA 3DBAA 1YKDA 2EA9A 1OTBA 3T4TA 2O9AA 3MQ0A 1V9ZA 5HPFA 4JGQA 3E0YA 1XFQA 2PR6A 2QJ5A 2JKRM 1LSXA 1T18A 4ARZB 2QHKA 4EUVA 4RQ9A 4Y3IA 5F69A 4BBVA 3LICA 2PHYA 3PXPA 3K3CA 2JHEA 1NWZA 2R78A 3TW8A 1VHMA 1T1AA 2M7UA 2OAP1 4OOLA 3KX0X 1ZHHB 3EGDC 1UWPX 3S7QA 4M4XA 4MMNA 3BWLA 2JKTM 3EWKA 5DJTA 3LUQA 4WELA 4ETZA 3UE3A 2O0YA 4IUHA 3KSIA 5MC7A 3OCLA 5HWWA 4CLCB 3IBRA 4WL9A 3B47A 3EOIA 4EERA 2G7UA 3PYPA 4EW7A 2ZMFA 4CQHA 3OLOA 1LSVA 1GSWA 4H6JB 2W3GA 2B02A 4MN7A 3PBRA 4R6LA 2V1AA 3F1PB 2QKPA 4R38A 2L1MA 3FC7A 4B9OA 3H82A 2YKHA 3D72A 3FG8A 1OPXA 5EFWA 2DMWA 1DP8A 4MDZA 3LIEA 3BW6A 5J7EA 2VGLS 1JNUA 4I38A 3S7OA 1BYWA 2M1CA 2O9CA 3CAXA 3BY9A 2I9VA 2D02A 4DJ2A 3EQVA 4HJ3A 1T1BA 4Q0HA 4IUKA 2W3DA 4MCWA 2ZOHA 4YOFA 4EESA 3VE3A 5HD5A 4WEKA 2WKQA 3K3DA 1S4RA 4ARZA 3TJZC 1XJ3A 4HH2A 4O8GA 3S7NA 4G3VA 4UQIM 4EEPA 2K2NA 1N9LA 2MJ6A 3V67A 4DMZA 2NUTC 3FPVA 5DFXA 2ZOIA 2VV8A 4CLCD 1T1CA 4WUJA 2HGVA 1P0ZA 3TRCA 2VLGA 4PKYG 4ETXA 3UE6A 2OOLA 3LR0A 4II7A 3HCYA 4I5SA 3CWFA 3W2ZA 5HWTA 1ODVA 4R3AA 5KIZA 5LBRA 4LRYC 3G6OA 4I3JA 3UB7A 4CLCE 5FL3A 3CITA 4YNRA 1D06A 3RH8B 4MN6A 2Y8HA 2VEAA 5TBMB 4XT2B 3F1NB 2XA7M 1MC0A 4WF0A 2FH5A 3KYZA 3KSGA 2O9BA 2IA2A 3CUEA 3RFBA 2L0WA 3LR5A 4AFIA 1MZUA 3F1PA 4EETB 2OWHA 3E98A 3R7WB 2P04A 1UGUA 2XRNA 4P6ZS 4Y5FA 5IS1A 1STZA 2PR5A 3LR3A 3T4QA 1DP9A 2JKRI 5K5BA 3T4SA 3ZYTA 1TS7A 3LIBA 1VB6A 4JGOA 4ZRRA 5IT5A 1P9RA 3ULFA 3VV4A 5HDCA 3T50A 5HDSA 1OT9A 4BBTA 4QPRA 4NXFA 1W63M 1IFQA 4KUKA 4KQOA 3A0SA 3R4KA 4PAUA 4WEJA 4LLOB 1P9WA 4MN5A 2VA0A 3NOTC 4EU0A 1G6OA 5G4YA 3F1OB 3MJQA 4IJGA 1OTEA 2KOIA 2W27A 4BJPA 5DKKA 4HP9A 3LYXA 5HD3A 2K31A 2L4RA 3HJKA 4CLCC 3KSFA 2GX5A 1N9OA 4E04A 1W63Q 2HJEA 5C5KA 2CMNA 1YSPA 4UEYA 1T19A 3UMEA 3LI8A 2P08A 3NJAA 2YKFA 4KQDA 3PBNA 1XJ6A 3K2NA 5TBMA 4XT2A 3F1NA 3CLOA 3BJNA 2VGLM 1TD5A 3LIAA 2W3HA 3OOVA 3P01A 3ICYA 4FSFA 5AVEA 4BWIA 3A0RA 3OBFA 3A0VA 3FPWA 2J3WA 2Z6CA 2LB9A 4LRZE 3MMHA 3MQOA 4DN0A 3R7WA 1H3QA 4NEED 4R70A 5J4EA 5KSHA 4GW9A 2QJ7A 2Z6DA 5DKLA 4HNBA 1S4SA 3T4KA 1XJ2A 1NLYA 3EEHA 4HJ4A 1IOUA 3LIFA 5G4ZA 3MFXA 1LL8A 1P97A 2Y79A 2KX6A 2LB5A 4Z1WA 3VOLA 4NXBA 5AJGA 3UB9A 1GSXA 5IU1A 4ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  5HSQ A;  3NOU C;  2KDK A;  1KOU A;  4GS9 B;  2H28 A;  4HP4 A;  2VV7 A;  4LRX C;  1XJ4 A;  5F68 A;  3F1O A;  1OTD A;  4WN5 A;  2PYR A;  3P7N A;  4I3I A;  1F98 A;  1S1Y A;  2PDR A;  1N9N A;  5I5L A;  1UWN X;  2VV6 A;  2K7S A;  4HHD A;  3MXQ A;  1EW0 A;  5F6A A;  2P7J A;  5AVF A;  2BAS A;  3NOP C;  4WLA A;  4DJ3 A;  3E4O A;  1TS6 A;  1V9Y A;  3GEC A;  2PD8 A;  4L9G A;  2INW A;  3SW1 A;  4L9F A;  4I39 A;  1DP6 A;  4HY8 A;  1G28 A;  1WA9 A;  3H7W B;  4LPZ A;  4GCZ A;  1OJG A;  1D7E A;  4EEU A;  3GDI A;  3IS2 A;  1S67 L;  3NHQ A;  2GJ3 A;  5J3W A;  2A24 B;  3C8C A;  3ZQ5 A;  4NXE A;  3B33 A;  5DJU A;  3PHY A;  3C2W A;  1X0O A;  4I3A A;  3MR0 A;  4HI4 A;  1OJ5 A;  4NXG A;  3E4P A;  4PKY A;  1DRM A;  4F3L A;  1LSW A;  3E4Q A;  4K08 A;  1OTI A;  4GS9 A;  3UB8 A;  2PD7 A;  1TS0 A;  2ZBB A;  4L9E A;  4GHI A;  2QWS A;  3H9W A;  3VE4 A;  1S1Z A;  2D01 A;  3BY8 A;  2V9A A;  1TS8 A;  4HQA A;  2OWJ A;  3IS2 B;  3LI9 A;  3MQQ A;  2W0N A;  4JGR A;  4KUO A;  3UMD A;  2PYP A;  1GSV A;  1S66 L;  3RTY A;  4F3L B;  4JGP A;  3HJI A;  5HWV A;  4BBU A;  1LT0 A;  5F5Y A;  4HJ6 A;  3UB6 A;  1XFN A;  1F9I A;  1OTA A;  1Y28 A;  2WKP A;  2A24 A;  4EQ1 A;  4GHI B;  2HV1 A;  2V1B A;  2J80 A;  5HZH A;  2V0U A;  3H82 B;  4YWZ A;  4HIA A;  3LID A;  2V0W A;  2JN7 A;  4EXO A;  5A8B A;  4HH3 A;  5HDD A;  1OT6 A;  4HOI A;  4H6J A;  2WKR A;  2EA9 A;  1OTB A;  1V9Z A;  4JGQ A;  1XFQ A;  2PR6 A;  2QJ5 A;  1LSX A;  1T18 A;  2QHK A;  4RQ9 A;  5F69 A;  4BBV A;  3LIC A;  2PHY A;  3K3C A;  2JHE A;  1NWZ A;  2R78 A;  1T1A A;  3KX0 X;  1UWP X;  4M4X A;  3BWL A;  3EWK A;  5DJT A;  3LUQ A;  5HWW A;  3IBR A;  4WL9 A;  4EER A;  3PYP A;  4EW7 A;  3OLO A;  1LSV A;  1GSW A;  4H6J B;  2B02 A;  4R6L A;  2V1A A;  3F1P B;  2QKP A;  4R38 A;  2L1M A;  3FC7 A;  4B9O A;  3H82 A;  2YKH A;  3D72 A;  3FG8 A;  5EFW A;  5J7E A;  1DP8 A;  3LIE A;  1JNU A;  4I38 A;  1BYW A;  2M1C A;  3CAX A;  3BY9 A;  2I9V A;  2D02 A;  4DJ2 A;  4HJ3 A;  1T1B A;  2ZOH A;  4EES A;  3VE3 A;  5HD5 A;  2WKQ A;  3K3D A;  1S4R A;  1XJ3 A;  4HH2 A;  4EEP A;  1N9L A;  2ZOI A;  2VV8 A;  1T1C A;  4WUJ A;  1P0Z A;  2VLG A;  4PKY G;  3UE6 A;  2OOL A;  4I5S A;  3CWF A;  5HWT A;  1ODV A;  4R3A A;  5KIZ A;  4LRY C;  3G6O A;  4I3J A;  3UB7 A;  1D06 A;  3RH8 B;  4MN6 A;  2VEA A;  5TBM B;  4XT2 B;  3F1N B;  4WF0 A;  2L0W A;  1MZU A;  3F1P A;  4EET B;  2OWH A;  1UGU A;  5IS1 A;  2PR5 A;  1DP9 A;  1TS7 A;  3LIB A;  1VB6 A;  4JGO A;  3ULF A;  5HDC A;  3T50 A;  5HDS A;  1OT9 A;  4BBT A;  4NXF A;  4KUK A;  3A0S A;  4LLO B;  4MN5 A;  3NOT C;  5G4Y A;  3F1O B;  3MJQ A;  1OTE A;  2W27 A;  5DKK A;  4HP9 A;  3LYX A;  5HD3 A;  2L4R A;  3HJK A;  1N9O A;  4E04 A;  2CMN A;  1T19 A;  3UME A;  3LI8 A;  3NJA A;  2YKF A;  4KQD A;  1XJ6 A;  5TBM A;  4XT2 A;  3F1N A;  3CLO A;  3LIA A;  3ICY A;  5AVE A;  3A0R A;  3A0V A;  2Z6C A;  4LRZ E;  3MQO A;  4R70 A;  5J4E A;  4GW9 A;  2QJ7 A;  2Z6D A;  5DKL A;  4HNB A;  1S4S A;  1XJ2 A;  3EEH A;  4HJ4 A;  3LIF A;  5G4Z A;  3MFX A;  1LL8 A;  1P97 A;  2KX6 A;  3VOL A;  4NXB A;  3UB9 A;  1GSX A;  5IU1 A; 
#chains in the Genus database with same CATH topology
 1WYC A;  4S2N C;  2H28 A;  2VV7 A;  5F68 A;  1L0F A;  1G68 A;  1OTD A;  4WN5 A;  4EBN A;  2BLS A;  2PYR A;  3BQ8 A;  3G30 A;  5FQJ A;  4GB7 A;  1JWP A;  3S1Y A;  1TEM A;  5L8M A;  5A90 A;  1MKM A;  3IH8 A;  4JXW A;  1ZG4 A;  4HHD A;  1BLH A;  3LFV A;  4MEZ A;  2X01 A;  4G3K A;  3UPO A;  4Y2F A;  4DJ3 A;  4PHT A;  3ZVW A;  4P6B A;  3SH7 A;  4L9F A;  1ZG6 A;  2J3T D;  4OPR A;  1PIO A;  4LV3 A;  1G28 A;  3KSH A;  3IF6 C;  3OCN A;  3U4L P;  3FKV A;  1NYM A;  2PAV P;  3PBO A;  1D7E A;  2V8C A;  4S2L A;  3PHY A;  3JVU A;  2OAQ 1;  4NXG A;  3E4P A;  4EBL A;  3ZG0 A;  3UE1 A;  3MKF A;  1LSW A;  3M2J A;  4FOF A;  1BLS A;  3UB8 A;  1TS0 A;  2B5R A;  2ZBB A;  1M40 A;  4LV1 A;  3O5Y A;  4E3M A;  2QWS A;  3H9W A;  1DY6 A;  3OC2 A;  5HL1 A;  3LEZ A;  3BY8 A;  4OOY A;  1S6R A;  2V8F A;  1SKO B;  3NY4 A;  4K91 A;  5M1A A;  3PR6 A;  3T4O A;  3QP4 A;  4ZJ3 A;  3QNC A;  1L0D A;  3TE8 A;  4KUO A;  3UMD A;  1F2K A;  1YLY A;  1MBL A;  4P85 A;  2PYP A;  3HUN A;  4UQI S;  3RTY A;  4F3L B;  4P0M A;  3HJI A;  3MZD A;  2ZQ9 A;  2J3T C;  1YMX A;  1XFN A;  2C6W B;  3JPU A;  5HAP A;  4YFM A;  3GSG A;  1Y28 A;  2WKP A;  2VJW A;  3ITB A;  4O01 A;  4EQI A;  2A24 A;  4EWF A;  3V39 A;  3DTI A;  1YSQ A;  3DTK A;  2ZL1 B;  2V0U A;  3LR4 A;  4Y13 A;  4KZ4 A;  4GZB A;  4Q0J A;  2R9X A;  5DF9 A;  4HEF A;  1PWG A;  1FIK A;  3T1R A;  2HZ5 A;  5HPI A;  1W5D A;  5FI6 A;  1YKD A;  3T4T A;  2ZC7 A;  3VP1 A;  3E0Y A;  2PR6 A;  2QJ5 A;  3Q07 A;  4GOG A;  2ZM0 A;  2JKR M;  4Y0U A;  4UAA A;  3MSH A;  2EX9 A;  1T18 A;  4JF6 A;  1HVB A;  1L0E A;  4RQ9 A;  3T1Q B;  4BLM A;  5BOH A;  4XUX A;  4BBV A;  3OPR A;  2PHY A;  4GD8 A;  4E3K A;  1IYQ A;  4OPQ A;  3TW8 A;  4OP5 A;  4XUZ A;  2OV5 A;  3VP4 A;  1ZHH B;  2EX6 A;  4MMN A;  4LEN A;  3EWK A;  4OQ0 A;  3UE3 A;  2O0Y A;  1Q2Q A;  4EUZ A;  1BUE A;  4R1G A;  4KQQ A;  4CLC B;  3IBR A;  5F83 A;  4EER A;  4D60 A;  5CED A;  1Q2P A;  4CQH A;  3MZE A;  3Q7V B;  2Z2L B;  2HPB A;  1AXB A;  2B02 A;  3M6H A;  3F1P B;  4R38 A;  1BTL A;  1NZU A;  3FC7 A;  2YKH A;  3FG8 A;  4MDZ A;  5EVI D;  3S7O A;  1VET B;  3BY9 A;  2I9V A;  4Q0H A;  4MCW A;  1MPL A;  1PI5 A;  4Y15 A;  4WEK A;  2WKQ A;  1E4D A;  3W8K A;  3DW0 A;  2J7V A;  3IF5 A;  4O8G A;  4G3V A;  1N9L A;  2MJ6 A;  5FAQ A;  2ZM2 A;  1IYP A;  2NUT C;  3FPV A;  5FA7 A;  1T1C A;  3V3R A;  3O88 A;  1P0Z A;  2OLV A;  2Y2L A;  1MKI A;  2VLG A;  3I7J A;  3OZH A;  1A0K A;  4QB8 A;  2EX2 A;  1GCE A;  3HCY A;  3CJM A;  5KIZ A;  2ZQA A;  3HLD A;  1M6K A;  4LRY C;  3NC8 A;  1KGE A;  2JKF A;  3F1N B;  4LCM A;  4WF0 A;  4GDN A;  1ALQ A;  2FH5 A;  4KEN B;  3KSG A;  2O9B A;  1W79 A;  3CUE A;  4K0X A;  2RCX A;  4ZJ2 A;  2OSU A;  4N1X A;  4OQH A;  2XRN A;  1TVF A;  3UDI A;  2JKR I;  3L7H A;  2WGW A;  1TS7 A;  3CPT A;  3G2Z A;  5EVI C;  3LY4 A;  5M19 A;  5HDC A;  2OLU A;  3QP6 A;  2Y2H A;  3V50 A;  2WK0 A;  4KQO A;  3A0S A;  4GNU A;  4BD1 A;  1CJF A;  5CHM A;  4FH2 A;  1HD8 A;  4DXC A;  5G4Y A;  3Q7Z A;  1YPR A;  4JPM A;  3F1O B;  3C7U A;  3ZG5 A;  4C6Y A;  1OTE A;  4BJP A;  5DKK A;  4UA6 A;  2ZC5 B;  2K31 A;  4QWO A;  1YQS A;  2WAF A;  4S2I A;  4X1L A;  4IVI A;  5AQA A;  1S0W A;  1PWC A;  4UEY A;  3UME A;  4KQD A;  3K2N A;  3Q82 A;  2Y91 A;  5TBM A;  3UPN A;  3VOY A;  5FAS A;  1TD5 A;  4OKP A;  4FCF A;  3ICY A;  4WMC A;  4BWI A;  1IYO A;  3HUO A;  1CEF A;  3ZG9 B;  1ZC2 A;  3FPW A;  2Z6C A;  3A3J A;  3MQO A;  5TFQ A;  3R7W A;  3WS4 A;  1K6S A;  2PBY A;  5J4E A;  4GW9 A;  2QJ7 A;  4HNB A;  4N9L A;  3MFX A;  1K55 A;  1P97 A;  1FOF A;  2LB5 A;  5L10 A;  4NXB A;  1ERO A;  4M3K A;  1J9M A;  5IU1 A;  4ME4 A;  5HSQ A;  1KDS A;  5EVE A;  3KO6 A;  2M7V A;  3IWI A;  1KOU A;  4R23 A;  3WS0 A;  4DDS A;  3IBJ A;  3U2A A;  4LCL A;  1KE0 A;  3NDE A;  4I3I A;  1IKG A;  1S1Y A;  4X69 A;  1XX2 A;  4OON A;  3MXQ A;  5DFY A;  3E4O A;  2G2U A;  4IVK A;  3NEC A;  5TR7 A;  2W1R A;  1DP6 A;  4OPY A;  3W4P A;  5CX7 A;  4KZA A;  1RGY A;  1K6R A;  1WA9 A;  4DE2 A;  1MWU A;  3H7W B;  1K55 C;  2ZM8 A;  5CEC A;  1YLW A;  2KLI A;  4EEU A;  3GDI A;  2QZ6 A;  3NHQ A;  2ZC6 B;  3ZQ5 A;  3PAG A;  4NXE A;  4S2K A;  1E3U D;  3A3E A;  3C2W A;  2Q9N A;  3CI6 A;  2B95 A;  1ZKJ A;  3MR0 A;  2Y2N A;  3GMW A;  5DF8 A;  2ZQC A;  3C30 A;  1K57 A;  5GLB A;  1ZTU A;  5FAT A;  4F3L A;  4R4S A;  4X56 A;  4FTX A;  2QMI A;  1QME A;  4HBT A;  1KE3 A;  1E3U A;  1KGG A;  4GS9 A;  3IHA A;  3W4O A;  1G5U A;  3IWO A;  1TF1 A;  2G2W A;  2ZL1 A;  1GHI A;  1BLC A;  5CGS A;  2Q0O A;  4OVD A;  3D9Y A;  2OWJ A;  4RX2 A;  3WS2 A;  3QP5 A;  1FSY A;  2HP5 A;  4S2O A;  1NLZ A;  3MQQ A;  3B42 A;  4JGR A;  3D3O A;  1H8M A;  1PWD A;  1VM1 A;  3EEA A;  2EWV A;  4R0Q A;  2H0T A;  1K0K A;  1ES5 A;  1E25 A;  2NUP C;  1LT0 A;  2DNS A;  3T12 B;  3UB6 A;  3EGX C;  3C5A A;  2XH9 A;  1EI5 A;  4EQ1 A;  2WKH A;  1FQG A;  3H82 B;  1XPB A;  2WYX A;  3ZGA B;  3ITA A;  4YWZ A;  4CJN A;  1ES3 A;  3Q1F A;  3LID A;  2V0W A;  2JN7 A;  4CLC A;  3SH8 A;  1LI9 A;  2DCF A;  4HH3 A;  4X53 A;  3PBS A;  1ACF A;  3S7P A;  3RXW A;  1SZV A;  2QPN A;  1OTB A;  3MQ0 A;  1LLB A;  5HPF A;  4JGQ A;  5DTS A;  4WM9 A;  2XFS A;  4IBX A;  2EFU A;  5FI2 A;  4ARZ B;  4XXR A;  2EFX A;  5F69 A;  5I94 A;  2ZLY A;  2XQZ A;  5CGX A;  1VET A;  1Z6F A;  2R78 A;  2Y4A A;  2M7U A;  2UV0 E;  2OAP 1;  3KX0 X;  3SS4 A;  4S2P A;  1SKF A;  4M4X A;  3ZDJ A;  2JKT M;  5HFO A;  2PBD P;  3LUQ A;  2EX8 A;  3KSI A;  5HWW A;  4WL9 A;  3B47 A;  2G7U A;  1NXY A;  3PYP A;  5DVA A;  4EW7 A;  3WWX A;  3TOI A;  2WAE A;  3OLO A;  1LSV A;  4H6J B;  2W3G A;  4R6L A;  3PBR A;  2ZQ8 A;  1TDG A;  1XA1 A;  2WZZ A;  1PW1 A;  1FR6 A;  4UA9 A;  2X02 A;  2L1M A;  3D72 A;  5J7E A;  3LIE A;  3FV7 A;  5FEF A;  1JNU A;  5F1G A;  4MLL A;  1GHP A;  2M1C A;  2GDN A;  3JYI A;  4B88 A;  4DRT A;  4ZBE A;  5F1F A;  3EQV A;  1FR1 A;  4IUK A;  3VSL A;  2W3D A;  3CHW P;  3GQZ A;  4YOF A;  3VE3 A;  2VK3 A;  4A5R A;  2Y2J A;  2EXA A;  4ZTK A;  1YLP A;  2A49 A;  3GR2 A;  5EEC A;  3TJZ C;  4JKT A;  4JXV A;  5HAR A;  4JBF A;  2VV8 A;  2VGJ A;  4WUJ A;  2HGV A;  4DKI A;  3GVB A;  1YT4 A;  3P09 A;  3VOZ A;  4GKU A;  1YLZ A;  3HLW A;  1ERM A;  5FAP A;  5GLA A;  5LBR A;  4KZ6 A;  3UB7 A;  3BRM A;  5FL3 A;  1KVL A;  1D06 A;  2VEA A;  4XT2 B;  4RVA A;  1MC0 A;  3KYZ A;  3W4Q A;  3RFB A;  4AFI A;  4X6T A;  1MZU A;  4N1H A;  2OWH A;  4Y17 A;  5AQ7 A;  3E98 A;  1PZO A;  1UGU A;  5FI7 A;  5IS1 A;  2PR5 A;  1DP9 A;  2PU2 A;  1IKI A;  3T4S A;  3ZYT A;  3LIB A;  3IF6 B;  1PNE A;  3PTE A;  2Y2M A;  3G2Y A;  2ZQD A;  3SZT A;  1P9R A;  3VV4 A;  2HDU A;  1HLU P;  4JXS A;  4KUK A;  2BG1 A;  4MNR A;  4PM9 A;  3CZD A;  4PAU A;  4LLO B;  1MWT A;  2VA0 A;  3NOT C;  4EU0 A;  3UDF A;  3NUL A;  3MJQ A;  2KOI A;  2W27 A;  3HLE A;  1PI4 A;  4HP9 A;  3LYX A;  2V20 A;  4B4Z A;  2L4R A;  1PRQ A;  3UO9 A;  5GHY A;  4JLF A;  1N9O A;  1J3W A;  1YSP A;  3N8S A;  3VP2 A;  3PBN A;  3CLO A;  2VGL M;  3OOV A;  3SS3 A;  1MWS A;  4S2M A;  2I72 A;  3MXS A;  2J9P A;  1SDN A;  4LRZ E;  4Y7P A;  2ZQ7 A;  3VP3 A;  2FFF B;  4EBP A;  3T4K A;  4S2J A;  2IWC A;  1XJ2 A;  3HLC A;  1NLY A;  1RP5 A;  1IOU A;  3LIF A;  5G4Z A;  5AQ9 A;  4DE1 A;  2C5W B;  4Z1W A;  1BLP A;  2JC7 A;  3VOL A;  1KGF A;  4OP8 A;  1RGZ A;  2V1Z A;  3H7W A;  3VSK A;  1Y54 A;  3NOU C;  4PPR A;  4K0W A;  3QP2 A;  1YM1 A;  1WE4 A;  3E2K A;  4Q0I A;  1XJ4 A;  2XSS A;  3KYQ A;  1SDE A;  2W3E A;  1N4O A;  4H8R A;  3PAE A;  1FCN A;  3MF0 A;  3BFC A;  1ES2 A;  3MKE A;  3P7N A;  2XK1 A;  3UE0 A;  3FWL A;  5HAQ A;  3IXH A;  3UDX A;  1F98 A;  2PDR A;  1N9N A;  2VV6 A;  2K7S A;  2CC1 A;  4GDB A;  4QU3 A;  3UB5 P;  2P9V A;  5F6A A;  4P6Z M;  4IHQ A;  2BAS A;  3NOP C;  4GJ4 A;  3OPL A;  4WLA A;  3DWZ A;  1V9Y A;  4RYE A;  1F5M A;  2PD8 A;  2XD5 A;  4I39 A;  3VMA A;  4B4X A;  4OQI A;  1Z09 A;  2ZMV A;  4KQR A;  5M18 A;  3T4J A;  2XRO A;  4JF5 A;  3N4I A;  4F94 A;  4LPZ A;  4NK3 A;  4B93 A;  4GCZ A;  4PM6 A;  4X55 A;  1S67 L;  5E2F A;  3NDG A;  2W1T B;  3HUM A;  5GHZ A;  5J3W A;  2A24 B;  3C8C A;  4G3W A;  2J8Y A;  1JTD A;  3SH9 A;  5DJU A;  1NZO A;  1L3L A;  3BM6 A;  3OPH A;  4HI4 A;  1OJ5 A;  1OME A;  3QP1 A;  5D3O A;  1JTG A;  3E4Q A;  4WMC D;  3BLS A;  4K08 A;  3CUE C;  2PD7 A;  2RL3 A;  2Y2I A;  3PBQ A;  4L9E A;  2JBF A;  4KZ9 A;  1PZP A;  4DXB A;  3VE4 A;  1S1Z A;  2V9A A;  4QD4 A;  2XEP A;  1TS8 A;  2HJ9 C;  1W7F A;  3PBT A;  3IS2 B;  5EM0 A;  5CHU A;  2AVX A;  3LI9 A;  4OOM A;  4WZ5 A;  3ZCZ A;  3V5M A;  4YIN A;  3C4P A;  4C75 A;  1ES4 A;  1DJA A;  4HJ6 A;  3M6B A;  2QYB A;  4NKP A;  1OTA A;  4GHI B;  2HV1 A;  1MWR A;  5HZH A;  1YAX A;  3IXB A;  4P87 A;  1K25 A;  4HIA A;  2BTF P;  1C3B A;  1GA9 A;  5A92 A;  4EXO A;  5HX9 A;  4OLG A;  4JXG A;  5HDD A;  1OT6 A;  4HOI A;  1G6A A;  4D2O A;  2VKS A;  4GLQ A;  5CXW A;  4H6J A;  1V9Z A;  1XFQ A;  5JYP A;  1PFL A;  2Y2O A;  5EVI B;  3FKW A;  4FUW A;  1LSX A;  3O87 A;  1SKO A;  1XP4 A;  4WZ5 C;  1K4E A;  4OPZ A;  1LL9 A;  3LIC A;  1K56 D;  3LCE A;  3PXP A;  3K3C A;  2JHE A;  1NWZ A;  2WUQ A;  1T1A A;  2H0Y A;  1K54 A;  5DTT A;  3GTC A;  3QP8 A;  4OOL A;  5DTK A;  3S7Q A;  3BWL A;  3O3V A;  1ONH A;  5DJT A;  4PM5 A;  4ETZ A;  4IUH A;  5MC7 A;  5U47 A;  1HZO A;  1K56 A;  5FDS A;  1XGI A;  3EOI A;  5EOO A;  3IX3 A;  1LL5 A;  4E3O A;  2ZMF A;  3D4F A;  3ZNY A;  3Q81 A;  4MN7 A;  3N7W A;  4S2N A;  3RXX A;  2H10 A;  4KG6 A;  2Y2P A;  5FEG A;  4GN2 A;  4B9O A;  2PRF A;  5EFW A;  5CEB A;  1DP8 A;  3BW6 A;  2XGN A;  2WGW B;  2VGL S;  5FQQ A;  5EE8 A;  4I38 A;  3IX4 A;  3CPT B;  3CAX A;  2D02 A;  1T1B A;  2VGK A;  3OPP A;  4KG5 A;  3NBL A;  2ZOH A;  5HD5 A;  2IWB A;  5FQI A;  1XJ3 A;  4HH2 A;  3S7N A;  3V67 A;  5DFX A;  5TGF A;  4CLC D;  1K57 C;  5HAI A;  3TRC A;  1FIL A;  3N8R A;  2OOL A;  3LR0 A;  4MBF A;  4I5S A;  3W2Z A;  2X71 A;  5FQ9 A;  1ODV A;  2HP9 A;  3HLB A;  4CLC E;  3CIT A;  4YNR A;  4MN6 A;  5TBM B;  4QHC A;  2XA7 M;  3S22 A;  3G31 A;  3MZF A;  4ZJ1 A;  3Q7V A;  3UN7 A;  2L0W A;  3LR5 A;  5E2E A;  1IEM A;  3F1P A;  4EET B;  4BL2 A;  3R7W B;  2P04 A;  1JWZ A;  1NY0 A;  4P6Z S;  4Y5F A;  1ONG A;  1STZ A;  5K5B A;  4PM7 A;  5EPH A;  3HRE A;  5FQM A;  1VB6 A;  4JGO A;  2HP6 A;  1O07 A;  2J9O A;  5IT5 A;  3T1S A;  5HDS A;  1H8Z A;  4QPR A;  4NXF A;  1IFQ A;  5CGW A;  4WEJ A;  5A93 A;  3BEB A;  1G6O A;  2H5S A;  3SOI A;  1CEG A;  4X1M A;  3B3X A;  1BT5 A;  3LGO A;  1U60 A;  4E3L A;  3HLF A;  2XF3 A;  5HD3 A;  3WS1 A;  2WGI A;  4CLC C;  3NIA A;  2Z2M B;  1YLT A;  4E04 A;  2HJE A;  5GL9 A;  3LI8 A;  3NJA A;  1EWZ A;  5F82 A;  3WRT A;  1XJ6 A;  4Y0O A;  3F1N A;  4X25 A;  3LIA A;  1GHM A;  1CF0 A;  2IWD A;  5HW3 A;  3P01 A;  4Q8I A;  4QJG A;  2A3U A;  4U0X A;  5AVE A;  1QMF A;  3ZG8 B;  3OBF A;  3ZG7 B;  5GHX A;  2XR0 A;  2J3W A;  4DN0 A;  4NEE D;  4BQM A;  1AWI A;  4R70 A;  3GRJ A;  1S4S A;  4RX3 A;  3EEH A;  1KE4 A;  3RJU A;  3V3S A;  5CHJ A;  1LL8 A;  2Y79 A;  4OH0 A;  4WBG A;  2KX6 A;  1YMS A;  3A3I A;  2ACG A;  3AGD A;  3N8L A;  5AJG A;  3UB9 A;  3IXD A;  2E8I A;  2XDM A;  4FD8 A;  2HF6 A;  4KZ3 A;  2XD1 A;  1K4F A;  2KDK A;  3CG5 A;  4GS9 B;  4HP4 A;  4LRX C;  2W1T A;  3E2L A;  3NI9 A;  3F1O A;  3DAV A;  3TG9 A;  3ZFZ A;  1YLJ A;  3AGE A;  4BEN A;  3ZHH A;  1TDL A;  3HVF A;  3MBZ A;  3JVV A;  4LV0 A;  2R9W A;  5I5L A;  5CER A;  1LHY A;  1UWN X;  2HDR A;  3N6I A;  1O7E A;  2DRW A;  2A2L A;  5E2H A;  1EW0 A;  2P7J A;  5AVF A;  2B18 A;  1VEU B;  4E3N A;  3C4O A;  1BSG A;  1KVM A;  1WYB A;  1TS6 A;  3GEC A;  4L9G A;  3SW1 A;  2INW A;  3IQA A;  4ID4 A;  4HY8 A;  2HDS A;  3S4X A;  1H5X A;  2GZA A;  3A3D A;  4NET A;  2JKT I;  3IH9 A;  2VX8 A;  3AGF A;  1OJG A;  3IS2 A;  3T1X A;  3BEC A;  4KZB A;  2WKI A;  2GJ3 A;  4BL3 A;  3B33 A;  3SS5 A;  1X0O A;  1XKZ A;  2VZW A;  3UY6 A;  4Y0T A;  4I3A A;  5TJJ A;  3EQU A;  1BUL A;  5IHV A;  4RA7 A;  4PKY A;  1DRM A;  4LGW A;  5EV0 A;  3G4P A;  4R3B A;  2Y2K A;  3ISG A;  1OTI A;  4Z9Q A;  5GLD A;  4U3T A;  2WZX A;  1SCW A;  3C38 A;  4GHI A;  4E3I A;  2D01 A;  4R4R A;  5G18 A;  2EWW A;  3T4L A;  4E3J A;  2JKG A;  3BQA A;  4E6X A;  4HQA A;  2UWX A;  2ZC3 B;  4QY5 A;  2GNX A;  5CTN A;  3LY3 A;  4EV4 A;  2O99 A;  1I2W A;  4BMW A;  2JE5 A;  2W0N A;  2V2F F;  5JYO A;  1NYY A;  3WS5 A;  4L0L A;  3HBR A;  1GSV A;  1S66 L;  5EVI A;  4JGP A;  3G35 A;  4N92 A;  5HWV A;  4BBU A;  5F5Y A;  4KZ7 A;  1VQQ A;  4O0P A;  4PM8 A;  1F9I A;  4IED A;  5FQK A;  3VP0 A;  1NRJ A;  1HTZ A;  1JWV A;  4U0T A;  2PT7 A;  2V1B A;  2J80 A;  5HL6 A;  2Y2G A;  2W3F A;  4O7D A;  2XA7 S;  3MXR A;  1BZA A;  2FZ0 A;  1ESI A;  4CPK A;  5A8B A;  2P74 A;  2WKR A;  3DBA A;  3A3F A;  2EA9 A;  2O9A A;  3QNB A;  3IT9 A;  1XGJ A;  1ESU A;  3O86 A;  1Y4O A;  4WYY A;  4NG2 A;  3VFH A;  2QHK A;  5J8X A;  4EUV A;  4Y3I A;  4LV2 A;  2Y55 A;  5AQB A;  2WAD A;  1SHV A;  1VHM A;  1I2S A;  5L09 A;  3EGD C;  1UWP X;  3BFD A;  1L0G A;  5FDH A;  4WEL A;  1JVJ A;  3OCL A;  5EUA A;  4LFU A;  1MY8 A;  1K38 A;  2XLN A;  3QHY A;  4QY6 A;  1KDW A;  3GV9 A;  1FSW A;  1GSW A;  3MS6 A;  3ZVT A;  4UA7 A;  4ZDX A;  2V1A A;  2Q9M A;  2QKP A;  1W8Y A;  5L2F A;  3H82 A;  1OPX A;  2DMW A;  1W8Q A;  2Y2Q A;  4DE3 A;  1RCJ A;  1N9B A;  4KZ8 A;  1BYW A;  1ERQ A;  5L07 A;  2O9C A;  4DJ2 A;  5DF7 A;  4HJ3 A;  4EES A;  3HLG A;  1PYY A;  5KZH A;  2FFY A;  1LI0 A;  3K3D A;  1S4R A;  4DE0 A;  4ARZ A;  3UPP A;  4JF4 A;  3WRZ A;  4UQI M;  4EEP A;  2K2N A;  4UHU A;  1CQA A;  3VFF A;  4DMZ A;  5FSR A;  1PW8 A;  2ZOI A;  3BFF A;  3KYE A;  3FZC A;  4PKY G;  4IBR A;  4ETX A;  4OQG A;  3UE6 A;  4II7 A;  5FAO A;  1D1J A;  3CWF A;  1CI9 A;  5HWT A;  4X68 A;  1FCM A;  5CTM A;  1H8Y A;  4R3A A;  3G6O A;  4I3J A;  3IX8 A;  2E8J A;  3RH8 B;  2Y8H A;  1L2S A;  3UNW A;  4KZ5 A;  5E43 A;  2IA2 A;  4N9K A;  5CRF A;  1DJB A;  3G34 A;  2ZC4 B;  5E2G A;  2Y59 A;  2ZJ9 A;  3IWQ A;  3BYD A;  3LR3 A;  3T4Q A;  3TSG A;  1NJ4 A;  3CMZ A;  1IEL A;  4DF6 A;  3IHB A;  2ZMA A;  5KSC A;  4ZRR A;  4E6W A;  3C7V A;  3P98 A;  3DTE A;  1I5Q A;  4C3Q A;  3ULF A;  3T50 A;  3HL9 A;  1OT9 A;  5EM1 A;  4BBT A;  3FYZ A;  4FH4 A;  1W63 M;  4DDY A;  4PMA A;  3DWK A;  3MFD A;  3R4K A;  3BFG A;  5GLC A;  2JCH A;  4HES A;  4GD6 A;  4KG2 A;  1P9W A;  4MN5 A;  4MBH A;  5EOE A;  1GA0 A;  4ESP A;  4IJG A;  1FCO A;  3BFE A;  3HJK A;  1DJC A;  3KSF A;  2WGV A;  2GX5 A;  2WKE A;  4R3J A;  3ZNT A;  1W63 Q;  1CI8 A;  3LEQ A;  5C5K A;  2CMN A;  1H0M A;  1T19 A;  2P08 A;  1XA7 A;  2YKF A;  2P9V B;  5KMW A;  3NCK A;  4XT2 A;  2HDQ A;  3BJN A;  4BD0 A;  2W3H A;  2XFT A;  3IXG A;  1XXM A;  4FSF A;  4MBK A;  1NRF A;  1MXO A;  3A0R A;  3LO7 A;  3A0V A;  2LB9 A;  2ZD8 A;  3MMH A;  4WZ4 A;  3BLM A;  1H3Q A;  1K54 C;  5KSH A;  4HBU A;  2EXB A;  2Z6D A;  5DKL A;  2PU4 A;  5EVL A;  1VEU A;  3G32 A;  3IF6 A;  4HJ4 A;  4OLD A;  4ZAM A;  3M2K A;  5A91 A;  1CK3 A;  1GSX A;  3DTM A;  3L9K A;  1IYS A; 
#chains in the Genus database with same CATH homology
 3H7W A;  2HF6 A;  5HSQ A;  3KO6 A;  3NOU C;  2KDK A;  2M7V A;  1KOU A;  4GS9 B;  2H28 A;  4HP4 A;  2VV7 A;  4LRX C;  4Q0I A;  1XJ4 A;  2XSS A;  5F68 A;  2W1T A;  3KYQ A;  3F1O A;  3IBJ A;  3U2A A;  1OTD A;  2W3E A;  4WN5 A;  3MF0 A;  2PYR A;  3BQ8 A;  3P7N A;  4I3I A;  1F98 A;  1S1Y A;  2PDR A;  3JVV A;  1N9N A;  5I5L A;  1UWN X;  5L8M A;  2VV6 A;  1MKM A;  2K7S A;  4HHD A;  2A2L A;  3LFV A;  3MXQ A;  1EW0 A;  4G3K A;  5F6A A;  2P7J A;  4P6Z M;  5AVF A;  2B18 A;  4IHQ A;  2BAS A;  5DFY A;  4Y2F A;  3NOP C;  4GJ4 A;  4WLA A;  4DJ3 A;  4PHT A;  3E4O A;  1TS6 A;  1V9Y A;  3GEC A;  1F5M A;  2PD8 A;  2INW A;  4L9G A;  3SW1 A;  2W1R A;  4L9F A;  4I39 A;  1DP6 A;  4HY8 A;  2J3T D;  2GZA A;  5CX7 A;  1G28 A;  3KSH A;  1WA9 A;  2ZMV A;  3OCN A;  3T4J A;  2XRO A;  3H7W B;  3PBO A;  2JKT I;  4LPZ A;  4B93 A;  2VX8 A;  4GCZ A;  1OJG A;  1D7E A;  2KLI A;  4EEU A;  3GDI A;  3IS2 A;  1S67 L;  3NHQ A;  2W1T B;  2GJ3 A;  5J3W A;  2A24 B;  3C8C A;  3ZQ5 A;  4G3W A;  4NXE A;  3B33 A;  5DJU A;  3PHY A;  3C2W A;  1X0O A;  2VZW A;  3JVU A;  3CI6 A;  2OAQ 1;  4I3A A;  3MR0 A;  5TJJ A;  3EQU A;  4HI4 A;  1OJ5 A;  4NXG A;  3E4P A;  3C30 A;  4PKY A;  1DRM A;  1ZTU A;  4F3L A;  1LSW A;  4FOF A;  3E4Q A;  4K08 A;  3CUE C;  1OTI A;  4GS9 A;  3UB8 A;  2PD7 A;  1TS0 A;  2ZBB A;  3PBQ A;  4L9E A;  3O5Y A;  3C38 A;  4GHI A;  2QWS A;  3H9W A;  1TF1 A;  3VE4 A;  3OC2 A;  1S1Z A;  2D01 A;  3BY8 A;  2EWW A;  3T4L A;  2V9A A;  1TS8 A;  2HJ9 C;  3BQA A;  4HQA A;  2OWJ A;  3IS2 B;  3PBT A;  3PR6 A;  2GNX A;  3T4O A;  3LI9 A;  1NLZ A;  4OOM A;  2O99 A;  3MQQ A;  3B42 A;  4BMW A;  3TE8 A;  2W0N A;  4JGR A;  4KUO A;  3UMD A;  3D3O A;  1H8M A;  4L0L A;  2PYP A;  1GSV A;  4UQI S;  1S66 L;  3EEA A;  3RTY A;  4F3L B;  4JGP A;  2EWV A;  3HJI A;  2NUP C;  2J3T C;  5HWV A;  4BBU A;  1LT0 A;  5F5Y A;  4HJ6 A;  4O0P A;  3UB6 A;  1XFN A;  1F9I A;  3EGX C;  2QYB A;  4NKP A;  1OTA A;  1Y28 A;  2WKP A;  2VJW A;  4O01 A;  1NRJ A;  2A24 A;  4EQ1 A;  4GHI B;  2HV1 A;  2PT7 A;  1YSQ A;  2V1B A;  2J80 A;  5HL6 A;  5HZH A;  2V0U A;  3LR4 A;  1YAX A;  3H82 B;  2W3F A;  4YWZ A;  4HIA A;  2XA7 S;  3LID A;  2V0W A;  4Q0J A;  2JN7 A;  4CLC A;  4EXO A;  5DF9 A;  2FZ0 A;  5A8B A;  4HH3 A;  5HDD A;  1OT6 A;  4HOI A;  3PBS A;  3S7P A;  2VKS A;  4GLQ A;  5HPI A;  4H6J A;  2WKR A;  3DBA A;  1YKD A;  2EA9 A;  1OTB A;  3T4T A;  2O9A A;  3MQ0 A;  1V9Z A;  5HPF A;  4JGQ A;  3E0Y A;  1XFQ A;  2PR6 A;  2QJ5 A;  2JKR M;  1LSX A;  1T18 A;  4ARZ B;  2QHK A;  4EUV A;  4RQ9 A;  4Y3I A;  5F69 A;  4BBV A;  3LIC A;  2PHY A;  3PXP A;  3K3C A;  2JHE A;  1NWZ A;  2R78 A;  3TW8 A;  1VHM A;  1T1A A;  2M7U A;  2OAP 1;  4OOL A;  3KX0 X;  1ZHH B;  3EGD C;  1UWP X;  3S7Q A;  4M4X A;  4MMN A;  3BWL A;  2JKT M;  3EWK A;  5DJT A;  3LUQ A;  4WEL A;  4ETZ A;  3UE3 A;  2O0Y A;  4IUH A;  3KSI A;  5MC7 A;  3OCL A;  5HWW A;  4CLC B;  3IBR A;  4WL9 A;  3B47 A;  3EOI A;  4EER A;  2G7U A;  3PYP A;  4EW7 A;  2ZMF A;  4CQH A;  3OLO A;  1LSV A;  1GSW A;  4H6J B;  2W3G A;  2B02 A;  4MN7 A;  3PBR A;  4R6L A;  2V1A A;  3F1P B;  2QKP A;  4R38 A;  2L1M A;  3FC7 A;  4B9O A;  3H82 A;  2YKH A;  3D72 A;  3FG8 A;  1OPX A;  5EFW A;  2DMW A;  1DP8 A;  4MDZ A;  3LIE A;  3BW6 A;  5J7E A;  2VGL S;  1JNU A;  4I38 A;  3S7O A;  1BYW A;  2M1C A;  2O9C A;  3CAX A;  3BY9 A;  2I9V A;  2D02 A;  4DJ2 A;  3EQV A;  4HJ3 A;  1T1B A;  4Q0H A;  4IUK A;  2W3D A;  4MCW A;  2ZOH A;  4YOF A;  4EES A;  3VE3 A;  5HD5 A;  4WEK A;  2WKQ A;  3K3D A;  1S4R A;  4ARZ A;  3TJZ C;  1XJ3 A;  4HH2 A;  4O8G A;  3S7N A;  4G3V A;  4UQI M;  4EEP A;  2K2N A;  1N9L A;  2MJ6 A;  3V67 A;  4DMZ A;  2NUT C;  3FPV A;  5DFX A;  2ZOI A;  2VV8 A;  4CLC D;  1T1C A;  4WUJ A;  2HGV A;  1P0Z A;  3TRC A;  2VLG A;  4PKY G;  4ETX A;  3UE6 A;  2OOL A;  3LR0 A;  4II7 A;  3HCY A;  4I5S A;  3CWF A;  3W2Z A;  5HWT A;  1ODV A;  4R3A A;  5KIZ A;  5LBR A;  4LRY C;  3G6O A;  4I3J A;  3UB7 A;  4CLC E;  5FL3 A;  3CIT A;  4YNR A;  1D06 A;  3RH8 B;  4MN6 A;  2Y8H A;  2VEA A;  5TBM B;  4XT2 B;  3F1N B;  2XA7 M;  1MC0 A;  4WF0 A;  2FH5 A;  3KYZ A;  3KSG A;  2O9B A;  2IA2 A;  3CUE A;  3RFB A;  2L0W A;  3LR5 A;  4AFI A;  1MZU A;  3F1P A;  4EET B;  2OWH A;  3E98 A;  3R7W B;  2P04 A;  1UGU A;  2XRN A;  4P6Z S;  4Y5F A;  5IS1 A;  1STZ A;  2PR5 A;  3LR3 A;  3T4Q A;  1DP9 A;  2JKR I;  5K5B A;  3T4S A;  3ZYT A;  1TS7 A;  3LIB A;  1VB6 A;  4JGO A;  4ZRR A;  5IT5 A;  1P9R A;  3ULF A;  3VV4 A;  5HDC A;  3T50 A;  5HDS A;  1OT9 A;  4BBT A;  4QPR A;  4NXF A;  1W63 M;  1IFQ A;  4KUK A;  4KQO A;  3A0S A;  3R4K A;  4PAU A;  4WEJ A;  4LLO B;  1P9W A;  4MN5 A;  2VA0 A;  3NOT C;  4EU0 A;  1G6O A;  5G4Y A;  3F1O B;  3MJQ A;  4IJG A;  1OTE A;  2KOI A;  2W27 A;  4BJP A;  5DKK A;  4HP9 A;  3LYX A;  5HD3 A;  2K31 A;  2L4R A;  3HJK A;  4CLC C;  3KSF A;  2GX5 A;  1N9O A;  4E04 A;  1W63 Q;  2HJE A;  5C5K A;  2CMN A;  1YSP A;  4UEY A;  1T19 A;  3UME A;  3LI8 A;  2P08 A;  3NJA A;  2YKF A;  4KQD A;  3PBN A;  1XJ6 A;  3K2N A;  5TBM A;  4XT2 A;  3F1N A;  3CLO A;  3BJN A;  2VGL M;  1TD5 A;  3LIA A;  2W3H A;  3OOV A;  3P01 A;  3ICY A;  4FSF A;  5AVE A;  4BWI A;  3A0R A;  3OBF A;  3A0V A;  3FPW A;  2J3W A;  2Z6C A;  2LB9 A;  4LRZ E;  3MMH A;  3MQO A;  4DN0 A;  3R7W A;  1H3Q A;  4NEE D;  4R70 A;  5J4E A;  5KSH A;  4GW9 A;  2QJ7 A;  2Z6D A;  5DKL A;  4HNB A;  1S4S A;  3T4K A;  1XJ2 A;  1NLY A;  3EEH A;  4HJ4 A;  1IOU A;  3LIF A;  5G4Z A;  3MFX A;  1LL8 A;  1P97 A;  2Y79 A;  2KX6 A;  2LB5 A;  4Z1W A;  3VOL A;  4NXB A;  5AJG A;  3UB9 A;  1GSX A;  5IU1 A;  4ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...