2V20A

Structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
269
Chain Sequence
PETLVKVKDAEDQLCRTSHRPCRVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGRRGSRGIIAALGPDGKPSRIVVIYTTGSRKKTDERNRQIAEIGASLIKHWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Engineering an Allosteric Binding Site for Aminoglycosides Into Tem1-Beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 103
structure length 269
sequence length 269
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2v20A00
3G32A 3UO9A 1BTLA 3LO7A 5FATA 1KE4A 1KVMA 3ZVTA 4ZTKA 1LLBA 1YLWA 3OCLA 4JXSA 1L0GA 1U60A 3W4QA 4DE3A 3C4PA 4KG5A 3OZHA 1KDWA 2WKHA 4K0XA 2X02A 1KGEA 3Q81A 4QY5A 4E3KA 1KE0A 3HLGA 1YLTA 1LI9A 2ZQDA 4E3LA 2J8YA 3ZVWA 2QPNA 3HUNA 2V1ZA 2RL3A 3QNCA 4KZ4A 2XK1A 1TVFA 5HFOA 1L0DA 3SH7A 2HDQA 5EECA 4B4ZA 4BD0A 4JLFA 4K91A 4P0MA 2WKEA 4GDBA 2ZQAA 4GDNA 4R0QA 1YLZA 3FV7A 3I7JA 2H0YA 5GLCA 1N4OA 3HBRA 4IBRA 5DF9A 3VFHA 2WKIA 4CPKA 4OP5A 4F94A 4HESA 2PU2A 3BYDA 1E3UD 4Z9QA 2PBYA 4OOLA 3W4PA 4FSFA 4Y0TA 5G18A 4JKTA 4BLMA 4KZ9A 5FI2A 1ESIA 1LHYA 2Y2KA 3NCKA 5DF8A 5E43A 3A3EA 4LCMA 4OVDA 5AQAA 2C5WB 1ZG4A 3BFGA 3UN7A 2WGWA 2WZXA 3IWOA 5AQBA 5FQJA 1FR1A 5TFQA 4EV4A 1EWZA 5HAPA 2ZC5B 2P9VB 3HLDA 4YINA 3DWKA 3G35A 1K25A 1J9MA 3FKVA 1YM1A 1MWTA 5A92A 3GTCA 2EX2A 4KZ7A 1XPBA 2Y2NA 4LV0A 1BULA 3N7WA 5I94A 2J7VA 4OLGA 4M3KA 1TDLA 1YLPA 5EOEA 1CEFA 1JWVA 2EX9A 2WZZA 4ID4A 3ZG9B 4QJGA 4GOGA 3M2KA 3M2JA 3MKFA 4KZBA 1JTGA 4DRTA 1LL5A 4PPRA 4WMCA 5CERA 4S2MA 3SH9A 3IT9A 1MY8A 5GHYA 1GHMA 4RYEA 3UPNA 2HPBA 3FKWA 1IEMA 4BL3A 2JE5A 2XF3A 1PIOA 3IXHA 4YFMA 1HD8A 3PBOA 1E25A 2WUQA 3BLSA 1HTZA 3BRMA 3HL9A 4B88A 1GA9A 3ZNTA 5A90A 1EI5A 4DE2A 4N1XA 2VGKA 3WS4A 3A3IA 3ZG7B 4KZAA 4GKUA 5E2EA 3ZGAB 5DTSA 2EXBA 1ES2A 3D4FA 4E3MA 3OPHA 4X6TA 3IHAA 4GB7A 1CEGA 4ZJ3A 5IHVA 1QMFA 2P9VA 1H5XA 2Y4AA 2FFYA 2XEPA 1YLJA 2ZM8A 2H10A 2XGNA 2ZJ9A 3RXXA 3W4OA 2J9PA 4JXWA 4WZ5A 1XA1A 2WK0A 4UA9A 3VP1A 1WYBA 4XUZA 4MEZA 3PBRA 3VP3A 1ZC2A 4PM9A 4EBLA 3NDGA 4JBFA 3C5AA 5FI7A 2WADA 5M19A 3G31A 4WBGA 4L0LA 5FQ9A 3VFFA 1W79A 2V2FF 3BM6A 4WEJA 1KVLA 5FAQA 3GVBA 4MBHA 3BFDA 4OKPA 4PM6A 5DTTA 5FQQA 1E3UA 2WGWB 3BFCA 2Y2MA 3O3VA 4E3JA 3AGDA 4OQ0A 4R3JA 5DTKA 4BD1A 1FQGA 2DCFA 1YMSA 3HLWA 3IH8A 3OCNA 1PI4A 1K6SA 2EX6A 2EFUA 3P98A 2BG1A 3UE3A 3UPOA 5HAQA 1H8ZA 3MBZA 1FSYA 3A3FA 5GLDA 3MZDA 1PYYA 3IWIA 4WELA 3O86A 1BLPA 1K4EA 1VQQA 5HX9A 1BLSA 5FAOA 1FOFA 2Q9NA 1NRFA 2Y2GA 5CGSA 1MWSA 3V39A 1MWRA 4RX3A 3UE1A 4KZ3A 4OQIA 4MBFA 5GLAA 2XLNA 4OP8A 4H8RA 4JF5A 3AGFA 3MZFA 2R9WA 2Y2PA 2BLSA 3GMWA 4R23A 4UA7A 3P09A 2JBFA 3C7UA 2DRWA 3WRZA 4WEKA 2ZC6B 1LL9A 2P74A 3Q7ZA 2WAFA 3N8SA 1GA0A 1KDSA 4KZ5A 5F1FA 4S2LA 4KG6A 1CI9A 4QB8A 1PWGA 4S2IA 2XH9A 3N8LA 4EBPA 1NYMA 2QZ6A 3SS3A 3AGEA 4Y0OA 3V5MA 5KSCA 4GNUA 4HBUA 4E3NA 5AQ9A 4HBTA 4EQIA 3DWZA 4PM5A 1K56D 4R1GA 4BJPA 3DTMA 4X53A 5HAIA 3ZNYA 3RJUA 3MKEA 2Y55A 3NBLA 5A93A 1WE4A 1SCWA 1NZOA 2EFXA 3HUOA 4OLDA 2ZQ8A 4X56A 1MKIA 2Z2LB 4OOYA 2Y59A 3SH8A 2ZLYA 4FH4A 3ZHHA 5CTMA 1Z6FA 3LEZA 3MZEA 5CHUA 4DXBA 1K4FA 1Q2PA 4RX2A 5FI6A 1YMXA 2HDSA 3ITBA 4S2OA 4MBKA 1NYYA 2Z2MB 4Y0UA 3FYZA 5FQIA 2JC7A 5HW3A 4P6BA 4LV2A 3FWLA 5CTNA 2ZQCA 4A5RA 3MFDA 1CI8A 2H0TA 1K38A 5EVID 2XFTA 1W8YA 4JF4A 3W8KA 2DNSA 1IYPA 1IKGA 5E2FA 4N9LA 1XA7A 3CJMA 5CECA 4FH2A 1TEMA 3WS2A 4PM7A 5CGXA 4UHUA 4EBNA 1S0WA 1DJBA 1FCMA 3HLBA 1N9BA 2HDRA 2ZMAA 4WYYA 3Q07A 4R4SA 4BL2A 1MPLA 4GZBA 5FASA 4NETA 3EQVA 2Y2HA 3RXWA 3VMAA 1XGJA 3IXBA 3GV9A 5L2FA 1ONHA 2A49A 3WRTA 1G68A 4WZ5C 2XD5A 3BFFA 3VOZA 4KQOA 4QD4A 4S2NA 4KZ8A 3A3JA 4GD8A 4OQGA 3ZDJA 1GCEA 2FFFB 5KMWA 3TOIA 3ZG0A 2Y91A 3S1YA 3PAEA 3IH9A 5GL9A 3BEBA 4DE0A 5J8XA 1NZUA 4P87A 1W5DA 4ZBEA 1XP4A 5CHMA 1JTDA 5GLBA 1RGYA 4KQRA 4S2PA 1L0FA 4KENB 3HVFA 4P85A 5JYPA 3TG9A 5FQKA 4XUXA 3UPPA 3NIAA 1E4DA 4CJNA 3SOIA 4IVIA 1NXYA 1SDEA 2ZD8A 2ZM2A 4LV1A 5EPHA 3BFEA 1ZG6A 4U0TA 4DKIA 3BECA 5AQ7A 4X69A 5CEBA 4FD8A 1H8YA 5HARA 3UE0A 2IWBA 4WZ4A 4HEFA 2HP5A 1JWZA 1L2SA 2OLVA 3GQZA 4UAAA 2Q9MA 1SKFA 3DW0A 3E2KA 3CZDA 3IQAA 4JF6A 4N1HA 1SDNA 4QY6A 2ZC3B 2GDNA 1K56A 5CRFA 4B4XA 2PU4A 5EUAA 4OONA 2IWCA 4WMCD 5HL1A 4IVKA 3ITAA 2G2UA 1ERMA 1Y54A 3IF5A 3PBSA 4BENA 4KZ6A 2QMIA 5DF7A 1I5QA 1EROA 1XX2A 2A3UA 2X71A 4OPRA 3WS1A 4QU3A 4JXVA 1RP5A 1RCJA 1PZPA 1ESUA 1PZOA 5F1GA 3WWXA 3IF6B 1LI0A 4Q8IA 2ZQ9A 4OPQA 5KSHA 2E8IA 3C7VA 1NJ4A 4DF6A 5E2GA 2XR0A 4K0WA 1FCNA 4O7DA 3Q7VA 4NK3A 5M1AA 4GN2A 4ZJ1A 2XQZA 3IXGA 2G2WA 5FSRA 4QHCA 1G6AA 4R3BA 4XXRA 3ZG8B 3UY6A 4DE1A 1VM1A 1KE3A 4BQMA 1CK3A 2Y2JA 3GRJA 1JWPA 1W8QA 2WGVA 3HLEA 1C3BA 1ERQA 5EVIA 3Q82A 1DJCA 5GHZA 1Q2QA 3QHYA 1SHVA 2Y2LA 2J9OA 3QNBA 3EQUA 3UDIA 5TGFA 3V3SA 1YLYA 3PBTA 3S4XA 3UDXA 4MLLA 5FA7A 3OPRA 1ZKJA 3VOYA 3O88A 4ZAMA 3BLMA 3VSLA 1ALQA 3MXRA 3VP2A 4OH0A 3MXSA 4WM9A 4LCLA 1DY6A 1PI5A 2HP6A 3LY3A 4KG2A 1W7FA 4S2JA 3A3DA 2EX8A 4RA7A 5EVLA 2C6WB 1DJAA 5FDHA 4D2OA 2JCHA 5E2HA 3PTEA 3HREA 1I2WA 4JXGA 4X68A 2OSUA 2OV5A 4N92A 5M18A 1BLCA 1YQSA 1MWUA 3PBNA 4DDYA 1WYCA 4GD6A 3IF6C 4LENA 3UDFA 3HLCA 3IHBA 2ZQ7A 3SS5A 3VP4A 1PWDA 3UNWA 1ES5A 2HP9A 2H5SA 1IYSA 2CC1A 1S6RA 3OPPA 3N8RA 4ZJ2A 1NY0A 3G2YA 3IF6A 1JVJA 3VP0A 3ZG5A 4OPYA 4E3IA 2RCXA 3WS5A 5CEDA 3OC2A 1QMEA 3G34A 1KGFA 4ZDXA 2HDUA 5EOOA 3SS4A 4PMAA 1OMEA 5CGWA 5F83A 3G4PA 3V3RA 2X01A 3CG5A 5FQMA 3ZFZA 1M40A 1AXBA 1YT4A 3M6BA 4C6YA 1GHPA 1TDGA 1XGIA 3C4OA 2XD1A 2IWDA 4S2NC 3TSGA 3N6IA 4KQQA 4DXCA 4E6WA 4E3OA 5KZHA 1I2SA 5TR7A 1O7EA 3G2ZA 1ES4A 3N4IA 1K55C 2Y2OA 3CMZA 4PM8A 2EXAA 3E2LA 5FAPA 3LCEA 4LV3A 5JYOA 1PW8A 5DVAA 2XDMA 2XFSA 3Q7VB 4Y7PA 5A91A 4OPZA 3M6HA 4IEDA 5CHJA 5GHXA 4DDSA 4EUZA 4X55A 2WGIA 1O07A 4FCFA 1PWCA 4N9KA 1PW1A 4C75A 1ES3A 2UWXA 1K55A 2ZC7A 5EVIB 1IYQA 4OOMA 3JYIA 4E6XA 4RVAA 2I72A 1BZAA 3HUMA 1FR6A 1K54C 3LY4A 3NC8A 3OPLA 5U47A 4C3QA 3VSKA 2Y2IA 4U0XA 3B3XA 3V50A 1K57C 3PBQA 1L0EA 3HLFA 2ZC4B 3GR2A 1RGZA 4JPMA 1BLHA 3NI9A 1KGGA 2R9XA 1IYOA 1XKZA 1BT5A 4OQHA 4U3TA 1K54A 1MXOA 1IKIA 5D3OA 1HZOA 3NY4A 2WYXA 3S22A 2WAEA 1BSGA 2B5RA 1K57A 4MNRA 3WS0A 3ISGA 4UA6A 3FZCA 3PAGA 2VGJA 5F82A 5CXWA 1K6RA 5EE8A 1BUEA 3NDEA 1MBLA 1M6KA 4S2KA 1ONGA 1FSWA 1XXMA 4R4RA 4EWFA 5BOHA 3G30A 3GSGA 5EVIC 2OLUA 3IWQA 1FCOA 3ZCZA 4IBXA 3IXDA 2Y2QA 1IELA 2V20A 3Q1FA 3O87A 1GHIA 1HVBA 2ZM0A
chains in the Genus database with same CATH superfamily
1ZHHB 4H6JB 1KE4A 1YLWA 1U60A 5J4EA 2WKHA 4K0XA 4LFUA 2X02A 1KGEA 4E3KA 1YLTA 2PDRA 3LR4A 2XK1A 2B18A 4P0MA 4GDBA 4R0QA 3I7JA 1N4OA 4CPKA 2PU2A 2PBYA 4BLMA 5FI2A 2VV7A 2VA0A 3QP8A 2C5WB 4KQDA 3UN7A 4NXEA 2OOLA 4GHIB 2WZXA 3IWOA 3JVVA 5TFQA 1EWZA 3LIEA 3HLDA 3G35A 1K25A 4GJ4A 1J9MA 4R6LA 4LV0A 3N7WA 5I94A 3D3OA 1YLPA 4MMNA 1CEFA 1JWVA 2EX9A 2WZZA 4ID4A 5F6AA 3M2KA 3M2JA 3FPWA 3LGOA 1MZUA 5GHYA 3IX8A 3UPNA 2HPBA 3T1SA 1IEMA 4Y15A 3PR6A 3VE3A 3IXHA 2PR6A 2O9BA 2W1TB 3CLOA 2WUQA 1HTZA 3BRMA 4B88A 4DE2A 3WS4A 4NKPA 3A3IA 4QWOA 3ZGAB 2JKTM 1ES2A 2GNXA 4EUVA 3OOVA 4GB7A 1CEGA 2Y4AA 2QWSA 1YLJA 3EGXC 2J9PA 1XA1A 1VEUA 3MR0A 4XUZA 3PBRA 3VP3A 1ZC2A 4JBFA 3C5AA 2M7VA 5FQ9A 1EW0A 3D72A 3BM6A 1KVLA 5FQQA 2WGWB 3AGDA 4RQ9A 3QP1A 5DTKA 1YMSA 3HLWA 5TBMB 2EX6A 1H8ZA 3MBZA 3BY8A 3MZDA 1PYYA 4FOFA 3O86A 1BLPA 1BLSA 5FAOA 1FOFA 2Q9NA 1IFQA 4LRZE 1MWSA 4RX3A 4MCWA 4OQIA 4PKYG 1LT0A 3CUEC 1XJ2A 4OP8A 4JF5A 3MZFA 5F69A 4UA7A 3P09A 5HD3A 3MQ0A 4WEKA 3Q7ZA 1UGUA 2WAFA 3N8SA 1GA0A 4KZ5A 4WF0A 4JGRA 1OTBA 4X1LA 1PWGA 3H7WA 4BBTA 2JKRM 2K7SA 4HH3A 2QZ6A 3SS3A 3AGEA 4GNUA 4PAUA 4E3NA 1Y4OA 4R1GA 3DTMA 4YWZA 4MN5A 3ZNYA 1GSWA 2JKGA 5A93A 2LB9A 1SCWA 3T4TA 2ZQ8A 5DFXA 2ZBBA 1MKIA 2Y59A 2ZLYA 4DXBA 1K4FA 1Q2PA 2L4RA 3VE4A 2HDSA 2Z2MB 3FYZA 5HD5A 3FWLA 2ZQCA 3MFDA 1CI8A 2H0TA 1W8YA 4JF4A 4N9LA 3CJMA 1W63M 4UHUA 4L9FA 1S0WA 1DJBA 3NECA 1N9BA 3EQVA 2Y2HA 3RXWA 2J3TC 3GV9A 4EXOA 1ONHA 3WRTA 2V0WA 4QD4A 4S2NA 4KZ8A 2QHKA 1DRMA 3PAEA 5AVEA 1DP9A 2VV8A 4ZBEA 1XP4A 5CHMA 2WKQA 4KQRA 3NHQA 4QPRA 4XUXA 1NXYA 2ZM2A 4LV1A 3BFEA 4U0TA 3MQQA 3BECA 4X1MA 4X69A 2JHEA 5CEBA 4O8GA 4ESPA 2HP5A 2OLVA 2Q9MA 4QY6A 3E2KA 3F1OB 1NRJA 1SDNA 3T4OA 4PHTA 4OONA 4WMCD 1Z09A 2W0NA 4HOIA 4WUJA 1RP5A 1HLUP 1ESUA 3TJZC 2V1BA 1NJ4A 4O7DA 1FCNA 1OTAA 3Q7VA 5M1AA 4GN2A 3IXGA 1G6AA 1KE3A 2ZOHA 1CK3A 4F3LA 1C3BA 3H82A 2Y2LA 3UDIA 2J9OA 3QNBA 3TRCA 3EWKA 3V3SA 1YSQA 3T50A 3PBTA 4EETB 3UDXA 4MLLA 3OPRA 3U4LP 3VOYA 2JKFA 3O88A 4ZAMA 3KYEA 4WM9A 4LCLA 3LY3A 1BYWA 5E2HA 4JXGA 4X68A 2OSUA 4II7A 4XT2B 4BBVA 1BLCA 3PBNA 5J3WA 4LENA 4MN7A 4ARZA 3SS5A 1S67L 3NOPC 3PYPA 1IYSA 1S6RA 3PHYA 3OPPA 2BTFP 4ZJ2A 3IF6A 2RCXA 1QMEA 1H8MA 3SS4A 4PMAA 4X25A 5CGWA 4H6JA 2X01A 5HWWA 1YT4A 3DTIA 3TSGA 2EWVA 4I3IA 1I2SA 5TR7A 1ES4A 3KSHA 3LCEA 5DJTA 5JYOA 1PW8A 3NJAA 2XDMA 2XFSA 5GHXA 3F1PB 2L1MA 4X55A 2WGIA 4FCFA 1PW1A 4C75A 1ES3A 4HNBA 2ZC7A 3OBFA 1IYQA 3JYIA 3T12B 1V9ZA 3UMEA 3IX4A 1FR6A 1YPRA 2Y2IA 4U0XA 3R7WB 2ZC4B 1BLHA 3NI9A 4GHIA 1IYOA 1K54A 5HDSA 3NY4A 3S22A 5A8BA 1NLZA 2WAEA 3WS0A 1OT6A 2VGJA 3NDEA 3A0SA 1MBLA 3KO6A 2INWA 1F98A 4EWFA 5C5KA 3TE8A 5EVIC 1FCOA 4IBXA 3GECA 1IELA 3Q1FA 1GHIA 4RVAA 1BTLA 3LO7A 1SKOA 3ZVTA 4ZTKA 1F5MA 1ACFA 3OCLA 1L0GA 4DE3A 3C4PA 2VEAA 3OZHA 3BW6A 1KDWA 1JNUA 1OT9A 3KSIA 4QY5A 1T18A 2V9AA 2ZQDA 4E3LA 3ZVWA 3HUNA 4IJGA 4B4ZA 2DMWA 1TVFA 5HFOA 1L0DA 3T1RA 4JLFA 4K91A 3T4SA 3LI8A 2A24A 1MKMA 2B02A 2ZQAA 3HBRA 5DF9A 4F94A 4OP5A 4HESA 3BYDA 4HP4A 1YAXA 3W4PA 2B95A 1ESIA 2XROA 1WA9A 4LCMA 3LFVA 2ZL1B 5HZHA 2WGWA 5FQJA 4DMZA 4EV4A 2ZC5B 3DWKA 5TBMA 2W3DA 3E4PA 2EX2A 3ICYA 4M3KA 3EEHA 4QJGA 2VJWA 3MJQA 1H0MA 4PPRA 4WMCA 5CERA 4S2MA 4RYEA 1SZVA 4I5SA 5HPFA 2E8JA 3OLOA 4HP9A 2HF6A 3FPVA 5A90A 4N1XA 1TS7A 4WL9A 3VV4A 3ZG7B 4KZAA 4GKUA 4JGPA 5E2EA 4FTXA 3G6OA 3D4FA 1T19A 2PYPA 3UB8A 3OPHA 5IHVA 1TF1A 2P9VA 1H5XA 2ZM8A 3RXXA 2XGNA 2ZJ9A 4WZ5A 1PNEA 1PRQA 2WK0A 2O9AA 4DJ2A 3VP1A 1WYBA 2K2NA 1OTEA 4EBLA 5M19A 3G31A 2V2FF 2PR5A 4MBHA 5DTTA 4OKPA 4O0PA 2ZMVA 2Y2MA 4R3JA 1T1CA 4I39A 1KOUA 2OWJA 1PI4A 3P98A 1LSWA 2YKFA 3A3FA 1N9NA 4ME4A 5CGSA 1MWRA 3P01A 4KZ3A 3UE6A 2M7UA 4MBFA 5GLAA 2EWWA 2XLNA 1T1BA 3GMWA 5G4YA 4R23A 4MDZA 2JBFA 2DRWA 2P74A 4S2LA 4GS9B 1CI9A 4QB8A 2QKPA 2XH9A 4E04A 3N8LA 5L8MA 1L3LA 4HBTA 4PM5A 3HCYA 3MMHA 3RJUA 3F1NB 3NBLA 1FILA 1WE4A 1P9WA 3HUOA 3F1OA 4OLDA 3S7NA 5HWVA 4OOYA 2R78A 5KIZA 3ZHHA 5CHUA 3NOUC 2I9VA 1NYYA 5FQIA 4DJ3A 1G5UA 5CTNA 1K38A 2XFTA 3RFBA 1IYPA 5CECA 2O9CA 1XA7A 3IX3A 1TEMA 4CLCA 4EU0A 2OAQ1 1FCMA 3HLBA 3CPTA 2ZMAA 4R4SA 3B33A 4NETA 3VMAA 2WKPA 4IUKA 5TJJA 3U2AA 3VOZA 5KMWA 4GD8A 3ZDJA 4LGWA 3ZG0A 3S1YA 3IH9A 1ODVA 3BEBA 1W5DA 3C2WA 1L0FA 1E4DA 2W3EA 2ZD8A 5DKKA 2QYBA 5HWTA 1OJGA 5AQ7A 4FD8A 4WZ4A 2Y8HA 5FASA 3DW0A 4N1HA 1K56A 1VETB 2PU4A 5HL1A 1F9IA 2G2UA 4ZRRA 3IF5A 1Y54A 2KOIA 3PBSA 4BENA 4KZ6A 1VHMA 2X71A 4OPRA 2W3GA 1RCJA 1PZOA 5F1GA 3WWXA 1LI0A 2ZQ9A 1XJ4A 4BBUA 3T4LA 4ETXA 4ZJ1A 2XQZA 3LR3A 4QHCA 3GRJA 1W8QA 3HLEA 1ERQA 3CITA 5GHZA 1Q2QA 1YLYA 2ZMFA 3S4XA 3LICA 4YOFA 4NXGA 3VSLA 4G3WA 1LSXA 3MXSA 2HP6A 4R70A 1W7FA 5EVLA 1DJAA 4D2OA 2JCHA 2V8FA 3PTEA 1I2WA 2PT7A 4YNRA 1YQSA 1MWUA 3FC7A 4DDYA 1WYCA 3IF6C 1CJFA 3VP4A 1PWDA 3UNWA 1ES5A 5HDDA 2CC1A 5CEDA 5DKLA 4E3IA 1PFLA 5EOOA 1OMEA 5F83A 3G4PA 3L9KA 3V3RA 5IU1A 3A0VA 1M40A 2IWDA 3N6IA 4E6WA 4E3OA 2P08A 3RTYA 3K2NA 2Y2OA 3LIBA 5DVAA 4HJ3A 5F5YA 4IEDA 3E4OA 4DDSA 3B42A 4N9KA 1DP6A 3ULFA 5EVIB 3ZYTA 2M1CA 1K54C 1V9YA 5U47A 4C3QA 3VSKA 1OTIA 3B3XA 3V50A 3GR2A 1RGZA 2ZL1A 4DN0A 2R9XA 3W2ZA 4OQHA 4PKYA 4U3TA 1MXOA 2HJ9C 5D3OA 2PD8A 1K57A 4HY8A 3ISGA 3PAGA 2W27A 5EFWA 1K6RA 4NEED 1G28A 3BQ8A 1AWIA 3T4KA 1XXMA 5BOHA 5EM0A 3G30A 3KSGA 3IWQA 3ZCZA 3DTKA 3IXDA 3R4KA 4BJPA 1HVBA 4Y5FA 2ZM0A 3UO9A 3IBRA 5FATA 4M4XA 3UB9A 3LIFA 5EV0A 4JXSA 3W4QA 3IBJA 4JGOA 3HJKA 1LI9A 2J8YA 2QPNA 3QNCA 3SH7A 2Q0OA 2HDQA 5EECA 4L9GA 2WKEA 4GDNA 5GLCA 3VFHA 2H0YA 3LI9A 4IBRA 2WKIA 5EM1A 5AJGA 1DP8A 3DAVA 3A3EA 5AQAA 1ZG4A 5HDCA 3K3DA 1FR1A 1S1ZA 3UB7A 3FKVA 1YM1A 1MWTA 1BULA 2J7VA 4OLGA 3LR5A 4HIAA 5EOEA 2W3FA 3DBAA 3EOIA 2D01A 4GOGA 3ZQ5A 1JTGA 4DRTA 1LL5A 3IS2B 1S4SA 4Z1WA 4EESA 4GW9A 3MXQA 4Q0JA 1GHMA 3FKWA 4BL3A 4GS9A 4Y2FA 2JE5A 1PIOA 1HD8A 2FH5A 4NXFA 3PBOA 3BLSA 3ZNTA 2VGKA 5DTSA 4LLOB 2G7UA 3LR0A 4X6TA 3IHAA 2H10A 5HL6A 3W4OA 4JXWA 4UA9A 5HPIA 2VGLM 4PM9A 1YKDA 2J3WA 3NDGA 5FI7A 2WADA 3KX0X 4WBGA 2L0WA 1NLYA 4WEJA 3GVBA 2FZ0A 3QP6A 4PM6A 2OWHA 3E0YA 1E3UA 4CLCD 3O3VA 4E3JA 4ETZA 2DCFA 2BG1A 5GLDA 1FSYA 4IUHA 3C30A 2W1TA 4EQ1A 3UE1A 3AGFA 2R9WA 2Y2PA 2BLSA 4P6ZM 2ZC6B 1G6OA 1MC0A 1KDSA 5F1FA 4KG6A 4S2IA 4EBPA 3S7QA 2YKHA 2HV1A 3V5MA 4CQHA 4HBUA 3DWZA 5IS1A 1K56D 4D60A 4X53A 2VGLS 4I3JA 3CAXA 3MKEA 3NOTC 4HI4A 3T1XA 1NZOA 2VV6A 2EFXA 1ZTUA 1OJ5A 4FH4A 3MZEA 4HH2A 4RX2A 1YMXA 4S2OA 4EW7A 3QP4A 4MBKA 4Y0UA 5HW3A 4P6BA 4CLCC 4I38A 1UWNX 1GSXA 2JKTI 5E2FA 4FH2A 3WS2A 5CGXA 4HHDA 5FEGA 4P6ZS 2HDRA 4WYYA 2O0YA 3Q07A 4BL2A 1XGJA 3IXBA 2PYRA 1G68A 4HJ6A 5EVEA 4KQOA 4OQGA 1GCEA 1K0KA 4DE0A 4F3LB 2NUTC 5J8XA 1NZUA 3H82B 2WKRA 2Z6CA 4S2PA 2CMNA 4P85A 5JYPA 4UEYA 3UPPA 3SOIA 1SDEA 5EPHA 1ZG6A 2ZOIA 4DKIA 5HARA 2IWBA 4HEFA 1JWZA 1L2SA 4UAAA 5G4ZA 1SKFA 3CZDA 2ZC3B 2XA7M 2GDNA 5CRFA 2IWCA 3O5YA 4I3AA 2QMIA 5DF7A 1EROA 1XX2A 2A3UA 2JKRI 5I5LA 2PRFA 1VB6A 2P7JA 5KSHA 4Q8IA 3IF6B 1XJ6A 3C7VA 4K0WA 4NK3A 3C8CA 4R3BA 4XXRA 4DE1A 1VM1A 1S66L 5EVIA 3Q82A 1SHVA 3EQUA 3CHWP 1P97A 3BLMA 3T4QA 4OH0A 1LSVA 4S2JA 2C6WB 5J7EA 2OV5A 5M18A 1D1JA 3HLCA 2ZQ7A 2VZWA 2HP9A 2XA7S 3EEAA 3C38A 1NY0A 4HQAA 3ZG5A 4OPYA 3WS5A 3OC2A 1KGFA 2HDUA 3NULA 1S4RA 2H28A 2QJ5A 3ZFZA 3M6BA 1GHPA 1TDGA 3C4OA 2XD1A 4S2NC 4R3AA 2PAVP 2O99A 5KZHA 1O7EA 3G2ZA 4G3VA 4PM8A 2EXAA 3E2LA 5FAPA 4LV3A 4FUWA 3FG8A 5L07A 4Y7PA 3D9YA 4OPZA 3M6HA 5CHJA 4EUZA 2P04A 1O07A 1SKOB 2V1AA 3P7NA 1K55A 4XT2A 1F2KA 4OOMA 1FIKA 2I72A 3HUMA 1N9LA 3NC8A 3BWLA 3OPLA 1T1AA 1K57C 3PBQA 1L0EA 3HLFA 4AFIA 1KGGA 5MC7A 1XKZA 1BT5A 2A24B 1HZOA 2VKSA 2B5RA 4Q0HA 3FZCA 1GSVA 2A2LA 4S2KA 4R4RA 3IS2A 4Y17A 2OLUA 3CWFA 4JGQA 2MJ6A 2V20A 3G32A 3F1PA 1KVMA 1LLBA 1YSPA 4KG5A 3SW1A 4B9OA 2J3TD 3Q81A 1KE0A 3HLGA 1LL8A 3R7WA 1IOUA 3UB5P 3SZTA 1TS6A 5FL3A 2V1ZA 2RL3A 4KZ4A 4Q0IA 4BD0A 1Y28A 1YLZA 3FV7A 3UMDA 1E3UD 4Z9QA 4OOLA 1TS0A 4FSFA 4Y0TA 5G18A 4JKTA 4KZ9A 1LHYA 2Y2KA 5DF8A 3NCKA 5E43A 4OVDA 1TS8A 4L9EA 3BFGA 2HJEA 1STZA 5AQBA 5HAPA 2P9VB 4YINA 3PXPA 2V8CA 3T1QB 4BMWA 5A92A 3GTCA 2KDKA 4KZ7A 1XPBA 2Y2NA 4R38A 1P9RA 4EERA 1TDLA 2QJ7A 4HJ4A 1OPXA 3ZG9B 4K08A 3MKFA 4KZBA 3KYQA 3SH9A 3IT9A 1MY8A 1OTDA 3BQAA 5DJUA 2XF3A 4Y3IA 4YFMA 2AVXA 1E25A 3H9WA 3HL9A 1GA9A 1EI5A 2EXBA 4E3MA 1CF0A 2GJ3A 3UB6A 4ZJ3A 1QMFA 2FFYA 2XEPA 3V67A 5AVFA 4MEZA 2LB5A 5FEFA 4L0LA 3VFFA 5HSQA 1W79A 2GZAA 5FAQA 1D06A 2KX6A 3BFDA 2W3HA 3BFCA 1UWPX 4NG2A 4OQ0A 4BD1A 1FQGA 1P0ZA 3IH8A 3OCNA 3UPOA 1K6SA 5F68A 2EFUA 3UE3A 5HAQA 4CLCE 3IWIA 4WELA 1K4EA 1VQQA 5HX9A 1NRFA 2Y2GA 3V39A 2J80A 1J3WA 2PHYA 4H8RA 3B47A 3WRZA 3C7UA 1LL9A 2NUPC 1N9OA 3CI6A 4CLCB 3CUEA 4GLQA 1XFQA 4Y13A 3CPTB 1NYMA 3E4QA 1X0OA 3BY9A 4Y0OA 5KSCA 4LRYC 3BJNA 1NWZA 5AQ9A 4EQIA 4UQIM 3LYXA 5HAIA 2Y55A 4X56A 2Z2LB 2IA2A 3SH8A 2BASA 4WLAA 1VEUB 3QP5A 5CTMA 1Z6FA 3LEZA 4BWIA 2V0UA 5FI6A 3ITBA 2VX8A 2JC7A 4LV2A 4A5RA 5EVID 2UV0E 3W8KA 2XSSA 2DNSA 4GCZA 1IKGA 2PD7A 2EA9A 2VK3A 4PM7A 3LEQA 5FDSA 4EBNA 5IT5A 1MPLA 4GZBA 5L2FA 2A49A 4KUKA 4WZ5C 2XD5A 3BFFA 5K5BA 3A3JA 2FFFB 3TOIA 2Y91A 3F1NA 3MFXA 5GL9A 3E98A 4UQIS 4P87A 3H7WB 5GLBA 1JTDA 2D02A 2OAP1 1RGYA 4KENB 1CQAA 3HVFA 3TG9A 4LPZA 3DTEA 5FQKA 3NIAA 4CJNA 4IVIA 1H8YA 3UE0A 3GQZA 3IQAA 4JF6A 4B4XA 5EUAA 1TD5A 2W1RA 4WN5A 4IVKA 3ITAA 1ERMA 1I5QA 3WS1A 4QU3A 4JXVA 3S7OA 1PZPA 5DFYA 4OPQA 2E8IA 4DF6A 3L7HA 4NXBA 5E2GA 2XR0A 5FSRA 2G2WA 3ZG8B 3UY6A 4BQMA 3LIDA 2Y2JA 2HZ5A 1JWPA 2WGVA 1DJCA 4KUOA 3QHYA 2PBDP 3S7PA 5TGFA 5FA7A 1ZKJA 1S1YA 4EEPA 3VOLA 1ALQA 3MXRA 3VP2A 1DY6A 1PI5A 4KG2A 3A3DA 2EX8A 4RA7A 5FDHA 2GX5A 3HREA 4N92A 1VETA 4O01A 2KLIA 4GD6A 3UDFA 3IHBA 3LUQA 2H5SA 2HGVA 3N8RA 3G2YA 1JVJA 2Y79A 3VP0A 3HJIA 3MS6A 3G34A 2Z6DA 5LBRA 4ZDXA 5L09A 3JPUA 2XRNA 3CG5A 1D7EA 5FQMA 4C6YA 1AXBA 1A0KA 1XGIA 4KQQA 4DXCA 3A0RA 4IHQA 3T4JA 3N4IA 1K55C 3CMZA 3TW8A 1XJ3A 2K31A 5A91A 3Q7VB 4G3KA 1PWCA 2VLGA 2UWXA 1XFNA 4E6XA 1BZAA 1H3QA 3K3CA 3LY4A 3QP2A 4JPMA 3MQOA 3EGDC 3GDIA 2JN7A 4LRXC 1IKIA 1W63Q 4B93A 5CX7A 2WYXA 3MF0A 4MNRA 1BSGA 4UA6A 4ARZB 5F82A 5CXWA 5EE8A 1BUEA 3JVUA 3KSFA 4MN6A 1M6KA 1ONGA 1FSWA 3GSGA 3KYZA 5L10A 3RH8B 3MSHA 4EEUA 2ACGA 2Y2QA 3LIAA 3O87A
chains in the Genus database with same CATH topology
3G32A 3UO9A 1BTLA 3LO7A 5FATA 1KE4A 1KVMA 3ZVTA 4ZTKA 1LLBA 1YLWA 3OCLA 4JXSA 1L0GA 1U60A 3W4QA 4DE3A 3C4PA 4KG5A 3OZHA 1KDWA 2WKHA 4K0XA 2X02A 1KGEA 3Q81A 4QY5A 4E3KA 1KE0A 3HLGA 1YLTA 1LI9A 2ZQDA 4E3LA 2J8YA 3ZVWA 2QPNA 3HUNA 2V1ZA 2RL3A 3QNCA 4KZ4A 2XK1A 1TVFA 5HFOA 1L0DA 3SH7A 2HDQA 5EECA 4B4ZA 4BD0A 4JLFA 4K91A 4P0MA 2WKEA 4GDBA 2ZQAA 4GDNA 4R0QA 1YLZA 3FV7A 3I7JA 2H0YA 5GLCA 1N4OA 3HBRA 4IBRA 5DF9A 3VFHA 2WKIA 4CPKA 4OP5A 4F94A 4HESA 2PU2A 3BYDA 1E3UD 4Z9QA 2PBYA 4OOLA 3W4PA 4FSFA 4Y0TA 5G18A 4JKTA 4BLMA 4KZ9A 5FI2A 1ESIA 1LHYA 2Y2KA 3NCKA 5DF8A 5E43A 3A3EA 4LCMA 4OVDA 5AQAA 2C5WB 1ZG4A 3BFGA 3UN7A 2WGWA 2WZXA 3IWOA 5AQBA 5FQJA 1FR1A 5TFQA 4EV4A 1EWZA 5HAPA 2ZC5B 2P9VB 3HLDA 4YINA 3DWKA 3G35A 1K25A 1J9MA 3FKVA 1YM1A 1MWTA 5A92A 3GTCA 2EX2A 4KZ7A 1XPBA 2Y2NA 4LV0A 1BULA 3N7WA 5I94A 2J7VA 4OLGA 4M3KA 1TDLA 1YLPA 5EOEA 1CEFA 1JWVA 2EX9A 2WZZA 4ID4A 3ZG9B 4QJGA 4GOGA 3M2KA 3M2JA 3MKFA 4KZBA 1JTGA 4DRTA 1LL5A 4PPRA 4WMCA 5CERA 4S2MA 3SH9A 3IT9A 1MY8A 5GHYA 1GHMA 4RYEA 3UPNA 2HPBA 3FKWA 1IEMA 4BL3A 2JE5A 2XF3A 1PIOA 3IXHA 4YFMA 1HD8A 3PBOA 1E25A 2WUQA 3BLSA 1HTZA 3BRMA 3HL9A 4B88A 1GA9A 3ZNTA 5A90A 1EI5A 4DE2A 4N1XA 2VGKA 3WS4A 3A3IA 3ZG7B 4KZAA 4GKUA 5E2EA 3ZGAB 5DTSA 2EXBA 1ES2A 3D4FA 4E3MA 3OPHA 4X6TA 3IHAA 4GB7A 1CEGA 4ZJ3A 5IHVA 1QMFA 2P9VA 1H5XA 2Y4AA 2FFYA 2XEPA 1YLJA 2ZM8A 2H10A 2XGNA 2ZJ9A 3RXXA 3W4OA 2J9PA 4JXWA 4WZ5A 1XA1A 2WK0A 4UA9A 3VP1A 1WYBA 4XUZA 4MEZA 3PBRA 3VP3A 1ZC2A 4PM9A 4EBLA 3NDGA 4JBFA 3C5AA 5FI7A 2WADA 5M19A 3G31A 4WBGA 4L0LA 5FQ9A 3VFFA 1W79A 2V2FF 3BM6A 4WEJA 1KVLA 5FAQA 3GVBA 4MBHA 3BFDA 4OKPA 4PM6A 5DTTA 5FQQA 1E3UA 2WGWB 3BFCA 2Y2MA 3O3VA 4E3JA 3AGDA 4OQ0A 4R3JA 5DTKA 4BD1A 1FQGA 2DCFA 1YMSA 3HLWA 3IH8A 3OCNA 1PI4A 1K6SA 2EX6A 2EFUA 3P98A 2BG1A 3UE3A 3UPOA 5HAQA 1H8ZA 3MBZA 1FSYA 3A3FA 5GLDA 3MZDA 1PYYA 3IWIA 4WELA 3O86A 1BLPA 1K4EA 1VQQA 5HX9A 1BLSA 5FAOA 1FOFA 2Q9NA 1NRFA 2Y2GA 5CGSA 1MWSA 3V39A 1MWRA 4RX3A 3UE1A 4KZ3A 4OQIA 4MBFA 5GLAA 2XLNA 4OP8A 4H8RA 4JF5A 3AGFA 3MZFA 2R9WA 2Y2PA 2BLSA 3GMWA 4R23A 4UA7A 3P09A 2JBFA 3C7UA 2DRWA 3WRZA 4WEKA 2ZC6B 1LL9A 2P74A 3Q7ZA 2WAFA 3N8SA 1GA0A 1KDSA 4KZ5A 5F1FA 4S2LA 4KG6A 1CI9A 4QB8A 1PWGA 4S2IA 2XH9A 3N8LA 4EBPA 1NYMA 2QZ6A 3SS3A 3AGEA 4Y0OA 3V5MA 5KSCA 4GNUA 4HBUA 4E3NA 5AQ9A 4HBTA 4EQIA 3DWZA 4PM5A 1K56D 4R1GA 4BJPA 3DTMA 4X53A 5HAIA 3ZNYA 3RJUA 3MKEA 2Y55A 3NBLA 5A93A 1WE4A 1SCWA 1NZOA 2EFXA 3HUOA 4OLDA 2ZQ8A 4X56A 1MKIA 2Z2LB 4OOYA 2Y59A 3SH8A 2ZLYA 4FH4A 3ZHHA 5CTMA 1Z6FA 3LEZA 3MZEA 5CHUA 4DXBA 1K4FA 1Q2PA 4RX2A 5FI6A 1YMXA 2HDSA 3ITBA 4S2OA 4MBKA 1NYYA 2Z2MB 4Y0UA 3FYZA 5FQIA 2JC7A 5HW3A 4P6BA 4LV2A 3FWLA 5CTNA 2ZQCA 4A5RA 3MFDA 1CI8A 2H0TA 1K38A 5EVID 2XFTA 1W8YA 4JF4A 3W8KA 2DNSA 1IYPA 1IKGA 5E2FA 4N9LA 1XA7A 3CJMA 5CECA 4FH2A 1TEMA 3WS2A 4PM7A 5CGXA 4UHUA 4EBNA 1S0WA 1DJBA 1FCMA 3HLBA 1N9BA 2HDRA 2ZMAA 4WYYA 3Q07A 4R4SA 4BL2A 1MPLA 4GZBA 5FASA 4NETA 3EQVA 2Y2HA 3RXWA 3VMAA 1XGJA 3IXBA 3GV9A 5L2FA 1ONHA 2A49A 3WRTA 1G68A 4WZ5C 2XD5A 3BFFA 3VOZA 4KQOA 4QD4A 4S2NA 4KZ8A 3A3JA 4GD8A 4OQGA 3ZDJA 1GCEA 2FFFB 5KMWA 3TOIA 3ZG0A 2Y91A 3S1YA 3PAEA 3IH9A 5GL9A 3BEBA 4DE0A 5J8XA 1NZUA 4P87A 1W5DA 4ZBEA 1XP4A 5CHMA 1JTDA 5GLBA 1RGYA 4KQRA 4S2PA 1L0FA 4KENB 3HVFA 4P85A 5JYPA 3TG9A 5FQKA 4XUXA 3UPPA 3NIAA 1E4DA 4CJNA 3SOIA 4IVIA 1NXYA 1SDEA 2ZD8A 2ZM2A 4LV1A 5EPHA 3BFEA 1ZG6A 4U0TA 4DKIA 3BECA 5AQ7A 4X69A 5CEBA 4FD8A 1H8YA 5HARA 3UE0A 2IWBA 4WZ4A 4HEFA 2HP5A 1JWZA 1L2SA 2OLVA 3GQZA 4UAAA 2Q9MA 1SKFA 3DW0A 3E2KA 3CZDA 3IQAA 4JF6A 4N1HA 1SDNA 4QY6A 2ZC3B 2GDNA 1K56A 5CRFA 4B4XA 2PU4A 5EUAA 4OONA 2IWCA 4WMCD 5HL1A 4IVKA 3ITAA 2G2UA 1ERMA 1Y54A 3IF5A 3PBSA 4BENA 4KZ6A 2QMIA 5DF7A 1I5QA 1EROA 1XX2A 2A3UA 2X71A 4OPRA 3WS1A 4QU3A 4JXVA 1RP5A 1RCJA 1PZPA 1ESUA 1PZOA 5F1GA 3WWXA 3IF6B 1LI0A 4Q8IA 2ZQ9A 4OPQA 5KSHA 2E8IA 3C7VA 1NJ4A 4DF6A 5E2GA 2XR0A 4K0WA 1FCNA 4O7DA 3Q7VA 4NK3A 5M1AA 4GN2A 4ZJ1A 2XQZA 3IXGA 2G2WA 5FSRA 4QHCA 1G6AA 4R3BA 4XXRA 3ZG8B 3UY6A 4DE1A 1VM1A 1KE3A 4BQMA 1CK3A 2Y2JA 3GRJA 1JWPA 1W8QA 2WGVA 3HLEA 1C3BA 1ERQA 5EVIA 3Q82A 1DJCA 5GHZA 1Q2QA 3QHYA 1SHVA 2Y2LA 2J9OA 3QNBA 3EQUA 3UDIA 5TGFA 3V3SA 1YLYA 3PBTA 3S4XA 3UDXA 4MLLA 5FA7A 3OPRA 1ZKJA 3VOYA 3O88A 4ZAMA 3BLMA 3VSLA 1ALQA 3MXRA 3VP2A 4OH0A 3MXSA 4WM9A 4LCLA 1DY6A 1PI5A 2HP6A 3LY3A 4KG2A 1W7FA 4S2JA 3A3DA 2EX8A 4RA7A 5EVLA 2C6WB 1DJAA 5FDHA 4D2OA 2JCHA 5E2HA 3PTEA 3HREA 1I2WA 4JXGA 4X68A 2OSUA 2OV5A 4N92A 5M18A 1BLCA 1YQSA 1MWUA 3PBNA 4DDYA 1WYCA 4GD6A 3IF6C 4LENA 3UDFA 3HLCA 3IHBA 2ZQ7A 3SS5A 3VP4A 1PWDA 3UNWA 1ES5A 2HP9A 2H5SA 1IYSA 2CC1A 1S6RA 3OPPA 3N8RA 4ZJ2A 1NY0A 3G2YA 3IF6A 1JVJA 3VP0A 3ZG5A 4OPYA 4E3IA 2RCXA 3WS5A 5CEDA 3OC2A 1QMEA 3G34A 1KGFA 4ZDXA 2HDUA 5EOOA 3SS4A 4PMAA 1OMEA 5CGWA 5F83A 3G4PA 3V3RA 2X01A 3CG5A 5FQMA 3ZFZA 1M40A 1AXBA 1YT4A 3M6BA 4C6YA 1GHPA 1TDGA 1XGIA 3C4OA 2XD1A 2IWDA 4S2NC 3TSGA 3N6IA 4KQQA 4DXCA 4E6WA 4E3OA 5KZHA 1I2SA 5TR7A 1O7EA 3G2ZA 1ES4A 3N4IA 1K55C 2Y2OA 3CMZA 4PM8A 2EXAA 3E2LA 5FAPA 3LCEA 4LV3A 5JYOA 1PW8A 5DVAA 2XDMA 2XFSA 3Q7VB 4Y7PA 5A91A 4OPZA 3M6HA 4IEDA 5CHJA 5GHXA 4DDSA 4EUZA 4X55A 2WGIA 1O07A 4FCFA 1PWCA 4N9KA 1PW1A 4C75A 1ES3A 2UWXA 1K55A 2ZC7A 5EVIB 1IYQA 4OOMA 3JYIA 4E6XA 4RVAA 2I72A 1BZAA 3HUMA 1FR6A 1K54C 3LY4A 3NC8A 3OPLA 5U47A 4C3QA 3VSKA 2Y2IA 4U0XA 3B3XA 3V50A 1K57C 3PBQA 1L0EA 3HLFA 2ZC4B 3GR2A 1RGZA 4JPMA 1BLHA 3NI9A 1KGGA 2R9XA 1IYOA 1XKZA 1BT5A 4OQHA 4U3TA 1K54A 1MXOA 1IKIA 5D3OA 1HZOA 3NY4A 2WYXA 3S22A 2WAEA 1BSGA 2B5RA 1K57A 4MNRA 3WS0A 3ISGA 4UA6A 3FZCA 3PAGA 2VGJA 5F82A 5CXWA 1K6RA 5EE8A 1BUEA 3NDEA 1MBLA 1M6KA 4S2KA 1ONGA 1FSWA 1XXMA 4R4RA 4EWFA 5BOHA 3G30A 3GSGA 5EVIC 2OLUA 3IWQA 1FCOA 3ZCZA 4IBXA 3IXDA 2Y2QA 1IELA 2V20A 3Q1FA 3O87A 1GHIA 1HVBA 2ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G32 A;  3UO9 A;  1BTL A;  3LO7 A;  5FAT A;  1KE4 A;  1KVM A;  3ZVT A;  4ZTK A;  1LLB A;  1YLW A;  3OCL A;  4JXS A;  1L0G A;  1U60 A;  3W4Q A;  4DE3 A;  3C4P A;  4KG5 A;  3OZH A;  1KDW A;  2WKH A;  4K0X A;  2X02 A;  1KGE A;  3Q81 A;  4QY5 A;  4E3K A;  1KE0 A;  3HLG A;  1YLT A;  1LI9 A;  2ZQD A;  4E3L A;  2J8Y A;  3ZVW A;  2QPN A;  3HUN A;  2V1Z A;  2RL3 A;  3QNC A;  4KZ4 A;  2XK1 A;  1TVF A;  5HFO A;  1L0D A;  3SH7 A;  2HDQ A;  5EEC A;  4B4Z A;  4BD0 A;  4JLF A;  4K91 A;  4P0M A;  2WKE A;  4GDB A;  2ZQA A;  4GDN A;  4R0Q A;  1YLZ A;  3FV7 A;  3I7J A;  2H0Y A;  5GLC A;  1N4O A;  3HBR A;  4IBR A;  5DF9 A;  3VFH A;  2WKI A;  4CPK A;  4OP5 A;  4F94 A;  4HES A;  2PU2 A;  3BYD A;  1E3U D;  4Z9Q A;  2PBY A;  4OOL A;  3W4P A;  4FSF A;  4Y0T A;  5G18 A;  4JKT A;  4BLM A;  4KZ9 A;  5FI2 A;  1ESI A;  1LHY A;  2Y2K A;  3NCK A;  5DF8 A;  5E43 A;  3A3E A;  4LCM A;  4OVD A;  5AQA A;  2C5W B;  1ZG4 A;  3BFG A;  3UN7 A;  2WGW A;  2WZX A;  3IWO A;  5AQB A;  5FQJ A;  1FR1 A;  5TFQ A;  4EV4 A;  1EWZ A;  5HAP A;  2ZC5 B;  2P9V B;  3HLD A;  4YIN A;  3DWK A;  3G35 A;  1K25 A;  1J9M A;  3FKV A;  1YM1 A;  1MWT A;  5A92 A;  3GTC A;  2EX2 A;  4KZ7 A;  1XPB A;  2Y2N A;  4LV0 A;  1BUL A;  3N7W A;  5I94 A;  2J7V A;  4OLG A;  4M3K A;  1TDL A;  1YLP A;  5EOE A;  1CEF A;  1JWV A;  2EX9 A;  2WZZ A;  4ID4 A;  3ZG9 B;  4QJG A;  4GOG A;  3M2K A;  3M2J A;  3MKF A;  4KZB A;  1JTG A;  4DRT A;  1LL5 A;  4PPR A;  4WMC A;  5CER A;  4S2M A;  3SH9 A;  3IT9 A;  1MY8 A;  5GHY A;  1GHM A;  4RYE A;  3UPN A;  2HPB A;  3FKW A;  1IEM A;  4BL3 A;  2JE5 A;  2XF3 A;  1PIO A;  3IXH A;  4YFM A;  1HD8 A;  3PBO A;  1E25 A;  2WUQ A;  3BLS A;  1HTZ A;  3BRM A;  3HL9 A;  4B88 A;  1GA9 A;  3ZNT A;  5A90 A;  1EI5 A;  4DE2 A;  4N1X A;  2VGK A;  3WS4 A;  3A3I A;  3ZG7 B;  4KZA A;  4GKU A;  5E2E A;  3ZGA B;  5DTS A;  2EXB A;  1ES2 A;  3D4F A;  4E3M A;  3OPH A;  4X6T A;  3IHA A;  4GB7 A;  1CEG A;  4ZJ3 A;  5IHV A;  1QMF A;  2P9V A;  1H5X A;  2Y4A A;  2FFY A;  2XEP A;  1YLJ A;  2ZM8 A;  2H10 A;  2XGN A;  2ZJ9 A;  3RXX A;  3W4O A;  2J9P A;  4JXW A;  4WZ5 A;  1XA1 A;  2WK0 A;  4UA9 A;  3VP1 A;  1WYB A;  4XUZ A;  4MEZ A;  3PBR A;  3VP3 A;  1ZC2 A;  4PM9 A;  4EBL A;  3NDG A;  4JBF A;  3C5A A;  5FI7 A;  2WAD A;  5M19 A;  3G31 A;  4WBG A;  4L0L A;  5FQ9 A;  3VFF A;  1W79 A;  2V2F F;  3BM6 A;  4WEJ A;  1KVL A;  5FAQ A;  3GVB A;  4MBH A;  3BFD A;  4OKP A;  4PM6 A;  5DTT A;  5FQQ A;  1E3U A;  2WGW B;  3BFC A;  2Y2M A;  3O3V A;  4E3J A;  3AGD A;  4OQ0 A;  4R3J A;  5DTK A;  4BD1 A;  1FQG A;  2DCF A;  1YMS A;  3HLW A;  3IH8 A;  3OCN A;  1PI4 A;  1K6S A;  2EX6 A;  2EFU A;  3P98 A;  2BG1 A;  3UE3 A;  3UPO A;  5HAQ A;  1H8Z A;  3MBZ A;  1FSY A;  3A3F A;  5GLD A;  3MZD A;  1PYY A;  3IWI A;  4WEL A;  3O86 A;  1BLP A;  1K4E A;  1VQQ A;  5HX9 A;  1BLS A;  5FAO A;  1FOF A;  2Q9N A;  1NRF A;  2Y2G A;  5CGS A;  1MWS A;  3V39 A;  1MWR A;  4RX3 A;  3UE1 A;  4KZ3 A;  4OQI A;  4MBF A;  5GLA A;  2XLN A;  4OP8 A;  4H8R A;  4JF5 A;  3AGF A;  3MZF A;  2R9W A;  2Y2P A;  2BLS A;  3GMW A;  4R23 A;  4UA7 A;  3P09 A;  2JBF A;  3C7U A;  2DRW A;  3WRZ A;  4WEK A;  2ZC6 B;  1LL9 A;  2P74 A;  3Q7Z A;  2WAF A;  3N8S A;  1GA0 A;  1KDS A;  4KZ5 A;  5F1F A;  4S2L A;  4KG6 A;  1CI9 A;  4QB8 A;  1PWG A;  4S2I A;  2XH9 A;  3N8L A;  4EBP A;  1NYM A;  2QZ6 A;  3SS3 A;  3AGE A;  4Y0O A;  3V5M A;  5KSC A;  4GNU A;  4HBU A;  4E3N A;  5AQ9 A;  4HBT A;  4EQI A;  3DWZ A;  4PM5 A;  1K56 D;  4R1G A;  4BJP A;  3DTM A;  4X53 A;  5HAI A;  3ZNY A;  3RJU A;  3MKE A;  2Y55 A;  3NBL A;  5A93 A;  1WE4 A;  1SCW A;  1NZO A;  2EFX A;  3HUO A;  4OLD A;  2ZQ8 A;  4X56 A;  1MKI A;  2Z2L B;  4OOY A;  2Y59 A;  3SH8 A;  2ZLY A;  4FH4 A;  3ZHH A;  5CTM A;  1Z6F A;  3LEZ A;  3MZE A;  5CHU A;  4DXB A;  1K4F A;  1Q2P A;  4RX2 A;  5FI6 A;  1YMX A;  2HDS A;  3ITB A;  4S2O A;  4MBK A;  1NYY A;  2Z2M B;  4Y0U A;  3FYZ A;  5FQI A;  2JC7 A;  5HW3 A;  4P6B A;  4LV2 A;  3FWL A;  5CTN A;  2ZQC A;  4A5R A;  3MFD A;  1CI8 A;  2H0T A;  1K38 A;  5EVI D;  2XFT A;  1W8Y A;  4JF4 A;  3W8K A;  2DNS A;  1IYP A;  1IKG A;  5E2F A;  4N9L A;  1XA7 A;  3CJM A;  5CEC A;  4FH2 A;  1TEM A;  3WS2 A;  4PM7 A;  5CGX A;  4UHU A;  4EBN A;  1S0W A;  1DJB A;  1FCM A;  3HLB A;  1N9B A;  2HDR A;  2ZMA A;  4WYY A;  3Q07 A;  4R4S A;  4BL2 A;  1MPL A;  4GZB A;  5FAS A;  4NET A;  3EQV A;  2Y2H A;  3RXW A;  3VMA A;  1XGJ A;  3IXB A;  3GV9 A;  5L2F A;  1ONH A;  2A49 A;  3WRT A;  1G68 A;  4WZ5 C;  2XD5 A;  3BFF A;  3VOZ A;  4KQO A;  4QD4 A;  4S2N A;  4KZ8 A;  3A3J A;  4GD8 A;  4OQG A;  3ZDJ A;  1GCE A;  2FFF B;  5KMW A;  3TOI A;  3ZG0 A;  2Y91 A;  3S1Y A;  3PAE A;  3IH9 A;  5GL9 A;  3BEB A;  4DE0 A;  5J8X A;  1NZU A;  4P87 A;  1W5D A;  4ZBE A;  1XP4 A;  5CHM A;  1JTD A;  5GLB A;  1RGY A;  4KQR A;  4S2P A;  1L0F A;  4KEN B;  3HVF A;  4P85 A;  5JYP A;  3TG9 A;  5FQK A;  4XUX A;  3UPP A;  3NIA A;  1E4D A;  4CJN A;  3SOI A;  4IVI A;  1NXY A;  1SDE A;  2ZD8 A;  2ZM2 A;  4LV1 A;  5EPH A;  3BFE A;  1ZG6 A;  4U0T A;  4DKI A;  3BEC A;  5AQ7 A;  4X69 A;  5CEB A;  4FD8 A;  1H8Y A;  5HAR A;  3UE0 A;  2IWB A;  4WZ4 A;  4HEF A;  2HP5 A;  1JWZ A;  1L2S A;  2OLV A;  3GQZ A;  4UAA A;  2Q9M A;  1SKF A;  3DW0 A;  3E2K A;  3CZD A;  3IQA A;  4JF6 A;  4N1H A;  1SDN A;  4QY6 A;  2ZC3 B;  2GDN A;  1K56 A;  5CRF A;  4B4X A;  2PU4 A;  5EUA A;  4OON A;  2IWC A;  4WMC D;  5HL1 A;  4IVK A;  3ITA A;  2G2U A;  1ERM A;  1Y54 A;  3IF5 A;  3PBS A;  4BEN A;  4KZ6 A;  2QMI A;  5DF7 A;  1I5Q A;  1ERO A;  1XX2 A;  2A3U A;  2X71 A;  4OPR A;  3WS1 A;  4QU3 A;  4JXV A;  1RP5 A;  1RCJ A;  1PZP A;  1ESU A;  1PZO A;  5F1G A;  3WWX A;  3IF6 B;  1LI0 A;  4Q8I A;  2ZQ9 A;  4OPQ A;  5KSH A;  2E8I A;  3C7V A;  1NJ4 A;  4DF6 A;  5E2G A;  2XR0 A;  4K0W A;  1FCN A;  4O7D A;  3Q7V A;  4NK3 A;  5M1A A;  4GN2 A;  4ZJ1 A;  2XQZ A;  3IXG A;  2G2W A;  5FSR A;  4QHC A;  1G6A A;  4R3B A;  4XXR A;  3ZG8 B;  3UY6 A;  4DE1 A;  1VM1 A;  1KE3 A;  4BQM A;  1CK3 A;  2Y2J A;  3GRJ A;  1JWP A;  1W8Q A;  2WGV A;  3HLE A;  1C3B A;  1ERQ A;  5EVI A;  3Q82 A;  1DJC A;  5GHZ A;  1Q2Q A;  3QHY A;  1SHV A;  2Y2L A;  2J9O A;  3QNB A;  3EQU A;  3UDI A;  5TGF A;  3V3S A;  1YLY A;  3PBT A;  3S4X A;  3UDX A;  4MLL A;  5FA7 A;  3OPR A;  1ZKJ A;  3VOY A;  3O88 A;  4ZAM A;  3BLM A;  3VSL A;  1ALQ A;  3MXR A;  3VP2 A;  4OH0 A;  3MXS A;  4WM9 A;  4LCL A;  1DY6 A;  1PI5 A;  2HP6 A;  3LY3 A;  4KG2 A;  1W7F A;  4S2J A;  3A3D A;  2EX8 A;  4RA7 A;  5EVL A;  2C6W B;  1DJA A;  5FDH A;  4D2O A;  2JCH A;  5E2H A;  3PTE A;  3HRE A;  1I2W A;  4JXG A;  4X68 A;  2OSU A;  2OV5 A;  4N92 A;  5M18 A;  1BLC A;  1YQS A;  1MWU A;  3PBN A;  4DDY A;  1WYC A;  4GD6 A;  3IF6 C;  4LEN A;  3UDF A;  3HLC A;  3IHB A;  2ZQ7 A;  3SS5 A;  3VP4 A;  1PWD A;  3UNW A;  1ES5 A;  2HP9 A;  2H5S A;  1IYS A;  2CC1 A;  1S6R A;  3OPP A;  3N8R A;  4ZJ2 A;  1NY0 A;  3G2Y A;  3IF6 A;  1JVJ A;  3VP0 A;  3ZG5 A;  4OPY A;  4E3I A;  2RCX A;  3WS5 A;  5CED A;  3OC2 A;  1QME A;  3G34 A;  1KGF A;  4ZDX A;  2HDU A;  5EOO A;  3SS4 A;  4PMA A;  1OME A;  5CGW A;  5F83 A;  3G4P A;  3V3R A;  2X01 A;  3CG5 A;  5FQM A;  3ZFZ A;  1M40 A;  1AXB A;  1YT4 A;  3M6B A;  4C6Y A;  1GHP A;  1TDG A;  1XGI A;  3C4O A;  2XD1 A;  2IWD A;  4S2N C;  3TSG A;  3N6I A;  4KQQ A;  4DXC A;  4E6W A;  4E3O A;  5KZH A;  1I2S A;  5TR7 A;  1O7E A;  3G2Z A;  1ES4 A;  3N4I A;  1K55 C;  2Y2O A;  3CMZ A;  4PM8 A;  2EXA A;  3E2L A;  5FAP A;  3LCE A;  4LV3 A;  5JYO A;  1PW8 A;  5DVA A;  2XDM A;  2XFS A;  3Q7V B;  4Y7P A;  5A91 A;  4OPZ A;  3M6H A;  4IED A;  5CHJ A;  5GHX A;  4DDS A;  4EUZ A;  4X55 A;  2WGI A;  1O07 A;  4FCF A;  1PWC A;  4N9K A;  1PW1 A;  4C75 A;  1ES3 A;  2UWX A;  1K55 A;  2ZC7 A;  5EVI B;  1IYQ A;  4OOM A;  3JYI A;  4E6X A;  4RVA A;  2I72 A;  1BZA A;  3HUM A;  1FR6 A;  1K54 C;  3LY4 A;  3NC8 A;  3OPL A;  5U47 A;  4C3Q A;  3VSK A;  2Y2I A;  4U0X A;  3B3X A;  3V50 A;  1K57 C;  3PBQ A;  1L0E A;  3HLF A;  2ZC4 B;  3GR2 A;  1RGZ A;  4JPM A;  1BLH A;  3NI9 A;  1KGG A;  2R9X A;  1IYO A;  1XKZ A;  1BT5 A;  4OQH A;  4U3T A;  1K54 A;  1MXO A;  1IKI A;  5D3O A;  1HZO A;  3NY4 A;  2WYX A;  3S22 A;  2WAE A;  1BSG A;  2B5R A;  1K57 A;  4MNR A;  3WS0 A;  3ISG A;  4UA6 A;  3FZC A;  3PAG A;  2VGJ A;  5F82 A;  5CXW A;  1K6R A;  5EE8 A;  1BUE A;  3NDE A;  1MBL A;  1M6K A;  4S2K A;  1ONG A;  1FSW A;  1XXM A;  4R4R A;  4EWF A;  5BOH A;  3G30 A;  3GSG A;  5EVI C;  2OLU A;  3IWQ A;  1FCO A;  3ZCZ A;  4IBX A;  3IXD A;  2Y2Q A;  1IEL A;  2V20 A;  3Q1F A;  3O87 A;  1GHI A;  1HVB A;  2ZM0 A; 
#chains in the Genus database with same CATH topology
 1ZHH B;  4H6J B;  1KE4 A;  1YLW A;  1U60 A;  5J4E A;  2WKH A;  4K0X A;  4LFU A;  2X02 A;  1KGE A;  4E3K A;  1YLT A;  2PDR A;  3LR4 A;  2XK1 A;  2B18 A;  4P0M A;  4GDB A;  4R0Q A;  3I7J A;  1N4O A;  4CPK A;  2PU2 A;  2PBY A;  4BLM A;  5FI2 A;  2VV7 A;  2VA0 A;  3QP8 A;  2C5W B;  4KQD A;  3UN7 A;  4NXE A;  2OOL A;  4GHI B;  2WZX A;  3IWO A;  3JVV A;  5TFQ A;  1EWZ A;  3LIE A;  3HLD A;  3G35 A;  1K25 A;  4GJ4 A;  1J9M A;  4R6L A;  4LV0 A;  3N7W A;  5I94 A;  3D3O A;  1YLP A;  4MMN A;  1CEF A;  1JWV A;  2EX9 A;  2WZZ A;  4ID4 A;  5F6A A;  3M2K A;  3M2J A;  3FPW A;  3LGO A;  1MZU A;  5GHY A;  3IX8 A;  3UPN A;  2HPB A;  3T1S A;  1IEM A;  4Y15 A;  3PR6 A;  3VE3 A;  3IXH A;  2PR6 A;  2O9B A;  2W1T B;  3CLO A;  2WUQ A;  1HTZ A;  3BRM A;  4B88 A;  4DE2 A;  3WS4 A;  4NKP A;  3A3I A;  4QWO A;  3ZGA B;  2JKT M;  1ES2 A;  2GNX A;  4EUV A;  3OOV A;  4GB7 A;  1CEG A;  2Y4A A;  2QWS A;  1YLJ A;  3EGX C;  2J9P A;  1XA1 A;  1VEU A;  3MR0 A;  4XUZ A;  3PBR A;  3VP3 A;  1ZC2 A;  4JBF A;  3C5A A;  2M7V A;  5FQ9 A;  1EW0 A;  3D72 A;  3BM6 A;  1KVL A;  5FQQ A;  2WGW B;  3AGD A;  4RQ9 A;  3QP1 A;  5DTK A;  1YMS A;  3HLW A;  5TBM B;  2EX6 A;  1H8Z A;  3MBZ A;  3BY8 A;  3MZD A;  1PYY A;  4FOF A;  3O86 A;  1BLP A;  1BLS A;  5FAO A;  1FOF A;  2Q9N A;  1IFQ A;  4LRZ E;  1MWS A;  4RX3 A;  4MCW A;  4OQI A;  4PKY G;  1LT0 A;  3CUE C;  1XJ2 A;  4OP8 A;  4JF5 A;  3MZF A;  5F69 A;  4UA7 A;  3P09 A;  5HD3 A;  3MQ0 A;  4WEK A;  3Q7Z A;  1UGU A;  2WAF A;  3N8S A;  1GA0 A;  4KZ5 A;  4WF0 A;  4JGR A;  1OTB A;  4X1L A;  1PWG A;  3H7W A;  4BBT A;  2JKR M;  2K7S A;  4HH3 A;  2QZ6 A;  3SS3 A;  3AGE A;  4GNU A;  4PAU A;  4E3N A;  1Y4O A;  4R1G A;  3DTM A;  4YWZ A;  4MN5 A;  3ZNY A;  1GSW A;  2JKG A;  5A93 A;  2LB9 A;  1SCW A;  3T4T A;  2ZQ8 A;  5DFX A;  2ZBB A;  1MKI A;  2Y59 A;  2ZLY A;  4DXB A;  1K4F A;  1Q2P A;  2L4R A;  3VE4 A;  2HDS A;  2Z2M B;  3FYZ A;  5HD5 A;  3FWL A;  2ZQC A;  3MFD A;  1CI8 A;  2H0T A;  1W8Y A;  4JF4 A;  4N9L A;  3CJM A;  1W63 M;  4UHU A;  4L9F A;  1S0W A;  1DJB A;  3NEC A;  1N9B A;  3EQV A;  2Y2H A;  3RXW A;  2J3T C;  3GV9 A;  4EXO A;  1ONH A;  3WRT A;  2V0W A;  4QD4 A;  4S2N A;  4KZ8 A;  2QHK A;  1DRM A;  3PAE A;  5AVE A;  1DP9 A;  2VV8 A;  4ZBE A;  1XP4 A;  5CHM A;  2WKQ A;  4KQR A;  3NHQ A;  4QPR A;  4XUX A;  1NXY A;  2ZM2 A;  4LV1 A;  3BFE A;  4U0T A;  3MQQ A;  3BEC A;  4X1M A;  4X69 A;  2JHE A;  5CEB A;  4O8G A;  4ESP A;  2HP5 A;  2OLV A;  2Q9M A;  4QY6 A;  3E2K A;  3F1O B;  1NRJ A;  1SDN A;  3T4O A;  4PHT A;  4OON A;  4WMC D;  1Z09 A;  2W0N A;  4HOI A;  4WUJ A;  1RP5 A;  1HLU P;  1ESU A;  3TJZ C;  2V1B A;  1NJ4 A;  4O7D A;  1FCN A;  1OTA A;  3Q7V A;  5M1A A;  4GN2 A;  3IXG A;  1G6A A;  1KE3 A;  2ZOH A;  1CK3 A;  4F3L A;  1C3B A;  3H82 A;  2Y2L A;  3UDI A;  2J9O A;  3QNB A;  3TRC A;  3EWK A;  3V3S A;  1YSQ A;  3T50 A;  3PBT A;  4EET B;  3UDX A;  4MLL A;  3OPR A;  3U4L P;  3VOY A;  2JKF A;  3O88 A;  4ZAM A;  3KYE A;  4WM9 A;  4LCL A;  3LY3 A;  1BYW A;  5E2H A;  4JXG A;  4X68 A;  2OSU A;  4II7 A;  4XT2 B;  4BBV A;  1BLC A;  3PBN A;  5J3W A;  4LEN A;  4MN7 A;  4ARZ A;  3SS5 A;  1S67 L;  3NOP C;  3PYP A;  1IYS A;  1S6R A;  3PHY A;  3OPP A;  2BTF P;  4ZJ2 A;  3IF6 A;  2RCX A;  1QME A;  1H8M A;  3SS4 A;  4PMA A;  4X25 A;  5CGW A;  4H6J A;  2X01 A;  5HWW A;  1YT4 A;  3DTI A;  3TSG A;  2EWV A;  4I3I A;  1I2S A;  5TR7 A;  1ES4 A;  3KSH A;  3LCE A;  5DJT A;  5JYO A;  1PW8 A;  3NJA A;  2XDM A;  2XFS A;  5GHX A;  3F1P B;  2L1M A;  4X55 A;  2WGI A;  4FCF A;  1PW1 A;  4C75 A;  1ES3 A;  4HNB A;  2ZC7 A;  3OBF A;  1IYQ A;  3JYI A;  3T12 B;  1V9Z A;  3UME A;  3IX4 A;  1FR6 A;  1YPR A;  2Y2I A;  4U0X A;  3R7W B;  2ZC4 B;  1BLH A;  3NI9 A;  4GHI A;  1IYO A;  1K54 A;  5HDS A;  3NY4 A;  3S22 A;  5A8B A;  1NLZ A;  2WAE A;  3WS0 A;  1OT6 A;  2VGJ A;  3NDE A;  3A0S A;  1MBL A;  3KO6 A;  2INW A;  1F98 A;  4EWF A;  5C5K A;  3TE8 A;  5EVI C;  1FCO A;  4IBX A;  3GEC A;  1IEL A;  3Q1F A;  1GHI A;  4RVA A;  1BTL A;  3LO7 A;  1SKO A;  3ZVT A;  4ZTK A;  1F5M A;  1ACF A;  3OCL A;  1L0G A;  4DE3 A;  3C4P A;  2VEA A;  3OZH A;  3BW6 A;  1KDW A;  1JNU A;  1OT9 A;  3KSI A;  4QY5 A;  1T18 A;  2V9A A;  2ZQD A;  4E3L A;  3ZVW A;  3HUN A;  4IJG A;  4B4Z A;  2DMW A;  1TVF A;  5HFO A;  1L0D A;  3T1R A;  4JLF A;  4K91 A;  3T4S A;  3LI8 A;  2A24 A;  1MKM A;  2B02 A;  2ZQA A;  3HBR A;  5DF9 A;  4F94 A;  4OP5 A;  4HES A;  3BYD A;  4HP4 A;  1YAX A;  3W4P A;  2B95 A;  1ESI A;  2XRO A;  1WA9 A;  4LCM A;  3LFV A;  2ZL1 B;  5HZH A;  2WGW A;  5FQJ A;  4DMZ A;  4EV4 A;  2ZC5 B;  3DWK A;  5TBM A;  2W3D A;  3E4P A;  2EX2 A;  3ICY A;  4M3K A;  3EEH A;  4QJG A;  2VJW A;  3MJQ A;  1H0M A;  4PPR A;  4WMC A;  5CER A;  4S2M A;  4RYE A;  1SZV A;  4I5S A;  5HPF A;  2E8J A;  3OLO A;  4HP9 A;  2HF6 A;  3FPV A;  5A90 A;  4N1X A;  1TS7 A;  4WL9 A;  3VV4 A;  3ZG7 B;  4KZA A;  4GKU A;  4JGP A;  5E2E A;  4FTX A;  3G6O A;  3D4F A;  1T19 A;  2PYP A;  3UB8 A;  3OPH A;  5IHV A;  1TF1 A;  2P9V A;  1H5X A;  2ZM8 A;  3RXX A;  2XGN A;  2ZJ9 A;  4WZ5 A;  1PNE A;  1PRQ A;  2WK0 A;  2O9A A;  4DJ2 A;  3VP1 A;  1WYB A;  2K2N A;  1OTE A;  4EBL A;  5M19 A;  3G31 A;  2V2F F;  2PR5 A;  4MBH A;  5DTT A;  4OKP A;  4O0P A;  2ZMV A;  2Y2M A;  4R3J A;  1T1C A;  4I39 A;  1KOU A;  2OWJ A;  1PI4 A;  3P98 A;  1LSW A;  2YKF A;  3A3F A;  1N9N A;  4ME4 A;  5CGS A;  1MWR A;  3P01 A;  4KZ3 A;  3UE6 A;  2M7U A;  4MBF A;  5GLA A;  2EWW A;  2XLN A;  1T1B A;  3GMW A;  5G4Y A;  4R23 A;  4MDZ A;  2JBF A;  2DRW A;  2P74 A;  4S2L A;  4GS9 B;  1CI9 A;  4QB8 A;  2QKP A;  2XH9 A;  4E04 A;  3N8L A;  5L8M A;  1L3L A;  4HBT A;  4PM5 A;  3HCY A;  3MMH A;  3RJU A;  3F1N B;  3NBL A;  1FIL A;  1WE4 A;  1P9W A;  3HUO A;  3F1O A;  4OLD A;  3S7N A;  5HWV A;  4OOY A;  2R78 A;  5KIZ A;  3ZHH A;  5CHU A;  3NOU C;  2I9V A;  1NYY A;  5FQI A;  4DJ3 A;  1G5U A;  5CTN A;  1K38 A;  2XFT A;  3RFB A;  1IYP A;  5CEC A;  2O9C A;  1XA7 A;  3IX3 A;  1TEM A;  4CLC A;  4EU0 A;  2OAQ 1;  1FCM A;  3HLB A;  3CPT A;  2ZMA A;  4R4S A;  3B33 A;  4NET A;  3VMA A;  2WKP A;  4IUK A;  5TJJ A;  3U2A A;  3VOZ A;  5KMW A;  4GD8 A;  3ZDJ A;  4LGW A;  3ZG0 A;  3S1Y A;  3IH9 A;  1ODV A;  3BEB A;  1W5D A;  3C2W A;  1L0F A;  1E4D A;  2W3E A;  2ZD8 A;  5DKK A;  2QYB A;  5HWT A;  1OJG A;  5AQ7 A;  4FD8 A;  4WZ4 A;  2Y8H A;  5FAS A;  3DW0 A;  4N1H A;  1K56 A;  1VET B;  2PU4 A;  5HL1 A;  1F9I A;  2G2U A;  4ZRR A;  3IF5 A;  1Y54 A;  2KOI A;  3PBS A;  4BEN A;  4KZ6 A;  1VHM A;  2X71 A;  4OPR A;  2W3G A;  1RCJ A;  1PZO A;  5F1G A;  3WWX A;  1LI0 A;  2ZQ9 A;  1XJ4 A;  4BBU A;  3T4L A;  4ETX A;  4ZJ1 A;  2XQZ A;  3LR3 A;  4QHC A;  3GRJ A;  1W8Q A;  3HLE A;  1ERQ A;  3CIT A;  5GHZ A;  1Q2Q A;  1YLY A;  2ZMF A;  3S4X A;  3LIC A;  4YOF A;  4NXG A;  3VSL A;  4G3W A;  1LSX A;  3MXS A;  2HP6 A;  4R70 A;  1W7F A;  5EVL A;  1DJA A;  4D2O A;  2JCH A;  2V8F A;  3PTE A;  1I2W A;  2PT7 A;  4YNR A;  1YQS A;  1MWU A;  3FC7 A;  4DDY A;  1WYC A;  3IF6 C;  1CJF A;  3VP4 A;  1PWD A;  3UNW A;  1ES5 A;  5HDD A;  2CC1 A;  5CED A;  5DKL A;  4E3I A;  1PFL A;  5EOO A;  1OME A;  5F83 A;  3G4P A;  3L9K A;  3V3R A;  5IU1 A;  3A0V A;  1M40 A;  2IWD A;  3N6I A;  4E6W A;  4E3O A;  2P08 A;  3RTY A;  3K2N A;  2Y2O A;  3LIB A;  5DVA A;  4HJ3 A;  5F5Y A;  4IED A;  3E4O A;  4DDS A;  3B42 A;  4N9K A;  1DP6 A;  3ULF A;  5EVI B;  3ZYT A;  2M1C A;  1K54 C;  1V9Y A;  5U47 A;  4C3Q A;  3VSK A;  1OTI A;  3B3X A;  3V50 A;  3GR2 A;  1RGZ A;  2ZL1 A;  4DN0 A;  2R9X A;  3W2Z A;  4OQH A;  4PKY A;  4U3T A;  1MXO A;  2HJ9 C;  5D3O A;  2PD8 A;  1K57 A;  4HY8 A;  3ISG A;  3PAG A;  2W27 A;  5EFW A;  1K6R A;  4NEE D;  1G28 A;  3BQ8 A;  1AWI A;  3T4K A;  1XXM A;  5BOH A;  5EM0 A;  3G30 A;  3KSG A;  3IWQ A;  3ZCZ A;  3DTK A;  3IXD A;  3R4K A;  4BJP A;  1HVB A;  4Y5F A;  2ZM0 A;  3UO9 A;  3IBR A;  5FAT A;  4M4X A;  3UB9 A;  3LIF A;  5EV0 A;  4JXS A;  3W4Q A;  3IBJ A;  4JGO A;  3HJK A;  1LI9 A;  2J8Y A;  2QPN A;  3QNC A;  3SH7 A;  2Q0O A;  2HDQ A;  5EEC A;  4L9G A;  2WKE A;  4GDN A;  5GLC A;  3VFH A;  2H0Y A;  3LI9 A;  4IBR A;  2WKI A;  5EM1 A;  5AJG A;  1DP8 A;  3DAV A;  3A3E A;  5AQA A;  1ZG4 A;  5HDC A;  3K3D A;  1FR1 A;  1S1Z A;  3UB7 A;  3FKV A;  1YM1 A;  1MWT A;  1BUL A;  2J7V A;  4OLG A;  3LR5 A;  4HIA A;  5EOE A;  2W3F A;  3DBA A;  3EOI A;  2D01 A;  4GOG A;  3ZQ5 A;  1JTG A;  4DRT A;  1LL5 A;  3IS2 B;  1S4S A;  4Z1W A;  4EES A;  4GW9 A;  3MXQ A;  4Q0J A;  1GHM A;  3FKW A;  4BL3 A;  4GS9 A;  4Y2F A;  2JE5 A;  1PIO A;  1HD8 A;  2FH5 A;  4NXF A;  3PBO A;  3BLS A;  3ZNT A;  2VGK A;  5DTS A;  4LLO B;  2G7U A;  3LR0 A;  4X6T A;  3IHA A;  2H10 A;  5HL6 A;  3W4O A;  4JXW A;  4UA9 A;  5HPI A;  2VGL M;  4PM9 A;  1YKD A;  2J3W A;  3NDG A;  5FI7 A;  2WAD A;  3KX0 X;  4WBG A;  2L0W A;  1NLY A;  4WEJ A;  3GVB A;  2FZ0 A;  3QP6 A;  4PM6 A;  2OWH A;  3E0Y A;  1E3U A;  4CLC D;  3O3V A;  4E3J A;  4ETZ A;  2DCF A;  2BG1 A;  5GLD A;  1FSY A;  4IUH A;  3C30 A;  2W1T A;  4EQ1 A;  3UE1 A;  3AGF A;  2R9W A;  2Y2P A;  2BLS A;  4P6Z M;  2ZC6 B;  1G6O A;  1MC0 A;  1KDS A;  5F1F A;  4KG6 A;  4S2I A;  4EBP A;  3S7Q A;  2YKH A;  2HV1 A;  3V5M A;  4CQH A;  4HBU A;  3DWZ A;  5IS1 A;  1K56 D;  4D60 A;  4X53 A;  2VGL S;  4I3J A;  3CAX A;  3MKE A;  3NOT C;  4HI4 A;  3T1X A;  1NZO A;  2VV6 A;  2EFX A;  1ZTU A;  1OJ5 A;  4FH4 A;  3MZE A;  4HH2 A;  4RX2 A;  1YMX A;  4S2O A;  4EW7 A;  3QP4 A;  4MBK A;  4Y0U A;  5HW3 A;  4P6B A;  4CLC C;  4I38 A;  1UWN X;  1GSX A;  2JKT I;  5E2F A;  4FH2 A;  3WS2 A;  5CGX A;  4HHD A;  5FEG A;  4P6Z S;  2HDR A;  4WYY A;  2O0Y A;  3Q07 A;  4BL2 A;  1XGJ A;  3IXB A;  2PYR A;  1G68 A;  4HJ6 A;  5EVE A;  4KQO A;  4OQG A;  1GCE A;  1K0K A;  4DE0 A;  4F3L B;  2NUT C;  5J8X A;  1NZU A;  3H82 B;  2WKR A;  2Z6C A;  4S2P A;  2CMN A;  4P85 A;  5JYP A;  4UEY A;  3UPP A;  3SOI A;  1SDE A;  5EPH A;  1ZG6 A;  2ZOI A;  4DKI A;  5HAR A;  2IWB A;  4HEF A;  1JWZ A;  1L2S A;  4UAA A;  5G4Z A;  1SKF A;  3CZD A;  2ZC3 B;  2XA7 M;  2GDN A;  5CRF A;  2IWC A;  3O5Y A;  4I3A A;  2QMI A;  5DF7 A;  1ERO A;  1XX2 A;  2A3U A;  2JKR I;  5I5L A;  2PRF A;  1VB6 A;  2P7J A;  5KSH A;  4Q8I A;  3IF6 B;  1XJ6 A;  3C7V A;  4K0W A;  4NK3 A;  3C8C A;  4R3B A;  4XXR A;  4DE1 A;  1VM1 A;  1S66 L;  5EVI A;  3Q82 A;  1SHV A;  3EQU A;  3CHW P;  1P97 A;  3BLM A;  3T4Q A;  4OH0 A;  1LSV A;  4S2J A;  2C6W B;  5J7E A;  2OV5 A;  5M18 A;  1D1J A;  3HLC A;  2ZQ7 A;  2VZW A;  2HP9 A;  2XA7 S;  3EEA A;  3C38 A;  1NY0 A;  4HQA A;  3ZG5 A;  4OPY A;  3WS5 A;  3OC2 A;  1KGF A;  2HDU A;  3NUL A;  1S4R A;  2H28 A;  2QJ5 A;  3ZFZ A;  3M6B A;  1GHP A;  1TDG A;  3C4O A;  2XD1 A;  4S2N C;  4R3A A;  2PAV P;  2O99 A;  5KZH A;  1O7E A;  3G2Z A;  4G3V A;  4PM8 A;  2EXA A;  3E2L A;  5FAP A;  4LV3 A;  4FUW A;  3FG8 A;  5L07 A;  4Y7P A;  3D9Y A;  4OPZ A;  3M6H A;  5CHJ A;  4EUZ A;  2P04 A;  1O07 A;  1SKO B;  2V1A A;  3P7N A;  1K55 A;  4XT2 A;  1F2K A;  4OOM A;  1FIK A;  2I72 A;  3HUM A;  1N9L A;  3NC8 A;  3BWL A;  3OPL A;  1T1A A;  1K57 C;  3PBQ A;  1L0E A;  3HLF A;  4AFI A;  1KGG A;  5MC7 A;  1XKZ A;  1BT5 A;  2A24 B;  1HZO A;  2VKS A;  2B5R A;  4Q0H A;  3FZC A;  1GSV A;  2A2L A;  4S2K A;  4R4R A;  3IS2 A;  4Y17 A;  2OLU A;  3CWF A;  4JGQ A;  2MJ6 A;  2V20 A;  3G32 A;  3F1P A;  1KVM A;  1LLB A;  1YSP A;  4KG5 A;  3SW1 A;  4B9O A;  2J3T D;  3Q81 A;  1KE0 A;  3HLG A;  1LL8 A;  3R7W A;  1IOU A;  3UB5 P;  3SZT A;  1TS6 A;  5FL3 A;  2V1Z A;  2RL3 A;  4KZ4 A;  4Q0I A;  4BD0 A;  1Y28 A;  1YLZ A;  3FV7 A;  3UMD A;  1E3U D;  4Z9Q A;  4OOL A;  1TS0 A;  4FSF A;  4Y0T A;  5G18 A;  4JKT A;  4KZ9 A;  1LHY A;  2Y2K A;  5DF8 A;  3NCK A;  5E43 A;  4OVD A;  1TS8 A;  4L9E A;  3BFG A;  2HJE A;  1STZ A;  5AQB A;  5HAP A;  2P9V B;  4YIN A;  3PXP A;  2V8C A;  3T1Q B;  4BMW A;  5A92 A;  3GTC A;  2KDK A;  4KZ7 A;  1XPB A;  2Y2N A;  4R38 A;  1P9R A;  4EER A;  1TDL A;  2QJ7 A;  4HJ4 A;  1OPX A;  3ZG9 B;  4K08 A;  3MKF A;  4KZB A;  3KYQ A;  3SH9 A;  3IT9 A;  1MY8 A;  1OTD A;  3BQA A;  5DJU A;  2XF3 A;  4Y3I A;  4YFM A;  2AVX A;  1E25 A;  3H9W A;  3HL9 A;  1GA9 A;  1EI5 A;  2EXB A;  4E3M A;  1CF0 A;  2GJ3 A;  3UB6 A;  4ZJ3 A;  1QMF A;  2FFY A;  2XEP A;  3V67 A;  5AVF A;  4MEZ A;  2LB5 A;  5FEF A;  4L0L A;  3VFF A;  5HSQ A;  1W79 A;  2GZA A;  5FAQ A;  1D06 A;  2KX6 A;  3BFD A;  2W3H A;  3BFC A;  1UWP X;  4NG2 A;  4OQ0 A;  4BD1 A;  1FQG A;  1P0Z A;  3IH8 A;  3OCN A;  3UPO A;  1K6S A;  5F68 A;  2EFU A;  3UE3 A;  5HAQ A;  4CLC E;  3IWI A;  4WEL A;  1K4E A;  1VQQ A;  5HX9 A;  1NRF A;  2Y2G A;  3V39 A;  2J80 A;  1J3W A;  2PHY A;  4H8R A;  3B47 A;  3WRZ A;  3C7U A;  1LL9 A;  2NUP C;  1N9O A;  3CI6 A;  4CLC B;  3CUE A;  4GLQ A;  1XFQ A;  4Y13 A;  3CPT B;  1NYM A;  3E4Q A;  1X0O A;  3BY9 A;  4Y0O A;  5KSC A;  4LRY C;  3BJN A;  1NWZ A;  5AQ9 A;  4EQI A;  4UQI M;  3LYX A;  5HAI A;  2Y55 A;  4X56 A;  2Z2L B;  2IA2 A;  3SH8 A;  2BAS A;  4WLA A;  1VEU B;  3QP5 A;  5CTM A;  1Z6F A;  3LEZ A;  4BWI A;  2V0U A;  5FI6 A;  3ITB A;  2VX8 A;  2JC7 A;  4LV2 A;  4A5R A;  5EVI D;  2UV0 E;  3W8K A;  2XSS A;  2DNS A;  4GCZ A;  1IKG A;  2PD7 A;  2EA9 A;  2VK3 A;  4PM7 A;  3LEQ A;  5FDS A;  4EBN A;  5IT5 A;  1MPL A;  4GZB A;  5L2F A;  2A49 A;  4KUK A;  4WZ5 C;  2XD5 A;  3BFF A;  5K5B A;  3A3J A;  2FFF B;  3TOI A;  2Y91 A;  3F1N A;  3MFX A;  5GL9 A;  3E98 A;  4UQI S;  4P87 A;  3H7W B;  5GLB A;  1JTD A;  2D02 A;  2OAP 1;  1RGY A;  4KEN B;  1CQA A;  3HVF A;  3TG9 A;  4LPZ A;  3DTE A;  5FQK A;  3NIA A;  4CJN A;  4IVI A;  1H8Y A;  3UE0 A;  3GQZ A;  3IQA A;  4JF6 A;  4B4X A;  5EUA A;  1TD5 A;  2W1R A;  4WN5 A;  4IVK A;  3ITA A;  1ERM A;  1I5Q A;  3WS1 A;  4QU3 A;  4JXV A;  3S7O A;  1PZP A;  5DFY A;  4OPQ A;  2E8I A;  4DF6 A;  3L7H A;  4NXB A;  5E2G A;  2XR0 A;  5FSR A;  2G2W A;  3ZG8 B;  3UY6 A;  4BQM A;  3LID A;  2Y2J A;  2HZ5 A;  1JWP A;  2WGV A;  1DJC A;  4KUO A;  3QHY A;  2PBD P;  3S7P A;  5TGF A;  5FA7 A;  1ZKJ A;  1S1Y A;  4EEP A;  3VOL A;  1ALQ A;  3MXR A;  3VP2 A;  1DY6 A;  1PI5 A;  4KG2 A;  3A3D A;  2EX8 A;  4RA7 A;  5FDH A;  2GX5 A;  3HRE A;  4N92 A;  1VET A;  4O01 A;  2KLI A;  4GD6 A;  3UDF A;  3IHB A;  3LUQ A;  2H5S A;  2HGV A;  3N8R A;  3G2Y A;  1JVJ A;  2Y79 A;  3VP0 A;  3HJI A;  3MS6 A;  3G34 A;  2Z6D A;  5LBR A;  4ZDX A;  5L09 A;  3JPU A;  2XRN A;  3CG5 A;  1D7E A;  5FQM A;  4C6Y A;  1AXB A;  1A0K A;  1XGI A;  4KQQ A;  4DXC A;  3A0R A;  4IHQ A;  3T4J A;  3N4I A;  1K55 C;  3CMZ A;  3TW8 A;  1XJ3 A;  2K31 A;  5A91 A;  3Q7V B;  4G3K A;  1PWC A;  2VLG A;  2UWX A;  1XFN A;  4E6X A;  1BZA A;  1H3Q A;  3K3C A;  3LY4 A;  3QP2 A;  4JPM A;  3MQO A;  3EGD C;  3GDI A;  2JN7 A;  4LRX C;  1IKI A;  1W63 Q;  4B93 A;  5CX7 A;  2WYX A;  3MF0 A;  4MNR A;  1BSG A;  4UA6 A;  4ARZ B;  5F82 A;  5CXW A;  5EE8 A;  1BUE A;  3JVU A;  3KSF A;  4MN6 A;  1M6K A;  1ONG A;  1FSW A;  3GSG A;  3KYZ A;  5L10 A;  3RH8 B;  3MSH A;  4EEU A;  2ACG A;  2Y2Q A;  3LIA A;  3O87 A; 
#chains in the Genus database with same CATH homology
 3G32 A;  3UO9 A;  1BTL A;  3LO7 A;  5FAT A;  1KE4 A;  1KVM A;  3ZVT A;  4ZTK A;  1LLB A;  1YLW A;  3OCL A;  4JXS A;  1L0G A;  1U60 A;  3W4Q A;  4DE3 A;  3C4P A;  4KG5 A;  3OZH A;  1KDW A;  2WKH A;  4K0X A;  2X02 A;  1KGE A;  3Q81 A;  4QY5 A;  4E3K A;  1KE0 A;  3HLG A;  1YLT A;  1LI9 A;  2ZQD A;  4E3L A;  2J8Y A;  3ZVW A;  2QPN A;  3HUN A;  2V1Z A;  2RL3 A;  3QNC A;  4KZ4 A;  2XK1 A;  1TVF A;  5HFO A;  1L0D A;  3SH7 A;  2HDQ A;  5EEC A;  4B4Z A;  4BD0 A;  4JLF A;  4K91 A;  4P0M A;  2WKE A;  4GDB A;  2ZQA A;  4GDN A;  4R0Q A;  1YLZ A;  3FV7 A;  3I7J A;  2H0Y A;  5GLC A;  1N4O A;  3HBR A;  4IBR A;  5DF9 A;  3VFH A;  2WKI A;  4CPK A;  4OP5 A;  4F94 A;  4HES A;  2PU2 A;  3BYD A;  1E3U D;  4Z9Q A;  2PBY A;  4OOL A;  3W4P A;  4FSF A;  4Y0T A;  5G18 A;  4JKT A;  4BLM A;  4KZ9 A;  5FI2 A;  1ESI A;  1LHY A;  2Y2K A;  3NCK A;  5DF8 A;  5E43 A;  3A3E A;  4LCM A;  4OVD A;  5AQA A;  2C5W B;  1ZG4 A;  3BFG A;  3UN7 A;  2WGW A;  2WZX A;  3IWO A;  5AQB A;  5FQJ A;  1FR1 A;  5TFQ A;  4EV4 A;  1EWZ A;  5HAP A;  2ZC5 B;  2P9V B;  3HLD A;  4YIN A;  3DWK A;  3G35 A;  1K25 A;  1J9M A;  3FKV A;  1YM1 A;  1MWT A;  5A92 A;  3GTC A;  2EX2 A;  4KZ7 A;  1XPB A;  2Y2N A;  4LV0 A;  1BUL A;  3N7W A;  5I94 A;  2J7V A;  4OLG A;  4M3K A;  1TDL A;  1YLP A;  5EOE A;  1CEF A;  1JWV A;  2EX9 A;  2WZZ A;  4ID4 A;  3ZG9 B;  4QJG A;  4GOG A;  3M2K A;  3M2J A;  3MKF A;  4KZB A;  1JTG A;  4DRT A;  1LL5 A;  4PPR A;  4WMC A;  5CER A;  4S2M A;  3SH9 A;  3IT9 A;  1MY8 A;  5GHY A;  1GHM A;  4RYE A;  3UPN A;  2HPB A;  3FKW A;  1IEM A;  4BL3 A;  2JE5 A;  2XF3 A;  1PIO A;  3IXH A;  4YFM A;  1HD8 A;  3PBO A;  1E25 A;  2WUQ A;  3BLS A;  1HTZ A;  3BRM A;  3HL9 A;  4B88 A;  1GA9 A;  3ZNT A;  5A90 A;  1EI5 A;  4DE2 A;  4N1X A;  2VGK A;  3WS4 A;  3A3I A;  3ZG7 B;  4KZA A;  4GKU A;  5E2E A;  3ZGA B;  5DTS A;  2EXB A;  1ES2 A;  3D4F A;  4E3M A;  3OPH A;  4X6T A;  3IHA A;  4GB7 A;  1CEG A;  4ZJ3 A;  5IHV A;  1QMF A;  2P9V A;  1H5X A;  2Y4A A;  2FFY A;  2XEP A;  1YLJ A;  2ZM8 A;  2H10 A;  2XGN A;  2ZJ9 A;  3RXX A;  3W4O A;  2J9P A;  4JXW A;  4WZ5 A;  1XA1 A;  2WK0 A;  4UA9 A;  3VP1 A;  1WYB A;  4XUZ A;  4MEZ A;  3PBR A;  3VP3 A;  1ZC2 A;  4PM9 A;  4EBL A;  3NDG A;  4JBF A;  3C5A A;  5FI7 A;  2WAD A;  5M19 A;  3G31 A;  4WBG A;  4L0L A;  5FQ9 A;  3VFF A;  1W79 A;  2V2F F;  3BM6 A;  4WEJ A;  1KVL A;  5FAQ A;  3GVB A;  4MBH A;  3BFD A;  4OKP A;  4PM6 A;  5DTT A;  5FQQ A;  1E3U A;  2WGW B;  3BFC A;  2Y2M A;  3O3V A;  4E3J A;  3AGD A;  4OQ0 A;  4R3J A;  5DTK A;  4BD1 A;  1FQG A;  2DCF A;  1YMS A;  3HLW A;  3IH8 A;  3OCN A;  1PI4 A;  1K6S A;  2EX6 A;  2EFU A;  3P98 A;  2BG1 A;  3UE3 A;  3UPO A;  5HAQ A;  1H8Z A;  3MBZ A;  1FSY A;  3A3F A;  5GLD A;  3MZD A;  1PYY A;  3IWI A;  4WEL A;  3O86 A;  1BLP A;  1K4E A;  1VQQ A;  5HX9 A;  1BLS A;  5FAO A;  1FOF A;  2Q9N A;  1NRF A;  2Y2G A;  5CGS A;  1MWS A;  3V39 A;  1MWR A;  4RX3 A;  3UE1 A;  4KZ3 A;  4OQI A;  4MBF A;  5GLA A;  2XLN A;  4OP8 A;  4H8R A;  4JF5 A;  3AGF A;  3MZF A;  2R9W A;  2Y2P A;  2BLS A;  3GMW A;  4R23 A;  4UA7 A;  3P09 A;  2JBF A;  3C7U A;  2DRW A;  3WRZ A;  4WEK A;  2ZC6 B;  1LL9 A;  2P74 A;  3Q7Z A;  2WAF A;  3N8S A;  1GA0 A;  1KDS A;  4KZ5 A;  5F1F A;  4S2L A;  4KG6 A;  1CI9 A;  4QB8 A;  1PWG A;  4S2I A;  2XH9 A;  3N8L A;  4EBP A;  1NYM A;  2QZ6 A;  3SS3 A;  3AGE A;  4Y0O A;  3V5M A;  5KSC A;  4GNU A;  4HBU A;  4E3N A;  5AQ9 A;  4HBT A;  4EQI A;  3DWZ A;  4PM5 A;  1K56 D;  4R1G A;  4BJP A;  3DTM A;  4X53 A;  5HAI A;  3ZNY A;  3RJU A;  3MKE A;  2Y55 A;  3NBL A;  5A93 A;  1WE4 A;  1SCW A;  1NZO A;  2EFX A;  3HUO A;  4OLD A;  2ZQ8 A;  4X56 A;  1MKI A;  2Z2L B;  4OOY A;  2Y59 A;  3SH8 A;  2ZLY A;  4FH4 A;  3ZHH A;  5CTM A;  1Z6F A;  3LEZ A;  3MZE A;  5CHU A;  4DXB A;  1K4F A;  1Q2P A;  4RX2 A;  5FI6 A;  1YMX A;  2HDS A;  3ITB A;  4S2O A;  4MBK A;  1NYY A;  2Z2M B;  4Y0U A;  3FYZ A;  5FQI A;  2JC7 A;  5HW3 A;  4P6B A;  4LV2 A;  3FWL A;  5CTN A;  2ZQC A;  4A5R A;  3MFD A;  1CI8 A;  2H0T A;  1K38 A;  5EVI D;  2XFT A;  1W8Y A;  4JF4 A;  3W8K A;  2DNS A;  1IYP A;  1IKG A;  5E2F A;  4N9L A;  1XA7 A;  3CJM A;  5CEC A;  4FH2 A;  1TEM A;  3WS2 A;  4PM7 A;  5CGX A;  4UHU A;  4EBN A;  1S0W A;  1DJB A;  1FCM A;  3HLB A;  1N9B A;  2HDR A;  2ZMA A;  4WYY A;  3Q07 A;  4R4S A;  4BL2 A;  1MPL A;  4GZB A;  5FAS A;  4NET A;  3EQV A;  2Y2H A;  3RXW A;  3VMA A;  1XGJ A;  3IXB A;  3GV9 A;  5L2F A;  1ONH A;  2A49 A;  3WRT A;  1G68 A;  4WZ5 C;  2XD5 A;  3BFF A;  3VOZ A;  4KQO A;  4QD4 A;  4S2N A;  4KZ8 A;  3A3J A;  4GD8 A;  4OQG A;  3ZDJ A;  1GCE A;  2FFF B;  5KMW A;  3TOI A;  3ZG0 A;  2Y91 A;  3S1Y A;  3PAE A;  3IH9 A;  5GL9 A;  3BEB A;  4DE0 A;  5J8X A;  1NZU A;  4P87 A;  1W5D A;  4ZBE A;  1XP4 A;  5CHM A;  1JTD A;  5GLB A;  1RGY A;  4KQR A;  4S2P A;  1L0F A;  4KEN B;  3HVF A;  4P85 A;  5JYP A;  3TG9 A;  5FQK A;  4XUX A;  3UPP A;  3NIA A;  1E4D A;  4CJN A;  3SOI A;  4IVI A;  1NXY A;  1SDE A;  2ZD8 A;  2ZM2 A;  4LV1 A;  5EPH A;  3BFE A;  1ZG6 A;  4U0T A;  4DKI A;  3BEC A;  5AQ7 A;  4X69 A;  5CEB A;  4FD8 A;  1H8Y A;  5HAR A;  3UE0 A;  2IWB A;  4WZ4 A;  4HEF A;  2HP5 A;  1JWZ A;  1L2S A;  2OLV A;  3GQZ A;  4UAA A;  2Q9M A;  1SKF A;  3DW0 A;  3E2K A;  3CZD A;  3IQA A;  4JF6 A;  4N1H A;  1SDN A;  4QY6 A;  2ZC3 B;  2GDN A;  1K56 A;  5CRF A;  4B4X A;  2PU4 A;  5EUA A;  4OON A;  2IWC A;  4WMC D;  5HL1 A;  4IVK A;  3ITA A;  2G2U A;  1ERM A;  1Y54 A;  3IF5 A;  3PBS A;  4BEN A;  4KZ6 A;  2QMI A;  5DF7 A;  1I5Q A;  1ERO A;  1XX2 A;  2A3U A;  2X71 A;  4OPR A;  3WS1 A;  4QU3 A;  4JXV A;  1RP5 A;  1RCJ A;  1PZP A;  1ESU A;  1PZO A;  5F1G A;  3WWX A;  3IF6 B;  1LI0 A;  4Q8I A;  2ZQ9 A;  4OPQ A;  5KSH A;  2E8I A;  3C7V A;  1NJ4 A;  4DF6 A;  5E2G A;  2XR0 A;  4K0W A;  1FCN A;  4O7D A;  3Q7V A;  4NK3 A;  5M1A A;  4GN2 A;  4ZJ1 A;  2XQZ A;  3IXG A;  2G2W A;  5FSR A;  4QHC A;  1G6A A;  4R3B A;  4XXR A;  3ZG8 B;  3UY6 A;  4DE1 A;  1VM1 A;  1KE3 A;  4BQM A;  1CK3 A;  2Y2J A;  3GRJ A;  1JWP A;  1W8Q A;  2WGV A;  3HLE A;  1C3B A;  1ERQ A;  5EVI A;  3Q82 A;  1DJC A;  5GHZ A;  1Q2Q A;  3QHY A;  1SHV A;  2Y2L A;  2J9O A;  3QNB A;  3EQU A;  3UDI A;  5TGF A;  3V3S A;  1YLY A;  3PBT A;  3S4X A;  3UDX A;  4MLL A;  5FA7 A;  3OPR A;  1ZKJ A;  3VOY A;  3O88 A;  4ZAM A;  3BLM A;  3VSL A;  1ALQ A;  3MXR A;  3VP2 A;  4OH0 A;  3MXS A;  4WM9 A;  4LCL A;  1DY6 A;  1PI5 A;  2HP6 A;  3LY3 A;  4KG2 A;  1W7F A;  4S2J A;  3A3D A;  2EX8 A;  4RA7 A;  5EVL A;  2C6W B;  1DJA A;  5FDH A;  4D2O A;  2JCH A;  5E2H A;  3PTE A;  3HRE A;  1I2W A;  4JXG A;  4X68 A;  2OSU A;  2OV5 A;  4N92 A;  5M18 A;  1BLC A;  1YQS A;  1MWU A;  3PBN A;  4DDY A;  1WYC A;  4GD6 A;  3IF6 C;  4LEN A;  3UDF A;  3HLC A;  3IHB A;  2ZQ7 A;  3SS5 A;  3VP4 A;  1PWD A;  3UNW A;  1ES5 A;  2HP9 A;  2H5S A;  1IYS A;  2CC1 A;  1S6R A;  3OPP A;  3N8R A;  4ZJ2 A;  1NY0 A;  3G2Y A;  3IF6 A;  1JVJ A;  3VP0 A;  3ZG5 A;  4OPY A;  4E3I A;  2RCX A;  3WS5 A;  5CED A;  3OC2 A;  1QME A;  3G34 A;  1KGF A;  4ZDX A;  2HDU A;  5EOO A;  3SS4 A;  4PMA A;  1OME A;  5CGW A;  5F83 A;  3G4P A;  3V3R A;  2X01 A;  3CG5 A;  5FQM A;  3ZFZ A;  1M40 A;  1AXB A;  1YT4 A;  3M6B A;  4C6Y A;  1GHP A;  1TDG A;  1XGI A;  3C4O A;  2XD1 A;  2IWD A;  4S2N C;  3TSG A;  3N6I A;  4KQQ A;  4DXC A;  4E6W A;  4E3O A;  5KZH A;  1I2S A;  5TR7 A;  1O7E A;  3G2Z A;  1ES4 A;  3N4I A;  1K55 C;  2Y2O A;  3CMZ A;  4PM8 A;  2EXA A;  3E2L A;  5FAP A;  3LCE A;  4LV3 A;  5JYO A;  1PW8 A;  5DVA A;  2XDM A;  2XFS A;  3Q7V B;  4Y7P A;  5A91 A;  4OPZ A;  3M6H A;  4IED A;  5CHJ A;  5GHX A;  4DDS A;  4EUZ A;  4X55 A;  2WGI A;  1O07 A;  4FCF A;  1PWC A;  4N9K A;  1PW1 A;  4C75 A;  1ES3 A;  2UWX A;  1K55 A;  2ZC7 A;  5EVI B;  1IYQ A;  4OOM A;  3JYI A;  4E6X A;  4RVA A;  2I72 A;  1BZA A;  3HUM A;  1FR6 A;  1K54 C;  3LY4 A;  3NC8 A;  3OPL A;  5U47 A;  4C3Q A;  3VSK A;  2Y2I A;  4U0X A;  3B3X A;  3V50 A;  1K57 C;  3PBQ A;  1L0E A;  3HLF A;  2ZC4 B;  3GR2 A;  1RGZ A;  4JPM A;  1BLH A;  3NI9 A;  1KGG A;  2R9X A;  1IYO A;  1XKZ A;  1BT5 A;  4OQH A;  4U3T A;  1K54 A;  1MXO A;  1IKI A;  5D3O A;  1HZO A;  3NY4 A;  2WYX A;  3S22 A;  2WAE A;  1BSG A;  2B5R A;  1K57 A;  4MNR A;  3WS0 A;  3ISG A;  4UA6 A;  3FZC A;  3PAG A;  2VGJ A;  5F82 A;  5CXW A;  1K6R A;  5EE8 A;  1BUE A;  3NDE A;  1MBL A;  1M6K A;  4S2K A;  1ONG A;  1FSW A;  1XXM A;  4R4R A;  4EWF A;  5BOH A;  3G30 A;  3GSG A;  5EVI C;  2OLU A;  3IWQ A;  1FCO A;  3ZCZ A;  4IBX A;  3IXD A;  2Y2Q A;  1IEL A;  2V20 A;  3Q1F A;  3O87 A;  1GHI A;  1HVB A;  2ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...