2V20A

Structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
269
Chain Sequence
PETLVKVKDAEDQLCRTSHRPCRVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGRRGSRGIIAALGPDGKPSRIVVIYTTGSRKKTDERNRQIAEIGASLIKHWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Engineering an Allosteric Binding Site for Aminoglycosides Into Tem1-Beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 103
structure length 269
sequence length 269
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2v20A00
3BM6A 1LI9A 5I94A 4L0LA 4WBGA 4BENA 1IYPA 1QMFA 2X71A 4R4SA 5KSHA 3SH8A 4BL2A 2Z2MB 4S2OA 3GR2A 3N7WA 5EUAA 1YLYA 2ZQ7A 3O86A 3Q81A 5EECA 5CTMA 2XGNA 2X01A 2XF3A 3MXSA 3WWXA 5L2FA 4QY5A 2XR0A 3FWLA 4OP8A 4UA6A 1W79A 3ISGA 3Q07A 1N9BA 5TR7A 3W4QA 4C3QA 3DWZA 4HESA 5HARA 1K57A 4KZAA 4OLGA 5GLAA 4YINA 4A5RA 4Y0TA 4OP5A 3QNBA 3UE0A 5CGWA 3DWKA 4QU3A 2JCHA 1LLBA 1FQGA 3MZEA 1M6KA 3OPPA 4PM8A 3PBNA 1E3UD 4LENA 3SH9A 3G35A 4DDSA 3HBRA 1NZOA 2XD1A 5F83A 4X68A 3SH7A 4JXWA 2C5WB 5DTSA 5CHMA 3O3VA 2V2FF 4QB8A 4UA7A 3BEBA 3IF5A 4XUZA 3O87A 3N4IA 2ZC5B 1SKFA 4DXBA 4IVKA 3VP2A 1K4EA 1NYMA 1VQQA 5TGFA 3FZCA 5FQJA 1GHIA 1TVFA 3S22A 4B4XA 5FQ9A 5HL1A 3HLFA 4LV1A 5J8XA 3HUOA 4XXRA 5EOEA 2FFFB 3G32A 5DTKA 3FKWA 4BQMA 4KZ6A 1PW1A 4LV0A 2EFUA 3VFFA 5E2FA 2Y2LA 5M18A 4DE0A 3ZFZA 1HTZA 3IHBA 4KZ7A 4C75A 3HUMA 1BLSA 1ZG4A 1SDNA 1MWSA 3G34A 2R9XA 2OV5A 1MPLA 3IH9A 4IEDA 1ESUA 5HAIA 4P6BA 4DDYA 3IF6C 1GA0A 1W5DA 2IWBA 2J7VA 4X6TA 3OCLA 1BSGA 5GLDA 3WS2A 1YT4A 4DE1A 3SOIA 3BECA 5FQKA 2WGVA 2Y2HA 3SS4A 1HD8A 1NRFA 3G2ZA 3JYIA 5A93A 3V5MA 2OLUA 2DCFA 5EVIB 3BRMA 4OPZA 4PM9A 2HDRA 2EX8A 4WZ4A 1CK3A 1K54C 3NIAA 1XA7A 4MNRA 1GA9A 1XX2A 3HUNA 4K0XA 5DF8A 2DNSA 3C7UA 3PBRA 1KGGA 2EX2A 4IBXA 4OOYA 3BFGA 3ZG5A 3Q7VA 3MKEA 1K6RA 1YLJA 5FQMA 4P85A 1TDLA 2ZC7A 5U47A 1K4FA 2Y2NA 3E2KA 1ESIA 4S2JA 4QD4A 3ZVTA 3HVFA 5FI7A 2PU2A 4WMCA 4DE2A 3A3DA 4CPKA 2XQZA 3VP1A 1GHMA 1KVMA 3IWIA 5KMWA 1FR1A 1NXYA 4OH0A 1BT5A 4E6XA 1KE4A 1K57C 4H8RA 1RGZA 4KQOA 3IWQA 4BLMA 2PBYA 2Y2JA 1KDWA 1ES2A 2WAEA 5A92A 2J9PA 1DJBA 1Z6FA 1ZG6A 3UY6A 1I2WA 4GD6A 4X55A 1FOFA 1XP4A 3N6IA 1NZUA 3OC2A 4LV3A 5FATA 3UDXA 3C4PA 5F82A 4WEJA 3IHAA 3RXXA 4S2KA 3VMAA 4ZDXA 3VP0A 5EE8A 4Y0OA 5AQBA 4HBTA 5GLBA 5DF9A 2Y59A 3Q82A 4MBHA 1PZPA 3ZCZA 5FQIA 4JXVA 4NETA 3M6HA 3S4XA 3A3FA 1NY0A 3MXRA 1HVBA 5CGSA 2J8YA 1JTGA 1YLWA 4Z9QA 1MBLA 4FD8A 2V20A 1CI9A 2H0YA 4OQHA 1LHYA 1Q2PA 5CHUA 1XA1A 3IXDA 2EX9A 3NBLA 5HX9A 1IYSA 1WYCA 3ITBA 3ZDJA 2ZC6B 4OOLA 5FAOA 1E3UA 3V3RA 1CI8A 4KZ8A 5FAPA 4BD1A 2ZM8A 3BFEA 3FV7A 1ONHA 4WZ5A 1ES4A 1JTDA 3Q7ZA 4PMAA 3VOYA 4KQQA 3NC8A 3OCNA 3CMZA 3OPRA 3HLCA 4E6WA 4OVDA 4N9KA 2Y2IA 3FYZA 3UDFA 2X02A 1DJAA 3ZGAB 1JWVA 1NJ4A 4E3OA 4LV2A 3WS1A 1FCOA 3V3SA 1ES5A 2P9VA 4MBKA 4OLDA 4RVAA 3IF6B 4EWFA 1CEGA 4FCFA 4OPYA 3UDIA 1M40A 4GD8A 5GHYA 5IHVA 3UE3A 1FR6A 3OPLA 2XFTA 4KENB 4OPQA 1FSYA 1XXMA 5FAQA 1MXOA 4ZJ1A 5CXWA 5F1FA 4S2NC 1JWPA 2HPBA 4YFMA 5EVIA 4DE3A 4LCLA 5CGXA 4S2LA 5FDHA 1BULA 2WUQA 1S0WA 4JXGA 4OPRA 4GN2A 4N9LA 2J9OA 2Y55A 3A3EA 3ZNYA 3GV9A 1XKZA 1YLTA 2H10A 2ZQ9A 4WELA 5EVID 3D4FA 4OQIA 4KG6A 4P0MA 2DRWA 1RP5A 3MFDA 5GHXA 3QHYA 4EBNA 2WKEA 4EUZA 1RCJA 3VOZA 1Q2QA 4WYYA 1O7EA 1ZC2A 3N8SA 1IYQA 4UHUA 2UWXA 3UNWA 4DF6A 3AGDA 5F1GA 1PWGA 2WADA 4UA9A 2HP9A 5GHZA 4OOMA 3EQVA 2WZXA 2Y2GA 4MLLA 4N92A 5A90A 4KQRA 2ZJ9A 2JE5A 1ONGA 3AGEA 1MKIA 3N8RA 4X56A 3VP4A 3LO7A 4GNUA 1K56D 1ERMA 4QY6A 3HL9A 3V50A 2ZMAA 4U0XA 4B4ZA 4X69A 4S2NA 3G30A 5EPHA 5HAPA 1KE0A 1YMXA 1YM1A 1K38A 5FSRA 2QZ6A 2WGWB 1KGEA 4NK3A 2H0TA 2OSUA 3VP3A 3GVBA 2HP5A 1YQSA 1ES3A 1PW8A 4ZJ3A 2ZC4B 4RA7A 3TSGA 4RX2A 1FSWA 1XPBA 5AQ9A 4DRTA 2XH9A 3RXWA 3PAGA 4QHCA 3IXGA 2PU4A 3IXBA 2WKIA 2ZQ8A 1DY6A 3UN7A 1I2SA 3P09A 4JLFA 1L0EA 3IT9A 2VGJA 2A3UA 4F94A 3VSLA 3SS5A 3CZDA 2JC7A 1FCMA 3IXHA 3ZG9B 5HAQA 1YLZA 3BFFA 3G2YA 1MWUA 2HP6A 3DTMA 2WK0A 2XFSA 4HEFA 3ZG8B 4WZ5C 4JF5A 2WGIA 1NYYA 5AQ7A 3W4OA 5EOOA 3CG5A 2ZC3B 2I72A 4IBRA 1ALQA 2FFYA 2B5RA 2Z2LB 3OPHA 1E4DA 4GOGA 4KG2A 5D3OA 5M19A 1L2SA 5KZHA 1IEMA 4R1GA 3QNCA 3C4OA 4B88A 2G2WA 2RCXA 4RX3A 1BUEA 4FH4A 1YMSA 4KZ3A 4GB7A 4S2MA 4FH2A 3A3IA 3B3XA 5FASA 2ZQAA 1N4OA 2ZD8A 3C5AA 1XGJA 1K25A 4U0TA 5EVIC 3ZG7B 1KGFA 4C6YA 3UPNA 1W8YA 1PIOA 3WS0A 2VGKA 4LCMA 3EQUA 3GMWA 5KSCA 1JWZA 3MZFA 4BJPA 1MWRA 2BLSA 2WKHA 4PM5A 5HW3A 3HLGA 2EXBA 3PBSA 4P87A 3W8KA 3ZHHA 4CJNA 2CC1A 5E2GA 1E25A 1KVLA 4GDBA 3DW0A 2WZZA 4DXCA 4X53A 1JVJA 3Q7VB 3WRZA 1IKIA 1G68A 1WE4A 4PPRA 3I7JA 2V1ZA 3NY4A 4JKTA 2H5SA 1IYOA 1G6AA 1LI0A 3C7VA 3M2JA 1L0GA 1H8YA 3Q1FA 4WEKA 4N1XA 3HLBA 5BOHA 4OQ0A 3BYDA 4ZAMA 5E43A 4S2IA 4Y7PA 4JPMA 4KZBA 2Y91A 3RJUA 1SCWA 3PTEA 4ID4A 4R3JA 5HFOA 3UO9A 4Q8IA 2GDNA 1C3BA 2Y2MA 4R3BA 3W4PA 3BLMA 4S2PA 3M6BA 4K91A 3TG9A 4EBPA 2WAFA 4K0WA 2Y2PA 3M2KA 3UPPA 2EFXA 1K55A 4R0QA 1BTLA 4E3MA 1EROA 2WGWA 3FKVA 4Y0UA 1PZOA 4WM9A 5JYPA 1BLCA 2Q9NA 3MKFA 1BZAA 5GLCA 4E3NA 1AXBA 5CEBA 4EV4A 4ZBEA 5CERA 4KG5A 4O7DA 1XGIA 4GKUA 2Y2QA 5FI2A 1CEFA 3WS4A 5G18A 1Y54A 2C6WB 5FQQA 3ZVWA 2EX6A 1K56A 3V39A 4N1HA 1PWDA 4IVIA 4E3IA 3UPOA 4M3KA 5EVLA 4D2OA 3HREA 5JYOA 1I5QA 1RGYA 1QMEA 4R4RA 3UE1A 3AGFA 1EWZA 5AQAA 2XDMA 1L0DA 3GSGA 2IWDA 2IWCA 3HLWA 3LY3A 1LL5A 4GDNA 4EBLA 3VSKA 5FI6A 1GHPA 4QJGA 3IWOA 1IKGA 1YLPA 1S6RA 1OMEA 2G2UA 3VFHA 1GCEA 2Y2KA 2P74A 3GTCA 2XLNA 1H5XA 2QPNA 1MWTA 3LY4A 5CECA 2XK1A 1W7FA 1DJCA 1IELA 4ZJ2A 4EQIA 2P9VB 3SS3A 1EI5A 3LCEA 4E3LA 5M1AA 3G4PA 4JBFA 5DVAA 3ITAA 3BFCA 1J9MA 5A91A 4OKPA 3NCKA 1K6SA 2JBFA 2BG1A 3G31A 3IQAA 4JF6A 2XD5A 3LEZA 1LL9A 1PWCA 4KZ9A 1MY8A 1ERQA 3NDEA 1SHVA 3WRTA 4BD0A 4E3JA 1TDGA 3MZDA 4XUXA 3PAEA 3PBTA 3GQZA 1BLPA 4MEZA 2R9WA 5CTNA 2ZM2A 1KE3A 5DTTA 5FA7A 2ZM0A 5E2HA 5GL9A 5CEDA 5E2EA 4OQGA 3HLEA 3N8LA 3O88A 4ZTKA 1HZOA 3NI9A 1ZKJA 5TFQA 5CRFA 4U3TA 3WS5A 2ZQCA 1PYYA 1PI5A 2HDSA 4RYEA 3PBOA 4JF4A 3ZNTA 2Y4AA 2ZQDA 3MBZA 2QMIA 4JXSA 1W8QA 1PI4A 3GRJA 4OONA 3NDGA 1BLHA 1TEMA 4KZ4A 3OZHA 4FSFA 4UAAA 4BL3A 3IH8A 4R23A 3E2LA 2RL3A 3CJMA 1H8ZA 2OLVA 1VM1A 3S1YA 3TOIA 1U60A 3IF6A 2WYXA 4HBUA 2A49A 2EXAA 4E3KA 3PBQA 2XEPA 2Q9MA 1KDSA 2ZLYA 4PM6A 4KZ5A 1SDEA 4DKIA 4GZBA 1O07A 2E8IA 1K55C 3BLSA 4PM7A 3BFDA 3ZG0A 3HLDA 1L0FA 2HDUA 4WMCD 5CHJA 2HDQA 4MBFA 2Y2OA 5DF7A 3P98A 1WYBA 1FCNA 1K54A 3A3JA
chains in the Genus database with same CATH superfamily
1LI9A 3BQ8A 3KSFA 1IYPA 3SH8A 2Z2MB 5DJUA 3LI8A 3Q81A 3T1RA 5EECA 1PFLA 5CTMA 2ZOIA 3FWLA 1N9BA 3W4QA 2V0WA 1FILA 4KZAA 5F68A 3LR5A 2FZ0A 4OP5A 3CUEC 1A0KA 2J3TD 3MQ0A 1CF0A 2J80A 5F83A 4X68A 2PAVP 5DTSA 2K31A 2YKHA 4QB8A 5EFWA 3IF5A 4XUZA 2ZC5B 2PHYA 1NYMA 5TGFA 3S22A 5J8XA 4BQMA 2OWJA 5HDDA 3IHBA 4KZ7A 1D1JA 2VK3A 4CLCC 2INWA 4DDYA 4JGRA 4L9FA 3WS2A 1YT4A 3BECA 4BBVA 5FQKA 1D06A 1HD8A 4LRYC 2Y79A 2O0YA 2HDRA 1XA7A 4MNRA 3TRCA 3EEHA 4XT2B 2DNSA 3A0RA 3T4KA 4IBXA 5DFYA 3MKEA 1OTEA 4X1LA 5HDCA 2ZC7A 2PBDP 3ZVTA 3HVFA 4G3KA 3A3DA 4CPKA 2QHKA 3VP1A 1KVMA 5KMWA 1NXYA 5KIZA 3IWQA 2Y2JA 3S7NA 1N9OA 3UY6A 1I2WA 3OC2A 3VP0A 5J3WA 3UB7A 3Q82A 3ICYA 1PZPA 4JXVA 2PYRA 3S4XA 1T19A 1P0ZA 3D9YA 2V20A 4OQHA 1XA1A 3NBLA 3H7WB 3R7WA 4BD1A 2XROA 4PMAA 3VOYA 1DP8A 3CMZA 4E04A 2Y2IA 3ZGAB 4ARZA 1FCOA 2G7UA 2JN7A 2HV1A 3IF6B 5IHVA 3UE3A 5F1FA 1FSYA 5FAQA 4S2NC 4AFIA 4YFMA 5EVIA 1IOUA 4S2LA 1VEUA 4YOFA 1S0WA 4GN2A 2J9OA 3LICA 1V9YA 3BWLA 2DRWA 3VOZA 1O7EA 1ZC2A 2XA7S 3N8SA 2WADA 4OOMA 2KX6A 2Y2GA 4N92A 4KQRA 2ZJ9A 2I9VA 1ONGA 2BASA 1ERMA 4QY6A 2ZMAA 5HAPA 1CQAA 2MJ6A 3C38A 2WGWB 4I5SA 4NK3A 2OSUA 2HP5A 3QP4A 4ZJ3A 2ZC4B 3TSGA 4IUHA 3KSHA 4QHCA 1W63Q 3P09A 4JLFA 2VGJA 3VSLA 4Z1WA 4HJ3A 2WK0A 1OTIA 1P97A 1YPRA 2WGIA 3W4OA 3CG5A 2P08A 4ETZA 1ALQA 3CWFA 4GOGA 3K3CA 4HOIA 2W3GA 2P7JA 3DAVA 1TS7A 2RCXA 1BUEA 4I3IA 4FH4A 3UB8A 2XRNA 3VE3A 3GDIA 2ZD8A 5HD3A 1KGFA 4C6YA 3UPNA 3S7QA 3T50A 1JWZA 2K7SA 1MWRA 3LGOA 3PBSA 4P87A 3ZHHA 5E2GA 2ZL1A 1S66L 4GDBA 4DXCA 3WRZA 1IKIA 1N9LA 3NY4A 3KX0X 1TS0A 3S7PA 1G6AA 3C7VA 3M2JA 4WEKA 4GLQA 3BYDA 4KZBA 2Y91A 3PTEA 3UO9A 4IHQA 3W4PA 2Y2MA 4S2PA 2Y2PA 3M2KA 2EFXA 3T1QB 2VV8A 1PZOA 3MKFA 1BZAA 2Z6DA 4E3NA 2D02A 3UE6A 3SW1A 3U4LP 5FI2A 5G18A 3UPOA 3TJZC 5JYOA 1RGYA 1EWZA 2XDMA 1L0DA 4EBLA 3R7WB 3DTKA 2O99A 3IWOA 1IKGA 1YLPA 1LL8A 4ARZB 2XK1A 1W7FA 2VZWA 4EQIA 3CUEA 5FEGA 2WKRA 5DVAA 2A24A 3QP2A 1UWNX 4NXFA 4JF6A 3LEZA 4NXEA 5TBMA 3NDEA 4O0PA 1SHVA 3WRTA 4BD0A 1TDGA 3GQZA 1S1YA 5L8MA 2EA9A 5DTTA 1KE3A 5FA7A 5CEDA 3N8LA 1YKDA 3C2WA 3NI9A 1JNUA 3T4LA 3PBOA 2QMIA 3VOLA 1W8QA 4OONA 4CLCA 4Q0IA 3IH8A 4EEPA 2RL3A 3CJMA 1H8ZA 4HBUA 2A49A 3T1XA 2Z6CA 2ZLYA 4MDZA 1K55C 2OOLA 2V1AA 4F3LA 1WYBA 1FCNA 3A3JA 3QP5A 1YSPA 2PD7A 3CAXA 1QMFA 2HJEA 2X71A 3CPTA 4BL2A 4S2OA 4QWOA 2ZQ7A 5IU1A 4WN5A 3KYZA 2X01A 3MXSA 4OP8A 4UA6A 3ISGA 5HPFA 5HARA 4Y2FA 4YINA 2JKFA 3QNBA 4MMNA 3QP8A 5CGWA 5J4EA 1LLBA 4R3AA 1FQGA 3MZEA 1M6KA 3PBNA 5F6AA 4JXWA 3PHYA 5CHMA 3O3VA 3BEBA 2QYBA 4L9GA 1LSXA 1SKFA 3A0VA 2JKRI 4IVKA 4P6ZS 1XJ6A 4EW7A 1Y4OA 3FZCA 5FQJA 4B4XA 5FQ9A 5HL1A 2W1TB 3HUOA 2ZL1B 4FUWA 3FKWA 2EFUA 3VFFA 5M18A 2Y2LA 1P9WA 3VE4A 4DN0A 1MPLA 3IH9A 5MC7A 1ESUA 5I5LA 4P6BA 4X6TA 1BSGA 3SOIA 3JVUA 3L7HA 2WGVA 2Y2HA 2V8FA 1F98A 5A93A 3E4OA 2DCFA 3BRMA 4PKYG 2EX8A 1K54C 3NIAA 1W63M 3HUNA 5DF8A 3C7UA 2EWWA 3LYXA 4LRXC 4OOYA 3BFGA 3ZG5A 3Q7VA 1GSWA 2ZBBA 3F1NB 5FQMA 4P85A 1TDLA 4GJ4A 1ESIA 4S2JA 4QD4A 3OOVA 2PU2A 4UQIM 4WMCA 4DE2A 3PR6A 4HIAA 1FR1A 4OH0A 4E6XA 3IX3A 1K57C 5LBRA 1RGZA 4BLMA 1ES2A 5A92A 2XSSA 4X55A 3C4PA 3RXXA 3IHAA 4S2KA 5HDSA 2A24B 4MBHA 3ZCZA 1MKMA 3M6HA 3NOUC 5TBMB 3MXRA 3CI6A 3UMDA 1HVBA 2J8YA 1MBLA 1STZA 1CI9A 4Y3IA 2EX9A 3ZDJA 4OOLA 1HLUP 1E3UA 3B33A 4KZ8A 3FV7A 1S4RA 1ES4A 4KQQA 2FH5A 4UEYA 1VHMA 4OVDA 3FYZA 4CLCB 4E3OA 3F1PA 4LV2A 4OLDA 4EWFA 5GHYA 4H6JA 1FR6A 2XFTA 3SZTA 4ZJ1A 5DJTA 1MXOA 5CXWA 1JWPA 1XJ2A 2HPBA 3IX4A 4LCLA 5DKLA 4F3LB 3UMEA 1KOUA 1BULA 5HWWA 4OPRA 1YLTA 2H10A 2ZQ9A 3K3DA 2PYPA 4OQIA 4P0MA 1RP5A 3MFDA 5GHXA 1IYQA 2UWXA 3MFXA 3AGDA 5F1GA 1NLYA 2HP9A 4KUKA 2WZXA 1F2KA 3AGEA 3N8RA 4MN5A 2JKGA 3MXQA 1IFQA 3V50A 2DMWA 3FC7A 4GCZA 4U0XA 5EPHA 1GSVA 1K38A 1KGEA 3VP3A 3GVBA 1ES3A 4GHIA 2GNXA 1FSWA 5AQ9A 4DRTA 2XH9A 3RXWA 3PAGA 3IXGA 2PU4A 2WKIA 3UN7A 1I2SA 3K2NA 1L0EA 3SS5A 3CZDA 2JC7A 1FCMA 3ZG9B 3BFFA 3H82A 3G2YA 3LIAA 1CJFA 4HEFA 3ZG8B 4JF5A 4WF0A 5AQ7A 5EOOA 2ZC3B 2O9CA 4IBRA 2QWSA 4HHDA 5D3OA 5M19A 5KZHA 1IEMA 4R1GA 3QNCA 2G2WA 4FOFA 1YMSA 4KZ3A 3D72A 1NWZA 3A3IA 3B3XA 3UB5P 2ZQAA 3EOIA 1K25A 2KLIA 3BJNA 4CLCD 3GMWA 1UWPX 5KSCA 2OWHA 3W8KA 1E25A 3NOPC 3E4QA 4X53A 1JVJA 3Q7VB 2VJWA 1PRQA 4JKTA 2B18A 1J3WA 4R6LA 1LI0A 5FEFA 1H8YA 4JGPA 3Q1FA 3F1OA 1S4SA 3EGXC 3HLBA 3B42A 4OQ0A 1SCWA 4ID4A 4R3JA 5HFOA 4Q8IA 2GDNA 4R3BA 3TG9A 2WAFA 2ZMFA 1WA9A 4X1MA 1K55A 4R0QA 1X0OA 1D7EA 2V0UA 4WM9A 1BLCA 1AXBA 4BMWA 4ZBEA 5CERA 4KG5A 1XGIA 1Y54A 4ESPA 3ZVWA 4GW9A 4N1HA 1PWDA 4IVIA 4D60A 4M3KA 3HREA 1I5QA 3UE1A 1P9RA 1LL5A 1YSQA 3UB9A 5FI6A 1GHPA 1OMEA 4EEUA 3GTCA 2EWVA 1H5XA 2QPNA 1DJCA 1H8MA 3D3OA 4ZJ2A 3SS3A 4LGWA 5M1AA 4JBFA 2XA7M 3ITAA 1J9MA 4OKPA 2JBFA 2QKPA 4H6JB 3G31A 2XD5A 5IS1A 4KZ9A 1VETA 1MY8A 3PAEA 3PBTA 3S7OA 2ZM2A 2ACGA 5E2EA 3CITA 5TFQA 5DFXA 4CLCE 2PD8A 4JF4A 2J3WA 3U2AA 3ULFA 3MBZA 1PI4A 2PDRA 3NDGA 1ZHHB 4GS9A 4FSFA 3IX8A 3E2LA 2OLVA 1U60A 4ME4A 2WYXA 4E3KA 2V8CA 4BBUA 1KDSA 5HSQA 4DKIA 3BLSA 1OTDA 3T4JA 4B93A 2QJ5A 4WMCD 5CHJA 4MBFA 2Y2OA 5FL3A 5DF7A 4GHIB 1K54A 2VA0A 3BM6A 4BENA 4R4SA 3BY9A 2VX8A 3N7WA 5EUAA 1YLYA 3H82B 2NUPC 2XGNA 3LIBA 4BBTA 1OPXA 4QY5A 2XR0A 4Q0HA 1W79A 5TR7A 3C30A 4I39A 5EV0A 3FPVA 4C3QA 3LUQA 2Q0OA 1K57A 5GLAA 3T12B 4Y0TA 3UE0A 3DWKA 2JCHA 3OPPA 1E3UD 1OTAA 4DDSA 3HBRA 4I3JA 2C5WB 4L9EA 2V2FF 4UA7A 3LI9A 4HP9A 3O87A 3N4IA 2QJ7A 4HI4A 4DXBA 3VP2A 1K4EA 2H28A 3E4PA 1TVFA 4LV1A 4DJ2A 4XXRA 3IS2A 2FFFB 3G32A 1TD5A 4EXOA 1OT9A 3LIEA 5E2FA 2K2NA 3L9KA 4DE0A 3ZFZA 4C75A 3MMHA 1MWSA 3G34A 2R9XA 3MR0A 4KUOA 5HAIA 3F1OB 1GA0A 1W5DA 2J7VA 1NRJA 3OCLA 5GLDA 3SS4A 3O5YA 2OLUA 5EVIB 3V5MA 4OPZA 4PM9A 4O01A 4WZ4A 1VEUB 1S67L 2EX2A 2W3FA 4BWIA 4NG2A 5U47A 5AJGA 1K4FA 3ZQ5A 1OTBA 4HJ6A 5G4ZA 5FI7A 2WKPA 2JKTI 1GHMA 1N9NA 4DJ3A 4I3AA 1KE4A 3BY8A 4YNRA 2PBYA 2WAEA 2J9PA 1DJBA 1Z6FA 1ZG6A 4MN6A 1XP4A 3N6IA 1NZUA 5EM0A 4WEJA 3KSGA 5EE8A 5GLBA 4NETA 2PRFA 1EW0A 1NY0A 5CGSA 1YLWA 3CHWP 1SKOA 1LHYA 5EM1A 5CHUA 2ZMVA 3IXDA 1IYSA 1WYCA 2BTFP 2ZC6B 1XFQA 5FAOA 2JHEA 1CI8A 2ZM8A 1ONHA 3Q7ZA 4DMZA 3OCNA 3HLCA 3C8CA 4JGQA 1DJAA 3QP1A 1JWVA 4RQ9A 4EESA 1VB6A 2D01A 3V3SA 2P9VA 4MBKA 4RVAA 4FCFA 2B95A 4OPQA 2E8JA 1TS8A 4DE3A 4HNBA 2A2LA 4FTXA 4XT2A 4N9LA 3A3EA 2LB9A 3GV9A 1XKZA 2W1RA 5EVID 3D4FA 1DP9A 1MZUA 3QP6A 4EBNA 4X25A 3G6OA 1RCJA 3FPWA 3UNWA 4P6ZM 4DF6A 2LB5A 4Y15A 5HL6A 4UA9A 1G6OA 5GHZA 3EQVA 4MLLA 5A90A 4X56A 3VP4A 3LO7A 4GNUA 3HL9A 3RTYA 4X69A 4S2NA 3G30A 1YM1A 2QZ6A 2H0TA 2M7VA 5L10A 3E98A 4PKYA 4RA7A 1XPBA 2ZQ8A 4EETB 3EGDC 4F94A 2A3UA 2J3TC 3IXHA 2VGLS 3IS2B 3DTMA 4WZ5C 2O9BA 3E0YA 2I72A 2B5RA 1E4DA 3KO6A 3IBJA 3OLOA 3KSIA 4B88A 4RX3A 1ACFA 1F5MA 3JPUA 4GB7A 4S2MA 5F69A 1Y28A 4FH2A 5FASA 4U0TA 5FDSA 1W8YA 3WS0A 2VGKA 4LCMA 3EQUA 1G28A 3MZFA 2BLSA 2WKHA 3CLOA 2OAQ1 2PT7A 5HW3A 2EXBA 2CC1A 4ZRRA 3DW0A 5K5BA 1G68A 2V1ZA 2H5SA 4EQ1A 3MJQA 4LPZA 3EWKA 4N1XA 4CQHA 2HF6A 5BOHA 4I38A 5E43A 4S2IA 4Y7PA 1K0KA 3RJUA 3MQQA 3BLMA 3OBFA 4HP4A 3W2ZA 5IT5A 4K0WA 3UPPA 4LFUA 1BTLA 2WGWA 3FKVA 4Y0UA 5JYPA 2Q9NA 4O7DA 3CPTB 4GKUA 5CX7A 5FQQA 1K56A 1SKOB 4II7A 1XJ4A 3EEAA 5EVLA 4D2OA 3NECA 1QMEA 3AGFA 5AQAA 2IWDA 3HLWA 4GDNA 1LT0A 3VSKA 4QJGA 1S6RA 2G2UA 1XFNA 1GCEA 2Y2KA 5CECA 1IELA 2P9VB 1EI5A 3LCEA 4E3LA 3BFCA 3LR3A 2BG1A 3MZDA 1DP6A 1BLPA 4MEZA 5CTNA 2CMNA 5E2HA 5GL9A 1HZOA 4U3TA 3WS5A 2ZQCA 1PYYA 2VEAA 3RH8B 2Y4AA 2ZQDA 4JXSA 3GRJA 4UAAA 1BLHA 1TEMA 3OZHA 3MQOA 2GZAA 4IUKA 3TOIA 3S1YA 5EVEA 3UB6A 2EXAA 2Q9MA 1SDEA 4GZBA 4PM7A 3BFDA 3LFVA 1L0FA 2HDUA 3KYEA 2WKQA 1FIKA 3P98A 5HPIA 4Y5FA 5AVEA 4PAUA 2B02A 5I94A 4L0LA 4WBGA 2VLGA 5KSHA 1ODVA 3GR2A 3O86A 4YWZA 5TJJA 1YAXA 3LEQA 4HJ4A 2XF3A 4MN7A 3WWXA 5L2FA 3Q07A 3HJIA 2YKFA 3LR4A 3DWZA 1ZTUA 4HESA 2V1BA 4OLGA 3VV4A 1T1BA 4A5RA 4QU3A 2O9AA 2UV0E 2KOIA 4PM8A 2NUTC 4LENA 3SH9A 1OJ5A 3G35A 1NZOA 2XD1A 1V9ZA 3SH7A 2GX5A 3MS6A 1VQQA 4KQDA 1GHIA 5AVFA 3HLFA 3LIDA 5EOEA 4NXGA 5DTKA 4EU0A 4KZ6A 1PW1A 3A0SA 4LV0A 1HTZA 3HUMA 1BLSA 1XJ3A 1SDNA 1ZG4A 3P7NA 4Y17A 5F5YA 2OV5A 4IEDA 3H9WA 3F1PB 2HGVA 3IF6C 2IWBA 1OT6A 1MC0A 4DE1A 1NRFA 3G2ZA 3JYIA 2W0NA 2PR6A 4IJGA 5HWTA 1CK3A 1GA9A 4ETXA 1XX2A 4K0XA 3PBRA 1KGGA 1T18A 1K6RA 1YLJA 3R4KA 1UGUA 2Y2NA 3E2KA 3MSHA 3IBRA 5DKKA 3NULA 3V67A 1T1AA 2XQZA 3IWIA 2L0WA 1BT5A 4H8RA 4KQOA 1KDWA 4PM5A 4GD6A 3GECA 1FOFA 4LV3A 5FATA 3UDXA 2ZOHA 5F82A 3VMAA 4ZDXA 4Y0OA 5AQBA 4HBTA 5DF9A 2Y59A 5FQIA 3A3FA 5L09A 4Z9QA 1JTGA 4FD8A 1L3LA 2H0YA 1PNEA 1Q2PA 2V9AA 5HX9A 3ITBA 2W1TA 3V3RA 5FAPA 3BFEA 4WZ5A 1JTDA 2W3EA 3NC8A 3OPRA 4E6WA 4N9KA 3UDFA 2X02A 1NJ4A 2Y8HA 3T4QA 3WS1A 1TF1A 1OJGA 1ES5A 1CEGA 4NXBA 4OPYA 3UDIA 1M40A 4GD8A 3OPLA 4KENB 1XXMA 3T1SA 2M1CA 1DRMA 4PHTA 3PXPA 5CGXA 5FDHA 2VV6A 2WUQA 1SZVA 2W3DA 4JXGA 2Y55A 4G3WA 3ZNYA 3B47A 4WELA 3F1NA 4KG6A 3QHYA 2WKEA 4EUZA 1Q2QA 1S1ZA 4WYYA 2W3HA 4UHUA 3TE8A 1PWGA 2AVXA 4O8GA 3LR0A 2JE5A 1MKIA 2P04A 1K56D 4B4ZA 1KE0A 1YMXA 5FSRA 3BQAA 4R70A 1YQSA 1PW8A 4RX2A 1H3QA 1BYWA 3HJKA 4EERA 3IXBA 1DY6A 3IT9A 3DBAA 5HAQA 2M7UA 1YLZA 1MWUA 4LRZE 2HP6A 3T4TA 2XFSA 4NKPA 1LSVA 1NYYA 4NEED 3RFBA 2FFYA 2W27A 2Z2LB 3OPHA 4KG2A 2IA2A 4HH3A 1L2SA 1G5UA 3C4OA 5HZHA 3MF0A 5HWVA 4M4XA 1GSXA 2L4RA 1AWIA 1N4OA 3C5AA 3NJAA 1VETB 1XGJA 4EUVA 1Z09A 5EVIC 1NLZA 3ZG7B 3P01A 1PIOA 4BJPA 1TS6A 3HLGA 4CJNA 3T4SA 1KVLA 2WZZA 4PPRA 1WE4A 3I7JA 2GJ3A 1IYOA 4GS9B 4JGOA 1L0GA 4Q0JA 3ZYTA 3T4OA 4MCWA 3FG8A 4ZAMA 5G4YA 4JPMA 5HD5A 2HZ5A 5A8BA 1C3BA 3M6BA 4K91A 4EBPA 4HH2A 4E3MA 3NHQA 1EROA 2KDKA 2VKSA 5GLCA 5CEBA 4EV4A 3DTEA 3TW8A 2L1MA 2Y2QA 1CEFA 3WS4A 3BW6A 2C6WB 4LLOB 2EX6A 3V39A 4R38A 4K08A 4E3IA 2VV7A 4R4RA 2JKTM 3GSGA 3LY3A 2IWCA 3JVVA 4QPRA 3VFHA 2P74A 2XLNA 1MWTA 3LY4A 4Y13A 4G3VA 5J7EA 3G4PA 5A91A 3LIFA 5L07A 3NCKA 1K6SA 3IQAA 1LL9A 1PWCA 1ERQA 4E3JA 3KYQA 4XUXA 4HQAA 4B9OA 4UQIS 2R9WA 2OAP1 2ZM0A 1T1CA 4HY8A 1F9IA 4WUJA 4OQGA 3HLEA 4ZTKA 3O88A 1LSWA 1ZKJA 3H7WA 5CRFA 1PI5A 3NOTC 3DTIA 2HDSA 4RYEA 3ZNTA 2R78A 4KZ4A 4WL9A 5C5KA 4BL3A 2PR5A 4R23A 2VGLM 1VM1A 3IF6A 3HCYA 3PBQA 2XEPA 4PM6A 4KZ5A 1H0MA 4WLAA 1O07A 2E8IA 2HJ9C 3PYPA 3HLDA 3ZG0A 2JKRM 2HDQA
chains in the Genus database with same CATH topology
3BM6A 1LI9A 5I94A 4L0LA 4WBGA 4BENA 1IYPA 1QMFA 2X71A 4R4SA 5KSHA 3SH8A 4BL2A 2Z2MB 4S2OA 3GR2A 3N7WA 5EUAA 1YLYA 2ZQ7A 3O86A 3Q81A 5EECA 5CTMA 2XGNA 2X01A 2XF3A 3MXSA 3WWXA 5L2FA 4QY5A 2XR0A 3FWLA 4OP8A 4UA6A 1W79A 3ISGA 3Q07A 1N9BA 5TR7A 3W4QA 4C3QA 3DWZA 4HESA 5HARA 1K57A 4KZAA 4OLGA 5GLAA 4YINA 4A5RA 4Y0TA 4OP5A 3QNBA 3UE0A 5CGWA 3DWKA 4QU3A 2JCHA 1LLBA 1FQGA 3MZEA 1M6KA 3OPPA 4PM8A 3PBNA 1E3UD 4LENA 3SH9A 3G35A 4DDSA 3HBRA 1NZOA 2XD1A 5F83A 4X68A 3SH7A 4JXWA 2C5WB 5DTSA 5CHMA 3O3VA 2V2FF 4QB8A 4UA7A 3BEBA 3IF5A 4XUZA 3O87A 3N4IA 2ZC5B 1SKFA 4DXBA 4IVKA 3VP2A 1K4EA 1NYMA 1VQQA 5TGFA 3FZCA 5FQJA 1GHIA 1TVFA 3S22A 4B4XA 5FQ9A 5HL1A 3HLFA 4LV1A 5J8XA 3HUOA 4XXRA 5EOEA 2FFFB 3G32A 5DTKA 3FKWA 4BQMA 4KZ6A 1PW1A 4LV0A 2EFUA 3VFFA 5E2FA 2Y2LA 5M18A 4DE0A 3ZFZA 1HTZA 3IHBA 4KZ7A 4C75A 3HUMA 1BLSA 1ZG4A 1SDNA 1MWSA 3G34A 2R9XA 2OV5A 1MPLA 3IH9A 4IEDA 1ESUA 5HAIA 4P6BA 4DDYA 3IF6C 1GA0A 1W5DA 2IWBA 2J7VA 4X6TA 3OCLA 1BSGA 5GLDA 3WS2A 1YT4A 4DE1A 3SOIA 3BECA 5FQKA 2WGVA 2Y2HA 3SS4A 1HD8A 1NRFA 3G2ZA 3JYIA 5A93A 3V5MA 2OLUA 2DCFA 5EVIB 3BRMA 4OPZA 4PM9A 2HDRA 2EX8A 4WZ4A 1CK3A 1K54C 3NIAA 1XA7A 4MNRA 1GA9A 1XX2A 3HUNA 4K0XA 5DF8A 2DNSA 3C7UA 3PBRA 1KGGA 2EX2A 4IBXA 4OOYA 3BFGA 3ZG5A 3Q7VA 3MKEA 1K6RA 1YLJA 5FQMA 4P85A 1TDLA 2ZC7A 5U47A 1K4FA 2Y2NA 3E2KA 1ESIA 4S2JA 4QD4A 3ZVTA 3HVFA 5FI7A 2PU2A 4WMCA 4DE2A 3A3DA 4CPKA 2XQZA 3VP1A 1GHMA 1KVMA 3IWIA 5KMWA 1FR1A 1NXYA 4OH0A 1BT5A 4E6XA 1KE4A 1K57C 4H8RA 1RGZA 4KQOA 3IWQA 4BLMA 2PBYA 2Y2JA 1KDWA 1ES2A 2WAEA 5A92A 2J9PA 1DJBA 1Z6FA 1ZG6A 3UY6A 1I2WA 4GD6A 4X55A 1FOFA 1XP4A 3N6IA 1NZUA 3OC2A 4LV3A 5FATA 3UDXA 3C4PA 5F82A 4WEJA 3IHAA 3RXXA 4S2KA 3VMAA 4ZDXA 3VP0A 5EE8A 4Y0OA 5AQBA 4HBTA 5GLBA 5DF9A 2Y59A 3Q82A 4MBHA 1PZPA 3ZCZA 5FQIA 4JXVA 4NETA 3M6HA 3S4XA 3A3FA 1NY0A 3MXRA 1HVBA 5CGSA 2J8YA 1JTGA 1YLWA 4Z9QA 1MBLA 4FD8A 2V20A 1CI9A 2H0YA 4OQHA 1LHYA 1Q2PA 5CHUA 1XA1A 3IXDA 2EX9A 3NBLA 5HX9A 1IYSA 1WYCA 3ITBA 3ZDJA 2ZC6B 4OOLA 5FAOA 1E3UA 3V3RA 1CI8A 4KZ8A 5FAPA 4BD1A 2ZM8A 3BFEA 3FV7A 1ONHA 4WZ5A 1ES4A 1JTDA 3Q7ZA 4PMAA 3VOYA 4KQQA 3NC8A 3OCNA 3CMZA 3OPRA 3HLCA 4E6WA 4OVDA 4N9KA 2Y2IA 3FYZA 3UDFA 2X02A 1DJAA 3ZGAB 1JWVA 1NJ4A 4E3OA 4LV2A 3WS1A 1FCOA 3V3SA 1ES5A 2P9VA 4MBKA 4OLDA 4RVAA 3IF6B 4EWFA 1CEGA 4FCFA 4OPYA 3UDIA 1M40A 4GD8A 5GHYA 5IHVA 3UE3A 1FR6A 3OPLA 2XFTA 4KENB 4OPQA 1FSYA 1XXMA 5FAQA 1MXOA 4ZJ1A 5CXWA 5F1FA 4S2NC 1JWPA 2HPBA 4YFMA 5EVIA 4DE3A 4LCLA 5CGXA 4S2LA 5FDHA 1BULA 2WUQA 1S0WA 4JXGA 4OPRA 4GN2A 4N9LA 2J9OA 2Y55A 3A3EA 3ZNYA 3GV9A 1XKZA 1YLTA 2H10A 2ZQ9A 4WELA 5EVID 3D4FA 4OQIA 4KG6A 4P0MA 2DRWA 1RP5A 3MFDA 5GHXA 3QHYA 4EBNA 2WKEA 4EUZA 1RCJA 3VOZA 1Q2QA 4WYYA 1O7EA 1ZC2A 3N8SA 1IYQA 4UHUA 2UWXA 3UNWA 4DF6A 3AGDA 5F1GA 1PWGA 2WADA 4UA9A 2HP9A 5GHZA 4OOMA 3EQVA 2WZXA 2Y2GA 4MLLA 4N92A 5A90A 4KQRA 2ZJ9A 2JE5A 1ONGA 3AGEA 1MKIA 3N8RA 4X56A 3VP4A 3LO7A 4GNUA 1K56D 1ERMA 4QY6A 3HL9A 3V50A 2ZMAA 4U0XA 4B4ZA 4X69A 4S2NA 3G30A 5EPHA 5HAPA 1KE0A 1YMXA 1YM1A 1K38A 5FSRA 2QZ6A 2WGWB 1KGEA 4NK3A 2H0TA 2OSUA 3VP3A 3GVBA 2HP5A 1YQSA 1ES3A 1PW8A 4ZJ3A 2ZC4B 4RA7A 3TSGA 4RX2A 1FSWA 1XPBA 5AQ9A 4DRTA 2XH9A 3RXWA 3PAGA 4QHCA 3IXGA 2PU4A 3IXBA 2WKIA 2ZQ8A 1DY6A 3UN7A 1I2SA 3P09A 4JLFA 1L0EA 3IT9A 2VGJA 2A3UA 4F94A 3VSLA 3SS5A 3CZDA 2JC7A 1FCMA 3IXHA 3ZG9B 5HAQA 1YLZA 3BFFA 3G2YA 1MWUA 2HP6A 3DTMA 2WK0A 2XFSA 4HEFA 3ZG8B 4WZ5C 4JF5A 2WGIA 1NYYA 5AQ7A 3W4OA 5EOOA 3CG5A 2ZC3B 2I72A 4IBRA 1ALQA 2FFYA 2B5RA 2Z2LB 3OPHA 1E4DA 4GOGA 4KG2A 5D3OA 5M19A 1L2SA 5KZHA 1IEMA 4R1GA 3QNCA 3C4OA 4B88A 2G2WA 2RCXA 4RX3A 1BUEA 4FH4A 1YMSA 4KZ3A 4GB7A 4S2MA 4FH2A 3A3IA 3B3XA 5FASA 2ZQAA 1N4OA 2ZD8A 3C5AA 1XGJA 1K25A 4U0TA 5EVIC 3ZG7B 1KGFA 4C6YA 3UPNA 1W8YA 1PIOA 3WS0A 2VGKA 4LCMA 3EQUA 3GMWA 5KSCA 1JWZA 3MZFA 4BJPA 1MWRA 2BLSA 2WKHA 4PM5A 5HW3A 3HLGA 2EXBA 3PBSA 4P87A 3W8KA 3ZHHA 4CJNA 2CC1A 5E2GA 1E25A 1KVLA 4GDBA 3DW0A 2WZZA 4DXCA 4X53A 1JVJA 3Q7VB 3WRZA 1IKIA 1G68A 1WE4A 4PPRA 3I7JA 2V1ZA 3NY4A 4JKTA 2H5SA 1IYOA 1G6AA 1LI0A 3C7VA 3M2JA 1L0GA 1H8YA 3Q1FA 4WEKA 4N1XA 3HLBA 5BOHA 4OQ0A 3BYDA 4ZAMA 5E43A 4S2IA 4Y7PA 4JPMA 4KZBA 2Y91A 3RJUA 1SCWA 3PTEA 4ID4A 4R3JA 5HFOA 3UO9A 4Q8IA 2GDNA 1C3BA 2Y2MA 4R3BA 3W4PA 3BLMA 4S2PA 3M6BA 4K91A 3TG9A 4EBPA 2WAFA 4K0WA 2Y2PA 3M2KA 3UPPA 2EFXA 1K55A 4R0QA 1BTLA 4E3MA 1EROA 2WGWA 3FKVA 4Y0UA 1PZOA 4WM9A 5JYPA 1BLCA 2Q9NA 3MKFA 1BZAA 5GLCA 4E3NA 1AXBA 5CEBA 4EV4A 4ZBEA 5CERA 4KG5A 4O7DA 1XGIA 4GKUA 2Y2QA 5FI2A 1CEFA 3WS4A 5G18A 1Y54A 2C6WB 5FQQA 3ZVWA 2EX6A 1K56A 3V39A 4N1HA 1PWDA 4IVIA 4E3IA 3UPOA 4M3KA 5EVLA 4D2OA 3HREA 5JYOA 1I5QA 1RGYA 1QMEA 4R4RA 3UE1A 3AGFA 1EWZA 5AQAA 2XDMA 1L0DA 3GSGA 2IWDA 2IWCA 3HLWA 3LY3A 1LL5A 4GDNA 4EBLA 3VSKA 5FI6A 1GHPA 4QJGA 3IWOA 1IKGA 1YLPA 1S6RA 1OMEA 2G2UA 3VFHA 1GCEA 2Y2KA 2P74A 3GTCA 2XLNA 1H5XA 2QPNA 1MWTA 3LY4A 5CECA 2XK1A 1W7FA 1DJCA 1IELA 4ZJ2A 4EQIA 2P9VB 3SS3A 1EI5A 3LCEA 4E3LA 5M1AA 3G4PA 4JBFA 5DVAA 3ITAA 3BFCA 1J9MA 5A91A 4OKPA 3NCKA 1K6SA 2JBFA 2BG1A 3G31A 3IQAA 4JF6A 2XD5A 3LEZA 1LL9A 1PWCA 4KZ9A 1MY8A 1ERQA 3NDEA 1SHVA 3WRTA 4BD0A 4E3JA 1TDGA 3MZDA 4XUXA 3PAEA 3PBTA 3GQZA 1BLPA 4MEZA 2R9WA 5CTNA 2ZM2A 1KE3A 5DTTA 5FA7A 2ZM0A 5E2HA 5GL9A 5CEDA 5E2EA 4OQGA 3HLEA 3N8LA 3O88A 4ZTKA 1HZOA 3NI9A 1ZKJA 5TFQA 5CRFA 4U3TA 3WS5A 2ZQCA 1PYYA 1PI5A 2HDSA 4RYEA 3PBOA 4JF4A 3ZNTA 2Y4AA 2ZQDA 3MBZA 2QMIA 4JXSA 1W8QA 1PI4A 3GRJA 4OONA 3NDGA 1BLHA 1TEMA 4KZ4A 3OZHA 4FSFA 4UAAA 4BL3A 3IH8A 4R23A 3E2LA 2RL3A 3CJMA 1H8ZA 2OLVA 1VM1A 3S1YA 3TOIA 1U60A 3IF6A 2WYXA 4HBUA 2A49A 2EXAA 4E3KA 3PBQA 2XEPA 2Q9MA 1KDSA 2ZLYA 4PM6A 4KZ5A 1SDEA 4DKIA 4GZBA 1O07A 2E8IA 1K55C 3BLSA 4PM7A 3BFDA 3ZG0A 3HLDA 1L0FA 2HDUA 4WMCD 5CHJA 2HDQA 4MBFA 2Y2OA 5DF7A 3P98A 1WYBA 1FCNA 1K54A 3A3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BM6 A;  1LI9 A;  5I94 A;  4L0L A;  4WBG A;  4BEN A;  1IYP A;  1QMF A;  2X71 A;  4R4S A;  5KSH A;  3SH8 A;  4BL2 A;  2Z2M B;  4S2O A;  3GR2 A;  3N7W A;  5EUA A;  1YLY A;  2ZQ7 A;  3O86 A;  3Q81 A;  5EEC A;  5CTM A;  2XGN A;  2X01 A;  2XF3 A;  3MXS A;  3WWX A;  5L2F A;  4QY5 A;  2XR0 A;  3FWL A;  4OP8 A;  4UA6 A;  1W79 A;  3ISG A;  3Q07 A;  1N9B A;  5TR7 A;  3W4Q A;  4C3Q A;  3DWZ A;  4HES A;  5HAR A;  1K57 A;  4KZA A;  4OLG A;  5GLA A;  4YIN A;  4A5R A;  4Y0T A;  4OP5 A;  3QNB A;  3UE0 A;  5CGW A;  3DWK A;  4QU3 A;  2JCH A;  1LLB A;  1FQG A;  3MZE A;  1M6K A;  3OPP A;  4PM8 A;  3PBN A;  1E3U D;  4LEN A;  3SH9 A;  3G35 A;  4DDS A;  3HBR A;  1NZO A;  2XD1 A;  5F83 A;  4X68 A;  3SH7 A;  4JXW A;  2C5W B;  5DTS A;  5CHM A;  3O3V A;  2V2F F;  4QB8 A;  4UA7 A;  3BEB A;  3IF5 A;  4XUZ A;  3O87 A;  3N4I A;  2ZC5 B;  1SKF A;  4DXB A;  4IVK A;  3VP2 A;  1K4E A;  1NYM A;  1VQQ A;  5TGF A;  3FZC A;  5FQJ A;  1GHI A;  1TVF A;  3S22 A;  4B4X A;  5FQ9 A;  5HL1 A;  3HLF A;  4LV1 A;  5J8X A;  3HUO A;  4XXR A;  5EOE A;  2FFF B;  3G32 A;  5DTK A;  3FKW A;  4BQM A;  4KZ6 A;  1PW1 A;  4LV0 A;  2EFU A;  3VFF A;  5E2F A;  2Y2L A;  5M18 A;  4DE0 A;  3ZFZ A;  1HTZ A;  3IHB A;  4KZ7 A;  4C75 A;  3HUM A;  1BLS A;  1ZG4 A;  1SDN A;  1MWS A;  3G34 A;  2R9X A;  2OV5 A;  1MPL A;  3IH9 A;  4IED A;  1ESU A;  5HAI A;  4P6B A;  4DDY A;  3IF6 C;  1GA0 A;  1W5D A;  2IWB A;  2J7V A;  4X6T A;  3OCL A;  1BSG A;  5GLD A;  3WS2 A;  1YT4 A;  4DE1 A;  3SOI A;  3BEC A;  5FQK A;  2WGV A;  2Y2H A;  3SS4 A;  1HD8 A;  1NRF A;  3G2Z A;  3JYI A;  5A93 A;  3V5M A;  2OLU A;  2DCF A;  5EVI B;  3BRM A;  4OPZ A;  4PM9 A;  2HDR A;  2EX8 A;  4WZ4 A;  1CK3 A;  1K54 C;  3NIA A;  1XA7 A;  4MNR A;  1GA9 A;  1XX2 A;  3HUN A;  4K0X A;  5DF8 A;  2DNS A;  3C7U A;  3PBR A;  1KGG A;  2EX2 A;  4IBX A;  4OOY A;  3BFG A;  3ZG5 A;  3Q7V A;  3MKE A;  1K6R A;  1YLJ A;  5FQM A;  4P85 A;  1TDL A;  2ZC7 A;  5U47 A;  1K4F A;  2Y2N A;  3E2K A;  1ESI A;  4S2J A;  4QD4 A;  3ZVT A;  3HVF A;  5FI7 A;  2PU2 A;  4WMC A;  4DE2 A;  3A3D A;  4CPK A;  2XQZ A;  3VP1 A;  1GHM A;  1KVM A;  3IWI A;  5KMW A;  1FR1 A;  1NXY A;  4OH0 A;  1BT5 A;  4E6X A;  1KE4 A;  1K57 C;  4H8R A;  1RGZ A;  4KQO A;  3IWQ A;  4BLM A;  2PBY A;  2Y2J A;  1KDW A;  1ES2 A;  2WAE A;  5A92 A;  2J9P A;  1DJB A;  1Z6F A;  1ZG6 A;  3UY6 A;  1I2W A;  4GD6 A;  4X55 A;  1FOF A;  1XP4 A;  3N6I A;  1NZU A;  3OC2 A;  4LV3 A;  5FAT A;  3UDX A;  3C4P A;  5F82 A;  4WEJ A;  3IHA A;  3RXX A;  4S2K A;  3VMA A;  4ZDX A;  3VP0 A;  5EE8 A;  4Y0O A;  5AQB A;  4HBT A;  5GLB A;  5DF9 A;  2Y59 A;  3Q82 A;  4MBH A;  1PZP A;  3ZCZ A;  5FQI A;  4JXV A;  4NET A;  3M6H A;  3S4X A;  3A3F A;  1NY0 A;  3MXR A;  1HVB A;  5CGS A;  2J8Y A;  1JTG A;  1YLW A;  4Z9Q A;  1MBL A;  4FD8 A;  2V20 A;  1CI9 A;  2H0Y A;  4OQH A;  1LHY A;  1Q2P A;  5CHU A;  1XA1 A;  3IXD A;  2EX9 A;  3NBL A;  5HX9 A;  1IYS A;  1WYC A;  3ITB A;  3ZDJ A;  2ZC6 B;  4OOL A;  5FAO A;  1E3U A;  3V3R A;  1CI8 A;  4KZ8 A;  5FAP A;  4BD1 A;  2ZM8 A;  3BFE A;  3FV7 A;  1ONH A;  4WZ5 A;  1ES4 A;  1JTD A;  3Q7Z A;  4PMA A;  3VOY A;  4KQQ A;  3NC8 A;  3OCN A;  3CMZ A;  3OPR A;  3HLC A;  4E6W A;  4OVD A;  4N9K A;  2Y2I A;  3FYZ A;  3UDF A;  2X02 A;  1DJA A;  3ZGA B;  1JWV A;  1NJ4 A;  4E3O A;  4LV2 A;  3WS1 A;  1FCO A;  3V3S A;  1ES5 A;  2P9V A;  4MBK A;  4OLD A;  4RVA A;  3IF6 B;  4EWF A;  1CEG A;  4FCF A;  4OPY A;  3UDI A;  1M40 A;  4GD8 A;  5GHY A;  5IHV A;  3UE3 A;  1FR6 A;  3OPL A;  2XFT A;  4KEN B;  4OPQ A;  1FSY A;  1XXM A;  5FAQ A;  1MXO A;  4ZJ1 A;  5CXW A;  5F1F A;  4S2N C;  1JWP A;  2HPB A;  4YFM A;  5EVI A;  4DE3 A;  4LCL A;  5CGX A;  4S2L A;  5FDH A;  1BUL A;  2WUQ A;  1S0W A;  4JXG A;  4OPR A;  4GN2 A;  4N9L A;  2J9O A;  2Y55 A;  3A3E A;  3ZNY A;  3GV9 A;  1XKZ A;  1YLT A;  2H10 A;  2ZQ9 A;  4WEL A;  5EVI D;  3D4F A;  4OQI A;  4KG6 A;  4P0M A;  2DRW A;  1RP5 A;  3MFD A;  5GHX A;  3QHY A;  4EBN A;  2WKE A;  4EUZ A;  1RCJ A;  3VOZ A;  1Q2Q A;  4WYY A;  1O7E A;  1ZC2 A;  3N8S A;  1IYQ A;  4UHU A;  2UWX A;  3UNW A;  4DF6 A;  3AGD A;  5F1G A;  1PWG A;  2WAD A;  4UA9 A;  2HP9 A;  5GHZ A;  4OOM A;  3EQV A;  2WZX A;  2Y2G A;  4MLL A;  4N92 A;  5A90 A;  4KQR A;  2ZJ9 A;  2JE5 A;  1ONG A;  3AGE A;  1MKI A;  3N8R A;  4X56 A;  3VP4 A;  3LO7 A;  4GNU A;  1K56 D;  1ERM A;  4QY6 A;  3HL9 A;  3V50 A;  2ZMA A;  4U0X A;  4B4Z A;  4X69 A;  4S2N A;  3G30 A;  5EPH A;  5HAP A;  1KE0 A;  1YMX A;  1YM1 A;  1K38 A;  5FSR A;  2QZ6 A;  2WGW B;  1KGE A;  4NK3 A;  2H0T A;  2OSU A;  3VP3 A;  3GVB A;  2HP5 A;  1YQS A;  1ES3 A;  1PW8 A;  4ZJ3 A;  2ZC4 B;  4RA7 A;  3TSG A;  4RX2 A;  1FSW A;  1XPB A;  5AQ9 A;  4DRT A;  2XH9 A;  3RXW A;  3PAG A;  4QHC A;  3IXG A;  2PU4 A;  3IXB A;  2WKI A;  2ZQ8 A;  1DY6 A;  3UN7 A;  1I2S A;  3P09 A;  4JLF A;  1L0E A;  3IT9 A;  2VGJ A;  2A3U A;  4F94 A;  3VSL A;  3SS5 A;  3CZD A;  2JC7 A;  1FCM A;  3IXH A;  3ZG9 B;  5HAQ A;  1YLZ A;  3BFF A;  3G2Y A;  1MWU A;  2HP6 A;  3DTM A;  2WK0 A;  2XFS A;  4HEF A;  3ZG8 B;  4WZ5 C;  4JF5 A;  2WGI A;  1NYY A;  5AQ7 A;  3W4O A;  5EOO A;  3CG5 A;  2ZC3 B;  2I72 A;  4IBR A;  1ALQ A;  2FFY A;  2B5R A;  2Z2L B;  3OPH A;  1E4D A;  4GOG A;  4KG2 A;  5D3O A;  5M19 A;  1L2S A;  5KZH A;  1IEM A;  4R1G A;  3QNC A;  3C4O A;  4B88 A;  2G2W A;  2RCX A;  4RX3 A;  1BUE A;  4FH4 A;  1YMS A;  4KZ3 A;  4GB7 A;  4S2M A;  4FH2 A;  3A3I A;  3B3X A;  5FAS A;  2ZQA A;  1N4O A;  2ZD8 A;  3C5A A;  1XGJ A;  1K25 A;  4U0T A;  5EVI C;  3ZG7 B;  1KGF A;  4C6Y A;  3UPN A;  1W8Y A;  1PIO A;  3WS0 A;  2VGK A;  4LCM A;  3EQU A;  3GMW A;  5KSC A;  1JWZ A;  3MZF A;  4BJP A;  1MWR A;  2BLS A;  2WKH A;  4PM5 A;  5HW3 A;  3HLG A;  2EXB A;  3PBS A;  4P87 A;  3W8K A;  3ZHH A;  4CJN A;  2CC1 A;  5E2G A;  1E25 A;  1KVL A;  4GDB A;  3DW0 A;  2WZZ A;  4DXC A;  4X53 A;  1JVJ A;  3Q7V B;  3WRZ A;  1IKI A;  1G68 A;  1WE4 A;  4PPR A;  3I7J A;  2V1Z A;  3NY4 A;  4JKT A;  2H5S A;  1IYO A;  1G6A A;  1LI0 A;  3C7V A;  3M2J A;  1L0G A;  1H8Y A;  3Q1F A;  4WEK A;  4N1X A;  3HLB A;  5BOH A;  4OQ0 A;  3BYD A;  4ZAM A;  5E43 A;  4S2I A;  4Y7P A;  4JPM A;  4KZB A;  2Y91 A;  3RJU A;  1SCW A;  3PTE A;  4ID4 A;  4R3J A;  5HFO A;  3UO9 A;  4Q8I A;  2GDN A;  1C3B A;  2Y2M A;  4R3B A;  3W4P A;  3BLM A;  4S2P A;  3M6B A;  4K91 A;  3TG9 A;  4EBP A;  2WAF A;  4K0W A;  2Y2P A;  3M2K A;  3UPP A;  2EFX A;  1K55 A;  4R0Q A;  1BTL A;  4E3M A;  1ERO A;  2WGW A;  3FKV A;  4Y0U A;  1PZO A;  4WM9 A;  5JYP A;  1BLC A;  2Q9N A;  3MKF A;  1BZA A;  5GLC A;  4E3N A;  1AXB A;  5CEB A;  4EV4 A;  4ZBE A;  5CER A;  4KG5 A;  4O7D A;  1XGI A;  4GKU A;  2Y2Q A;  5FI2 A;  1CEF A;  3WS4 A;  5G18 A;  1Y54 A;  2C6W B;  5FQQ A;  3ZVW A;  2EX6 A;  1K56 A;  3V39 A;  4N1H A;  1PWD A;  4IVI A;  4E3I A;  3UPO A;  4M3K A;  5EVL A;  4D2O A;  3HRE A;  5JYO A;  1I5Q A;  1RGY A;  1QME A;  4R4R A;  3UE1 A;  3AGF A;  1EWZ A;  5AQA A;  2XDM A;  1L0D A;  3GSG A;  2IWD A;  2IWC A;  3HLW A;  3LY3 A;  1LL5 A;  4GDN A;  4EBL A;  3VSK A;  5FI6 A;  1GHP A;  4QJG A;  3IWO A;  1IKG A;  1YLP A;  1S6R A;  1OME A;  2G2U A;  3VFH A;  1GCE A;  2Y2K A;  2P74 A;  3GTC A;  2XLN A;  1H5X A;  2QPN A;  1MWT A;  3LY4 A;  5CEC A;  2XK1 A;  1W7F A;  1DJC A;  1IEL A;  4ZJ2 A;  4EQI A;  2P9V B;  3SS3 A;  1EI5 A;  3LCE A;  4E3L A;  5M1A A;  3G4P A;  4JBF A;  5DVA A;  3ITA A;  3BFC A;  1J9M A;  5A91 A;  4OKP A;  3NCK A;  1K6S A;  2JBF A;  2BG1 A;  3G31 A;  3IQA A;  4JF6 A;  2XD5 A;  3LEZ A;  1LL9 A;  1PWC A;  4KZ9 A;  1MY8 A;  1ERQ A;  3NDE A;  1SHV A;  3WRT A;  4BD0 A;  4E3J A;  1TDG A;  3MZD A;  4XUX A;  3PAE A;  3PBT A;  3GQZ A;  1BLP A;  4MEZ A;  2R9W A;  5CTN A;  2ZM2 A;  1KE3 A;  5DTT A;  5FA7 A;  2ZM0 A;  5E2H A;  5GL9 A;  5CED A;  5E2E A;  4OQG A;  3HLE A;  3N8L A;  3O88 A;  4ZTK A;  1HZO A;  3NI9 A;  1ZKJ A;  5TFQ A;  5CRF A;  4U3T A;  3WS5 A;  2ZQC A;  1PYY A;  1PI5 A;  2HDS A;  4RYE A;  3PBO A;  4JF4 A;  3ZNT A;  2Y4A A;  2ZQD A;  3MBZ A;  2QMI A;  4JXS A;  1W8Q A;  1PI4 A;  3GRJ A;  4OON A;  3NDG A;  1BLH A;  1TEM A;  4KZ4 A;  3OZH A;  4FSF A;  4UAA A;  4BL3 A;  3IH8 A;  4R23 A;  3E2L A;  2RL3 A;  3CJM A;  1H8Z A;  2OLV A;  1VM1 A;  3S1Y A;  3TOI A;  1U60 A;  3IF6 A;  2WYX A;  4HBU A;  2A49 A;  2EXA A;  4E3K A;  3PBQ A;  2XEP A;  2Q9M A;  1KDS A;  2ZLY A;  4PM6 A;  4KZ5 A;  1SDE A;  4DKI A;  4GZB A;  1O07 A;  2E8I A;  1K55 C;  3BLS A;  4PM7 A;  3BFD A;  3ZG0 A;  3HLD A;  1L0F A;  2HDU A;  4WMC D;  5CHJ A;  2HDQ A;  4MBF A;  2Y2O A;  5DF7 A;  3P98 A;  1WYB A;  1FCN A;  1K54 A;  3A3J A; 
#chains in the Genus database with same CATH topology
 1LI9 A;  3BQ8 A;  3KSF A;  1IYP A;  3SH8 A;  2Z2M B;  5DJU A;  3LI8 A;  3Q81 A;  3T1R A;  5EEC A;  1PFL A;  5CTM A;  2ZOI A;  3FWL A;  1N9B A;  3W4Q A;  2V0W A;  1FIL A;  4KZA A;  5F68 A;  3LR5 A;  2FZ0 A;  4OP5 A;  3CUE C;  1A0K A;  2J3T D;  3MQ0 A;  1CF0 A;  2J80 A;  5F83 A;  4X68 A;  2PAV P;  5DTS A;  2K31 A;  2YKH A;  4QB8 A;  5EFW A;  3IF5 A;  4XUZ A;  2ZC5 B;  2PHY A;  1NYM A;  5TGF A;  3S22 A;  5J8X A;  4BQM A;  2OWJ A;  5HDD A;  3IHB A;  4KZ7 A;  1D1J A;  2VK3 A;  4CLC C;  2INW A;  4DDY A;  4JGR A;  4L9F A;  3WS2 A;  1YT4 A;  3BEC A;  4BBV A;  5FQK A;  1D06 A;  1HD8 A;  4LRY C;  2Y79 A;  2O0Y A;  2HDR A;  1XA7 A;  4MNR A;  3TRC A;  3EEH A;  4XT2 B;  2DNS A;  3A0R A;  3T4K A;  4IBX A;  5DFY A;  3MKE A;  1OTE A;  4X1L A;  5HDC A;  2ZC7 A;  2PBD P;  3ZVT A;  3HVF A;  4G3K A;  3A3D A;  4CPK A;  2QHK A;  3VP1 A;  1KVM A;  5KMW A;  1NXY A;  5KIZ A;  3IWQ A;  2Y2J A;  3S7N A;  1N9O A;  3UY6 A;  1I2W A;  3OC2 A;  3VP0 A;  5J3W A;  3UB7 A;  3Q82 A;  3ICY A;  1PZP A;  4JXV A;  2PYR A;  3S4X A;  1T19 A;  1P0Z A;  3D9Y A;  2V20 A;  4OQH A;  1XA1 A;  3NBL A;  3H7W B;  3R7W A;  4BD1 A;  2XRO A;  4PMA A;  3VOY A;  1DP8 A;  3CMZ A;  4E04 A;  2Y2I A;  3ZGA B;  4ARZ A;  1FCO A;  2G7U A;  2JN7 A;  2HV1 A;  3IF6 B;  5IHV A;  3UE3 A;  5F1F A;  1FSY A;  5FAQ A;  4S2N C;  4AFI A;  4YFM A;  5EVI A;  1IOU A;  4S2L A;  1VEU A;  4YOF A;  1S0W A;  4GN2 A;  2J9O A;  3LIC A;  1V9Y A;  3BWL A;  2DRW A;  3VOZ A;  1O7E A;  1ZC2 A;  2XA7 S;  3N8S A;  2WAD A;  4OOM A;  2KX6 A;  2Y2G A;  4N92 A;  4KQR A;  2ZJ9 A;  2I9V A;  1ONG A;  2BAS A;  1ERM A;  4QY6 A;  2ZMA A;  5HAP A;  1CQA A;  2MJ6 A;  3C38 A;  2WGW B;  4I5S A;  4NK3 A;  2OSU A;  2HP5 A;  3QP4 A;  4ZJ3 A;  2ZC4 B;  3TSG A;  4IUH A;  3KSH A;  4QHC A;  1W63 Q;  3P09 A;  4JLF A;  2VGJ A;  3VSL A;  4Z1W A;  4HJ3 A;  2WK0 A;  1OTI A;  1P97 A;  1YPR A;  2WGI A;  3W4O A;  3CG5 A;  2P08 A;  4ETZ A;  1ALQ A;  3CWF A;  4GOG A;  3K3C A;  4HOI A;  2W3G A;  2P7J A;  3DAV A;  1TS7 A;  2RCX A;  1BUE A;  4I3I A;  4FH4 A;  3UB8 A;  2XRN A;  3VE3 A;  3GDI A;  2ZD8 A;  5HD3 A;  1KGF A;  4C6Y A;  3UPN A;  3S7Q A;  3T50 A;  1JWZ A;  2K7S A;  1MWR A;  3LGO A;  3PBS A;  4P87 A;  3ZHH A;  5E2G A;  2ZL1 A;  1S66 L;  4GDB A;  4DXC A;  3WRZ A;  1IKI A;  1N9L A;  3NY4 A;  3KX0 X;  1TS0 A;  3S7P A;  1G6A A;  3C7V A;  3M2J A;  4WEK A;  4GLQ A;  3BYD A;  4KZB A;  2Y91 A;  3PTE A;  3UO9 A;  4IHQ A;  3W4P A;  2Y2M A;  4S2P A;  2Y2P A;  3M2K A;  2EFX A;  3T1Q B;  2VV8 A;  1PZO A;  3MKF A;  1BZA A;  2Z6D A;  4E3N A;  2D02 A;  3UE6 A;  3SW1 A;  3U4L P;  5FI2 A;  5G18 A;  3UPO A;  3TJZ C;  5JYO A;  1RGY A;  1EWZ A;  2XDM A;  1L0D A;  4EBL A;  3R7W B;  3DTK A;  2O99 A;  3IWO A;  1IKG A;  1YLP A;  1LL8 A;  4ARZ B;  2XK1 A;  1W7F A;  2VZW A;  4EQI A;  3CUE A;  5FEG A;  2WKR A;  5DVA A;  2A24 A;  3QP2 A;  1UWN X;  4NXF A;  4JF6 A;  3LEZ A;  4NXE A;  5TBM A;  3NDE A;  4O0P A;  1SHV A;  3WRT A;  4BD0 A;  1TDG A;  3GQZ A;  1S1Y A;  5L8M A;  2EA9 A;  5DTT A;  1KE3 A;  5FA7 A;  5CED A;  3N8L A;  1YKD A;  3C2W A;  3NI9 A;  1JNU A;  3T4L A;  3PBO A;  2QMI A;  3VOL A;  1W8Q A;  4OON A;  4CLC A;  4Q0I A;  3IH8 A;  4EEP A;  2RL3 A;  3CJM A;  1H8Z A;  4HBU A;  2A49 A;  3T1X A;  2Z6C A;  2ZLY A;  4MDZ A;  1K55 C;  2OOL A;  2V1A A;  4F3L A;  1WYB A;  1FCN A;  3A3J A;  3QP5 A;  1YSP A;  2PD7 A;  3CAX A;  1QMF A;  2HJE A;  2X71 A;  3CPT A;  4BL2 A;  4S2O A;  4QWO A;  2ZQ7 A;  5IU1 A;  4WN5 A;  3KYZ A;  2X01 A;  3MXS A;  4OP8 A;  4UA6 A;  3ISG A;  5HPF A;  5HAR A;  4Y2F A;  4YIN A;  2JKF A;  3QNB A;  4MMN A;  3QP8 A;  5CGW A;  5J4E A;  1LLB A;  4R3A A;  1FQG A;  3MZE A;  1M6K A;  3PBN A;  5F6A A;  4JXW A;  3PHY A;  5CHM A;  3O3V A;  3BEB A;  2QYB A;  4L9G A;  1LSX A;  1SKF A;  3A0V A;  2JKR I;  4IVK A;  4P6Z S;  1XJ6 A;  4EW7 A;  1Y4O A;  3FZC A;  5FQJ A;  4B4X A;  5FQ9 A;  5HL1 A;  2W1T B;  3HUO A;  2ZL1 B;  4FUW A;  3FKW A;  2EFU A;  3VFF A;  5M18 A;  2Y2L A;  1P9W A;  3VE4 A;  4DN0 A;  1MPL A;  3IH9 A;  5MC7 A;  1ESU A;  5I5L A;  4P6B A;  4X6T A;  1BSG A;  3SOI A;  3JVU A;  3L7H A;  2WGV A;  2Y2H A;  2V8F A;  1F98 A;  5A93 A;  3E4O A;  2DCF A;  3BRM A;  4PKY G;  2EX8 A;  1K54 C;  3NIA A;  1W63 M;  3HUN A;  5DF8 A;  3C7U A;  2EWW A;  3LYX A;  4LRX C;  4OOY A;  3BFG A;  3ZG5 A;  3Q7V A;  1GSW A;  2ZBB A;  3F1N B;  5FQM A;  4P85 A;  1TDL A;  4GJ4 A;  1ESI A;  4S2J A;  4QD4 A;  3OOV A;  2PU2 A;  4UQI M;  4WMC A;  4DE2 A;  3PR6 A;  4HIA A;  1FR1 A;  4OH0 A;  4E6X A;  3IX3 A;  1K57 C;  5LBR A;  1RGZ A;  4BLM A;  1ES2 A;  5A92 A;  2XSS A;  4X55 A;  3C4P A;  3RXX A;  3IHA A;  4S2K A;  5HDS A;  2A24 B;  4MBH A;  3ZCZ A;  1MKM A;  3M6H A;  3NOU C;  5TBM B;  3MXR A;  3CI6 A;  3UMD A;  1HVB A;  2J8Y A;  1MBL A;  1STZ A;  1CI9 A;  4Y3I A;  2EX9 A;  3ZDJ A;  4OOL A;  1HLU P;  1E3U A;  3B33 A;  4KZ8 A;  3FV7 A;  1S4R A;  1ES4 A;  4KQQ A;  2FH5 A;  4UEY A;  1VHM A;  4OVD A;  3FYZ A;  4CLC B;  4E3O A;  3F1P A;  4LV2 A;  4OLD A;  4EWF A;  5GHY A;  4H6J A;  1FR6 A;  2XFT A;  3SZT A;  4ZJ1 A;  5DJT A;  1MXO A;  5CXW A;  1JWP A;  1XJ2 A;  2HPB A;  3IX4 A;  4LCL A;  5DKL A;  4F3L B;  3UME A;  1KOU A;  1BUL A;  5HWW A;  4OPR A;  1YLT A;  2H10 A;  2ZQ9 A;  3K3D A;  2PYP A;  4OQI A;  4P0M A;  1RP5 A;  3MFD A;  5GHX A;  1IYQ A;  2UWX A;  3MFX A;  3AGD A;  5F1G A;  1NLY A;  2HP9 A;  4KUK A;  2WZX A;  1F2K A;  3AGE A;  3N8R A;  4MN5 A;  2JKG A;  3MXQ A;  1IFQ A;  3V50 A;  2DMW A;  3FC7 A;  4GCZ A;  4U0X A;  5EPH A;  1GSV A;  1K38 A;  1KGE A;  3VP3 A;  3GVB A;  1ES3 A;  4GHI A;  2GNX A;  1FSW A;  5AQ9 A;  4DRT A;  2XH9 A;  3RXW A;  3PAG A;  3IXG A;  2PU4 A;  2WKI A;  3UN7 A;  1I2S A;  3K2N A;  1L0E A;  3SS5 A;  3CZD A;  2JC7 A;  1FCM A;  3ZG9 B;  3BFF A;  3H82 A;  3G2Y A;  3LIA A;  1CJF A;  4HEF A;  3ZG8 B;  4JF5 A;  4WF0 A;  5AQ7 A;  5EOO A;  2ZC3 B;  2O9C A;  4IBR A;  2QWS A;  4HHD A;  5D3O A;  5M19 A;  5KZH A;  1IEM A;  4R1G A;  3QNC A;  2G2W A;  4FOF A;  1YMS A;  4KZ3 A;  3D72 A;  1NWZ A;  3A3I A;  3B3X A;  3UB5 P;  2ZQA A;  3EOI A;  1K25 A;  2KLI A;  3BJN A;  4CLC D;  3GMW A;  1UWP X;  5KSC A;  2OWH A;  3W8K A;  1E25 A;  3NOP C;  3E4Q A;  4X53 A;  1JVJ A;  3Q7V B;  2VJW A;  1PRQ A;  4JKT A;  2B18 A;  1J3W A;  4R6L A;  1LI0 A;  5FEF A;  1H8Y A;  4JGP A;  3Q1F A;  3F1O A;  1S4S A;  3EGX C;  3HLB A;  3B42 A;  4OQ0 A;  1SCW A;  4ID4 A;  4R3J A;  5HFO A;  4Q8I A;  2GDN A;  4R3B A;  3TG9 A;  2WAF A;  2ZMF A;  1WA9 A;  4X1M A;  1K55 A;  4R0Q A;  1X0O A;  1D7E A;  2V0U A;  4WM9 A;  1BLC A;  1AXB A;  4BMW A;  4ZBE A;  5CER A;  4KG5 A;  1XGI A;  1Y54 A;  4ESP A;  3ZVW A;  4GW9 A;  4N1H A;  1PWD A;  4IVI A;  4D60 A;  4M3K A;  3HRE A;  1I5Q A;  3UE1 A;  1P9R A;  1LL5 A;  1YSQ A;  3UB9 A;  5FI6 A;  1GHP A;  1OME A;  4EEU A;  3GTC A;  2EWV A;  1H5X A;  2QPN A;  1DJC A;  1H8M A;  3D3O A;  4ZJ2 A;  3SS3 A;  4LGW A;  5M1A A;  4JBF A;  2XA7 M;  3ITA A;  1J9M A;  4OKP A;  2JBF A;  2QKP A;  4H6J B;  3G31 A;  2XD5 A;  5IS1 A;  4KZ9 A;  1VET A;  1MY8 A;  3PAE A;  3PBT A;  3S7O A;  2ZM2 A;  2ACG A;  5E2E A;  3CIT A;  5TFQ A;  5DFX A;  4CLC E;  2PD8 A;  4JF4 A;  2J3W A;  3U2A A;  3ULF A;  3MBZ A;  1PI4 A;  2PDR A;  3NDG A;  1ZHH B;  4GS9 A;  4FSF A;  3IX8 A;  3E2L A;  2OLV A;  1U60 A;  4ME4 A;  2WYX A;  4E3K A;  2V8C A;  4BBU A;  1KDS A;  5HSQ A;  4DKI A;  3BLS A;  1OTD A;  3T4J A;  4B93 A;  2QJ5 A;  4WMC D;  5CHJ A;  4MBF A;  2Y2O A;  5FL3 A;  5DF7 A;  4GHI B;  1K54 A;  2VA0 A;  3BM6 A;  4BEN A;  4R4S A;  3BY9 A;  2VX8 A;  3N7W A;  5EUA A;  1YLY A;  3H82 B;  2NUP C;  2XGN A;  3LIB A;  4BBT A;  1OPX A;  4QY5 A;  2XR0 A;  4Q0H A;  1W79 A;  5TR7 A;  3C30 A;  4I39 A;  5EV0 A;  3FPV A;  4C3Q A;  3LUQ A;  2Q0O A;  1K57 A;  5GLA A;  3T12 B;  4Y0T A;  3UE0 A;  3DWK A;  2JCH A;  3OPP A;  1E3U D;  1OTA A;  4DDS A;  3HBR A;  4I3J A;  2C5W B;  4L9E A;  2V2F F;  4UA7 A;  3LI9 A;  4HP9 A;  3O87 A;  3N4I A;  2QJ7 A;  4HI4 A;  4DXB A;  3VP2 A;  1K4E A;  2H28 A;  3E4P A;  1TVF A;  4LV1 A;  4DJ2 A;  4XXR A;  3IS2 A;  2FFF B;  3G32 A;  1TD5 A;  4EXO A;  1OT9 A;  3LIE A;  5E2F A;  2K2N A;  3L9K A;  4DE0 A;  3ZFZ A;  4C75 A;  3MMH A;  1MWS A;  3G34 A;  2R9X A;  3MR0 A;  4KUO A;  5HAI A;  3F1O B;  1GA0 A;  1W5D A;  2J7V A;  1NRJ A;  3OCL A;  5GLD A;  3SS4 A;  3O5Y A;  2OLU A;  5EVI B;  3V5M A;  4OPZ A;  4PM9 A;  4O01 A;  4WZ4 A;  1VEU B;  1S67 L;  2EX2 A;  2W3F A;  4BWI A;  4NG2 A;  5U47 A;  5AJG A;  1K4F A;  3ZQ5 A;  1OTB A;  4HJ6 A;  5G4Z A;  5FI7 A;  2WKP A;  2JKT I;  1GHM A;  1N9N A;  4DJ3 A;  4I3A A;  1KE4 A;  3BY8 A;  4YNR A;  2PBY A;  2WAE A;  2J9P A;  1DJB A;  1Z6F A;  1ZG6 A;  4MN6 A;  1XP4 A;  3N6I A;  1NZU A;  5EM0 A;  4WEJ A;  3KSG A;  5EE8 A;  5GLB A;  4NET A;  2PRF A;  1EW0 A;  1NY0 A;  5CGS A;  1YLW A;  3CHW P;  1SKO A;  1LHY A;  5EM1 A;  5CHU A;  2ZMV A;  3IXD A;  1IYS A;  1WYC A;  2BTF P;  2ZC6 B;  1XFQ A;  5FAO A;  2JHE A;  1CI8 A;  2ZM8 A;  1ONH A;  3Q7Z A;  4DMZ A;  3OCN A;  3HLC A;  3C8C A;  4JGQ A;  1DJA A;  3QP1 A;  1JWV A;  4RQ9 A;  4EES A;  1VB6 A;  2D01 A;  3V3S A;  2P9V A;  4MBK A;  4RVA A;  4FCF A;  2B95 A;  4OPQ A;  2E8J A;  1TS8 A;  4DE3 A;  4HNB A;  2A2L A;  4FTX A;  4XT2 A;  4N9L A;  3A3E A;  2LB9 A;  3GV9 A;  1XKZ A;  2W1R A;  5EVI D;  3D4F A;  1DP9 A;  1MZU A;  3QP6 A;  4EBN A;  4X25 A;  3G6O A;  1RCJ A;  3FPW A;  3UNW A;  4P6Z M;  4DF6 A;  2LB5 A;  4Y15 A;  5HL6 A;  4UA9 A;  1G6O A;  5GHZ A;  3EQV A;  4MLL A;  5A90 A;  4X56 A;  3VP4 A;  3LO7 A;  4GNU A;  3HL9 A;  3RTY A;  4X69 A;  4S2N A;  3G30 A;  1YM1 A;  2QZ6 A;  2H0T A;  2M7V A;  5L10 A;  3E98 A;  4PKY A;  4RA7 A;  1XPB A;  2ZQ8 A;  4EET B;  3EGD C;  4F94 A;  2A3U A;  2J3T C;  3IXH A;  2VGL S;  3IS2 B;  3DTM A;  4WZ5 C;  2O9B A;  3E0Y A;  2I72 A;  2B5R A;  1E4D A;  3KO6 A;  3IBJ A;  3OLO A;  3KSI A;  4B88 A;  4RX3 A;  1ACF A;  1F5M A;  3JPU A;  4GB7 A;  4S2M A;  5F69 A;  1Y28 A;  4FH2 A;  5FAS A;  4U0T A;  5FDS A;  1W8Y A;  3WS0 A;  2VGK A;  4LCM A;  3EQU A;  1G28 A;  3MZF A;  2BLS A;  2WKH A;  3CLO A;  2OAQ 1;  2PT7 A;  5HW3 A;  2EXB A;  2CC1 A;  4ZRR A;  3DW0 A;  5K5B A;  1G68 A;  2V1Z A;  2H5S A;  4EQ1 A;  3MJQ A;  4LPZ A;  3EWK A;  4N1X A;  4CQH A;  2HF6 A;  5BOH A;  4I38 A;  5E43 A;  4S2I A;  4Y7P A;  1K0K A;  3RJU A;  3MQQ A;  3BLM A;  3OBF A;  4HP4 A;  3W2Z A;  5IT5 A;  4K0W A;  3UPP A;  4LFU A;  1BTL A;  2WGW A;  3FKV A;  4Y0U A;  5JYP A;  2Q9N A;  4O7D A;  3CPT B;  4GKU A;  5CX7 A;  5FQQ A;  1K56 A;  1SKO B;  4II7 A;  1XJ4 A;  3EEA A;  5EVL A;  4D2O A;  3NEC A;  1QME A;  3AGF A;  5AQA A;  2IWD A;  3HLW A;  4GDN A;  1LT0 A;  3VSK A;  4QJG A;  1S6R A;  2G2U A;  1XFN A;  1GCE A;  2Y2K A;  5CEC A;  1IEL A;  2P9V B;  1EI5 A;  3LCE A;  4E3L A;  3BFC A;  3LR3 A;  2BG1 A;  3MZD A;  1DP6 A;  1BLP A;  4MEZ A;  5CTN A;  2CMN A;  5E2H A;  5GL9 A;  1HZO A;  4U3T A;  3WS5 A;  2ZQC A;  1PYY A;  2VEA A;  3RH8 B;  2Y4A A;  2ZQD A;  4JXS A;  3GRJ A;  4UAA A;  1BLH A;  1TEM A;  3OZH A;  3MQO A;  2GZA A;  4IUK A;  3TOI A;  3S1Y A;  5EVE A;  3UB6 A;  2EXA A;  2Q9M A;  1SDE A;  4GZB A;  4PM7 A;  3BFD A;  3LFV A;  1L0F A;  2HDU A;  3KYE A;  2WKQ A;  1FIK A;  3P98 A;  5HPI A;  4Y5F A;  5AVE A;  4PAU A;  2B02 A;  5I94 A;  4L0L A;  4WBG A;  2VLG A;  5KSH A;  1ODV A;  3GR2 A;  3O86 A;  4YWZ A;  5TJJ A;  1YAX A;  3LEQ A;  4HJ4 A;  2XF3 A;  4MN7 A;  3WWX A;  5L2F A;  3Q07 A;  3HJI A;  2YKF A;  3LR4 A;  3DWZ A;  1ZTU A;  4HES A;  2V1B A;  4OLG A;  3VV4 A;  1T1B A;  4A5R A;  4QU3 A;  2O9A A;  2UV0 E;  2KOI A;  4PM8 A;  2NUT C;  4LEN A;  3SH9 A;  1OJ5 A;  3G35 A;  1NZO A;  2XD1 A;  1V9Z A;  3SH7 A;  2GX5 A;  3MS6 A;  1VQQ A;  4KQD A;  1GHI A;  5AVF A;  3HLF A;  3LID A;  5EOE A;  4NXG A;  5DTK A;  4EU0 A;  4KZ6 A;  1PW1 A;  3A0S A;  4LV0 A;  1HTZ A;  3HUM A;  1BLS A;  1XJ3 A;  1SDN A;  1ZG4 A;  3P7N A;  4Y17 A;  5F5Y A;  2OV5 A;  4IED A;  3H9W A;  3F1P B;  2HGV A;  3IF6 C;  2IWB A;  1OT6 A;  1MC0 A;  4DE1 A;  1NRF A;  3G2Z A;  3JYI A;  2W0N A;  2PR6 A;  4IJG A;  5HWT A;  1CK3 A;  1GA9 A;  4ETX A;  1XX2 A;  4K0X A;  3PBR A;  1KGG A;  1T18 A;  1K6R A;  1YLJ A;  3R4K A;  1UGU A;  2Y2N A;  3E2K A;  3MSH A;  3IBR A;  5DKK A;  3NUL A;  3V67 A;  1T1A A;  2XQZ A;  3IWI A;  2L0W A;  1BT5 A;  4H8R A;  4KQO A;  1KDW A;  4PM5 A;  4GD6 A;  3GEC A;  1FOF A;  4LV3 A;  5FAT A;  3UDX A;  2ZOH A;  5F82 A;  3VMA A;  4ZDX A;  4Y0O A;  5AQB A;  4HBT A;  5DF9 A;  2Y59 A;  5FQI A;  3A3F A;  5L09 A;  4Z9Q A;  1JTG A;  4FD8 A;  1L3L A;  2H0Y A;  1PNE A;  1Q2P A;  2V9A A;  5HX9 A;  3ITB A;  2W1T A;  3V3R A;  5FAP A;  3BFE A;  4WZ5 A;  1JTD A;  2W3E A;  3NC8 A;  3OPR A;  4E6W A;  4N9K A;  3UDF A;  2X02 A;  1NJ4 A;  2Y8H A;  3T4Q A;  3WS1 A;  1TF1 A;  1OJG A;  1ES5 A;  1CEG A;  4NXB A;  4OPY A;  3UDI A;  1M40 A;  4GD8 A;  3OPL A;  4KEN B;  1XXM A;  3T1S A;  2M1C A;  1DRM A;  4PHT A;  3PXP A;  5CGX A;  5FDH A;  2VV6 A;  2WUQ A;  1SZV A;  2W3D A;  4JXG A;  2Y55 A;  4G3W A;  3ZNY A;  3B47 A;  4WEL A;  3F1N A;  4KG6 A;  3QHY A;  2WKE A;  4EUZ A;  1Q2Q A;  1S1Z A;  4WYY A;  2W3H A;  4UHU A;  3TE8 A;  1PWG A;  2AVX A;  4O8G A;  3LR0 A;  2JE5 A;  1MKI A;  2P04 A;  1K56 D;  4B4Z A;  1KE0 A;  1YMX A;  5FSR A;  3BQA A;  4R70 A;  1YQS A;  1PW8 A;  4RX2 A;  1H3Q A;  1BYW A;  3HJK A;  4EER A;  3IXB A;  1DY6 A;  3IT9 A;  3DBA A;  5HAQ A;  2M7U A;  1YLZ A;  1MWU A;  4LRZ E;  2HP6 A;  3T4T A;  2XFS A;  4NKP A;  1LSV A;  1NYY A;  4NEE D;  3RFB A;  2FFY A;  2W27 A;  2Z2L B;  3OPH A;  4KG2 A;  2IA2 A;  4HH3 A;  1L2S A;  1G5U A;  3C4O A;  5HZH A;  3MF0 A;  5HWV A;  4M4X A;  1GSX A;  2L4R A;  1AWI A;  1N4O A;  3C5A A;  3NJA A;  1VET B;  1XGJ A;  4EUV A;  1Z09 A;  5EVI C;  1NLZ A;  3ZG7 B;  3P01 A;  1PIO A;  4BJP A;  1TS6 A;  3HLG A;  4CJN A;  3T4S A;  1KVL A;  2WZZ A;  4PPR A;  1WE4 A;  3I7J A;  2GJ3 A;  1IYO A;  4GS9 B;  4JGO A;  1L0G A;  4Q0J A;  3ZYT A;  3T4O A;  4MCW A;  3FG8 A;  4ZAM A;  5G4Y A;  4JPM A;  5HD5 A;  2HZ5 A;  5A8B A;  1C3B A;  3M6B A;  4K91 A;  4EBP A;  4HH2 A;  4E3M A;  3NHQ A;  1ERO A;  2KDK A;  2VKS A;  5GLC A;  5CEB A;  4EV4 A;  3DTE A;  3TW8 A;  2L1M A;  2Y2Q A;  1CEF A;  3WS4 A;  3BW6 A;  2C6W B;  4LLO B;  2EX6 A;  3V39 A;  4R38 A;  4K08 A;  4E3I A;  2VV7 A;  4R4R A;  2JKT M;  3GSG A;  3LY3 A;  2IWC A;  3JVV A;  4QPR A;  3VFH A;  2P74 A;  2XLN A;  1MWT A;  3LY4 A;  4Y13 A;  4G3V A;  5J7E A;  3G4P A;  5A91 A;  3LIF A;  5L07 A;  3NCK A;  1K6S A;  3IQA A;  1LL9 A;  1PWC A;  1ERQ A;  4E3J A;  3KYQ A;  4XUX A;  4HQA A;  4B9O A;  4UQI S;  2R9W A;  2OAP 1;  2ZM0 A;  1T1C A;  4HY8 A;  1F9I A;  4WUJ A;  4OQG A;  3HLE A;  4ZTK A;  3O88 A;  1LSW A;  1ZKJ A;  3H7W A;  5CRF A;  1PI5 A;  3NOT C;  3DTI A;  2HDS A;  4RYE A;  3ZNT A;  2R78 A;  4KZ4 A;  4WL9 A;  5C5K A;  4BL3 A;  2PR5 A;  4R23 A;  2VGL M;  1VM1 A;  3IF6 A;  3HCY A;  3PBQ A;  2XEP A;  4PM6 A;  4KZ5 A;  1H0M A;  4WLA A;  1O07 A;  2E8I A;  2HJ9 C;  3PYP A;  3HLD A;  3ZG0 A;  2JKR M;  2HDQ A; 
#chains in the Genus database with same CATH homology
 3BM6 A;  1LI9 A;  5I94 A;  4L0L A;  4WBG A;  4BEN A;  1IYP A;  1QMF A;  2X71 A;  4R4S A;  5KSH A;  3SH8 A;  4BL2 A;  2Z2M B;  4S2O A;  3GR2 A;  3N7W A;  5EUA A;  1YLY A;  2ZQ7 A;  3O86 A;  3Q81 A;  5EEC A;  5CTM A;  2XGN A;  2X01 A;  2XF3 A;  3MXS A;  3WWX A;  5L2F A;  4QY5 A;  2XR0 A;  3FWL A;  4OP8 A;  4UA6 A;  1W79 A;  3ISG A;  3Q07 A;  1N9B A;  5TR7 A;  3W4Q A;  4C3Q A;  3DWZ A;  4HES A;  5HAR A;  1K57 A;  4KZA A;  4OLG A;  5GLA A;  4YIN A;  4A5R A;  4Y0T A;  4OP5 A;  3QNB A;  3UE0 A;  5CGW A;  3DWK A;  4QU3 A;  2JCH A;  1LLB A;  1FQG A;  3MZE A;  1M6K A;  3OPP A;  4PM8 A;  3PBN A;  1E3U D;  4LEN A;  3SH9 A;  3G35 A;  4DDS A;  3HBR A;  1NZO A;  2XD1 A;  5F83 A;  4X68 A;  3SH7 A;  4JXW A;  2C5W B;  5DTS A;  5CHM A;  3O3V A;  2V2F F;  4QB8 A;  4UA7 A;  3BEB A;  3IF5 A;  4XUZ A;  3O87 A;  3N4I A;  2ZC5 B;  1SKF A;  4DXB A;  4IVK A;  3VP2 A;  1K4E A;  1NYM A;  1VQQ A;  5TGF A;  3FZC A;  5FQJ A;  1GHI A;  1TVF A;  3S22 A;  4B4X A;  5FQ9 A;  5HL1 A;  3HLF A;  4LV1 A;  5J8X A;  3HUO A;  4XXR A;  5EOE A;  2FFF B;  3G32 A;  5DTK A;  3FKW A;  4BQM A;  4KZ6 A;  1PW1 A;  4LV0 A;  2EFU A;  3VFF A;  5E2F A;  2Y2L A;  5M18 A;  4DE0 A;  3ZFZ A;  1HTZ A;  3IHB A;  4KZ7 A;  4C75 A;  3HUM A;  1BLS A;  1ZG4 A;  1SDN A;  1MWS A;  3G34 A;  2R9X A;  2OV5 A;  1MPL A;  3IH9 A;  4IED A;  1ESU A;  5HAI A;  4P6B A;  4DDY A;  3IF6 C;  1GA0 A;  1W5D A;  2IWB A;  2J7V A;  4X6T A;  3OCL A;  1BSG A;  5GLD A;  3WS2 A;  1YT4 A;  4DE1 A;  3SOI A;  3BEC A;  5FQK A;  2WGV A;  2Y2H A;  3SS4 A;  1HD8 A;  1NRF A;  3G2Z A;  3JYI A;  5A93 A;  3V5M A;  2OLU A;  2DCF A;  5EVI B;  3BRM A;  4OPZ A;  4PM9 A;  2HDR A;  2EX8 A;  4WZ4 A;  1CK3 A;  1K54 C;  3NIA A;  1XA7 A;  4MNR A;  1GA9 A;  1XX2 A;  3HUN A;  4K0X A;  5DF8 A;  2DNS A;  3C7U A;  3PBR A;  1KGG A;  2EX2 A;  4IBX A;  4OOY A;  3BFG A;  3ZG5 A;  3Q7V A;  3MKE A;  1K6R A;  1YLJ A;  5FQM A;  4P85 A;  1TDL A;  2ZC7 A;  5U47 A;  1K4F A;  2Y2N A;  3E2K A;  1ESI A;  4S2J A;  4QD4 A;  3ZVT A;  3HVF A;  5FI7 A;  2PU2 A;  4WMC A;  4DE2 A;  3A3D A;  4CPK A;  2XQZ A;  3VP1 A;  1GHM A;  1KVM A;  3IWI A;  5KMW A;  1FR1 A;  1NXY A;  4OH0 A;  1BT5 A;  4E6X A;  1KE4 A;  1K57 C;  4H8R A;  1RGZ A;  4KQO A;  3IWQ A;  4BLM A;  2PBY A;  2Y2J A;  1KDW A;  1ES2 A;  2WAE A;  5A92 A;  2J9P A;  1DJB A;  1Z6F A;  1ZG6 A;  3UY6 A;  1I2W A;  4GD6 A;  4X55 A;  1FOF A;  1XP4 A;  3N6I A;  1NZU A;  3OC2 A;  4LV3 A;  5FAT A;  3UDX A;  3C4P A;  5F82 A;  4WEJ A;  3IHA A;  3RXX A;  4S2K A;  3VMA A;  4ZDX A;  3VP0 A;  5EE8 A;  4Y0O A;  5AQB A;  4HBT A;  5GLB A;  5DF9 A;  2Y59 A;  3Q82 A;  4MBH A;  1PZP A;  3ZCZ A;  5FQI A;  4JXV A;  4NET A;  3M6H A;  3S4X A;  3A3F A;  1NY0 A;  3MXR A;  1HVB A;  5CGS A;  2J8Y A;  1JTG A;  1YLW A;  4Z9Q A;  1MBL A;  4FD8 A;  2V20 A;  1CI9 A;  2H0Y A;  4OQH A;  1LHY A;  1Q2P A;  5CHU A;  1XA1 A;  3IXD A;  2EX9 A;  3NBL A;  5HX9 A;  1IYS A;  1WYC A;  3ITB A;  3ZDJ A;  2ZC6 B;  4OOL A;  5FAO A;  1E3U A;  3V3R A;  1CI8 A;  4KZ8 A;  5FAP A;  4BD1 A;  2ZM8 A;  3BFE A;  3FV7 A;  1ONH A;  4WZ5 A;  1ES4 A;  1JTD A;  3Q7Z A;  4PMA A;  3VOY A;  4KQQ A;  3NC8 A;  3OCN A;  3CMZ A;  3OPR A;  3HLC A;  4E6W A;  4OVD A;  4N9K A;  2Y2I A;  3FYZ A;  3UDF A;  2X02 A;  1DJA A;  3ZGA B;  1JWV A;  1NJ4 A;  4E3O A;  4LV2 A;  3WS1 A;  1FCO A;  3V3S A;  1ES5 A;  2P9V A;  4MBK A;  4OLD A;  4RVA A;  3IF6 B;  4EWF A;  1CEG A;  4FCF A;  4OPY A;  3UDI A;  1M40 A;  4GD8 A;  5GHY A;  5IHV A;  3UE3 A;  1FR6 A;  3OPL A;  2XFT A;  4KEN B;  4OPQ A;  1FSY A;  1XXM A;  5FAQ A;  1MXO A;  4ZJ1 A;  5CXW A;  5F1F A;  4S2N C;  1JWP A;  2HPB A;  4YFM A;  5EVI A;  4DE3 A;  4LCL A;  5CGX A;  4S2L A;  5FDH A;  1BUL A;  2WUQ A;  1S0W A;  4JXG A;  4OPR A;  4GN2 A;  4N9L A;  2J9O A;  2Y55 A;  3A3E A;  3ZNY A;  3GV9 A;  1XKZ A;  1YLT A;  2H10 A;  2ZQ9 A;  4WEL A;  5EVI D;  3D4F A;  4OQI A;  4KG6 A;  4P0M A;  2DRW A;  1RP5 A;  3MFD A;  5GHX A;  3QHY A;  4EBN A;  2WKE A;  4EUZ A;  1RCJ A;  3VOZ A;  1Q2Q A;  4WYY A;  1O7E A;  1ZC2 A;  3N8S A;  1IYQ A;  4UHU A;  2UWX A;  3UNW A;  4DF6 A;  3AGD A;  5F1G A;  1PWG A;  2WAD A;  4UA9 A;  2HP9 A;  5GHZ A;  4OOM A;  3EQV A;  2WZX A;  2Y2G A;  4MLL A;  4N92 A;  5A90 A;  4KQR A;  2ZJ9 A;  2JE5 A;  1ONG A;  3AGE A;  1MKI A;  3N8R A;  4X56 A;  3VP4 A;  3LO7 A;  4GNU A;  1K56 D;  1ERM A;  4QY6 A;  3HL9 A;  3V50 A;  2ZMA A;  4U0X A;  4B4Z A;  4X69 A;  4S2N A;  3G30 A;  5EPH A;  5HAP A;  1KE0 A;  1YMX A;  1YM1 A;  1K38 A;  5FSR A;  2QZ6 A;  2WGW B;  1KGE A;  4NK3 A;  2H0T A;  2OSU A;  3VP3 A;  3GVB A;  2HP5 A;  1YQS A;  1ES3 A;  1PW8 A;  4ZJ3 A;  2ZC4 B;  4RA7 A;  3TSG A;  4RX2 A;  1FSW A;  1XPB A;  5AQ9 A;  4DRT A;  2XH9 A;  3RXW A;  3PAG A;  4QHC A;  3IXG A;  2PU4 A;  3IXB A;  2WKI A;  2ZQ8 A;  1DY6 A;  3UN7 A;  1I2S A;  3P09 A;  4JLF A;  1L0E A;  3IT9 A;  2VGJ A;  2A3U A;  4F94 A;  3VSL A;  3SS5 A;  3CZD A;  2JC7 A;  1FCM A;  3IXH A;  3ZG9 B;  5HAQ A;  1YLZ A;  3BFF A;  3G2Y A;  1MWU A;  2HP6 A;  3DTM A;  2WK0 A;  2XFS A;  4HEF A;  3ZG8 B;  4WZ5 C;  4JF5 A;  2WGI A;  1NYY A;  5AQ7 A;  3W4O A;  5EOO A;  3CG5 A;  2ZC3 B;  2I72 A;  4IBR A;  1ALQ A;  2FFY A;  2B5R A;  2Z2L B;  3OPH A;  1E4D A;  4GOG A;  4KG2 A;  5D3O A;  5M19 A;  1L2S A;  5KZH A;  1IEM A;  4R1G A;  3QNC A;  3C4O A;  4B88 A;  2G2W A;  2RCX A;  4RX3 A;  1BUE A;  4FH4 A;  1YMS A;  4KZ3 A;  4GB7 A;  4S2M A;  4FH2 A;  3A3I A;  3B3X A;  5FAS A;  2ZQA A;  1N4O A;  2ZD8 A;  3C5A A;  1XGJ A;  1K25 A;  4U0T A;  5EVI C;  3ZG7 B;  1KGF A;  4C6Y A;  3UPN A;  1W8Y A;  1PIO A;  3WS0 A;  2VGK A;  4LCM A;  3EQU A;  3GMW A;  5KSC A;  1JWZ A;  3MZF A;  4BJP A;  1MWR A;  2BLS A;  2WKH A;  4PM5 A;  5HW3 A;  3HLG A;  2EXB A;  3PBS A;  4P87 A;  3W8K A;  3ZHH A;  4CJN A;  2CC1 A;  5E2G A;  1E25 A;  1KVL A;  4GDB A;  3DW0 A;  2WZZ A;  4DXC A;  4X53 A;  1JVJ A;  3Q7V B;  3WRZ A;  1IKI A;  1G68 A;  1WE4 A;  4PPR A;  3I7J A;  2V1Z A;  3NY4 A;  4JKT A;  2H5S A;  1IYO A;  1G6A A;  1LI0 A;  3C7V A;  3M2J A;  1L0G A;  1H8Y A;  3Q1F A;  4WEK A;  4N1X A;  3HLB A;  5BOH A;  4OQ0 A;  3BYD A;  4ZAM A;  5E43 A;  4S2I A;  4Y7P A;  4JPM A;  4KZB A;  2Y91 A;  3RJU A;  1SCW A;  3PTE A;  4ID4 A;  4R3J A;  5HFO A;  3UO9 A;  4Q8I A;  2GDN A;  1C3B A;  2Y2M A;  4R3B A;  3W4P A;  3BLM A;  4S2P A;  3M6B A;  4K91 A;  3TG9 A;  4EBP A;  2WAF A;  4K0W A;  2Y2P A;  3M2K A;  3UPP A;  2EFX A;  1K55 A;  4R0Q A;  1BTL A;  4E3M A;  1ERO A;  2WGW A;  3FKV A;  4Y0U A;  1PZO A;  4WM9 A;  5JYP A;  1BLC A;  2Q9N A;  3MKF A;  1BZA A;  5GLC A;  4E3N A;  1AXB A;  5CEB A;  4EV4 A;  4ZBE A;  5CER A;  4KG5 A;  4O7D A;  1XGI A;  4GKU A;  2Y2Q A;  5FI2 A;  1CEF A;  3WS4 A;  5G18 A;  1Y54 A;  2C6W B;  5FQQ A;  3ZVW A;  2EX6 A;  1K56 A;  3V39 A;  4N1H A;  1PWD A;  4IVI A;  4E3I A;  3UPO A;  4M3K A;  5EVL A;  4D2O A;  3HRE A;  5JYO A;  1I5Q A;  1RGY A;  1QME A;  4R4R A;  3UE1 A;  3AGF A;  1EWZ A;  5AQA A;  2XDM A;  1L0D A;  3GSG A;  2IWD A;  2IWC A;  3HLW A;  3LY3 A;  1LL5 A;  4GDN A;  4EBL A;  3VSK A;  5FI6 A;  1GHP A;  4QJG A;  3IWO A;  1IKG A;  1YLP A;  1S6R A;  1OME A;  2G2U A;  3VFH A;  1GCE A;  2Y2K A;  2P74 A;  3GTC A;  2XLN A;  1H5X A;  2QPN A;  1MWT A;  3LY4 A;  5CEC A;  2XK1 A;  1W7F A;  1DJC A;  1IEL A;  4ZJ2 A;  4EQI A;  2P9V B;  3SS3 A;  1EI5 A;  3LCE A;  4E3L A;  5M1A A;  3G4P A;  4JBF A;  5DVA A;  3ITA A;  3BFC A;  1J9M A;  5A91 A;  4OKP A;  3NCK A;  1K6S A;  2JBF A;  2BG1 A;  3G31 A;  3IQA A;  4JF6 A;  2XD5 A;  3LEZ A;  1LL9 A;  1PWC A;  4KZ9 A;  1MY8 A;  1ERQ A;  3NDE A;  1SHV A;  3WRT A;  4BD0 A;  4E3J A;  1TDG A;  3MZD A;  4XUX A;  3PAE A;  3PBT A;  3GQZ A;  1BLP A;  4MEZ A;  2R9W A;  5CTN A;  2ZM2 A;  1KE3 A;  5DTT A;  5FA7 A;  2ZM0 A;  5E2H A;  5GL9 A;  5CED A;  5E2E A;  4OQG A;  3HLE A;  3N8L A;  3O88 A;  4ZTK A;  1HZO A;  3NI9 A;  1ZKJ A;  5TFQ A;  5CRF A;  4U3T A;  3WS5 A;  2ZQC A;  1PYY A;  1PI5 A;  2HDS A;  4RYE A;  3PBO A;  4JF4 A;  3ZNT A;  2Y4A A;  2ZQD A;  3MBZ A;  2QMI A;  4JXS A;  1W8Q A;  1PI4 A;  3GRJ A;  4OON A;  3NDG A;  1BLH A;  1TEM A;  4KZ4 A;  3OZH A;  4FSF A;  4UAA A;  4BL3 A;  3IH8 A;  4R23 A;  3E2L A;  2RL3 A;  3CJM A;  1H8Z A;  2OLV A;  1VM1 A;  3S1Y A;  3TOI A;  1U60 A;  3IF6 A;  2WYX A;  4HBU A;  2A49 A;  2EXA A;  4E3K A;  3PBQ A;  2XEP A;  2Q9M A;  1KDS A;  2ZLY A;  4PM6 A;  4KZ5 A;  1SDE A;  4DKI A;  4GZB A;  1O07 A;  2E8I A;  1K55 C;  3BLS A;  4PM7 A;  3BFD A;  3ZG0 A;  3HLD A;  1L0F A;  2HDU A;  4WMC D;  5CHJ A;  2HDQ A;  4MBF A;  2Y2O A;  5DF7 A;  3P98 A;  1WYB A;  1FCN A;  1K54 A;  3A3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...