2V20A

Structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
269
Chain Sequence
PETLVKVKDAEDQLCRTSHRPCRVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGRRGSRGIIAALGPDGKPSRIVVIYTTGSRKKTDERNRQIAEIGASLIKHWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering an Allosteric Binding Site for Aminoglycosides Into Tem1-Beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TEM
total genus 103
structure length 269
sequence length 269
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2v20A00
4BLMA 2WGVA 4MEZA 5EE8A 3IT9A 1CI9A 1RGZA 2GDNA 3ZG7B 3V39A 3S22A 1VQQA 1EROA 4OQHA 1BLSA 4P87A 5G18A 4B4XA 5GL9A 3E2LA 4GD8A 1K56D 5TR7A 1LI0A 1PZPA 2Y55A 5FATA 1ES2A 3BFEA 5FQMA 4JLFA 5KSCA 5F1FA 3IHAA 2XFTA 3G35A 2R9XA 3HLBA 3MKFA 5EOEA 3NBLA 5DTTA 1FCMA 1O7EA 2Q9NA 5EECA 5KSHA 1BZAA 2Y2OA 5CGWA 3IQAA 3PBNA 1HD8A 3OPHA 3P98A 3S1YA 3UDXA 5DF8A 4ZAMA 1FSWA 1JWVA 1YLZA 2WKEA 4E3IA 3M2JA 5FI2A 1W8QA 2Y2LA 1YT4A 3ISGA 2ZQCA 1Q2PA 5FAQA 4DE3A 1E3UA 5I94A 3Q7VA 3OCNA 4BL2A 1PW1A 3NI9A 4IBRA 4LENA 3O88A 3NCKA 2C6WB 4R3BA 5KZHA 1JVJA 1K57C 4OP8A 4X6TA 2ZLYA 2QPNA 1K54C 3ZNTA 4R0QA 3SS5A 3V5MA 5GHZA 4B88A 3PAGA 4CPKA 3V3SA 3IXHA 1K4EA 2WAEA 4GOGA 4OPRA 4BQMA 1ONGA 1W7FA 3DWKA 5BOHA 4YFMA 4X56A 2V1ZA 5GLCA 4X68A 1H8ZA 3A3FA 2OLUA 4L0LA 1BLCA 3G30A 2ZM8A 3C5AA 3WS0A 2H5SA 3HLWA 3HBRA 1U60A 5FA7A 1FOFA 2A3UA 3ZGAB 4LV0A 4R1GA 3LO7A 2PU4A 3UDFA 3PBOA 2VGJA 4MLLA 4JPMA 4LV1A 2QZ6A 1QMEA 2BG1A 4RVAA 1I2WA 4OKPA 3UDIA 4EBNA 1LLBA 3ZG9B 1K57A 3G2ZA 4OLDA 4ZDXA 4N92A 5GLDA 5CRFA 3VP3A 2Y2NA 5HFOA 1K6RA 1XP4A 1IEMA 2X71A 3MKEA 1NRFA 4WEJA 4OH0A 4U0TA 4QB8A 1KGEA 5CERA 3HUMA 2DCFA 4N1HA 4JXSA 1IKIA 4XUZA 1OMEA 3LY3A 4KG6A 3WS4A 1JWPA 3BEBA 1VM1A 4ID4A 1KDWA 3HLDA 4OQIA 1DY6A 4P0MA 3G32A 1ESUA 2EX8A 3HREA 1TDLA 4S2NA 2X01A 4KQRA 1ONHA 3SS4A 1BTLA 5EPHA 4Y7PA 4FSFA 5HW3A 1PWCA 4E3KA 2Y59A 1NYYA 3WS2A 1JTDA 3BFDA 5FDHA 3AGDA 2OSUA 1MPLA 3BFCA 3VOZA 1PWGA 1YMXA 1KVMA 1ZC2A 1W79A 3EQVA 3QHYA 4HESA 3C4OA 3ZHHA 4S2NC 5CEDA 4KQQA 5GLBA 2HDQA 2HP5A 4KG2A 1NXYA 4GB7A 3NDEA 1FCNA 2E8IA 3ZG0A 5EOOA 2EX6A 3TSGA 1L0FA 3GV9A 2EX2A 4EUZA 1MWRA 4FD8A 5HX9A 3ZVWA 4EBLA 4HEFA 1YMSA 3GSGA 2Y2IA 1ERMA 1E3UD 3BLMA 1MWUA 4GZBA 4DRTA 1Z6FA 4OQGA 3VP0A 3C4PA 1DJAA 3NDGA 1K55A 3WRZA 2DNSA 3A3IA 3G34A 3C7UA 1ZG6A 1FSYA 2ZJ9A 3UPNA 1ES4A 2J9OA 4IVKA 4N9KA 4D2OA 4DDSA 2ZQ8A 3WS1A 3N8RA 4R4RA 3W4PA 3W4QA 5EVIB 1TDGA 4KZBA 4Q8IA 1GHPA 1ZKJA 5CGSA 4JF4A 4X55A 5FAOA 3GR2A 4BENA 3IXBA 5E2HA 3QNCA 3HLCA 1CI8A 3IF5A 3UPPA 5FASA 2Y91A 2ZQDA 4ZTKA 4N1XA 3G2YA 4WEKA 2G2UA 5EUAA 2IWBA 1PIOA 5FQ9A 2PU2A 1K54A 4PM6A 3BFGA 3P09A 3FKVA 3SOIA 5J8XA 4JXGA 3DW0A 4DE0A 1L2SA 1KDSA 4F94A 4WZ5A 2FFFB 5L2FA 2Y2GA 1BT5A 1G6AA 1KGFA 4N9LA 3GTCA 1TEMA 4C6YA 1XGJA 4DDYA 2HDSA 2XH9A 4QJGA 4QD4A 1HZOA 4OOLA 2HP6A 3PBQA 5M1AA 3VP1A 1JTGA 1JWZA 3CJMA 1KE3A 5DTSA 5CEBA 4WELA 1IELA 1BULA 4MBFA 4GDBA 3VFHA 2V2FF 3M6HA 3PBRA 4YINA 3VP4A 5HAPA 3TOIA 4JXWA 3MXSA 2JCHA 2ZD8A 4LV3A 5FI7A 2BLSA 2XR0A 2WGIA 3IHBA 5DF7A 1LHYA 3EQUA 2JC7A 2EFXA 1GHIA 2Y2MA 4RYEA 1ES5A 4HBUA 3FV7A 5A93A 3N8LA 3OZHA 3SH9A 1MWSA 2XLNA 3VP2A 2WAFA 5AQBA 3ZG8B 2Z2LB 3RJUA 3UO9A 1XXMA 4OLGA 4PM5A 1YLYA 4FCFA 2XFSA 4WZ5C 4GD6A 4DF6A 2WKHA 1Q2QA 2FFYA 3UPOA 2RL3A 4DE1A 3Q7ZA 3GMWA 4JF6A 1NY0A 4KG5A 5TGFA 1RGYA 3NIAA 1DJCA 3PBSA 4JF5A 4S2LA 5D3OA 3HVFA 3IH8A 3FWLA 4E6XA 1K38A 1GA9A 2EXAA 1L0GA 2ZC4B 1YLWA 4Y0UA 1EI5A 4UAAA 3M6BA 1KGGA 4XUXA 5HL1A 1IYQA 4O7DA 3CG5A 4EQIA 1BLHA 4KZ4A 2HPBA 2VGKA 3BRMA 3OCLA 5DTKA 5AQ7A 2Y2PA 2ZC6B 4OQ0A 3OPLA 4OOYA 4UA9A 1O07A 3GVBA 5E2EA 3MXRA 1WYBA 5HAIA 1W5DA 1XKZA 4KZ7A 2A49A 5EVIA 5FQKA 3OC2A 1NZUA 2H0TA 5CHUA 1XX2A 1CK3A 3MZEA 4PM9A 3UN7A 3PBTA 5CECA 3HUNA 1N9BA 4P85A 2XF3A 1K55C 3A3EA 5FAPA 5TFQA 4WMCD 5FSRA 3A3JA 4H8RA 4FH2A 5CTNA 2ZQ9A 5EVIC 4X69A 1MXOA 4RX3A 1I5QA 5GHYA 3S4XA 5AQ9A 1PWDA 3VMAA 1L0EA 2WADA 4P6BA 5FI6A 4WBGA 3ITBA 5KMWA 4LV2A 1ERQA 4OVDA 2OLVA 1G68A 2Y2KA 3MZFA 4MBKA 4Y0TA 3E2KA 4M3KA 5M18A 3B3XA 3HLEA 3IF6B 4RA7A 1M6KA 4GN2A 1E4DA 3M2KA 4E3OA 4QY5A 2WK0A 4UA6A 4K91A 2QMIA 5HARA 1IYPA 3IXGA 1N4OA 2XD1A 3Q1FA 4FH4A 1NJ4A 3FZCA 4CJNA 1YQSA 2ZMAA 3BFFA 3JYIA 1SHVA 1BLPA 2H10A 3W4OA 5AQAA 4LCLA 1KE0A 5GHXA 2CC1A 2B5RA 2P9VB 5CGXA 3Q82A 2ZM0A 1MY8A 4OOMA 4R23A 4S2OA 3D4FA 3UNWA 1ESIA 4DXBA 1FCOA 1K6SA 4EV4A 3MFDA 4QU3A 1KVLA 5F83A 1DJBA 4KZ3A 4KZAA 2XK1A 2P9VA 3QNBA 3V50A 1K25A 1K4FA 3ZG5A 2C5WB 4S2KA 1CEGA 3WRTA 4S2MA 5CHJA 2HP9A 3BECA 3IXDA 2WUQA 1J9MA 1FR6A 1AXBA 3HLGA 2J7VA 4WM9A 1PI5A 4K0XA 3UE1A 1RCJA 2I72A 1SDEA 4R4SA 3OPPA 2J8YA 4S2JA 3VSLA 3ZDJA 3PTEA 3NY4A 4NETA 4PM8A 5EVID 4ZJ1A 5FQQA 3MZDA 2ZC7A 3RXXA 5DVAA 4JBFA 1YLTA 1IYOA 3FYZA 3N7WA 5A91A 1FR1A 5HAQA 1HVBA 2EX9A 3BLSA 4GDNA 4MNRA 1SCWA 5CHMA 5F82A 5CTMA 1C3BA 1NYMA 2ZC3B 1GHMA 4WMCA 4S2IA 1ZG4A 3DTMA 1E25A 2XDMA 2Y2JA 4K0WA 1KE4A 3IWQA 1K56A 4KENB 5GLAA 4E3NA 3ZVTA 5JYPA 1TVFA 3O3VA 5A90A 1H5XA 4WYYA 3BM6A 1XA7A 2OV5A 4E6WA 4R3JA 1PW8A 4U3TA 3AGEA 4S2PA 3UY6A 4GNUA 2Q9MA 1XA1A 3TG9A 3Q81A 4ZBEA 3WWXA 4XXRA 3RXWA 2UWXA 2EXBA 3IWIA 3ITAA 3CZDA 3OPRA 2X02A 2JE5A 1WYCA 4JKTA 1QMFA 4OONA 1YLPA 3LY4A 2Y2QA 2IWCA 3LCEA 2IWDA 4ZJ3A 3GRJA 4IBXA 4WZ4A 4E3JA 1PI4A 4UA7A 2ZM2A 4LCMA 3I7JA 4UHUA 1W8YA 5FQIA 4B4ZA 3GQZA 1NZOA 1CEFA 4NK3A 3SH7A 4E3MA 3VSKA 1LI9A 1BUEA 2JBFA 5A92A 1IKGA 2ZQ7A 4OP5A 2EFUA 1PYYA 2WKIA 3IWOA 2WZZA 1WE4A 3UE0A 5JYOA 4EWFA 2H0YA 2XD5A 3O87A 2R9WA 1ALQA 3N8SA 1M40A 3W8KA 3PAEA 1BSGA 4BJPA 3SH8A 1MKIA 1I2SA 4MBHA 2V20A 3IF6A 4IEDA 5DF9A 3ZCZA 3UE3A 2J9PA 3C7VA 5F1GA 4QHCA 5E2GA 5U47A 1GA0A 3V3RA 4Z9QA 2Y4AA 3ZFZA 3CMZA 3LEZA 4PPRA 2WYXA 1YM1A 4C75A 4DE2A 1LL5A 4X53A 2WGWB 5FQJA 3ZNYA 3Q07A 2P74A 4PMAA 5M19A 1HTZA 2RCXA 2WZXA 3N6IA 3HUOA 4PM7A 4E3LA 5E2FA 3MBZA 2Z2MB 4BL3A 2XQZA 2HDRA 2Y2HA 4OPQA 4OPZA 1S6RA 3O86A 1L0DA 3WS5A 5CXWA 4U0XA 3VOYA 4KZ9A 1SDNA 4DXCA 1GCEA 4IVIA 3SS3A 3BYDA 4OPYA 3Q7VB 1MBLA 1XPBA 3A3DA 4GKUA 3VFFA 2DRWA 4C3QA 1LL9A 2PBYA 1RP5A 1YLJA 5IHVA 4DKIA 1H8YA 4A5RA 4ZJ2A 1XGIA 2HDUA 1IYSA 1SKFA 2XEPA 2ZQAA 3HLFA 3G31A 4JXVA 4KQOA 2WGWA 3N4IA 4KZ8A 4RX2A 2G2WA 5E43A 4QY6A 4Y0OA 4BD1A 1S0WA 3NC8A 2XGNA 3FKWA 4KZ5A 1MWTA 5EVLA 2ZC5B 1FQGA 1PZOA 4HBTA 1Y54A 1ES3A 3IF6C 3HL9A 3IH9A 1EWZA 3G4PA 4KZ6A 4BD0A 3AGFA 4EBPA 3DWZA
chains in the Genus database with same CATH superfamily
2WGVA 4MEZA 3GECA 4LGWA 1RGZA 3LIEA 1EROA 4P87A 3A0VA 2L1MA 3E2LA 3B33A 1K56D 2V8FA 5FQMA 4JLFA 3BW6A 3IHAA 2R9XA 4GS9A 4E04A 2Q9NA 2Y2OA 1HD8A 3OPHA 3P98A 3LGOA 3M2JA 1OTDA 2Y2LA 3JVVA 4YWZA 1Q2PA 5I94A 3Q7VA 4BL2A 1PW1A 2C6WB 2GX5A 5KZHA 2ZLYA 1T19A 3CUEA 3LR3A 4CPKA 1K4EA 4BQMA 3KX0X 1ONGA 3V67A 2L0WA 1H8ZA 4L0LA 2ZM8A 2VV6A 1VETA 3HBRA 4DJ3A 1U60A 4G3KA 3ZGAB 4EUVA 4MLLA 4JPMA 4LV1A 1QMEA 4HH3A 2KOIA 5HPFA 3CITA 4BBTA 4EEUA 4OLDA 4ZDXA 4N92A 3VP3A 4U0TA 4QB8A 1V9YA 3HUMA 4N1HA 3S7PA 3BEBA 2J80A 2EX8A 1MZUA 3SS4A 1S1YA 4IHQA 3MS6A 3GDIA 3U4LP 4Q0JA 4L9EA 5TBMB 1ZC2A 1W79A 1LSXA 1XJ6A 2K2NA 5CEDA 4KQQA 2HDQA 4GB7A 5EOOA 4GHIA 3TSGA 1L0FA 3DTKA 2W1RA 2I9VA 4II7A 3U2AA 3GSGA 2VJWA 1ERMA 3C4PA 3WRZA 1Y4OA 2DNSA 4R38A 3UPNA 2J9OA 3NECA 3WS1A 1MKMA 4HH2A 5EVIB 1LSWA 4Q8IA 1GHPA 4X55A 3GR2A 5E2HA 5IT5A 3UB9A 1CI8A 2ZQDA 4ZTKA 3VOLA 3B42A 1F9IA 3FKVA 4F94A 3IX8A 5L2FA 1BT5A 4WN5A 2V0UA 1VEUA 2K31A 2HDSA 5CX7A 3HJKA 4LRYC 2XH9A 4QJGA 2NUPC 5HZHA 2V2FF 2VA0A 1YSQA 2JCHA 2ZD8A 2BLSA 2XR0A 2VZWA 3LFVA 4NG2A 1F2KA 2WGIA 3IHBA 1OPXA 3FC7A 2Y2MA 4RYEA 5A93A 3UB7A 1WA9A 3LIDA 4PM5A 3OLOA 4GD6A 5F68A 4DE1A 1NY0A 1RGYA 3NIAA 5D3OA 4S2LA 3IS2A 3HVFA 3IH8A 2EXAA 1KGGA 3P01A 1IOUA 4O7DA 4EQIA 5HWVA 3VOYA 2MJ6A 3BRMA 4Q0IA 1O07A 3GVBA 2A2LA 2QHKA 1CQAA 1WYBA 2O9BA 3UN7A 3PBTA 2O9AA 4P85A 3UMEA 5TFQA 5FAPA 5FSRA 2L4RA 4NXGA 4FH2A 1MXOA 1I5QA 2J3TD 5GHYA 5AQ9A 1PWDA 3S4XA 1L0EA 2M1CA 5FI6A 3ITBA 4OVDA 1G68A 4MBKA 4Y0TA 4M3KA 1D1JA 1NLYA 3IF6B 1ZHHB 4E3OA 3PXPA 5HARA 3QP4A 4Y3IA 4CJNA 1YQSA 1YSPA 3JYIA 3KSHA 1BLPA 2FZ0A 1A0KA 2B5RA 2P9VB 3Q82A 2ZM0A 1MY8A 4S2OA 3UNWA 3T1XA 4DXBA 1D06A 1FCOA 2E8JA 3KYZA 5L09A 4S2KA 5CHJA 2HP9A 3JPUA 1J9MA 1AXBA 3HLGA 3OPPA 2J8YA 5HDCA 4S2JA 3SZTA 1TS7A 3PTEA 2PHYA 4AFIA 2D02A 5EVID 2INWA 3BY8A 5FQQA 2XRNA 2JKTM 1IYOA 3FYZA 2ZOIA 1V9ZA 1SCWA 1AWIA 1P9RA 1C3BA 2ZC3B 4WMCA 4S2IA 4NXFA 4K0WA 4WLAA 3VE3A 1K56A 5MC7A 1H5XA 3BM6A 2OV5A 4E6WA 2XROA 2V0WA 4R3JA 3S7QA 3AGEA 1XA1A 3TG9A 3Q81A 1OTIA 3RXWA 2EXBA 2GNXA 1WYCA 4FUWA 3BQAA 2QJ7A 3ULFA 3TE8A 3LCEA 4E3JA 4IBXA 2ZM2A 5J3WA 1NZOA 1CEFA 4NK3A 2W3HA 3VSKA 4EESA 4JGQA 2JBFA 1FILA 1IKGA 2Z6DA 1PYYA 4G3WA 3UE0A 2PBDP 2XD5A 3N8SA 1XFQA 1BSGA 3PHYA 3C2WA 1I2SA 2V20A 3IF6A 3ZCZA 1MC0A 3UE3A 3C7VA 4XT2A 5U47A 2Y4AA 5L10A 2HF6A 4X53A 1TD5A 1XJ4A 3E4PA 1HTZA 3UB6A 3MBZA 4OPQA 4YNRA 1GCEA 3SS3A 4OPYA 5HDSA 2PBYA 3BQ8A 1H8YA 1SKFA 4MN5A 4RX2A 5E43A 1NWZA 2YKFA 4KZ5A 3G6OA 1MWTA 1PZOA 3NOTC 4BD0A 4NKPA 3DWZA 3IT9A 1CI9A 3F1NB 4OQHA 4R6LA 4B4XA 2M7VA 5DFYA 2Y55A 5FATA 3BFEA 4LLOB 4NXBA 5F1FA 3D3OA 3FPVA 2XFTA 3IBRA 4HI4A 5EOEA 5DTTA 5EECA 4HP9A 5CGWA 3IQAA 3PBNA 3S1YA 4ZAMA 1FSWA 1JWVA 1JNUA 2WKEA 4E3IA 5EFWA 1YPRA 3ISGA 4DE3A 2VX8A 1E3UA 1S4SA 3NI9A 4IBRA 4LENA 3NCKA 1W63M 1JVJA 4X6TA 2QPNA 3ZNTA 4R0QA 2V1AA 3V3SA 1W7FA 2VK3A 5BOHA 4X56A 2V1ZA 2LB9A 3A3FA 2OLUA 3B47A 3H9WA 2Z6CA 5FA7A 4X1MA 4HJ4A 4LV0A 1UWNX 3LO7A 3UDFA 5F6AA 3TJZC 2BG1A 3MQOA 3PR6A 5IU1A 4F3LA 3UDIA 2XA7S 1K57A 3G2ZA 5GLDA 1K6RA 1XP4A 2X71A 3MKEA 3MQQA 4WEJA 4OH0A 1IKIA 4XUZA 1IFQA 1JWPA 2ZMVA 1KDWA 3HLDA 3MSHA 1OT9A 4S2NA 2X01A 4Y7PA 3S7NA 3BFDA 2LB5A 2P04A 3E4QA 3BJNA 3VOZA 3KYQA 1KVMA 1PRQA 3EQVA 3QHYA 3ZHHA 1OTBA 4KG2A 1L3LA 1NXYA 1FCNA 4R70A 3ZG0A 2EX6A 5LBRA 3GV9A 4EUZA 4YOFA 4FD8A 5HX9A 3ZVWA 4HEFA 5TJJA 2YKHA 1K55A 3C7UA 4Z1WA 1ES4A 4N9KA 3H82A 1SKOA 4KZBA 2W1TB 4EW7A 4BENA 3IXBA 4LRXC 2Y91A 3G2YA 1PIOA 4Y15A 2PU2A 3KSFA 3QP8A 3LR4A 4LRZE 3SOIA 3T4OA 1KGFA 4N9LA 5J4EA 2BTFP 2P08A 3RFBA 4I39A 4OOLA 5M1AA 1JWZA 1KE3A 1IELA 4GDBA 3M6HA 1P97A 4IUKA 4JXWA 3MXSA 3TOIA 2V1BA 1LHYA 1GHIA 4M4XA 2CMNA 3FV7A 3SH9A 1MWSA 2WAFA 4I3IA 3ZG8B 2Z2LB 3RJUA 1YLYA 2XFSA 4WZ5C 1CJFA 3UPOA 2RL3A 1Z09A 5K5BA 4JF6A 2HV1A 5TGFA 1DJCA 4E6XA 3FWLA 4D60A 1L0GA 2ZC4B 1YLWA 4UAAA 3M6BA 5HL1A 3QP5A 1KOUA 3CG5A 3HJIA 4KZ4A 2VGKA 5AQ7A 2Y2PA 2W0NA 5EV0A 3NHQA 5L8MA 5EVEA 2ZOHA 3MXRA 2FH5A 5EVIA 3MR0A 2VLGA 2OWHA 1CK3A 5FEGA 5CECA 3L7HA 3HUNA 1N9BA 3ZYTA 4WMCD 4X69A 2HJ9C 4NEED 4P6BA 5KMWA 4LV2A 1UGUA 1ERQA 4UQIM 2Y2KA 3MZFA 3HLEA 4I5SA 2PT7A 3RTYA 4GN2A 1E4DA 2ZL1B 4QY5A 1IYPA 4Q0HA 4MDZA 3T4SA 3Q1FA 4FH4A 3FZCA 3R7WA 1SZVA 5EM1A 1H0MA 1KE0A 4OOMA 2OAQ1 2JKRI 3D4FA 4QU3A 4GJ4A 5F83A 2P9VA 3K3DA 3QNBA 3H7WA 1K25A 2R78A 3ZG5A 4S2MA 3BECA 3MXQA 4G3VA 1FR6A 3VSLA 1T1CA 4X1LA 3ZDJA 4NETA 4PM8A 3EEHA 2ZC7A 1YLTA 3N7WA 1HVBA 4MNRA 5CHMA 1GHMA 1ZG4A 5AVFA 4E3NA 3ZVTA 3E98A 5A90A 4WYYA 1XA7A 1H8MA 4CLCC 3A0SA 4S2PA 2OAP1 4OONA 1YLPA 3LICA 2XA7M 4WZ4A 2OWJA 3I7JA 5FQIA 4GS9B 5DJUA 4E3MA 3IS2B 1LI9A 5A92A 1W63Q 2PD8A 2EFUA 3IWOA 2WZZA 3PYPA 5IS1A 2H0YA 3O87A 2R9WA 1ALQA 3VE4A 2ZL1A 4F3LB 4IEDA 4QHCA 3V3RA 4O8GA 3ZFZA 1LL5A 2WGWB 4PMAA 5M19A 2RCXA 2B95A 4E3LA 5E2FA 3WS5A 2W3FA 4KZ9A 1SDNA 5FDSA 2J3WA 1YAXA 4GKUA 4C3QA 1K0KA 4CLCA 5HPIA 1RP5A 4DKIA 2Y8HA 1XGIA 1IYSA 2ZQAA 4KQOA 4JXVA 2WGWA 2G2WA 4BD1A 2XGNA 4LPZA 1FQGA 4HBTA 3IH9A 3G4PA 3A0RA 3AGFA 3T1QB 4EBPA 4BLMA 3JVUA 2ACGA 3CHWP 2GDNA 3F1NA 3S22A 1VQQA 3EOIA 5GL9A 4GD8A 5TR7A 1PZPA 1ES2A 3HLBA 3NBLA 1O7EA 5KSHA 4I38A 3NJAA 2W3EA 3UDXA 5DF8A 1YLZA 5TBMA 3OCNA 4PKYA 4R3BA 1K54C 5GHZA 3PAGA 4GOGA 4OPRA 2WAEA 1TF1A 4X68A 1BLCA 3CI6A 3C5AA 3WS0A 1STZA 1FOFA 2HZ5A 4R1GA 4BWIA 3PBOA 1S4RA 2VGJA 4OKPA 3K2NA 4EBNA 1LLBA 3ZG9B 1F98A 3C30A 2GZAA 2O99A 4IJGA 2VGLS 1NRFA 2OOLA 1KGEA 2DCFA 4JXSA 1OMEA 3NOPC 4KG6A 1VM1A 5I5LA 4ID4A 1DY6A 4P0MA 3HREA 4H6JA 3LIFA 1BTLA 5EPHA 5HW3A 2Y59A 1NYYA 1OJ5A 5FDHA 3AGDA 1OT6A 4MCWA 2OSUA 2EWVA 5HWWA 2W3DA 1PWGA 4WF0A 1YKDA 5GLBA 3NDEA 2ZBBA 3E0YA 2EX2A 1MWRA 1XJ2A 4GLQA 3D72A 1YMSA 2DMWA 5AJGA 3P7NA 1Z6FA 4I3AA 4HP4A 3NDGA 4EEPA 1N9OA 3CPTA 4IVKA 2ZQ8A 3EWKA 3N8RA 4R4RA 3W4QA 1TDGA 1NRJA 1ZKJA 3EGDC 3IX3A 4EETB 3DTEA 3C38A 1T1AA 1G6OA 3UPPA 5FASA 3MMHA 4CLCB 4HJ3A 4UQIS 2G2UA 1FIKA 3KYEA 1K54A 4PM6A 3F1PA 1T1BA 5J8XA 5KIZA 4JXGA 2Q0OA 3DW0A 4KUKA 2Y2GA 1NLZA 1TEMA 1VHMA 1XGJA 4DDYA 2VEAA 4QD4A 1HZOA 3PBQA 3R4KA 5CEBA 4WELA 4MBFA 1BULA 4EERA 4YINA 5DF7A 3EQUA 2JC7A 2KDKA 2EFXA 4MN6A 1ES5A 3N8LA 1G28A 4WUJA 4QPRA 4PKYG 3UO9A 4L9GA 4HY8A 4OLGA 4FCFA 4DF6A 2WKHA 1DP8A 1LT0A 3Q7ZA 3GMWA 4P6ZS 2B18A 4KG5A 4JF5A 1GA9A 4Y0UA 1EI5A 4XUXA 1IYQA 3OCLA 2JKFA 2ZC6B 4OQ0A 4BBVA 3OPLA 4UA9A 5FL3A 1N9NA 5E2EA 1H3QA 5HAIA 4Y5FA 2A49A 3OC2A 4ETXA 5CHUA 3CLOA 1XX2A 4PM9A 2JN7A 2XF3A 3UMDA 3FPWA 4H8RA 4JGPA 5EVIC 4HQAA 4RX3A 3VMAA 3KO6A 1OTAA 2OLVA 3T1SA 3E2KA 4XT2B 3ZQ5A 3BY9A 3EEAA 4RA7A 5HWTA 3M2KA 2WK0A 3UE6A 4UA6A 4K91A 2QMIA 3IXGA 2XD1A 5A8BA 3BFFA 4HOIA 1SHVA 2H10A 2KX6A 5DKLA 2CC1A 4R23A 2VV7A 5L07A 1K6SA 4EV4A 3MFDA 3NOUC 4KZ3A 1BYWA 2XK1A 3V50A 3FG8A 4CLCD 2W3GA 3WRTA 5HSQA 2WUQA 5DFXA 2PD7A 2J7VA 1GSXA 1PI5A 3CPTB 2I72A 4K08A 3NY4A 5HD5A 4ZJ1A 3RXXA 4ARZA 5DKKA 1FR1A 5HAQA 4HHDA 2EX9A 4GDNA 5F82A 1ODVA 3T4JA 5AVEA 4GHIB 3DTMA 2D01A 3T4TA 5JYPA 5GLAA 1DP6A 1TS8A 3O3VA 4ARZB 4ZRRA 4QWOA 1DP9A 1XJ3A 4U3TA 2Q9MA 4BBUA 3CAXA 3WWXA 2UWXA 3ITAA 3CZDA 1QMFA 3LY4A 2QWSA 2QYBA 1CF0A 2Y2QA 2IWDA 4Y2FA 4ZJ3A 3GRJA 4UA7A 1D7EA 5J7EA 1W8YA 2W27A 4OP5A 3LI9A 2WKIA 1WE4A 4CQHA 5JYOA 4EWFA 4HNBA 1M40A 3W8KA 4BJPA 5C5KA 5DF9A 2J9PA 5E2GA 4GCZA 3C8CA 3LEZA 2WYXA 4C75A 4DE2A 3Q07A 2P74A 3N6IA 2J3TC 4PM7A 2QJ5A 3T4QA 2XQZA 2Y2HA 3O86A 4LFUA 5CXWA 2P7JA 4IVIA 3Q7VB 1MBLA 3MJQA 3A3DA 2DRWA 1F5MA 2WKQA 3DBAA 4A5RA 2HDUA 3G31A 3N4IA 2WKPA 5G4ZA 4Y0OA 3NC8A 1S0WA 1S67L 5EVLA 1SKOB 3L9KA 1ES3A 3F1OA 3HL9A 4KZ6A 3LEQA 4R3AA 5EE8A 3ZG7B 3V39A 1BLSA 5G18A 3O5YA 1LI0A 1XFNA 5KSCA 3OOVA 5HL6A 3G35A 3MKFA 4B9OA 1FCMA 1BZAA 4KQDA 2KLIA 5FI2A 1W8QA 1YT4A 2ZQCA 5FAQA 4DN0A 3IBJA 3O88A 1K57C 4OP8A 2UV0E 1TS6A 3SS5A 3V5MA 4B88A 3IXHA 2JHEA 3DWKA 2PYRA 4YFMA 5GLCA 3G30A 2H5SA 3E4OA 1N9LA 3HLWA 4PHTA 2A3UA 3MQ0A 5G4YA 2PU4A 4UEYA 3ICYA 2QZ6A 4RVAA 1I2WA 5F5YA 4BMWA 3UB5P 4FTXA 5CRFA 2Y2NA 5HFOA 1IEMA 5CERA 4NXEA 3QP2A 3LY3A 3WS4A 4GW9A 4OQIA 2VGLM 3G32A 1ESUA 1TDLA 3QP1A 1S66L 4KQRA 1ONHA 4FSFA 1PWCA 4E3KA 3WS2A 1JTDA 2BASA 2EA9A 5EM0A 4PAUA 4EQ1A 4HIAA 2A24A 1MPLA 3BFCA 1YMXA 1EW0A 3QP6A 4HESA 3C4OA 2HJEA 4MN7A 4WL9A 1S1ZA 4S2NC 3NULA 2HP5A 4ESPA 2GJ3A 2E8IA 4EBLA 4L9FA 2Y2IA 1E3UD 3BLMA 1MWUA 4GZBA 4DRTA 4OQGA 3VP0A 1DJAA 3BWLA 3A3IA 3G34A 1ZG6A 1FSYA 2ZJ9A 2PYPA 2QKPA 3T4LA 4O0PA 4D2OA 4DDSA 3F1OB 3MFXA 3W4PA 4P6ZM 5CGSA 4JF4A 5FAOA 1VETB 4B93A 1UWPX 3QNCA 3HLCA 3IF5A 4X25A 1PNEA 3DAVA 3KSGA 3DTIA 4N1XA 4WEKA 5EUAA 2IWBA 5HD3A 3CUEC 5FQ9A 3BFGA 3P09A 3CWFA 3RH8B 4DJ2A 3K3CA 4DE0A 1L2SA 1KDSA 4WZ5A 2FFFB 2PAVP 1G6AA 3GTCA 4C6YA 2PRFA 4EU0A 2HP6A 3VP1A 1JTGA 3CJMA 5DTSA 5DJTA 3VFHA 3VP4A 1DRMA 3PBRA 5HAPA 4LV3A 5FI7A 4HBUA 3LIAA 3OZHA 2XLNA 3VP2A 1VEUB 2XSSA 5AQBA 2NUTC 1LL8A 1XXMA 3LUQA 1Q2QA 2FFYA 3SW1A 2ZMFA 2M7UA 3PBSA 3F1PB 1K38A 4RQ9A 1G5UA 5FEFA 2WKRA 3D9YA 1BLHA 5DTKA 2HPBA 2V8CA 4OOYA 3UB8A 4HJ6A 2JKGA 1W5DA 1XKZA 4KZ7A 5FQKA 1NZUA 2H0TA 4CLCE 2PR6A 3MZEA 2Y79A 3TRCA 1K55C 3A3EA 3A3JA 5CTNA 2ZQ9A 1ZTUA 2PR5A 2WADA 4WBGA 2O0YA 5M18A 3B3XA 4JGRA 1M6KA 1P0ZA 1ACFA 1TS0A 4I3JA 1N4OA 2G7UA 1NJ4A 2ZMAA 3W4OA 5AQAA 4LCLA 3EGXC 5GHXA 2O9CA 2EWWA 5CGXA 3W2ZA 3HCYA 4H6JB 1Y28A 1ESIA 3T12B 3T4KA 3LR0A 1KVLA 1DJBA 4KZAA 1HLUP 1K4FA 2W1TA 2C5WB 1CEGA 3IXDA 3OBFA 4WM9A 3H82B 3MF0A 4K0XA 3UE1A 1RCJA 4Y13A 1SDEA 4R4SA 3T50A 4FOFA 1J3WA 3VV4A 3MZDA 1OTEA 4JBFA 5DVAA 5A91A 4DMZA 3BLSA 5CTMA 2V9AA 1NYMA 2VKSA 4KENB 1E25A 2XDMA 2Y2JA 1KE4A 2JKTI 3IX4A 3IWQA 2JKRM 1TVFA 3LR5A 1PW8A 1GSWA 3UY6A 4GNUA 1PFLA 4ZBEA 1GSVA 4ETZA 4XXRA 2A24B 3IWIA 3OPRA 2X02A 2JE5A 4JKTA 4MMNA 2IWCA 3H7WB 4ME4A 1PI4A 4LCMA 4UHUA 2AVXA 4B4ZA 2B02A 2IA2A 2VV8A 3GQZA 3SH7A 1BUEA 1P9WA 3S7OA 3R7WB 2ZQ7A 3PAEA 4KUOA 3SH8A 1MKIA 4MBHA 5F1GA 1GA0A 3LIBA 4Z9QA 3CMZA 4PPRA 1YM1A 5FQJA 3ZNYA 3T1RA 2WZXA 3HUOA 4IUHA 2Z2MB 4BL3A 2HDRA 4OPZA 1S6RA 1L0DA 3TW8A 4U0XA 5HDDA 4DXCA 4EXOA 3BYDA 1XPBA 3VFFA 2PDRA 1LL9A 2K7SA 1YLJA 5IHVA 4ZJ2A 3KSIA 2XEPA 3HLFA 4KZ8A 5F69A 2HGVA 1T18A 4QY6A 4O01A 3LI8A 1VB6A 3LYXA 3FKWA 4Y17A 1LSVA 2H28A 2ZC5B 1OJGA 1Y54A 4JGOA 1X0OA 3IF6C 1EWZA
chains in the Genus database with same CATH topology
4BLMA 2WGVA 4MEZA 5EE8A 3IT9A 1CI9A 1RGZA 2GDNA 3ZG7B 3V39A 3S22A 1VQQA 1EROA 4OQHA 1BLSA 4P87A 5G18A 4B4XA 5GL9A 3E2LA 4GD8A 1K56D 5TR7A 1LI0A 1PZPA 2Y55A 5FATA 1ES2A 3BFEA 5FQMA 4JLFA 5KSCA 5F1FA 3IHAA 2XFTA 3G35A 2R9XA 3HLBA 3MKFA 5EOEA 3NBLA 5DTTA 1FCMA 1O7EA 2Q9NA 5EECA 5KSHA 1BZAA 2Y2OA 5CGWA 3IQAA 3PBNA 1HD8A 3OPHA 3P98A 3S1YA 3UDXA 5DF8A 4ZAMA 1FSWA 1JWVA 1YLZA 2WKEA 4E3IA 3M2JA 5FI2A 1W8QA 2Y2LA 1YT4A 3ISGA 2ZQCA 1Q2PA 5FAQA 4DE3A 1E3UA 5I94A 3Q7VA 3OCNA 4BL2A 1PW1A 3NI9A 4IBRA 4LENA 3O88A 3NCKA 2C6WB 4R3BA 5KZHA 1JVJA 1K57C 4OP8A 4X6TA 2ZLYA 2QPNA 1K54C 3ZNTA 4R0QA 3SS5A 3V5MA 5GHZA 4B88A 3PAGA 4CPKA 3V3SA 3IXHA 1K4EA 2WAEA 4GOGA 4OPRA 4BQMA 1ONGA 1W7FA 3DWKA 5BOHA 4YFMA 4X56A 2V1ZA 5GLCA 4X68A 1H8ZA 3A3FA 2OLUA 4L0LA 1BLCA 3G30A 2ZM8A 3C5AA 3WS0A 2H5SA 3HLWA 3HBRA 1U60A 5FA7A 1FOFA 2A3UA 3ZGAB 4LV0A 4R1GA 3LO7A 2PU4A 3UDFA 3PBOA 2VGJA 4MLLA 4JPMA 4LV1A 2QZ6A 1QMEA 2BG1A 4RVAA 1I2WA 4OKPA 3UDIA 4EBNA 1LLBA 3ZG9B 1K57A 3G2ZA 4OLDA 4ZDXA 4N92A 5GLDA 5CRFA 3VP3A 2Y2NA 5HFOA 1K6RA 1XP4A 1IEMA 2X71A 3MKEA 1NRFA 4WEJA 4OH0A 4U0TA 4QB8A 1KGEA 5CERA 3HUMA 2DCFA 4N1HA 4JXSA 1IKIA 4XUZA 1OMEA 3LY3A 4KG6A 3WS4A 1JWPA 3BEBA 1VM1A 4ID4A 1KDWA 3HLDA 4OQIA 1DY6A 4P0MA 3G32A 1ESUA 2EX8A 3HREA 1TDLA 4S2NA 2X01A 4KQRA 1ONHA 3SS4A 1BTLA 5EPHA 4Y7PA 4FSFA 5HW3A 1PWCA 4E3KA 2Y59A 1NYYA 3WS2A 1JTDA 3BFDA 5FDHA 3AGDA 2OSUA 1MPLA 3BFCA 3VOZA 1PWGA 1YMXA 1KVMA 1ZC2A 1W79A 3EQVA 3QHYA 4HESA 3C4OA 3ZHHA 4S2NC 5CEDA 4KQQA 5GLBA 2HDQA 2HP5A 4KG2A 1NXYA 4GB7A 3NDEA 1FCNA 2E8IA 3ZG0A 5EOOA 2EX6A 3TSGA 1L0FA 3GV9A 2EX2A 4EUZA 1MWRA 4FD8A 5HX9A 3ZVWA 4EBLA 4HEFA 1YMSA 3GSGA 2Y2IA 1ERMA 1E3UD 3BLMA 1MWUA 4GZBA 4DRTA 1Z6FA 4OQGA 3VP0A 3C4PA 1DJAA 3NDGA 1K55A 3WRZA 2DNSA 3A3IA 3G34A 3C7UA 1ZG6A 1FSYA 2ZJ9A 3UPNA 1ES4A 2J9OA 4IVKA 4N9KA 4D2OA 4DDSA 2ZQ8A 3WS1A 3N8RA 4R4RA 3W4PA 3W4QA 5EVIB 1TDGA 4KZBA 4Q8IA 1GHPA 1ZKJA 5CGSA 4JF4A 4X55A 5FAOA 3GR2A 4BENA 3IXBA 5E2HA 3QNCA 3HLCA 1CI8A 3IF5A 3UPPA 5FASA 2Y91A 2ZQDA 4ZTKA 4N1XA 3G2YA 4WEKA 2G2UA 5EUAA 2IWBA 1PIOA 5FQ9A 2PU2A 1K54A 4PM6A 3BFGA 3P09A 3FKVA 3SOIA 5J8XA 4JXGA 3DW0A 4DE0A 1L2SA 1KDSA 4F94A 4WZ5A 2FFFB 5L2FA 2Y2GA 1BT5A 1G6AA 1KGFA 4N9LA 3GTCA 1TEMA 4C6YA 1XGJA 4DDYA 2HDSA 2XH9A 4QJGA 4QD4A 1HZOA 4OOLA 2HP6A 3PBQA 5M1AA 3VP1A 1JTGA 1JWZA 3CJMA 1KE3A 5DTSA 5CEBA 4WELA 1IELA 1BULA 4MBFA 4GDBA 3VFHA 2V2FF 3M6HA 3PBRA 4YINA 3VP4A 5HAPA 3TOIA 4JXWA 3MXSA 2JCHA 2ZD8A 4LV3A 5FI7A 2BLSA 2XR0A 2WGIA 3IHBA 5DF7A 1LHYA 3EQUA 2JC7A 2EFXA 1GHIA 2Y2MA 4RYEA 1ES5A 4HBUA 3FV7A 5A93A 3N8LA 3OZHA 3SH9A 1MWSA 2XLNA 3VP2A 2WAFA 5AQBA 3ZG8B 2Z2LB 3RJUA 3UO9A 1XXMA 4OLGA 4PM5A 1YLYA 4FCFA 2XFSA 4WZ5C 4GD6A 4DF6A 2WKHA 1Q2QA 2FFYA 3UPOA 2RL3A 4DE1A 3Q7ZA 3GMWA 4JF6A 1NY0A 4KG5A 5TGFA 1RGYA 3NIAA 1DJCA 3PBSA 4JF5A 4S2LA 5D3OA 3HVFA 3IH8A 3FWLA 4E6XA 1K38A 1GA9A 2EXAA 1L0GA 2ZC4B 1YLWA 4Y0UA 1EI5A 4UAAA 3M6BA 1KGGA 4XUXA 5HL1A 1IYQA 4O7DA 3CG5A 4EQIA 1BLHA 4KZ4A 2HPBA 2VGKA 3BRMA 3OCLA 5DTKA 5AQ7A 2Y2PA 2ZC6B 4OQ0A 3OPLA 4OOYA 4UA9A 1O07A 3GVBA 5E2EA 3MXRA 1WYBA 5HAIA 1W5DA 1XKZA 4KZ7A 2A49A 5EVIA 5FQKA 3OC2A 1NZUA 2H0TA 5CHUA 1XX2A 1CK3A 3MZEA 4PM9A 3UN7A 3PBTA 5CECA 3HUNA 1N9BA 4P85A 2XF3A 1K55C 3A3EA 5FAPA 5TFQA 4WMCD 5FSRA 3A3JA 4H8RA 4FH2A 5CTNA 2ZQ9A 5EVIC 4X69A 1MXOA 4RX3A 1I5QA 5GHYA 3S4XA 5AQ9A 1PWDA 3VMAA 1L0EA 2WADA 4P6BA 5FI6A 4WBGA 3ITBA 5KMWA 4LV2A 1ERQA 4OVDA 2OLVA 1G68A 2Y2KA 3MZFA 4MBKA 4Y0TA 3E2KA 4M3KA 5M18A 3B3XA 3HLEA 3IF6B 4RA7A 1M6KA 4GN2A 1E4DA 3M2KA 4E3OA 4QY5A 2WK0A 4UA6A 4K91A 2QMIA 5HARA 1IYPA 3IXGA 1N4OA 2XD1A 3Q1FA 4FH4A 1NJ4A 3FZCA 4CJNA 1YQSA 2ZMAA 3BFFA 3JYIA 1SHVA 1BLPA 2H10A 3W4OA 5AQAA 4LCLA 1KE0A 5GHXA 2CC1A 2B5RA 2P9VB 5CGXA 3Q82A 2ZM0A 1MY8A 4OOMA 4R23A 4S2OA 3D4FA 3UNWA 1ESIA 4DXBA 1FCOA 1K6SA 4EV4A 3MFDA 4QU3A 1KVLA 5F83A 1DJBA 4KZ3A 4KZAA 2XK1A 2P9VA 3QNBA 3V50A 1K25A 1K4FA 3ZG5A 2C5WB 4S2KA 1CEGA 3WRTA 4S2MA 5CHJA 2HP9A 3BECA 3IXDA 2WUQA 1J9MA 1FR6A 1AXBA 3HLGA 2J7VA 4WM9A 1PI5A 4K0XA 3UE1A 1RCJA 2I72A 1SDEA 4R4SA 3OPPA 2J8YA 4S2JA 3VSLA 3ZDJA 3PTEA 3NY4A 4NETA 4PM8A 5EVID 4ZJ1A 5FQQA 3MZDA 2ZC7A 3RXXA 5DVAA 4JBFA 1YLTA 1IYOA 3FYZA 3N7WA 5A91A 1FR1A 5HAQA 1HVBA 2EX9A 3BLSA 4GDNA 4MNRA 1SCWA 5CHMA 5F82A 5CTMA 1C3BA 1NYMA 2ZC3B 1GHMA 4WMCA 4S2IA 1ZG4A 3DTMA 1E25A 2XDMA 2Y2JA 4K0WA 1KE4A 3IWQA 1K56A 4KENB 5GLAA 4E3NA 3ZVTA 5JYPA 1TVFA 3O3VA 5A90A 1H5XA 4WYYA 3BM6A 1XA7A 2OV5A 4E6WA 4R3JA 1PW8A 4U3TA 3AGEA 4S2PA 3UY6A 4GNUA 2Q9MA 1XA1A 3TG9A 3Q81A 4ZBEA 3WWXA 4XXRA 3RXWA 2UWXA 2EXBA 3IWIA 3ITAA 3CZDA 3OPRA 2X02A 2JE5A 1WYCA 4JKTA 1QMFA 4OONA 1YLPA 3LY4A 2Y2QA 2IWCA 3LCEA 2IWDA 4ZJ3A 3GRJA 4IBXA 4WZ4A 4E3JA 1PI4A 4UA7A 2ZM2A 4LCMA 3I7JA 4UHUA 1W8YA 5FQIA 4B4ZA 3GQZA 1NZOA 1CEFA 4NK3A 3SH7A 4E3MA 3VSKA 1LI9A 1BUEA 2JBFA 5A92A 1IKGA 2ZQ7A 4OP5A 2EFUA 1PYYA 2WKIA 3IWOA 2WZZA 1WE4A 3UE0A 5JYOA 4EWFA 2H0YA 2XD5A 3O87A 2R9WA 1ALQA 3N8SA 1M40A 3W8KA 3PAEA 1BSGA 4BJPA 3SH8A 1MKIA 1I2SA 4MBHA 2V20A 3IF6A 4IEDA 5DF9A 3ZCZA 3UE3A 2J9PA 3C7VA 5F1GA 4QHCA 5E2GA 5U47A 1GA0A 3V3RA 4Z9QA 2Y4AA 3ZFZA 3CMZA 3LEZA 4PPRA 2WYXA 1YM1A 4C75A 4DE2A 1LL5A 4X53A 2WGWB 5FQJA 3ZNYA 3Q07A 2P74A 4PMAA 5M19A 1HTZA 2RCXA 2WZXA 3N6IA 3HUOA 4PM7A 4E3LA 5E2FA 3MBZA 2Z2MB 4BL3A 2XQZA 2HDRA 2Y2HA 4OPQA 4OPZA 1S6RA 3O86A 1L0DA 3WS5A 5CXWA 4U0XA 3VOYA 4KZ9A 1SDNA 4DXCA 1GCEA 4IVIA 3SS3A 3BYDA 4OPYA 3Q7VB 1MBLA 1XPBA 3A3DA 4GKUA 3VFFA 2DRWA 4C3QA 1LL9A 2PBYA 1RP5A 1YLJA 5IHVA 4DKIA 1H8YA 4A5RA 4ZJ2A 1XGIA 2HDUA 1IYSA 1SKFA 2XEPA 2ZQAA 3HLFA 3G31A 4JXVA 4KQOA 2WGWA 3N4IA 4KZ8A 4RX2A 2G2WA 5E43A 4QY6A 4Y0OA 4BD1A 1S0WA 3NC8A 2XGNA 3FKWA 4KZ5A 1MWTA 5EVLA 2ZC5B 1FQGA 1PZOA 4HBTA 1Y54A 1ES3A 3IF6C 3HL9A 3IH9A 1EWZA 3G4PA 4KZ6A 4BD0A 3AGFA 4EBPA 3DWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BLM A;  2WGV A;  4MEZ A;  5EE8 A;  3IT9 A;  1CI9 A;  1RGZ A;  2GDN A;  3ZG7 B;  3V39 A;  3S22 A;  1VQQ A;  1ERO A;  4OQH A;  1BLS A;  4P87 A;  5G18 A;  4B4X A;  5GL9 A;  3E2L A;  4GD8 A;  1K56 D;  5TR7 A;  1LI0 A;  1PZP A;  2Y55 A;  5FAT A;  1ES2 A;  3BFE A;  5FQM A;  4JLF A;  5KSC A;  5F1F A;  3IHA A;  2XFT A;  3G35 A;  2R9X A;  3HLB A;  3MKF A;  5EOE A;  3NBL A;  5DTT A;  1FCM A;  1O7E A;  2Q9N A;  5EEC A;  5KSH A;  1BZA A;  2Y2O A;  5CGW A;  3IQA A;  3PBN A;  1HD8 A;  3OPH A;  3P98 A;  3S1Y A;  3UDX A;  5DF8 A;  4ZAM A;  1FSW A;  1JWV A;  1YLZ A;  2WKE A;  4E3I A;  3M2J A;  5FI2 A;  1W8Q A;  2Y2L A;  1YT4 A;  3ISG A;  2ZQC A;  1Q2P A;  5FAQ A;  4DE3 A;  1E3U A;  5I94 A;  3Q7V A;  3OCN A;  4BL2 A;  1PW1 A;  3NI9 A;  4IBR A;  4LEN A;  3O88 A;  3NCK A;  2C6W B;  4R3B A;  5KZH A;  1JVJ A;  1K57 C;  4OP8 A;  4X6T A;  2ZLY A;  2QPN A;  1K54 C;  3ZNT A;  4R0Q A;  3SS5 A;  3V5M A;  5GHZ A;  4B88 A;  3PAG A;  4CPK A;  3V3S A;  3IXH A;  1K4E A;  2WAE A;  4GOG A;  4OPR A;  4BQM A;  1ONG A;  1W7F A;  3DWK A;  5BOH A;  4YFM A;  4X56 A;  2V1Z A;  5GLC A;  4X68 A;  1H8Z A;  3A3F A;  2OLU A;  4L0L A;  1BLC A;  3G30 A;  2ZM8 A;  3C5A A;  3WS0 A;  2H5S A;  3HLW A;  3HBR A;  1U60 A;  5FA7 A;  1FOF A;  2A3U A;  3ZGA B;  4LV0 A;  4R1G A;  3LO7 A;  2PU4 A;  3UDF A;  3PBO A;  2VGJ A;  4MLL A;  4JPM A;  4LV1 A;  2QZ6 A;  1QME A;  2BG1 A;  4RVA A;  1I2W A;  4OKP A;  3UDI A;  4EBN A;  1LLB A;  3ZG9 B;  1K57 A;  3G2Z A;  4OLD A;  4ZDX A;  4N92 A;  5GLD A;  5CRF A;  3VP3 A;  2Y2N A;  5HFO A;  1K6R A;  1XP4 A;  1IEM A;  2X71 A;  3MKE A;  1NRF A;  4WEJ A;  4OH0 A;  4U0T A;  4QB8 A;  1KGE A;  5CER A;  3HUM A;  2DCF A;  4N1H A;  4JXS A;  1IKI A;  4XUZ A;  1OME A;  3LY3 A;  4KG6 A;  3WS4 A;  1JWP A;  3BEB A;  1VM1 A;  4ID4 A;  1KDW A;  3HLD A;  4OQI A;  1DY6 A;  4P0M A;  3G32 A;  1ESU A;  2EX8 A;  3HRE A;  1TDL A;  4S2N A;  2X01 A;  4KQR A;  1ONH A;  3SS4 A;  1BTL A;  5EPH A;  4Y7P A;  4FSF A;  5HW3 A;  1PWC A;  4E3K A;  2Y59 A;  1NYY A;  3WS2 A;  1JTD A;  3BFD A;  5FDH A;  3AGD A;  2OSU A;  1MPL A;  3BFC A;  3VOZ A;  1PWG A;  1YMX A;  1KVM A;  1ZC2 A;  1W79 A;  3EQV A;  3QHY A;  4HES A;  3C4O A;  3ZHH A;  4S2N C;  5CED A;  4KQQ A;  5GLB A;  2HDQ A;  2HP5 A;  4KG2 A;  1NXY A;  4GB7 A;  3NDE A;  1FCN A;  2E8I A;  3ZG0 A;  5EOO A;  2EX6 A;  3TSG A;  1L0F A;  3GV9 A;  2EX2 A;  4EUZ A;  1MWR A;  4FD8 A;  5HX9 A;  3ZVW A;  4EBL A;  4HEF A;  1YMS A;  3GSG A;  2Y2I A;  1ERM A;  1E3U D;  3BLM A;  1MWU A;  4GZB A;  4DRT A;  1Z6F A;  4OQG A;  3VP0 A;  3C4P A;  1DJA A;  3NDG A;  1K55 A;  3WRZ A;  2DNS A;  3A3I A;  3G34 A;  3C7U A;  1ZG6 A;  1FSY A;  2ZJ9 A;  3UPN A;  1ES4 A;  2J9O A;  4IVK A;  4N9K A;  4D2O A;  4DDS A;  2ZQ8 A;  3WS1 A;  3N8R A;  4R4R A;  3W4P A;  3W4Q A;  5EVI B;  1TDG A;  4KZB A;  4Q8I A;  1GHP A;  1ZKJ A;  5CGS A;  4JF4 A;  4X55 A;  5FAO A;  3GR2 A;  4BEN A;  3IXB A;  5E2H A;  3QNC A;  3HLC A;  1CI8 A;  3IF5 A;  3UPP A;  5FAS A;  2Y91 A;  2ZQD A;  4ZTK A;  4N1X A;  3G2Y A;  4WEK A;  2G2U A;  5EUA A;  2IWB A;  1PIO A;  5FQ9 A;  2PU2 A;  1K54 A;  4PM6 A;  3BFG A;  3P09 A;  3FKV A;  3SOI A;  5J8X A;  4JXG A;  3DW0 A;  4DE0 A;  1L2S A;  1KDS A;  4F94 A;  4WZ5 A;  2FFF B;  5L2F A;  2Y2G A;  1BT5 A;  1G6A A;  1KGF A;  4N9L A;  3GTC A;  1TEM A;  4C6Y A;  1XGJ A;  4DDY A;  2HDS A;  2XH9 A;  4QJG A;  4QD4 A;  1HZO A;  4OOL A;  2HP6 A;  3PBQ A;  5M1A A;  3VP1 A;  1JTG A;  1JWZ A;  3CJM A;  1KE3 A;  5DTS A;  5CEB A;  4WEL A;  1IEL A;  1BUL A;  4MBF A;  4GDB A;  3VFH A;  2V2F F;  3M6H A;  3PBR A;  4YIN A;  3VP4 A;  5HAP A;  3TOI A;  4JXW A;  3MXS A;  2JCH A;  2ZD8 A;  4LV3 A;  5FI7 A;  2BLS A;  2XR0 A;  2WGI A;  3IHB A;  5DF7 A;  1LHY A;  3EQU A;  2JC7 A;  2EFX A;  1GHI A;  2Y2M A;  4RYE A;  1ES5 A;  4HBU A;  3FV7 A;  5A93 A;  3N8L A;  3OZH A;  3SH9 A;  1MWS A;  2XLN A;  3VP2 A;  2WAF A;  5AQB A;  3ZG8 B;  2Z2L B;  3RJU A;  3UO9 A;  1XXM A;  4OLG A;  4PM5 A;  1YLY A;  4FCF A;  2XFS A;  4WZ5 C;  4GD6 A;  4DF6 A;  2WKH A;  1Q2Q A;  2FFY A;  3UPO A;  2RL3 A;  4DE1 A;  3Q7Z A;  3GMW A;  4JF6 A;  1NY0 A;  4KG5 A;  5TGF A;  1RGY A;  3NIA A;  1DJC A;  3PBS A;  4JF5 A;  4S2L A;  5D3O A;  3HVF A;  3IH8 A;  3FWL A;  4E6X A;  1K38 A;  1GA9 A;  2EXA A;  1L0G A;  2ZC4 B;  1YLW A;  4Y0U A;  1EI5 A;  4UAA A;  3M6B A;  1KGG A;  4XUX A;  5HL1 A;  1IYQ A;  4O7D A;  3CG5 A;  4EQI A;  1BLH A;  4KZ4 A;  2HPB A;  2VGK A;  3BRM A;  3OCL A;  5DTK A;  5AQ7 A;  2Y2P A;  2ZC6 B;  4OQ0 A;  3OPL A;  4OOY A;  4UA9 A;  1O07 A;  3GVB A;  5E2E A;  3MXR A;  1WYB A;  5HAI A;  1W5D A;  1XKZ A;  4KZ7 A;  2A49 A;  5EVI A;  5FQK A;  3OC2 A;  1NZU A;  2H0T A;  5CHU A;  1XX2 A;  1CK3 A;  3MZE A;  4PM9 A;  3UN7 A;  3PBT A;  5CEC A;  3HUN A;  1N9B A;  4P85 A;  2XF3 A;  1K55 C;  3A3E A;  5FAP A;  5TFQ A;  4WMC D;  5FSR A;  3A3J A;  4H8R A;  4FH2 A;  5CTN A;  2ZQ9 A;  5EVI C;  4X69 A;  1MXO A;  4RX3 A;  1I5Q A;  5GHY A;  3S4X A;  5AQ9 A;  1PWD A;  3VMA A;  1L0E A;  2WAD A;  4P6B A;  5FI6 A;  4WBG A;  3ITB A;  5KMW A;  4LV2 A;  1ERQ A;  4OVD A;  2OLV A;  1G68 A;  2Y2K A;  3MZF A;  4MBK A;  4Y0T A;  3E2K A;  4M3K A;  5M18 A;  3B3X A;  3HLE A;  3IF6 B;  4RA7 A;  1M6K A;  4GN2 A;  1E4D A;  3M2K A;  4E3O A;  4QY5 A;  2WK0 A;  4UA6 A;  4K91 A;  2QMI A;  5HAR A;  1IYP A;  3IXG A;  1N4O A;  2XD1 A;  3Q1F A;  4FH4 A;  1NJ4 A;  3FZC A;  4CJN A;  1YQS A;  2ZMA A;  3BFF A;  3JYI A;  1SHV A;  1BLP A;  2H10 A;  3W4O A;  5AQA A;  4LCL A;  1KE0 A;  5GHX A;  2CC1 A;  2B5R A;  2P9V B;  5CGX A;  3Q82 A;  2ZM0 A;  1MY8 A;  4OOM A;  4R23 A;  4S2O A;  3D4F A;  3UNW A;  1ESI A;  4DXB A;  1FCO A;  1K6S A;  4EV4 A;  3MFD A;  4QU3 A;  1KVL A;  5F83 A;  1DJB A;  4KZ3 A;  4KZA A;  2XK1 A;  2P9V A;  3QNB A;  3V50 A;  1K25 A;  1K4F A;  3ZG5 A;  2C5W B;  4S2K A;  1CEG A;  3WRT A;  4S2M A;  5CHJ A;  2HP9 A;  3BEC A;  3IXD A;  2WUQ A;  1J9M A;  1FR6 A;  1AXB A;  3HLG A;  2J7V A;  4WM9 A;  1PI5 A;  4K0X A;  3UE1 A;  1RCJ A;  2I72 A;  1SDE A;  4R4S A;  3OPP A;  2J8Y A;  4S2J A;  3VSL A;  3ZDJ A;  3PTE A;  3NY4 A;  4NET A;  4PM8 A;  5EVI D;  4ZJ1 A;  5FQQ A;  3MZD A;  2ZC7 A;  3RXX A;  5DVA A;  4JBF A;  1YLT A;  1IYO A;  3FYZ A;  3N7W A;  5A91 A;  1FR1 A;  5HAQ A;  1HVB A;  2EX9 A;  3BLS A;  4GDN A;  4MNR A;  1SCW A;  5CHM A;  5F82 A;  5CTM A;  1C3B A;  1NYM A;  2ZC3 B;  1GHM A;  4WMC A;  4S2I A;  1ZG4 A;  3DTM A;  1E25 A;  2XDM A;  2Y2J A;  4K0W A;  1KE4 A;  3IWQ A;  1K56 A;  4KEN B;  5GLA A;  4E3N A;  3ZVT A;  5JYP A;  1TVF A;  3O3V A;  5A90 A;  1H5X A;  4WYY A;  3BM6 A;  1XA7 A;  2OV5 A;  4E6W A;  4R3J A;  1PW8 A;  4U3T A;  3AGE A;  4S2P A;  3UY6 A;  4GNU A;  2Q9M A;  1XA1 A;  3TG9 A;  3Q81 A;  4ZBE A;  3WWX A;  4XXR A;  3RXW A;  2UWX A;  2EXB A;  3IWI A;  3ITA A;  3CZD A;  3OPR A;  2X02 A;  2JE5 A;  1WYC A;  4JKT A;  1QMF A;  4OON A;  1YLP A;  3LY4 A;  2Y2Q A;  2IWC A;  3LCE A;  2IWD A;  4ZJ3 A;  3GRJ A;  4IBX A;  4WZ4 A;  4E3J A;  1PI4 A;  4UA7 A;  2ZM2 A;  4LCM A;  3I7J A;  4UHU A;  1W8Y A;  5FQI A;  4B4Z A;  3GQZ A;  1NZO A;  1CEF A;  4NK3 A;  3SH7 A;  4E3M A;  3VSK A;  1LI9 A;  1BUE A;  2JBF A;  5A92 A;  1IKG A;  2ZQ7 A;  4OP5 A;  2EFU A;  1PYY A;  2WKI A;  3IWO A;  2WZZ A;  1WE4 A;  3UE0 A;  5JYO A;  4EWF A;  2H0Y A;  2XD5 A;  3O87 A;  2R9W A;  1ALQ A;  3N8S A;  1M40 A;  3W8K A;  3PAE A;  1BSG A;  4BJP A;  3SH8 A;  1MKI A;  1I2S A;  4MBH A;  2V20 A;  3IF6 A;  4IED A;  5DF9 A;  3ZCZ A;  3UE3 A;  2J9P A;  3C7V A;  5F1G A;  4QHC A;  5E2G A;  5U47 A;  1GA0 A;  3V3R A;  4Z9Q A;  2Y4A A;  3ZFZ A;  3CMZ A;  3LEZ A;  4PPR A;  2WYX A;  1YM1 A;  4C75 A;  4DE2 A;  1LL5 A;  4X53 A;  2WGW B;  5FQJ A;  3ZNY A;  3Q07 A;  2P74 A;  4PMA A;  5M19 A;  1HTZ A;  2RCX A;  2WZX A;  3N6I A;  3HUO A;  4PM7 A;  4E3L A;  5E2F A;  3MBZ A;  2Z2M B;  4BL3 A;  2XQZ A;  2HDR A;  2Y2H A;  4OPQ A;  4OPZ A;  1S6R A;  3O86 A;  1L0D A;  3WS5 A;  5CXW A;  4U0X A;  3VOY A;  4KZ9 A;  1SDN A;  4DXC A;  1GCE A;  4IVI A;  3SS3 A;  3BYD A;  4OPY A;  3Q7V B;  1MBL A;  1XPB A;  3A3D A;  4GKU A;  3VFF A;  2DRW A;  4C3Q A;  1LL9 A;  2PBY A;  1RP5 A;  1YLJ A;  5IHV A;  4DKI A;  1H8Y A;  4A5R A;  4ZJ2 A;  1XGI A;  2HDU A;  1IYS A;  1SKF A;  2XEP A;  2ZQA A;  3HLF A;  3G31 A;  4JXV A;  4KQO A;  2WGW A;  3N4I A;  4KZ8 A;  4RX2 A;  2G2W A;  5E43 A;  4QY6 A;  4Y0O A;  4BD1 A;  1S0W A;  3NC8 A;  2XGN A;  3FKW A;  4KZ5 A;  1MWT A;  5EVL A;  2ZC5 B;  1FQG A;  1PZO A;  4HBT A;  1Y54 A;  1ES3 A;  3IF6 C;  3HL9 A;  3IH9 A;  1EWZ A;  3G4P A;  4KZ6 A;  4BD0 A;  3AGF A;  4EBP A;  3DWZ A; 
#chains in the Genus database with same CATH topology
 2WGV A;  4MEZ A;  3GEC A;  4LGW A;  1RGZ A;  3LIE A;  1ERO A;  4P87 A;  3A0V A;  2L1M A;  3E2L A;  3B33 A;  1K56 D;  2V8F A;  5FQM A;  4JLF A;  3BW6 A;  3IHA A;  2R9X A;  4GS9 A;  4E04 A;  2Q9N A;  2Y2O A;  1HD8 A;  3OPH A;  3P98 A;  3LGO A;  3M2J A;  1OTD A;  2Y2L A;  3JVV A;  4YWZ A;  1Q2P A;  5I94 A;  3Q7V A;  4BL2 A;  1PW1 A;  2C6W B;  2GX5 A;  5KZH A;  2ZLY A;  1T19 A;  3CUE A;  3LR3 A;  4CPK A;  1K4E A;  4BQM A;  3KX0 X;  1ONG A;  3V67 A;  2L0W A;  1H8Z A;  4L0L A;  2ZM8 A;  2VV6 A;  1VET A;  3HBR A;  4DJ3 A;  1U60 A;  4G3K A;  3ZGA B;  4EUV A;  4MLL A;  4JPM A;  4LV1 A;  1QME A;  4HH3 A;  2KOI A;  5HPF A;  3CIT A;  4BBT A;  4EEU A;  4OLD A;  4ZDX A;  4N92 A;  3VP3 A;  4U0T A;  4QB8 A;  1V9Y A;  3HUM A;  4N1H A;  3S7P A;  3BEB A;  2J80 A;  2EX8 A;  1MZU A;  3SS4 A;  1S1Y A;  4IHQ A;  3MS6 A;  3GDI A;  3U4L P;  4Q0J A;  4L9E A;  5TBM B;  1ZC2 A;  1W79 A;  1LSX A;  1XJ6 A;  2K2N A;  5CED A;  4KQQ A;  2HDQ A;  4GB7 A;  5EOO A;  4GHI A;  3TSG A;  1L0F A;  3DTK A;  2W1R A;  2I9V A;  4II7 A;  3U2A A;  3GSG A;  2VJW A;  1ERM A;  3C4P A;  3WRZ A;  1Y4O A;  2DNS A;  4R38 A;  3UPN A;  2J9O A;  3NEC A;  3WS1 A;  1MKM A;  4HH2 A;  5EVI B;  1LSW A;  4Q8I A;  1GHP A;  4X55 A;  3GR2 A;  5E2H A;  5IT5 A;  3UB9 A;  1CI8 A;  2ZQD A;  4ZTK A;  3VOL A;  3B42 A;  1F9I A;  3FKV A;  4F94 A;  3IX8 A;  5L2F A;  1BT5 A;  4WN5 A;  2V0U A;  1VEU A;  2K31 A;  2HDS A;  5CX7 A;  3HJK A;  4LRY C;  2XH9 A;  4QJG A;  2NUP C;  5HZH A;  2V2F F;  2VA0 A;  1YSQ A;  2JCH A;  2ZD8 A;  2BLS A;  2XR0 A;  2VZW A;  3LFV A;  4NG2 A;  1F2K A;  2WGI A;  3IHB A;  1OPX A;  3FC7 A;  2Y2M A;  4RYE A;  5A93 A;  3UB7 A;  1WA9 A;  3LID A;  4PM5 A;  3OLO A;  4GD6 A;  5F68 A;  4DE1 A;  1NY0 A;  1RGY A;  3NIA A;  5D3O A;  4S2L A;  3IS2 A;  3HVF A;  3IH8 A;  2EXA A;  1KGG A;  3P01 A;  1IOU A;  4O7D A;  4EQI A;  5HWV A;  3VOY A;  2MJ6 A;  3BRM A;  4Q0I A;  1O07 A;  3GVB A;  2A2L A;  2QHK A;  1CQA A;  1WYB A;  2O9B A;  3UN7 A;  3PBT A;  2O9A A;  4P85 A;  3UME A;  5TFQ A;  5FAP A;  5FSR A;  2L4R A;  4NXG A;  4FH2 A;  1MXO A;  1I5Q A;  2J3T D;  5GHY A;  5AQ9 A;  1PWD A;  3S4X A;  1L0E A;  2M1C A;  5FI6 A;  3ITB A;  4OVD A;  1G68 A;  4MBK A;  4Y0T A;  4M3K A;  1D1J A;  1NLY A;  3IF6 B;  1ZHH B;  4E3O A;  3PXP A;  5HAR A;  3QP4 A;  4Y3I A;  4CJN A;  1YQS A;  1YSP A;  3JYI A;  3KSH A;  1BLP A;  2FZ0 A;  1A0K A;  2B5R A;  2P9V B;  3Q82 A;  2ZM0 A;  1MY8 A;  4S2O A;  3UNW A;  3T1X A;  4DXB A;  1D06 A;  1FCO A;  2E8J A;  3KYZ A;  5L09 A;  4S2K A;  5CHJ A;  2HP9 A;  3JPU A;  1J9M A;  1AXB A;  3HLG A;  3OPP A;  2J8Y A;  5HDC A;  4S2J A;  3SZT A;  1TS7 A;  3PTE A;  2PHY A;  4AFI A;  2D02 A;  5EVI D;  2INW A;  3BY8 A;  5FQQ A;  2XRN A;  2JKT M;  1IYO A;  3FYZ A;  2ZOI A;  1V9Z A;  1SCW A;  1AWI A;  1P9R A;  1C3B A;  2ZC3 B;  4WMC A;  4S2I A;  4NXF A;  4K0W A;  4WLA A;  3VE3 A;  1K56 A;  5MC7 A;  1H5X A;  3BM6 A;  2OV5 A;  4E6W A;  2XRO A;  2V0W A;  4R3J A;  3S7Q A;  3AGE A;  1XA1 A;  3TG9 A;  3Q81 A;  1OTI A;  3RXW A;  2EXB A;  2GNX A;  1WYC A;  4FUW A;  3BQA A;  2QJ7 A;  3ULF A;  3TE8 A;  3LCE A;  4E3J A;  4IBX A;  2ZM2 A;  5J3W A;  1NZO A;  1CEF A;  4NK3 A;  2W3H A;  3VSK A;  4EES A;  4JGQ A;  2JBF A;  1FIL A;  1IKG A;  2Z6D A;  1PYY A;  4G3W A;  3UE0 A;  2PBD P;  2XD5 A;  3N8S A;  1XFQ A;  1BSG A;  3PHY A;  3C2W A;  1I2S A;  2V20 A;  3IF6 A;  3ZCZ A;  1MC0 A;  3UE3 A;  3C7V A;  4XT2 A;  5U47 A;  2Y4A A;  5L10 A;  2HF6 A;  4X53 A;  1TD5 A;  1XJ4 A;  3E4P A;  1HTZ A;  3UB6 A;  3MBZ A;  4OPQ A;  4YNR A;  1GCE A;  3SS3 A;  4OPY A;  5HDS A;  2PBY A;  3BQ8 A;  1H8Y A;  1SKF A;  4MN5 A;  4RX2 A;  5E43 A;  1NWZ A;  2YKF A;  4KZ5 A;  3G6O A;  1MWT A;  1PZO A;  3NOT C;  4BD0 A;  4NKP A;  3DWZ A;  3IT9 A;  1CI9 A;  3F1N B;  4OQH A;  4R6L A;  4B4X A;  2M7V A;  5DFY A;  2Y55 A;  5FAT A;  3BFE A;  4LLO B;  4NXB A;  5F1F A;  3D3O A;  3FPV A;  2XFT A;  3IBR A;  4HI4 A;  5EOE A;  5DTT A;  5EEC A;  4HP9 A;  5CGW A;  3IQA A;  3PBN A;  3S1Y A;  4ZAM A;  1FSW A;  1JWV A;  1JNU A;  2WKE A;  4E3I A;  5EFW A;  1YPR A;  3ISG A;  4DE3 A;  2VX8 A;  1E3U A;  1S4S A;  3NI9 A;  4IBR A;  4LEN A;  3NCK A;  1W63 M;  1JVJ A;  4X6T A;  2QPN A;  3ZNT A;  4R0Q A;  2V1A A;  3V3S A;  1W7F A;  2VK3 A;  5BOH A;  4X56 A;  2V1Z A;  2LB9 A;  3A3F A;  2OLU A;  3B47 A;  3H9W A;  2Z6C A;  5FA7 A;  4X1M A;  4HJ4 A;  4LV0 A;  1UWN X;  3LO7 A;  3UDF A;  5F6A A;  3TJZ C;  2BG1 A;  3MQO A;  3PR6 A;  5IU1 A;  4F3L A;  3UDI A;  2XA7 S;  1K57 A;  3G2Z A;  5GLD A;  1K6R A;  1XP4 A;  2X71 A;  3MKE A;  3MQQ A;  4WEJ A;  4OH0 A;  1IKI A;  4XUZ A;  1IFQ A;  1JWP A;  2ZMV A;  1KDW A;  3HLD A;  3MSH A;  1OT9 A;  4S2N A;  2X01 A;  4Y7P A;  3S7N A;  3BFD A;  2LB5 A;  2P04 A;  3E4Q A;  3BJN A;  3VOZ A;  3KYQ A;  1KVM A;  1PRQ A;  3EQV A;  3QHY A;  3ZHH A;  1OTB A;  4KG2 A;  1L3L A;  1NXY A;  1FCN A;  4R70 A;  3ZG0 A;  2EX6 A;  5LBR A;  3GV9 A;  4EUZ A;  4YOF A;  4FD8 A;  5HX9 A;  3ZVW A;  4HEF A;  5TJJ A;  2YKH A;  1K55 A;  3C7U A;  4Z1W A;  1ES4 A;  4N9K A;  3H82 A;  1SKO A;  4KZB A;  2W1T B;  4EW7 A;  4BEN A;  3IXB A;  4LRX C;  2Y91 A;  3G2Y A;  1PIO A;  4Y15 A;  2PU2 A;  3KSF A;  3QP8 A;  3LR4 A;  4LRZ E;  3SOI A;  3T4O A;  1KGF A;  4N9L A;  5J4E A;  2BTF P;  2P08 A;  3RFB A;  4I39 A;  4OOL A;  5M1A A;  1JWZ A;  1KE3 A;  1IEL A;  4GDB A;  3M6H A;  1P97 A;  4IUK A;  4JXW A;  3MXS A;  3TOI A;  2V1B A;  1LHY A;  1GHI A;  4M4X A;  2CMN A;  3FV7 A;  3SH9 A;  1MWS A;  2WAF A;  4I3I A;  3ZG8 B;  2Z2L B;  3RJU A;  1YLY A;  2XFS A;  4WZ5 C;  1CJF A;  3UPO A;  2RL3 A;  1Z09 A;  5K5B A;  4JF6 A;  2HV1 A;  5TGF A;  1DJC A;  4E6X A;  3FWL A;  4D60 A;  1L0G A;  2ZC4 B;  1YLW A;  4UAA A;  3M6B A;  5HL1 A;  3QP5 A;  1KOU A;  3CG5 A;  3HJI A;  4KZ4 A;  2VGK A;  5AQ7 A;  2Y2P A;  2W0N A;  5EV0 A;  3NHQ A;  5L8M A;  5EVE A;  2ZOH A;  3MXR A;  2FH5 A;  5EVI A;  3MR0 A;  2VLG A;  2OWH A;  1CK3 A;  5FEG A;  5CEC A;  3L7H A;  3HUN A;  1N9B A;  3ZYT A;  4WMC D;  4X69 A;  2HJ9 C;  4NEE D;  4P6B A;  5KMW A;  4LV2 A;  1UGU A;  1ERQ A;  4UQI M;  2Y2K A;  3MZF A;  3HLE A;  4I5S A;  2PT7 A;  3RTY A;  4GN2 A;  1E4D A;  2ZL1 B;  4QY5 A;  1IYP A;  4Q0H A;  4MDZ A;  3T4S A;  3Q1F A;  4FH4 A;  3FZC A;  3R7W A;  1SZV A;  5EM1 A;  1H0M A;  1KE0 A;  4OOM A;  2OAQ 1;  2JKR I;  3D4F A;  4QU3 A;  4GJ4 A;  5F83 A;  2P9V A;  3K3D A;  3QNB A;  3H7W A;  1K25 A;  2R78 A;  3ZG5 A;  4S2M A;  3BEC A;  3MXQ A;  4G3V A;  1FR6 A;  3VSL A;  1T1C A;  4X1L A;  3ZDJ A;  4NET A;  4PM8 A;  3EEH A;  2ZC7 A;  1YLT A;  3N7W A;  1HVB A;  4MNR A;  5CHM A;  1GHM A;  1ZG4 A;  5AVF A;  4E3N A;  3ZVT A;  3E98 A;  5A90 A;  4WYY A;  1XA7 A;  1H8M A;  4CLC C;  3A0S A;  4S2P A;  2OAP 1;  4OON A;  1YLP A;  3LIC A;  2XA7 M;  4WZ4 A;  2OWJ A;  3I7J A;  5FQI A;  4GS9 B;  5DJU A;  4E3M A;  3IS2 B;  1LI9 A;  5A92 A;  1W63 Q;  2PD8 A;  2EFU A;  3IWO A;  2WZZ A;  3PYP A;  5IS1 A;  2H0Y A;  3O87 A;  2R9W A;  1ALQ A;  3VE4 A;  2ZL1 A;  4F3L B;  4IED A;  4QHC A;  3V3R A;  4O8G A;  3ZFZ A;  1LL5 A;  2WGW B;  4PMA A;  5M19 A;  2RCX A;  2B95 A;  4E3L A;  5E2F A;  3WS5 A;  2W3F A;  4KZ9 A;  1SDN A;  5FDS A;  2J3W A;  1YAX A;  4GKU A;  4C3Q A;  1K0K A;  4CLC A;  5HPI A;  1RP5 A;  4DKI A;  2Y8H A;  1XGI A;  1IYS A;  2ZQA A;  4KQO A;  4JXV A;  2WGW A;  2G2W A;  4BD1 A;  2XGN A;  4LPZ A;  1FQG A;  4HBT A;  3IH9 A;  3G4P A;  3A0R A;  3AGF A;  3T1Q B;  4EBP A;  4BLM A;  3JVU A;  2ACG A;  3CHW P;  2GDN A;  3F1N A;  3S22 A;  1VQQ A;  3EOI A;  5GL9 A;  4GD8 A;  5TR7 A;  1PZP A;  1ES2 A;  3HLB A;  3NBL A;  1O7E A;  5KSH A;  4I38 A;  3NJA A;  2W3E A;  3UDX A;  5DF8 A;  1YLZ A;  5TBM A;  3OCN A;  4PKY A;  4R3B A;  1K54 C;  5GHZ A;  3PAG A;  4GOG A;  4OPR A;  2WAE A;  1TF1 A;  4X68 A;  1BLC A;  3CI6 A;  3C5A A;  3WS0 A;  1STZ A;  1FOF A;  2HZ5 A;  4R1G A;  4BWI A;  3PBO A;  1S4R A;  2VGJ A;  4OKP A;  3K2N A;  4EBN A;  1LLB A;  3ZG9 B;  1F98 A;  3C30 A;  2GZA A;  2O99 A;  4IJG A;  2VGL S;  1NRF A;  2OOL A;  1KGE A;  2DCF A;  4JXS A;  1OME A;  3NOP C;  4KG6 A;  1VM1 A;  5I5L A;  4ID4 A;  1DY6 A;  4P0M A;  3HRE A;  4H6J A;  3LIF A;  1BTL A;  5EPH A;  5HW3 A;  2Y59 A;  1NYY A;  1OJ5 A;  5FDH A;  3AGD A;  1OT6 A;  4MCW A;  2OSU A;  2EWV A;  5HWW A;  2W3D A;  1PWG A;  4WF0 A;  1YKD A;  5GLB A;  3NDE A;  2ZBB A;  3E0Y A;  2EX2 A;  1MWR A;  1XJ2 A;  4GLQ A;  3D72 A;  1YMS A;  2DMW A;  5AJG A;  3P7N A;  1Z6F A;  4I3A A;  4HP4 A;  3NDG A;  4EEP A;  1N9O A;  3CPT A;  4IVK A;  2ZQ8 A;  3EWK A;  3N8R A;  4R4R A;  3W4Q A;  1TDG A;  1NRJ A;  1ZKJ A;  3EGD C;  3IX3 A;  4EET B;  3DTE A;  3C38 A;  1T1A A;  1G6O A;  3UPP A;  5FAS A;  3MMH A;  4CLC B;  4HJ3 A;  4UQI S;  2G2U A;  1FIK A;  3KYE A;  1K54 A;  4PM6 A;  3F1P A;  1T1B A;  5J8X A;  5KIZ A;  4JXG A;  2Q0O A;  3DW0 A;  4KUK A;  2Y2G A;  1NLZ A;  1TEM A;  1VHM A;  1XGJ A;  4DDY A;  2VEA A;  4QD4 A;  1HZO A;  3PBQ A;  3R4K A;  5CEB A;  4WEL A;  4MBF A;  1BUL A;  4EER A;  4YIN A;  5DF7 A;  3EQU A;  2JC7 A;  2KDK A;  2EFX A;  4MN6 A;  1ES5 A;  3N8L A;  1G28 A;  4WUJ A;  4QPR A;  4PKY G;  3UO9 A;  4L9G A;  4HY8 A;  4OLG A;  4FCF A;  4DF6 A;  2WKH A;  1DP8 A;  1LT0 A;  3Q7Z A;  3GMW A;  4P6Z S;  2B18 A;  4KG5 A;  4JF5 A;  1GA9 A;  4Y0U A;  1EI5 A;  4XUX A;  1IYQ A;  3OCL A;  2JKF A;  2ZC6 B;  4OQ0 A;  4BBV A;  3OPL A;  4UA9 A;  5FL3 A;  1N9N A;  5E2E A;  1H3Q A;  5HAI A;  4Y5F A;  2A49 A;  3OC2 A;  4ETX A;  5CHU A;  3CLO A;  1XX2 A;  4PM9 A;  2JN7 A;  2XF3 A;  3UMD A;  3FPW A;  4H8R A;  4JGP A;  5EVI C;  4HQA A;  4RX3 A;  3VMA A;  3KO6 A;  1OTA A;  2OLV A;  3T1S A;  3E2K A;  4XT2 B;  3ZQ5 A;  3BY9 A;  3EEA A;  4RA7 A;  5HWT A;  3M2K A;  2WK0 A;  3UE6 A;  4UA6 A;  4K91 A;  2QMI A;  3IXG A;  2XD1 A;  5A8B A;  3BFF A;  4HOI A;  1SHV A;  2H10 A;  2KX6 A;  5DKL A;  2CC1 A;  4R23 A;  2VV7 A;  5L07 A;  1K6S A;  4EV4 A;  3MFD A;  3NOU C;  4KZ3 A;  1BYW A;  2XK1 A;  3V50 A;  3FG8 A;  4CLC D;  2W3G A;  3WRT A;  5HSQ A;  2WUQ A;  5DFX A;  2PD7 A;  2J7V A;  1GSX A;  1PI5 A;  3CPT B;  2I72 A;  4K08 A;  3NY4 A;  5HD5 A;  4ZJ1 A;  3RXX A;  4ARZ A;  5DKK A;  1FR1 A;  5HAQ A;  4HHD A;  2EX9 A;  4GDN A;  5F82 A;  1ODV A;  3T4J A;  5AVE A;  4GHI B;  3DTM A;  2D01 A;  3T4T A;  5JYP A;  5GLA A;  1DP6 A;  1TS8 A;  3O3V A;  4ARZ B;  4ZRR A;  4QWO A;  1DP9 A;  1XJ3 A;  4U3T A;  2Q9M A;  4BBU A;  3CAX A;  3WWX A;  2UWX A;  3ITA A;  3CZD A;  1QMF A;  3LY4 A;  2QWS A;  2QYB A;  1CF0 A;  2Y2Q A;  2IWD A;  4Y2F A;  4ZJ3 A;  3GRJ A;  4UA7 A;  1D7E A;  5J7E A;  1W8Y A;  2W27 A;  4OP5 A;  3LI9 A;  2WKI A;  1WE4 A;  4CQH A;  5JYO A;  4EWF A;  4HNB A;  1M40 A;  3W8K A;  4BJP A;  5C5K A;  5DF9 A;  2J9P A;  5E2G A;  4GCZ A;  3C8C A;  3LEZ A;  2WYX A;  4C75 A;  4DE2 A;  3Q07 A;  2P74 A;  3N6I A;  2J3T C;  4PM7 A;  2QJ5 A;  3T4Q A;  2XQZ A;  2Y2H A;  3O86 A;  4LFU A;  5CXW A;  2P7J A;  4IVI A;  3Q7V B;  1MBL A;  3MJQ A;  3A3D A;  2DRW A;  1F5M A;  2WKQ A;  3DBA A;  4A5R A;  2HDU A;  3G31 A;  3N4I A;  2WKP A;  5G4Z A;  4Y0O A;  3NC8 A;  1S0W A;  1S67 L;  5EVL A;  1SKO B;  3L9K A;  1ES3 A;  3F1O A;  3HL9 A;  4KZ6 A;  3LEQ A;  4R3A A;  5EE8 A;  3ZG7 B;  3V39 A;  1BLS A;  5G18 A;  3O5Y A;  1LI0 A;  1XFN A;  5KSC A;  3OOV A;  5HL6 A;  3G35 A;  3MKF A;  4B9O A;  1FCM A;  1BZA A;  4KQD A;  2KLI A;  5FI2 A;  1W8Q A;  1YT4 A;  2ZQC A;  5FAQ A;  4DN0 A;  3IBJ A;  3O88 A;  1K57 C;  4OP8 A;  2UV0 E;  1TS6 A;  3SS5 A;  3V5M A;  4B88 A;  3IXH A;  2JHE A;  3DWK A;  2PYR A;  4YFM A;  5GLC A;  3G30 A;  2H5S A;  3E4O A;  1N9L A;  3HLW A;  4PHT A;  2A3U A;  3MQ0 A;  5G4Y A;  2PU4 A;  4UEY A;  3ICY A;  2QZ6 A;  4RVA A;  1I2W A;  5F5Y A;  4BMW A;  3UB5 P;  4FTX A;  5CRF A;  2Y2N A;  5HFO A;  1IEM A;  5CER A;  4NXE A;  3QP2 A;  3LY3 A;  3WS4 A;  4GW9 A;  4OQI A;  2VGL M;  3G32 A;  1ESU A;  1TDL A;  3QP1 A;  1S66 L;  4KQR A;  1ONH A;  4FSF A;  1PWC A;  4E3K A;  3WS2 A;  1JTD A;  2BAS A;  2EA9 A;  5EM0 A;  4PAU A;  4EQ1 A;  4HIA A;  2A24 A;  1MPL A;  3BFC A;  1YMX A;  1EW0 A;  3QP6 A;  4HES A;  3C4O A;  2HJE A;  4MN7 A;  4WL9 A;  1S1Z A;  4S2N C;  3NUL A;  2HP5 A;  4ESP A;  2GJ3 A;  2E8I A;  4EBL A;  4L9F A;  2Y2I A;  1E3U D;  3BLM A;  1MWU A;  4GZB A;  4DRT A;  4OQG A;  3VP0 A;  1DJA A;  3BWL A;  3A3I A;  3G34 A;  1ZG6 A;  1FSY A;  2ZJ9 A;  2PYP A;  2QKP A;  3T4L A;  4O0P A;  4D2O A;  4DDS A;  3F1O B;  3MFX A;  3W4P A;  4P6Z M;  5CGS A;  4JF4 A;  5FAO A;  1VET B;  4B93 A;  1UWP X;  3QNC A;  3HLC A;  3IF5 A;  4X25 A;  1PNE A;  3DAV A;  3KSG A;  3DTI A;  4N1X A;  4WEK A;  5EUA A;  2IWB A;  5HD3 A;  3CUE C;  5FQ9 A;  3BFG A;  3P09 A;  3CWF A;  3RH8 B;  4DJ2 A;  3K3C A;  4DE0 A;  1L2S A;  1KDS A;  4WZ5 A;  2FFF B;  2PAV P;  1G6A A;  3GTC A;  4C6Y A;  2PRF A;  4EU0 A;  2HP6 A;  3VP1 A;  1JTG A;  3CJM A;  5DTS A;  5DJT A;  3VFH A;  3VP4 A;  1DRM A;  3PBR A;  5HAP A;  4LV3 A;  5FI7 A;  4HBU A;  3LIA A;  3OZH A;  2XLN A;  3VP2 A;  1VEU B;  2XSS A;  5AQB A;  2NUT C;  1LL8 A;  1XXM A;  3LUQ A;  1Q2Q A;  2FFY A;  3SW1 A;  2ZMF A;  2M7U A;  3PBS A;  3F1P B;  1K38 A;  4RQ9 A;  1G5U A;  5FEF A;  2WKR A;  3D9Y A;  1BLH A;  5DTK A;  2HPB A;  2V8C A;  4OOY A;  3UB8 A;  4HJ6 A;  2JKG A;  1W5D A;  1XKZ A;  4KZ7 A;  5FQK A;  1NZU A;  2H0T A;  4CLC E;  2PR6 A;  3MZE A;  2Y79 A;  3TRC A;  1K55 C;  3A3E A;  3A3J A;  5CTN A;  2ZQ9 A;  1ZTU A;  2PR5 A;  2WAD A;  4WBG A;  2O0Y A;  5M18 A;  3B3X A;  4JGR A;  1M6K A;  1P0Z A;  1ACF A;  1TS0 A;  4I3J A;  1N4O A;  2G7U A;  1NJ4 A;  2ZMA A;  3W4O A;  5AQA A;  4LCL A;  3EGX C;  5GHX A;  2O9C A;  2EWW A;  5CGX A;  3W2Z A;  3HCY A;  4H6J B;  1Y28 A;  1ESI A;  3T12 B;  3T4K A;  3LR0 A;  1KVL A;  1DJB A;  4KZA A;  1HLU P;  1K4F A;  2W1T A;  2C5W B;  1CEG A;  3IXD A;  3OBF A;  4WM9 A;  3H82 B;  3MF0 A;  4K0X A;  3UE1 A;  1RCJ A;  4Y13 A;  1SDE A;  4R4S A;  3T50 A;  4FOF A;  1J3W A;  3VV4 A;  3MZD A;  1OTE A;  4JBF A;  5DVA A;  5A91 A;  4DMZ A;  3BLS A;  5CTM A;  2V9A A;  1NYM A;  2VKS A;  4KEN B;  1E25 A;  2XDM A;  2Y2J A;  1KE4 A;  2JKT I;  3IX4 A;  3IWQ A;  2JKR M;  1TVF A;  3LR5 A;  1PW8 A;  1GSW A;  3UY6 A;  4GNU A;  1PFL A;  4ZBE A;  1GSV A;  4ETZ A;  4XXR A;  2A24 B;  3IWI A;  3OPR A;  2X02 A;  2JE5 A;  4JKT A;  4MMN A;  2IWC A;  3H7W B;  4ME4 A;  1PI4 A;  4LCM A;  4UHU A;  2AVX A;  4B4Z A;  2B02 A;  2IA2 A;  2VV8 A;  3GQZ A;  3SH7 A;  1BUE A;  1P9W A;  3S7O A;  3R7W B;  2ZQ7 A;  3PAE A;  4KUO A;  3SH8 A;  1MKI A;  4MBH A;  5F1G A;  1GA0 A;  3LIB A;  4Z9Q A;  3CMZ A;  4PPR A;  1YM1 A;  5FQJ A;  3ZNY A;  3T1R A;  2WZX A;  3HUO A;  4IUH A;  2Z2M B;  4BL3 A;  2HDR A;  4OPZ A;  1S6R A;  1L0D A;  3TW8 A;  4U0X A;  5HDD A;  4DXC A;  4EXO A;  3BYD A;  1XPB A;  3VFF A;  2PDR A;  1LL9 A;  2K7S A;  1YLJ A;  5IHV A;  4ZJ2 A;  3KSI A;  2XEP A;  3HLF A;  4KZ8 A;  5F69 A;  2HGV A;  1T18 A;  4QY6 A;  4O01 A;  3LI8 A;  1VB6 A;  3LYX A;  3FKW A;  4Y17 A;  1LSV A;  2H28 A;  2ZC5 B;  1OJG A;  1Y54 A;  4JGO A;  1X0O A;  3IF6 C;  1EWZ A; 
#chains in the Genus database with same CATH homology
 4BLM A;  2WGV A;  4MEZ A;  5EE8 A;  3IT9 A;  1CI9 A;  1RGZ A;  2GDN A;  3ZG7 B;  3V39 A;  3S22 A;  1VQQ A;  1ERO A;  4OQH A;  1BLS A;  4P87 A;  5G18 A;  4B4X A;  5GL9 A;  3E2L A;  4GD8 A;  1K56 D;  5TR7 A;  1LI0 A;  1PZP A;  2Y55 A;  5FAT A;  1ES2 A;  3BFE A;  5FQM A;  4JLF A;  5KSC A;  5F1F A;  3IHA A;  2XFT A;  3G35 A;  2R9X A;  3HLB A;  3MKF A;  5EOE A;  3NBL A;  5DTT A;  1FCM A;  1O7E A;  2Q9N A;  5EEC A;  5KSH A;  1BZA A;  2Y2O A;  5CGW A;  3IQA A;  3PBN A;  1HD8 A;  3OPH A;  3P98 A;  3S1Y A;  3UDX A;  5DF8 A;  4ZAM A;  1FSW A;  1JWV A;  1YLZ A;  2WKE A;  4E3I A;  3M2J A;  5FI2 A;  1W8Q A;  2Y2L A;  1YT4 A;  3ISG A;  2ZQC A;  1Q2P A;  5FAQ A;  4DE3 A;  1E3U A;  5I94 A;  3Q7V A;  3OCN A;  4BL2 A;  1PW1 A;  3NI9 A;  4IBR A;  4LEN A;  3O88 A;  3NCK A;  2C6W B;  4R3B A;  5KZH A;  1JVJ A;  1K57 C;  4OP8 A;  4X6T A;  2ZLY A;  2QPN A;  1K54 C;  3ZNT A;  4R0Q A;  3SS5 A;  3V5M A;  5GHZ A;  4B88 A;  3PAG A;  4CPK A;  3V3S A;  3IXH A;  1K4E A;  2WAE A;  4GOG A;  4OPR A;  4BQM A;  1ONG A;  1W7F A;  3DWK A;  5BOH A;  4YFM A;  4X56 A;  2V1Z A;  5GLC A;  4X68 A;  1H8Z A;  3A3F A;  2OLU A;  4L0L A;  1BLC A;  3G30 A;  2ZM8 A;  3C5A A;  3WS0 A;  2H5S A;  3HLW A;  3HBR A;  1U60 A;  5FA7 A;  1FOF A;  2A3U A;  3ZGA B;  4LV0 A;  4R1G A;  3LO7 A;  2PU4 A;  3UDF A;  3PBO A;  2VGJ A;  4MLL A;  4JPM A;  4LV1 A;  2QZ6 A;  1QME A;  2BG1 A;  4RVA A;  1I2W A;  4OKP A;  3UDI A;  4EBN A;  1LLB A;  3ZG9 B;  1K57 A;  3G2Z A;  4OLD A;  4ZDX A;  4N92 A;  5GLD A;  5CRF A;  3VP3 A;  2Y2N A;  5HFO A;  1K6R A;  1XP4 A;  1IEM A;  2X71 A;  3MKE A;  1NRF A;  4WEJ A;  4OH0 A;  4U0T A;  4QB8 A;  1KGE A;  5CER A;  3HUM A;  2DCF A;  4N1H A;  4JXS A;  1IKI A;  4XUZ A;  1OME A;  3LY3 A;  4KG6 A;  3WS4 A;  1JWP A;  3BEB A;  1VM1 A;  4ID4 A;  1KDW A;  3HLD A;  4OQI A;  1DY6 A;  4P0M A;  3G32 A;  1ESU A;  2EX8 A;  3HRE A;  1TDL A;  4S2N A;  2X01 A;  4KQR A;  1ONH A;  3SS4 A;  1BTL A;  5EPH A;  4Y7P A;  4FSF A;  5HW3 A;  1PWC A;  4E3K A;  2Y59 A;  1NYY A;  3WS2 A;  1JTD A;  3BFD A;  5FDH A;  3AGD A;  2OSU A;  1MPL A;  3BFC A;  3VOZ A;  1PWG A;  1YMX A;  1KVM A;  1ZC2 A;  1W79 A;  3EQV A;  3QHY A;  4HES A;  3C4O A;  3ZHH A;  4S2N C;  5CED A;  4KQQ A;  5GLB A;  2HDQ A;  2HP5 A;  4KG2 A;  1NXY A;  4GB7 A;  3NDE A;  1FCN A;  2E8I A;  3ZG0 A;  5EOO A;  2EX6 A;  3TSG A;  1L0F A;  3GV9 A;  2EX2 A;  4EUZ A;  1MWR A;  4FD8 A;  5HX9 A;  3ZVW A;  4EBL A;  4HEF A;  1YMS A;  3GSG A;  2Y2I A;  1ERM A;  1E3U D;  3BLM A;  1MWU A;  4GZB A;  4DRT A;  1Z6F A;  4OQG A;  3VP0 A;  3C4P A;  1DJA A;  3NDG A;  1K55 A;  3WRZ A;  2DNS A;  3A3I A;  3G34 A;  3C7U A;  1ZG6 A;  1FSY A;  2ZJ9 A;  3UPN A;  1ES4 A;  2J9O A;  4IVK A;  4N9K A;  4D2O A;  4DDS A;  2ZQ8 A;  3WS1 A;  3N8R A;  4R4R A;  3W4P A;  3W4Q A;  5EVI B;  1TDG A;  4KZB A;  4Q8I A;  1GHP A;  1ZKJ A;  5CGS A;  4JF4 A;  4X55 A;  5FAO A;  3GR2 A;  4BEN A;  3IXB A;  5E2H A;  3QNC A;  3HLC A;  1CI8 A;  3IF5 A;  3UPP A;  5FAS A;  2Y91 A;  2ZQD A;  4ZTK A;  4N1X A;  3G2Y A;  4WEK A;  2G2U A;  5EUA A;  2IWB A;  1PIO A;  5FQ9 A;  2PU2 A;  1K54 A;  4PM6 A;  3BFG A;  3P09 A;  3FKV A;  3SOI A;  5J8X A;  4JXG A;  3DW0 A;  4DE0 A;  1L2S A;  1KDS A;  4F94 A;  4WZ5 A;  2FFF B;  5L2F A;  2Y2G A;  1BT5 A;  1G6A A;  1KGF A;  4N9L A;  3GTC A;  1TEM A;  4C6Y A;  1XGJ A;  4DDY A;  2HDS A;  2XH9 A;  4QJG A;  4QD4 A;  1HZO A;  4OOL A;  2HP6 A;  3PBQ A;  5M1A A;  3VP1 A;  1JTG A;  1JWZ A;  3CJM A;  1KE3 A;  5DTS A;  5CEB A;  4WEL A;  1IEL A;  1BUL A;  4MBF A;  4GDB A;  3VFH A;  2V2F F;  3M6H A;  3PBR A;  4YIN A;  3VP4 A;  5HAP A;  3TOI A;  4JXW A;  3MXS A;  2JCH A;  2ZD8 A;  4LV3 A;  5FI7 A;  2BLS A;  2XR0 A;  2WGI A;  3IHB A;  5DF7 A;  1LHY A;  3EQU A;  2JC7 A;  2EFX A;  1GHI A;  2Y2M A;  4RYE A;  1ES5 A;  4HBU A;  3FV7 A;  5A93 A;  3N8L A;  3OZH A;  3SH9 A;  1MWS A;  2XLN A;  3VP2 A;  2WAF A;  5AQB A;  3ZG8 B;  2Z2L B;  3RJU A;  3UO9 A;  1XXM A;  4OLG A;  4PM5 A;  1YLY A;  4FCF A;  2XFS A;  4WZ5 C;  4GD6 A;  4DF6 A;  2WKH A;  1Q2Q A;  2FFY A;  3UPO A;  2RL3 A;  4DE1 A;  3Q7Z A;  3GMW A;  4JF6 A;  1NY0 A;  4KG5 A;  5TGF A;  1RGY A;  3NIA A;  1DJC A;  3PBS A;  4JF5 A;  4S2L A;  5D3O A;  3HVF A;  3IH8 A;  3FWL A;  4E6X A;  1K38 A;  1GA9 A;  2EXA A;  1L0G A;  2ZC4 B;  1YLW A;  4Y0U A;  1EI5 A;  4UAA A;  3M6B A;  1KGG A;  4XUX A;  5HL1 A;  1IYQ A;  4O7D A;  3CG5 A;  4EQI A;  1BLH A;  4KZ4 A;  2HPB A;  2VGK A;  3BRM A;  3OCL A;  5DTK A;  5AQ7 A;  2Y2P A;  2ZC6 B;  4OQ0 A;  3OPL A;  4OOY A;  4UA9 A;  1O07 A;  3GVB A;  5E2E A;  3MXR A;  1WYB A;  5HAI A;  1W5D A;  1XKZ A;  4KZ7 A;  2A49 A;  5EVI A;  5FQK A;  3OC2 A;  1NZU A;  2H0T A;  5CHU A;  1XX2 A;  1CK3 A;  3MZE A;  4PM9 A;  3UN7 A;  3PBT A;  5CEC A;  3HUN A;  1N9B A;  4P85 A;  2XF3 A;  1K55 C;  3A3E A;  5FAP A;  5TFQ A;  4WMC D;  5FSR A;  3A3J A;  4H8R A;  4FH2 A;  5CTN A;  2ZQ9 A;  5EVI C;  4X69 A;  1MXO A;  4RX3 A;  1I5Q A;  5GHY A;  3S4X A;  5AQ9 A;  1PWD A;  3VMA A;  1L0E A;  2WAD A;  4P6B A;  5FI6 A;  4WBG A;  3ITB A;  5KMW A;  4LV2 A;  1ERQ A;  4OVD A;  2OLV A;  1G68 A;  2Y2K A;  3MZF A;  4MBK A;  4Y0T A;  3E2K A;  4M3K A;  5M18 A;  3B3X A;  3HLE A;  3IF6 B;  4RA7 A;  1M6K A;  4GN2 A;  1E4D A;  3M2K A;  4E3O A;  4QY5 A;  2WK0 A;  4UA6 A;  4K91 A;  2QMI A;  5HAR A;  1IYP A;  3IXG A;  1N4O A;  2XD1 A;  3Q1F A;  4FH4 A;  1NJ4 A;  3FZC A;  4CJN A;  1YQS A;  2ZMA A;  3BFF A;  3JYI A;  1SHV A;  1BLP A;  2H10 A;  3W4O A;  5AQA A;  4LCL A;  1KE0 A;  5GHX A;  2CC1 A;  2B5R A;  2P9V B;  5CGX A;  3Q82 A;  2ZM0 A;  1MY8 A;  4OOM A;  4R23 A;  4S2O A;  3D4F A;  3UNW A;  1ESI A;  4DXB A;  1FCO A;  1K6S A;  4EV4 A;  3MFD A;  4QU3 A;  1KVL A;  5F83 A;  1DJB A;  4KZ3 A;  4KZA A;  2XK1 A;  2P9V A;  3QNB A;  3V50 A;  1K25 A;  1K4F A;  3ZG5 A;  2C5W B;  4S2K A;  1CEG A;  3WRT A;  4S2M A;  5CHJ A;  2HP9 A;  3BEC A;  3IXD A;  2WUQ A;  1J9M A;  1FR6 A;  1AXB A;  3HLG A;  2J7V A;  4WM9 A;  1PI5 A;  4K0X A;  3UE1 A;  1RCJ A;  2I72 A;  1SDE A;  4R4S A;  3OPP A;  2J8Y A;  4S2J A;  3VSL A;  3ZDJ A;  3PTE A;  3NY4 A;  4NET A;  4PM8 A;  5EVI D;  4ZJ1 A;  5FQQ A;  3MZD A;  2ZC7 A;  3RXX A;  5DVA A;  4JBF A;  1YLT A;  1IYO A;  3FYZ A;  3N7W A;  5A91 A;  1FR1 A;  5HAQ A;  1HVB A;  2EX9 A;  3BLS A;  4GDN A;  4MNR A;  1SCW A;  5CHM A;  5F82 A;  5CTM A;  1C3B A;  1NYM A;  2ZC3 B;  1GHM A;  4WMC A;  4S2I A;  1ZG4 A;  3DTM A;  1E25 A;  2XDM A;  2Y2J A;  4K0W A;  1KE4 A;  3IWQ A;  1K56 A;  4KEN B;  5GLA A;  4E3N A;  3ZVT A;  5JYP A;  1TVF A;  3O3V A;  5A90 A;  1H5X A;  4WYY A;  3BM6 A;  1XA7 A;  2OV5 A;  4E6W A;  4R3J A;  1PW8 A;  4U3T A;  3AGE A;  4S2P A;  3UY6 A;  4GNU A;  2Q9M A;  1XA1 A;  3TG9 A;  3Q81 A;  4ZBE A;  3WWX A;  4XXR A;  3RXW A;  2UWX A;  2EXB A;  3IWI A;  3ITA A;  3CZD A;  3OPR A;  2X02 A;  2JE5 A;  1WYC A;  4JKT A;  1QMF A;  4OON A;  1YLP A;  3LY4 A;  2Y2Q A;  2IWC A;  3LCE A;  2IWD A;  4ZJ3 A;  3GRJ A;  4IBX A;  4WZ4 A;  4E3J A;  1PI4 A;  4UA7 A;  2ZM2 A;  4LCM A;  3I7J A;  4UHU A;  1W8Y A;  5FQI A;  4B4Z A;  3GQZ A;  1NZO A;  1CEF A;  4NK3 A;  3SH7 A;  4E3M A;  3VSK A;  1LI9 A;  1BUE A;  2JBF A;  5A92 A;  1IKG A;  2ZQ7 A;  4OP5 A;  2EFU A;  1PYY A;  2WKI A;  3IWO A;  2WZZ A;  1WE4 A;  3UE0 A;  5JYO A;  4EWF A;  2H0Y A;  2XD5 A;  3O87 A;  2R9W A;  1ALQ A;  3N8S A;  1M40 A;  3W8K A;  3PAE A;  1BSG A;  4BJP A;  3SH8 A;  1MKI A;  1I2S A;  4MBH A;  2V20 A;  3IF6 A;  4IED A;  5DF9 A;  3ZCZ A;  3UE3 A;  2J9P A;  3C7V A;  5F1G A;  4QHC A;  5E2G A;  5U47 A;  1GA0 A;  3V3R A;  4Z9Q A;  2Y4A A;  3ZFZ A;  3CMZ A;  3LEZ A;  4PPR A;  2WYX A;  1YM1 A;  4C75 A;  4DE2 A;  1LL5 A;  4X53 A;  2WGW B;  5FQJ A;  3ZNY A;  3Q07 A;  2P74 A;  4PMA A;  5M19 A;  1HTZ A;  2RCX A;  2WZX A;  3N6I A;  3HUO A;  4PM7 A;  4E3L A;  5E2F A;  3MBZ A;  2Z2M B;  4BL3 A;  2XQZ A;  2HDR A;  2Y2H A;  4OPQ A;  4OPZ A;  1S6R A;  3O86 A;  1L0D A;  3WS5 A;  5CXW A;  4U0X A;  3VOY A;  4KZ9 A;  1SDN A;  4DXC A;  1GCE A;  4IVI A;  3SS3 A;  3BYD A;  4OPY A;  3Q7V B;  1MBL A;  1XPB A;  3A3D A;  4GKU A;  3VFF A;  2DRW A;  4C3Q A;  1LL9 A;  2PBY A;  1RP5 A;  1YLJ A;  5IHV A;  4DKI A;  1H8Y A;  4A5R A;  4ZJ2 A;  1XGI A;  2HDU A;  1IYS A;  1SKF A;  2XEP A;  2ZQA A;  3HLF A;  3G31 A;  4JXV A;  4KQO A;  2WGW A;  3N4I A;  4KZ8 A;  4RX2 A;  2G2W A;  5E43 A;  4QY6 A;  4Y0O A;  4BD1 A;  1S0W A;  3NC8 A;  2XGN A;  3FKW A;  4KZ5 A;  1MWT A;  5EVL A;  2ZC5 B;  1FQG A;  1PZO A;  4HBT A;  1Y54 A;  1ES3 A;  3IF6 C;  3HL9 A;  3IH9 A;  1EWZ A;  3G4P A;  4KZ6 A;  4BD0 A;  3AGF A;  4EBP A;  3DWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...