2V22B

Replace: a strategy for iterative design of cyclin binding groove inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Replace: A Strategy for Iterative Design of Cyclin- Binding Groove Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2v22B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2v22B02
3K7AM 4YOOA 1O9KA 1W98B 2WMBB 2X1NB 2EUFA 4BCMD 4CFMB 4EOLB 3POMA 4BCOB 2PK9B 5LMKB 1OGUB 3LQ5B 1C9BA 3EIDB 3BLRB 4CFXB 1GUXB 4CFVB 4F70B 4F7NB 2UUEB 2WIHB 2I53A 3G33B 1AISB 4KRCB 1KXUA 4F7JB 1TFBA 4CXAB 3TN8B 4EOKB 4EORB 2R7GA 4CFUB 4F6WB 5CYIB 2CCIB 4II5B 2IW9B 1OI9B 2PHGA 4EC8B 4EOOB 3BHVB 4EOSB 5I5ZB 1PKDB 3BHTB 1D3UB 3EJ1B 1URCB 1VINA 2C5NB 3BLHB 4ELLA 2V22B 3TNIB 4CRLB 2PMIB 2UZDB 1G3NC 3BHUB 1AD6A 4BCGB 1E9HB 1OKVB 1OIYB 2JGZB 3DDQB 4I3ZB 2C5XB 3DDPB 4BCND 3QHWB 4CFNB 4EC9B 2UZLB 5HNBB 5L2WB 4EOIB 4EOJB 1VOLA 1JKWA 4BCMB 4ROCA 5IF1B 2WHBB 3M03A 4NSTB 2IW8B 2WEVB 1F5QB 2I40B 1FVVB 2QDJA 1O9KB 2B9RA 4BCQD 4ELJA 4F7SB 5LQFB 2W99A 2C6TB 1XO2A 5IDNB 3MY1B 4BCIB 4BCFB 1UNLD 1H28B 1OL1B 2BKZB 4BCHB 5CEIB 3MY5B 5ACBA 4ROEA 3RGFB 2WXVB 4EOMB 1QMZB 2IW6B 3QHRB 2IVXA 1JOWA 1VYWB 1JSTB 2W2HA 5HQ0B 4TTHA 4BCKB 4KRDB 4BCJB 1OKWB 3O0GD 3TNWB 2W9ZA 2WIPB 1N4MA 1FINB 4FX3B 1GUXA 1H4LD 5IDPB 5HBJB 1P5EB 2C5VB 1H26B 2UZEB 2CJMB 1OL2B 2BPMB 4BCNB 2C4GB 1H1RB 2WFYB 3H4CA 1H1SB 4RODA 2CCHB 3TNHB 1UNHD 4G6LB 4IMYB 1ZP2A 5HVYB 1UNGD 4YOZA 1H1PB 4F7LB 4BCQB 3BLQB 4YOSA 4CFUD 2UZBB 2F2CA 4OR5B 5FGKB 2G9XB 3MIAB 2W9FA 4EOQB 4UN0A 1GH6B 3MI9B 2WMAB 2WPAB 4EONB 1H24B 3F5XB 1GY3B 4YC3B 4EOPB 5HBHB 2C5OB 5EFQB 1H1QB 5BNJB 4Y72B 4CFWB 2PK2A 2W96A 1BU2A 3EOCB 4BCPB 5ICPB 1JSUB 4F6SB 1OIUB 3DOGB 4OGRB 1H27B 5HBEB 4F6UB 1H25B
chains in the Genus database with same CATH superfamily
2WMBB 1UGPB 2X1NB 4BCMD 5EJCA 3EIDB 4OB1B 4F7NB 2QQ8A 2UUEB 2I53A 1TFBA 1UGQB 3PO3S 2PHGA 5I5ZB 4M6VA 1PKDB 1URCB 3A8MB 2V22B 3TNIB 1G3NC 1AD6A 1OKVB 3HBLA 2DPPB 4BCND 3DDPB 4EC9B 2UZLB 5HNBB 3VKHA 2ZCFB 4NSTB 2ZPFB 2D0QB 4ELJA 3X24B 2C6TB 1XO2A 3MY5B 2BS3A 1QMZB 1JOWA 3VYGB 1JSTB 2WJ9A 3TNWB 3WVEB 5IDPB 1H26B 2BPMB 4RODA 2CCHB 3TNHB 1TD6A 4IMYB 1UNGD 4F7LB 2F2CA 4OR5B 3BG5A 4EOQB 4UN0A 1GH6B 3GTMS 3X20B 3F5XB 1GY3B 4BBSM 4YC3B 5BNJB 4Y72B 2DMEA 3EOCB 4BCPB 3DOGB 3WVDB 5HBEB 4F6UB 4Z6YA 3K7AM 3HO8A 2EUFA 4CFMB 2ZPIB 2PK9B 5LMKB 4BBRM 3BLRB 2CZ7B 4KRCB 4CXAB 1QLBA 3QYHB 2CCIB 3B57A 1OI9B 4EOSB 4MFDA 3DJBA 1VINA 3BLHB 4ELLA 2QDYB 2LW4A 3BG3A 1UGRB 1FKMA 4I3ZB 1VOLA 4EOIB 2ZPEB 4BCMB 2CZ6B 3M03A 2WEVB 4F7SB 4BCQD 4BXXX 2W99A 4FM4B 2ZPBB 1UNLD 1H28B 1OL1B 2CZ0B 2QGSA 1ENWA 4EOMB 3QHRB 2IW6B 1VYWB 4BCKB 1V29B 2UZEB 2CJMB 4BCNB 2QF7A 2C4GB 3H4CA 2QFZA 1UNHD 1ZP2A 4YOZA 1H1PB 2PJQA 3QYEA 4CFUD 4BY1X 2G9XB 2W9FA 4EONB 1H24B 2CZ1B 3X26B 2C5OB 5EFQB 4HNUA 3VYHB 2PK2A 1BU2A 5DQWA 1JSUB 2G77A 1H27B 2BS2A 1O9KA 4EOLB 3POMA 1OGUB 3LQ5B 3QWLA 4CFXB 4CFVB 4F70B 2WIHB 3TW6A 3BG9A 3G33B 3A8HB 1AISB 4AKIA 1KXUA 3TN8B 4EOKB 4EORB 2R7GA 4QSHA 4AKGA 3QYBA 4LOCA 2KR6A 3QXEB 5CYIB 4II5B 4AKHA 1D3UB 3TW7A 2UZDB 3BHUB 1E9HB 3A8GB 2DXCB 5IHYA 2C5XB 4CFNB 3QHWB 5L2WB 4EOJB 3KHIA 2WHBB 3A8LB 5LQFB 2QDJA 1O9KB 2B9RA 4OB2B 3VKGA 4MFEA 3MY1B 3X28B 4NC6A 2BKZB 3QZ5B 3RGFB 4HL4A 2WXVB 2IVXA 2CYZB 2DXBB 4AI6A 4BY7X 2W2HA 4ZGEB 4KRDB 1AHJB 3O0GD 2WIPB 4FX3B 1GUXA 1H4LD 4JX4A 5HBJB 1P5EB 5DQVA 1OL2B 1H1RB 2DD5B 4G6LB 5HVYB 4BCQB 3BLQB 2UZBB 2ZZDB 3MI9B 2WMAB 3DTOA 5HBHB 4JX6A 1H1QB 2IN3A 3HB9A 4CFWB 2W96A 5ICPB 4F6SB 4OGRB 1H25B 4YOOA 1W98B 2KMGA 4MIMA 4HLQA 4BCOB 1C9BA 1GUXB 3X25B 3NDQA 4ZGJB 4OB0B 4F7JB 4CFUB 4F6WB 2IW9B 4EC8B 4EOOB 3BHVB 1E7PA 3BHTB 3EJ1B 2C5NB 4CRLB 2PMIB 2DD4B 4BCGB 1OIYB 2JGZB 3DDQB 5CEIB 3QZ9B 1JKWA 4ROCA 5IF1B 2IW8B 1F5QB 2I40B 1FVVB 2ZPGB 5IDNB 4BCIB 4BCFB 4BCHB 5ACBA 4ROEA 3A8OB 5HQ0B 4TTHA 3DL1A 4BCJB 4JX5A 1OKWB 1IREB 2W9ZA 1N4MA 1FINB 2C5VB 2WFYB 1H1SB 4HNVA 4OB3B 4HNTA 3HZJA 4YOSA 5FGKB 3MIAB 3QYGB 1UGSB 2WPAB 4EOPB 4ZGDB 2ZPHB 2AHJB 3HHTB 1OIUB 2BS4A
chains in the Genus database with same CATH topology
3K7AM 4YOOA 1O9KA 1W98B 2WMBB 2X1NB 2EUFA 4BCMD 4CFMB 4EOLB 3POMA 4BCOB 2PK9B 5LMKB 1OGUB 3LQ5B 1C9BA 3EIDB 3BLRB 4CFXB 1GUXB 4CFVB 4F70B 4F7NB 2UUEB 2WIHB 2I53A 3G33B 1AISB 4KRCB 1KXUA 4F7JB 1TFBA 4CXAB 3TN8B 4EOKB 4EORB 2R7GA 4CFUB 4F6WB 5CYIB 2CCIB 4II5B 2IW9B 1OI9B 2PHGA 4EC8B 4EOOB 3BHVB 4EOSB 5I5ZB 1PKDB 3BHTB 1D3UB 3EJ1B 1URCB 1VINA 2C5NB 3BLHB 4ELLA 2V22B 3TNIB 4CRLB 2PMIB 2UZDB 1G3NC 3BHUB 1AD6A 4BCGB 1E9HB 1OKVB 1OIYB 2JGZB 3DDQB 4I3ZB 2C5XB 3DDPB 4BCND 3QHWB 4CFNB 4EC9B 2UZLB 5HNBB 5L2WB 4EOIB 4EOJB 1VOLA 1JKWA 4BCMB 4ROCA 5IF1B 2WHBB 3M03A 4NSTB 2IW8B 2WEVB 1F5QB 2I40B 1FVVB 2QDJA 1O9KB 2B9RA 4BCQD 4ELJA 4F7SB 5LQFB 2W99A 2C6TB 1XO2A 5IDNB 3MY1B 4BCIB 4BCFB 1UNLD 1H28B 1OL1B 2BKZB 4BCHB 5CEIB 3MY5B 5ACBA 4ROEA 3RGFB 2WXVB 4EOMB 1QMZB 2IW6B 3QHRB 2IVXA 1JOWA 1VYWB 1JSTB 2W2HA 5HQ0B 4TTHA 4BCKB 4KRDB 4BCJB 1OKWB 3O0GD 3TNWB 2W9ZA 2WIPB 1N4MA 1FINB 4FX3B 1GUXA 1H4LD 5IDPB 5HBJB 1P5EB 2C5VB 1H26B 2UZEB 2CJMB 1OL2B 2BPMB 4BCNB 2C4GB 1H1RB 2WFYB 3H4CA 1H1SB 4RODA 2CCHB 3TNHB 1UNHD 4G6LB 4IMYB 1ZP2A 5HVYB 1UNGD 4YOZA 1H1PB 4F7LB 4BCQB 3BLQB 4YOSA 4CFUD 2UZBB 2F2CA 4OR5B 5FGKB 2G9XB 3MIAB 2W9FA 4EOQB 4UN0A 1GH6B 3MI9B 2WMAB 2WPAB 4EONB 1H24B 3F5XB 1GY3B 4YC3B 4EOPB 5HBHB 2C5OB 5EFQB 1H1QB 5BNJB 4Y72B 4CFWB 2PK2A 2W96A 1BU2A 3EOCB 4BCPB 5ICPB 1JSUB 4F6SB 1OIUB 3DOGB 4OGRB 1H27B 5HBEB 4F6UB 1H25B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A M;  4YOO A;  1O9K A;  1W98 B;  2WMB B;  2X1N B;  2EUF A;  4BCM D;  4CFM B;  4EOL B;  3POM A;  4BCO B;  2PK9 B;  5LMK B;  1OGU B;  3LQ5 B;  1C9B A;  3EID B;  3BLR B;  4CFX B;  1GUX B;  4CFV B;  4F70 B;  4F7N B;  2UUE B;  2WIH B;  2I53 A;  3G33 B;  1AIS B;  4KRC B;  1KXU A;  4F7J B;  1TFB A;  4CXA B;  3TN8 B;  4EOK B;  4EOR B;  2R7G A;  4CFU B;  4F6W B;  5CYI B;  2CCI B;  4II5 B;  2IW9 B;  1OI9 B;  2PHG A;  4EC8 B;  4EOO B;  3BHV B;  4EOS B;  5I5Z B;  1PKD B;  3BHT B;  1D3U B;  3EJ1 B;  1URC B;  1VIN A;  2C5N B;  3BLH B;  4ELL A;  2V22 B;  3TNI B;  4CRL B;  2PMI B;  2UZD B;  1G3N C;  3BHU B;  1AD6 A;  4BCG B;  1E9H B;  1OKV B;  1OIY B;  2JGZ B;  3DDQ B;  4I3Z B;  2C5X B;  3DDP B;  4BCN D;  3QHW B;  4CFN B;  4EC9 B;  2UZL B;  5HNB B;  5L2W B;  4EOI B;  4EOJ B;  1VOL A;  1JKW A;  4BCM B;  4ROC A;  5IF1 B;  2WHB B;  3M03 A;  4NST B;  2IW8 B;  2WEV B;  1F5Q B;  2I40 B;  1FVV B;  2QDJ A;  1O9K B;  2B9R A;  4BCQ D;  4ELJ A;  4F7S B;  5LQF B;  2W99 A;  2C6T B;  1XO2 A;  5IDN B;  3MY1 B;  4BCI B;  4BCF B;  1UNL D;  1H28 B;  1OL1 B;  2BKZ B;  4BCH B;  5CEI B;  3MY5 B;  5ACB A;  4ROE A;  3RGF B;  2WXV B;  4EOM B;  1QMZ B;  2IW6 B;  3QHR B;  2IVX A;  1JOW A;  1VYW B;  1JST B;  2W2H A;  5HQ0 B;  4TTH A;  4BCK B;  4KRD B;  4BCJ B;  1OKW B;  3O0G D;  3TNW B;  2W9Z A;  2WIP B;  1N4M A;  1FIN B;  4FX3 B;  1GUX A;  1H4L D;  5IDP B;  5HBJ B;  1P5E B;  2C5V B;  1H26 B;  2UZE B;  2CJM B;  1OL2 B;  2BPM B;  4BCN B;  2C4G B;  1H1R B;  2WFY B;  3H4C A;  1H1S B;  4ROD A;  2CCH B;  3TNH B;  1UNH D;  4G6L B;  4IMY B;  1ZP2 A;  5HVY B;  1UNG D;  4YOZ A;  1H1P B;  4F7L B;  4BCQ B;  3BLQ B;  4YOS A;  4CFU D;  2UZB B;  2F2C A;  4OR5 B;  5FGK B;  2G9X B;  3MIA B;  2W9F A;  4EOQ B;  4UN0 A;  1GH6 B;  3MI9 B;  2WMA B;  2WPA B;  4EON B;  1H24 B;  3F5X B;  1GY3 B;  4YC3 B;  4EOP B;  5HBH B;  2C5O B;  5EFQ B;  1H1Q B;  5BNJ B;  4Y72 B;  4CFW B;  2PK2 A;  2W96 A;  1BU2 A;  3EOC B;  4BCP B;  5ICP B;  1JSU B;  4F6S B;  1OIU B;  3DOG B;  4OGR B;  1H27 B;  5HBE B;  4F6U B;  1H25 B; 
#chains in the Genus database with same CATH topology
 2WMB B;  1UGP B;  2X1N B;  4BCM D;  5EJC A;  3EID B;  4OB1 B;  4F7N B;  2QQ8 A;  2UUE B;  2I53 A;  1TFB A;  1UGQ B;  3PO3 S;  2PHG A;  5I5Z B;  4M6V A;  1PKD B;  1URC B;  3A8M B;  2V22 B;  3TNI B;  1G3N C;  1AD6 A;  1OKV B;  3HBL A;  2DPP B;  4BCN D;  3DDP B;  4EC9 B;  2UZL B;  5HNB B;  3VKH A;  2ZCF B;  4NST B;  2ZPF B;  2D0Q B;  4ELJ A;  3X24 B;  2C6T B;  1XO2 A;  3MY5 B;  2BS3 A;  1QMZ B;  1JOW A;  3VYG B;  1JST B;  2WJ9 A;  3TNW B;  3WVE B;  5IDP B;  1H26 B;  2BPM B;  4ROD A;  2CCH B;  3TNH B;  1TD6 A;  4IMY B;  1UNG D;  4F7L B;  2F2C A;  4OR5 B;  3BG5 A;  4EOQ B;  4UN0 A;  1GH6 B;  3GTM S;  3X20 B;  3F5X B;  1GY3 B;  4BBS M;  4YC3 B;  5BNJ B;  4Y72 B;  2DME A;  3EOC B;  4BCP B;  3DOG B;  3WVD B;  5HBE B;  4F6U B;  4Z6Y A;  3K7A M;  3HO8 A;  2EUF A;  4CFM B;  2ZPI B;  2PK9 B;  5LMK B;  4BBR M;  3BLR B;  2CZ7 B;  4KRC B;  4CXA B;  1QLB A;  3QYH B;  2CCI B;  3B57 A;  1OI9 B;  4EOS B;  4MFD A;  3DJB A;  1VIN A;  3BLH B;  4ELL A;  2QDY B;  2LW4 A;  3BG3 A;  1UGR B;  1FKM A;  4I3Z B;  1VOL A;  4EOI B;  2ZPE B;  4BCM B;  2CZ6 B;  3M03 A;  2WEV B;  4F7S B;  4BCQ D;  4BXX X;  2W99 A;  4FM4 B;  2ZPB B;  1UNL D;  1H28 B;  1OL1 B;  2CZ0 B;  2QGS A;  1ENW A;  4EOM B;  3QHR B;  2IW6 B;  1VYW B;  4BCK B;  1V29 B;  2UZE B;  2CJM B;  4BCN B;  2QF7 A;  2C4G B;  3H4C A;  2QFZ A;  1UNH D;  1ZP2 A;  4YOZ A;  1H1P B;  2PJQ A;  3QYE A;  4CFU D;  4BY1 X;  2G9X B;  2W9F A;  4EON B;  1H24 B;  2CZ1 B;  3X26 B;  2C5O B;  5EFQ B;  4HNU A;  3VYH B;  2PK2 A;  1BU2 A;  5DQW A;  1JSU B;  2G77 A;  1H27 B;  2BS2 A;  1O9K A;  4EOL B;  3POM A;  1OGU B;  3LQ5 B;  3QWL A;  4CFX B;  4CFV B;  4F70 B;  2WIH B;  3TW6 A;  3BG9 A;  3G33 B;  3A8H B;  1AIS B;  4AKI A;  1KXU A;  3TN8 B;  4EOK B;  4EOR B;  2R7G A;  4QSH A;  4AKG A;  3QYB A;  4LOC A;  2KR6 A;  3QXE B;  5CYI B;  4II5 B;  4AKH A;  1D3U B;  3TW7 A;  2UZD B;  3BHU B;  1E9H B;  3A8G B;  2DXC B;  5IHY A;  2C5X B;  4CFN B;  3QHW B;  5L2W B;  4EOJ B;  3KHI A;  2WHB B;  3A8L B;  5LQF B;  2QDJ A;  1O9K B;  2B9R A;  4OB2 B;  3VKG A;  4MFE A;  3MY1 B;  3X28 B;  4NC6 A;  2BKZ B;  3QZ5 B;  3RGF B;  4HL4 A;  2WXV B;  2IVX A;  2CYZ B;  2DXB B;  4AI6 A;  4BY7 X;  2W2H A;  4ZGE B;  4KRD B;  1AHJ B;  3O0G D;  2WIP B;  4FX3 B;  1GUX A;  1H4L D;  4JX4 A;  5HBJ B;  1P5E B;  5DQV A;  1OL2 B;  1H1R B;  2DD5 B;  4G6L B;  5HVY B;  4BCQ B;  3BLQ B;  2UZB B;  2ZZD B;  3MI9 B;  2WMA B;  3DTO A;  5HBH B;  4JX6 A;  1H1Q B;  2IN3 A;  3HB9 A;  4CFW B;  2W96 A;  5ICP B;  4F6S B;  4OGR B;  1H25 B;  4YOO A;  1W98 B;  2KMG A;  4MIM A;  4HLQ A;  4BCO B;  1C9B A;  1GUX B;  3X25 B;  3NDQ A;  4ZGJ B;  4OB0 B;  4F7J B;  4CFU B;  4F6W B;  2IW9 B;  4EC8 B;  4EOO B;  3BHV B;  1E7P A;  3BHT B;  3EJ1 B;  2C5N B;  4CRL B;  2PMI B;  2DD4 B;  4BCG B;  1OIY B;  2JGZ B;  3DDQ B;  5CEI B;  3QZ9 B;  1JKW A;  4ROC A;  5IF1 B;  2IW8 B;  1F5Q B;  2I40 B;  1FVV B;  2ZPG B;  5IDN B;  4BCI B;  4BCF B;  4BCH B;  5ACB A;  4ROE A;  3A8O B;  5HQ0 B;  4TTH A;  3DL1 A;  4BCJ B;  4JX5 A;  1OKW B;  1IRE B;  2W9Z A;  1N4M A;  1FIN B;  2C5V B;  2WFY B;  1H1S B;  4HNV A;  4OB3 B;  4HNT A;  3HZJ A;  4YOS A;  5FGK B;  3MIA B;  3QYG B;  1UGS B;  2WPA B;  4EOP B;  4ZGD B;  2ZPH B;  2AHJ B;  3HHT B;  1OIU B;  2BS4 A; 
#chains in the Genus database with same CATH homology
 3K7A M;  4YOO A;  1O9K A;  1W98 B;  2WMB B;  2X1N B;  2EUF A;  4BCM D;  4CFM B;  4EOL B;  3POM A;  4BCO B;  2PK9 B;  5LMK B;  1OGU B;  3LQ5 B;  1C9B A;  3EID B;  3BLR B;  4CFX B;  1GUX B;  4CFV B;  4F70 B;  4F7N B;  2UUE B;  2WIH B;  2I53 A;  3G33 B;  1AIS B;  4KRC B;  1KXU A;  4F7J B;  1TFB A;  4CXA B;  3TN8 B;  4EOK B;  4EOR B;  2R7G A;  4CFU B;  4F6W B;  5CYI B;  2CCI B;  4II5 B;  2IW9 B;  1OI9 B;  2PHG A;  4EC8 B;  4EOO B;  3BHV B;  4EOS B;  5I5Z B;  1PKD B;  3BHT B;  1D3U B;  3EJ1 B;  1URC B;  1VIN A;  2C5N B;  3BLH B;  4ELL A;  2V22 B;  3TNI B;  4CRL B;  2PMI B;  2UZD B;  1G3N C;  3BHU B;  1AD6 A;  4BCG B;  1E9H B;  1OKV B;  1OIY B;  2JGZ B;  3DDQ B;  4I3Z B;  2C5X B;  3DDP B;  4BCN D;  3QHW B;  4CFN B;  4EC9 B;  2UZL B;  5HNB B;  5L2W B;  4EOI B;  4EOJ B;  1VOL A;  1JKW A;  4BCM B;  4ROC A;  5IF1 B;  2WHB B;  3M03 A;  4NST B;  2IW8 B;  2WEV B;  1F5Q B;  2I40 B;  1FVV B;  2QDJ A;  1O9K B;  2B9R A;  4BCQ D;  4ELJ A;  4F7S B;  5LQF B;  2W99 A;  2C6T B;  1XO2 A;  5IDN B;  3MY1 B;  4BCI B;  4BCF B;  1UNL D;  1H28 B;  1OL1 B;  2BKZ B;  4BCH B;  5CEI B;  3MY5 B;  5ACB A;  4ROE A;  3RGF B;  2WXV B;  4EOM B;  1QMZ B;  2IW6 B;  3QHR B;  2IVX A;  1JOW A;  1VYW B;  1JST B;  2W2H A;  5HQ0 B;  4TTH A;  4BCK B;  4KRD B;  4BCJ B;  1OKW B;  3O0G D;  3TNW B;  2W9Z A;  2WIP B;  1N4M A;  1FIN B;  4FX3 B;  1GUX A;  1H4L D;  5IDP B;  5HBJ B;  1P5E B;  2C5V B;  1H26 B;  2UZE B;  2CJM B;  1OL2 B;  2BPM B;  4BCN B;  2C4G B;  1H1R B;  2WFY B;  3H4C A;  1H1S B;  4ROD A;  2CCH B;  3TNH B;  1UNH D;  4G6L B;  4IMY B;  1ZP2 A;  5HVY B;  1UNG D;  4YOZ A;  1H1P B;  4F7L B;  4BCQ B;  3BLQ B;  4YOS A;  4CFU D;  2UZB B;  2F2C A;  4OR5 B;  5FGK B;  2G9X B;  3MIA B;  2W9F A;  4EOQ B;  4UN0 A;  1GH6 B;  3MI9 B;  2WMA B;  2WPA B;  4EON B;  1H24 B;  3F5X B;  1GY3 B;  4YC3 B;  4EOP B;  5HBH B;  2C5O B;  5EFQ B;  1H1Q B;  5BNJ B;  4Y72 B;  4CFW B;  2PK2 A;  2W96 A;  1BU2 A;  3EOC B;  4BCP B;  5ICP B;  1JSU B;  4F6S B;  1OIU B;  3DOG B;  4OGR B;  1H27 B;  5HBE B;  4F6U B;  1H25 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...