2V2FF

Crystal structure of pbp1a from drug-resistant strain 5204 from streptococcus pneumoniae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
366
Chain Sequence
YPAYMDNYLKEVINQVEQETGYNLLTTGMDVYTNVDQEAQKHLWDIYNSDQYVSYPDDDLQVASTVVDVSNGKVIAQLGARHSFGTNQAVETNRDWGSAMKPITDYAPAIEYGVYDSTATMVNDIPYNYPGTSTPVYNWDRAYFGNITLQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPSMHYANAISSNTTESNKQYGASSEKMAAAYAAFANGGIYHKPMYINKVVFSDGSKKEFSDVGTRAMKETTAYMMTEMMKTVLAYGTGRGAYLPWLAQAGKTGTSNYTDYVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMITYLSEGSPEDWNIPEGLYRNGEFVFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN BINDING PROTEIN 1A
publication title Common Alterations in Pbp1A from Resistant Streptococcus Pneumoniae Decrease its Reactivity Toward {Beta}-Lactams: Structural Insights.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 124
structure length 366
sequence length 383
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2v2fF00
3GMWA 3MFDA 4WBGA 1NY0A 1S0WA 3N8SA 4KZ4A 2ZQ9A 1QMFA 2WGWA 4YINA 4OKPA 3G2ZA 4E3KA 1IYQA 1YT4A 1YQSA 4ZDXA 2E8IA 3P98A 1N4OA 3ISGA 2HPBA 4E6XA 5DTTA 1TDLA 1SCWA 4LENA 4GDBA 1MWSA 3IXGA 4OPRA 3VOZA 3MKEA 3UNWA 2G2UA 5FAQA 5M19A 3LY3A 2G2WA 3GQZA 2RCXA 2XF3A 3ZVWA 3ZVTA 5U47A 1ES5A 1W79A 2J9PA 3VFHA 3HLDA 2ZM8A 5EVIC 4IBRA 1MKIA 2V20A 1Q2QA 3IF6B 3N4IA 1DJAA 1W8QA 2Y2PA 4IVIA 4BQMA 2Y55A 3Q7VB 2PU2A 4OOYA 3WRZA 5EOOA 1ES4A 2JCHA 3D4FA 1LI0A 3C5AA 1KDWA 4X6TA 2Y2JA 4BD1A 5JYOA 2EX6A 1ESUA 5A90A 1W7FA 1NYYA 5EVLA 2JBFA 3HLFA 3EQUA 5FA7A 4N1HA 1MWUA 4FH4A 4R4RA 3VFFA 3G2YA 4RVAA 1XKZA 5EVID 4OONA 1XA1A 3HLGA 3W8KA 4HBTA 4WZ5A 1ESIA 4U0TA 3SH9A 4N92A 4S2OA 4YFMA 1HTZA 3NDEA 1ES3A 3MZDA 1MY8A 1M40A 1Z6FA 4R3BA 3IXHA 3PAEA 1NJ4A 2Y2HA 3DTMA 2EX8A 4Z9QA 3BECA 5M18A 5AQ7A 3UDIA 3NCKA 1LL9A 2ZC7A 4EQIA 5DF7A 3VMAA 4EV4A 4IBXA 4JLFA 3Q07A 3VP1A 5CGWA 4DXCA 4WZ5C 4KZAA 1K38A 4IVKA 1EI5A 1ES2A 4R3JA 4A5RA 1CK3A 4OLGA 1IYSA 1BT5A 4BJPA 1PW1A 4S2MA 1K54C 4E3LA 2Y2IA 4XUZA 5CHUA 1IELA 3C4OA 3OPLA 3TOIA 2ZLYA 1DJBA 3EQVA 4PM9A 1JWPA 4M3KA 5E2HA 3UPPA 4E3MA 5E2GA 4KG6A 4LCMA 2X71A 4UHUA 1CEGA 2XFTA 3NDGA 3OCLA 5CRFA 1C3BA 1XPBA 4KENB 1XXMA 4ZAMA 1K6SA 5HARA 1IYOA 2XFSA 3N7WA 2Y4AA 2HP9A 5FQKA 2H10A 2C6WB 4EUZA 2XGNA 4KZBA 4RX3A 5IHVA 5FAOA 5HAQA 4X56A 3OPHA 3WS0A 1BLCA 1L2SA 2R9WA 1E3UD 5CEDA 1TVFA 4ZJ2A 2EX9A 4C6YA 5E43A 2Z2MB 3VP3A 3Q7ZA 5GHXA 4JKTA 1L0GA 2VGJA 5DVAA 5F1FA 3BFEA 5AQBA 3VP4A 1XGIA 4IEDA 5CGSA 1SKFA 2ZQ7A 1H8YA 2DCFA 4QHCA 4RYEA 4OOLA 1I5QA 4OPYA 1VM1A 1YMSA 2OLVA 2P9VA 3GSGA 1YMXA 3TG9A 3DW0A 2WGIA 5A92A 2ZQCA 3SS5A 1GCEA 1KGEA 4LV2A 1E25A 4KZ5A 3BFCA 2ZQ8A 1SDEA 1K57A 3Q82A 1PWCA 2WKIA 4GOGA 1IKGA 5DTKA 4JF4A 3V3RA 1BLSA 4JXWA 2XK1A 4LV3A 3HBRA 3WS2A 3CG5A 4S2IA 3I7JA 1HD8A 3E2KA 1HZOA 3OCNA 5EECA 5GLAA 1NZOA 4DE2A 4P87A 4DRTA 4DE0A 4BL3A 1MWRA 3PBRA 3G4PA 3TSGA 3HVFA 3M6BA 5HW3A 1QMEA 1M6KA 3G35A 1E4DA 2WGWB 4S2NC 2XD5A 1BLPA 3NY4A 4P0MA 1K56A 1PWGA 3JYIA 5EVIA 5F1GA 4QJGA 2GDNA 3IHBA 2ZM2A 2IWBA 3O3VA 2R9XA 3MXRA 5A91A 1CI8A 2HDRA 4GKUA 5FI7A 1YLYA 4U0XA 4JXSA 4MNRA 4HESA 1GA9A 3LO7A 5GLDA 4C75A 1LL5A 3LCEA 4BENA 4X69A 3NC8A 1KGFA 2WGVA 4UA6A 4Y0TA 1H5XA 3OPPA 5BOHA 3IWIA 3FKWA 2EXBA 3PAGA 4JF6A 4PM6A 4UA9A 1ERQA 5AQAA 4FH2A 3UN7A 4Y0OA 5EOEA 1TDGA 3BEBA 3SOIA 4DE1A 4R23A 3SS4A 1W8YA 2OLUA 4EBPA 2ZM0A 1SDNA 2XD1A 2CC1A 3AGDA 4BLMA 4R1GA 1I2SA 5DF9A 2QMIA 4S2KA 3V50A 3V39A 1K54A 2IWDA 1BULA 4H8RA 2WZXA 2I72A 2PBYA 4JBFA 4D2OA 4MBHA 3S4XA 1RCJA 1YLTA 4GB7A 3HUOA 3SS3A 4FSFA 1E3UA 1I2WA 1DJCA 2PU4A 3MBZA 5E2FA 5FI2A 1O7EA 4PMAA 5GLCA 4P6BA 4ZJ1A 2Y2MA 2RL3A 1PW8A 3A3FA 3OC2A 4K0WA 3IF6C 4KQRA 2B5RA 1PYYA 3WS5A 2Q9MA 5GLBA 1U60A 3W4OA 2WUQA 2J8YA 4XXRA 3OPRA 4HEFA 5CHMA 5FI6A 3HLCA 4MLLA 5GL9A 4KG5A 3ZG7B 3UE1A 3C4PA 1KVLA 1JTDA 1FQGA 1JVJA 1RP5A 1WE4A 4X53A 3ZFZA 4E6WA 5FQJA 3ZDJA 2H5SA 5TR7A 3IXBA 3UPNA 1YLWA 3IWQA 2BLSA 4N1XA 1K6RA 2ZD8A 3VP0A 1ZKJA 5HL1A 2EFXA 1L0FA 4PM7A 2A3UA 5FASA 4NETA 3WS1A 2HDQA 4O7DA 3DWZA 3WS4A 3UE0A 3CJMA 1NRFA 2ZQDA 4OP5A 4GN2A 2WZZA 3FV7A 3IH8A 3VP2A 1PZPA 3FYZA 3G32A 5KSHA 1KGGA 1PWDA 2FFYA 2P9VB 1PIOA 3N6IA 4ZTKA 5HAPA 3N8LA 3BM6A 4PM8A 1PZOA 1YLPA 4WMCD 4QU3A 1RGYA 4JPMA 4Y0UA 3O86A 3IT9A 3RJUA 5FQIA 4OQ0A 3E2LA 1JTGA 3GR2A 4OOMA 1ZG4A 3V5MA 3IXDA 4OPZA 1BTLA 1WYBA 4S2NA 2WAEA 4OVDA 3HLWA 3QNCA 1H8ZA 1ONGA 2JC7A 2X01A 2QZ6A 5DTSA 4B4ZA 4XUXA 5CGXA 5FQMA 5CHJA 5FQQA 2HP5A 3V3SA 3WWXA 5CECA 5TGFA 1FCMA 1BSGA 1XP4A 3LEZA 3AGEA 4S2PA 3ZCZA 1ONHA 5HFOA 1K25A 1MWTA 3W4PA 4OPQA 1W5DA 3A3DA 3VSKA 2ZC3B 5EVIB 3BFGA 3O88A 3GTCA 3PBSA 4KZ7A 3IWOA 3NI9A 2WK0A 3ZG5A 2UWXA 1PI4A 2HDSA 4Q8IA 5FATA 1K4FA 1XX2A 1LLBA 3FWLA 3HLBA 5A93A 5JYPA 2J7VA 2OSUA 4KZ8A 4B88A 3BLMA 1FR1A 2A49A 3UE3A 2Y91A 5FQ9A 2Y2LA 3N8RA 1XA7A 4ZJ3A 2DRWA 5EUAA 4KZ9A 4WYYA 1FCNA 4UAAA 4X68A 2WAFA 3PBQA 4KQOA 4DDSA 3IHAA 4K0XA 1ALQA 3G31A 1LHYA 2ZQAA 1KE4A 2EX2A 4JF5A 1VQQA 4GNUA 2Z2LB 5HAIA 3S1YA 3Q81A 1BLHA 4N9LA 1S6RA 5F82A 3SH8A 1OMEA 4P85A 2H0TA 3VOYA 2EXAA 3IQAA 3WRTA 3FZCA 3GV9A 5I94A 4DDYA 4ZBEA 4C3QA 1YLJA 3LY4A 1GHIA 3ZHHA 2OV5A 5GHZA 1YM1A 4ID4A 1CEFA 2Q9NA 4RX2A 3BFDA 3HUMA 4DXBA 1FR6A 1FSYA 4NK3A 2ZC5B 2Y2GA 3IF6A 4E3JA 2JE5A 1SHVA 3Q7VA 3GRJA 1ZC2A 4EBNA 2Y2QA 3SH7A 3G34A 4FCFA 4HBUA 3UDFA 4DF6A 4MEZA 4E3IA 1Q2PA 1N9BA 3QNBA 3NIAA 1K56D 3PBTA 2Y59A 3UO9A 3IF5A 3BRMA 2IWCA 1FCOA 4S2JA 5CEBA 3W4QA 4WMCA 1IKIA 2BG1A 3ITAA 2WKHA 2WYXA 3MZEA 3M2JA 4JXVA 1EWZA 1GHPA 5FAPA 4DKIA 3B3XA 2Y2KA 4GD8A 4GDNA 5TFQA 4PPRA 4FD8A 4QB8A 4WEKA 1WYCA 3RXXA 2DNSA 3ITBA 3PBNA 2J9OA 4OP8A 3BYDA 1BUEA 2HP6A 1KE3A 4B4XA 1G68A 5D3OA 1XGJA 3BLSA 5M1AA 2XEPA 5KSCA 1TEMA 2V1ZA 3MKFA 1ERMA 3HREA 3Q1FA 4OLDA 3ZGAB 3UPOA 3ZG9B 2ZJ9A 1K55A 2ZMAA 3M2KA 1NZUA 1ZG6A 4OQHA 4WEJA 2WKEA 3ZNYA 3MZFA 2HDUA 3FKVA 4RA7A 3HUNA 2XLNA 2XR0A 5FDHA 2C5WB 5G18A 1O07A 4F94A 3P09A 3HLEA 1NYMA 3ZNTA 5HX9A 3UY6A 4BD0A 4R0QA 4E3OA 1IYPA 4N9KA 4QY6A 3BFFA 5J8XA 4S2LA 3O87A 1KDSA 3C7VA 4LV0A 1FSWA 3PTEA 4U3TA 5CTNA 2H0YA 4L0LA 4CPKA 3A3IA 1K55C 4EWFA 1MBLA 4R4SA 4DE3A 4X55A 5F83A 5CTMA 1GA0A 1JWZA 2EFUA 1MPLA 4UA7A 1KE0A 4LCLA 5AQ9A 3S22A 2WADA 1MXOA 1L0DA 4QD4A 3QHYA 4Y7PA 3MXSA 5L2FA 2ZC4B 4KZ3A 1AXBA 3CMZA 4LV1A 4MBFA 2ZC6B 4KZ6A 1IEMA 1HVBA 2VGKA 4KG2A 1NXYA 3UDXA 4GD6A 5GHYA 4PM5A 4BL2A 5FSRA 2FFFB 3RXWA 1LI9A 3CZDA 3IH9A 2XQZA 5DF8A 4WZ4A 4GZBA 3NBLA 3VSLA 4JXGA 3A3EA 4KQQA 5KZHA 4OQGA 1PI5A 4EBLA 5CXWA 1FOFA 1KVMA 1Y54A 2X02A 3OZHA 4QY5A 1JWVA 4WM9A 5EE8A 3DWKA 4OQIA 1J9MA 3G30A 2V2FF 1G6AA 3A3JA 4OH0A 1DY6A 2XDMA 2Y2NA 1K4EA 3HL9A 2QPNA 5EPHA 3GVBA 4MBKA 1L0EA 4WELA 4CJNA 5KMWA 3ZG0A 3C7UA 3ZG8B 2P74A 1EROA 1BZAA 1GHMA 2XH9A 5CERA 4E3NA 1CI9A 1RGZA 3AGFA 3M6HA 2Y2OA 5E2EA 1K57C 3PBOA 1YLZA 4K91A
chains in the Genus database with same CATH superfamily
1S4SA 4WBGA 3N8SA 2WGWA 2K2NA 1IYQA 1YT4A 1YQSA 1SCWA 1H0MA 3IXGA 5M19A 2W3GA 2HF6A 3ZVWA 4LGWA 1VEUA 1ES5A 5EVIC 1MKIA 2L1MA 3F1PB 1ES4A 3KYQA 4FUWA 1EW0A 3C5AA 4X6TA 2Y2JA 5JYOA 4GCZA 4YWZA 3HLFA 5FA7A 3ZYTA 4FH4A 2JN7A 4R4RA 1XKZA 4HBTA 4U0TA 3KSFA 1MY8A 1M40A 1Z6FA 5FDSA 1NJ4A 4Z9QA 3BECA 5M18A 4IBXA 5TJJA 3VP1A 2NUPC 4ESPA 4X1LA 4KZAA 4IVKA 1CK3A 4BMWA 4OLGA 1IYSA 1N9NA 2Y2IA 4XT2B 3C4OA 3OPLA 3TOIA 1DJBA 3UPPA 2HGVA 4UHUA 1X0OA 3NDGA 1V9YA 3LIEA 2HP9A 5FEGA 4CQHA 4X56A 3IS2A 2R9WA 1TVFA 4EV4A 2A24A 3Q7ZA 1L0GA 2QJ5A 2VGJA 3BFEA 2I9VA 3VP4A 1XGIA 4IEDA 2V0UA 4QHCA 1I5QA 2KX6A 4OPYA 1K0KA 1YMSA 2P9VA 3GSGA 4I38A 5EM1A 1KGEA 2KDKA 4LV2A 4KZ5A 2ZQ8A 1SDEA 4PAUA 4HJ4A 1DP9A 1S4RA 5DTKA 3HJKA 1AWIA 3KSHA 3MQQA 2VGLM 3T4JA 5GLAA 5EECA 4P87A 4DRTA 4DE0A 2FZ0A 1QMEA 2QHKA 1M6KA 3G35A 4S2NC 1BLPA 4K08A 4P0MA 3A0VA 2GDNA 1TS6A 2OOLA 2ZM2A 4EQ1A 2DMWA 3MXRA 1CI8A 3LI9A 4GKUA 3MF0A 1F98A 4JXSA 4MNRA 3PXPA 3LCEA 3OPPA 5BOHA 2J3TC 5FL3A 4L9EA 4FH2A 4G3KA 3BJNA 4O0PA 3LIDA 3TRCA 3H7WA 5HSQA 5DFYA 3LIFA 3T1SA 3AGDA 4R1GA 4WL9A 5DF9A 4NEED 1XJ6A 1BULA 5F69A 4JBFA 3BQAA 2JKTI 3LR0A 3NECA 2V9AA 4PMAA 2VKSA 4HP9A 3PYPA 5GLCA 1OT6A 1XFNA 1PW8A 3A3FA 4K0WA 1OTDA 4BBTA 4L9GA 4AFIA 5HDSA 2Q9MA 3KX0X 4HEFA 3HLCA 3QP2A 3ZFZA 4UQIS 4MDZA 5FQJA 2H5SA 4DN0A 5TR7A 3IXBA 1YPRA 1YLWA 3T4TA 2ZD8A 3H9WA 4ETZA 5HL1A 1ACFA 3B33A 2HDQA 3DWZA 3UE0A 4GN2A 1PZPA 1P9WA 1NWZA 1KGGA 2M7VA 3BM6A 4WMCD 1W63Q 4JPMA 3IT9A 3V5MA 1MKMA 1BTLA 1WYBA 3NOUC 4O01A 2QZ6A 5FQQA 5DJUA 1H8MA 4II7A 3LEZA 4MCWA 1ONHA 1KOUA 4YOFA 5F6AA 3W4PA 5L10A 3FPWA 2ZC3B 2VV8A 3HCYA 4UQIM 4Y3IA 3PBSA 4ARZA 1PI4A 2CMNA 3E98A 5FATA 1XX2A 3T1RA 4B88A 2MJ6A 1FR1A 3UE3A 3LIAA 2Y91A 5F68A 3F1NA 4JGRA 4KZ9A 4WYYA 1T18A 2JKFA 4DDSA 1OJ5A 1LHYA 2EX2A 4JF5A 1VQQA 1G5UA 3SH8A 1ZTUA 3WRTA 3LICA 3UMDA 3VV4A 3CHWP 1CEFA 3BFDA 1FR6A 4E3JA 3T50A 1SHVA 3GRJA 1ZC2A 3F1PA 3FG8A 4HBUA 3UDFA 2IA2A 4HQAA 3NIAA 2M7UA 1K56D 1S67L 3EWKA 1S1YA 4S2JA 5CEBA 3BW6A 4WMCA 1IKIA 2BG1A 1Y4OA 2ZBBA 5FAPA 2VJWA 2ZOHA 4WEKA 4PPRA 2OWJA 1SZVA 3BLSA 3F1OB 5KSCA 1TEMA 2V1ZA 2Y79A 3HREA 4XT2A 3ZG9B 2ZJ9A 3M2KA 1ZG6A 2HDUA 3FKVA 5G18A 2ZL1B 1O07A 3ZNTA 5HX9A 3UY6A 4R0QA 4E3OA 4N9KA 2VX8A 3FPVA 3BFFA 3O87A 1KDSA 1FSWA 3PTEA 4U3TA 2PR5A 5CTNA 4CPKA 1K55C 4EWFA 1CF0A 5F83A 4UA7A 1JNUA 4Y7PA 2YKFA 4KZ3A 1YKDA 2JKGA 3E4PA 2NUTC 5GHYA 2FFFB 4ME4A 5DF8A 4I5SA 3PR6A 4JXGA 1GSWA 5CXWA 1Y54A 3OZHA 4WM9A 1L3LA 5EE8A 1J9MA 2V2FF 2V1AA 1DY6A 1K4EA 2QPNA 5EPHA 1L0EA 3L9KA 2XH9A 4E3NA 1RGZA 2Y2OA 5E2EA 3CUEA 2XRNA 1YLZA 5AVFA 1S0WA 3RTYA 3VE3A 1MC0A 4E3KA 2E8IA 3P98A 3ISGA 1TDLA 4X1MA 4HY8A 5FAQA 3LY3A 2G2WA 3GQZA 5DJTA 3W2ZA 3ZVTA 4IVIA 3Q7VB 2PU2A 3WRZA 5I5LA 2JCHA 3D4FA 1LI0A 2D02A 3HJIA 1KDWA 4QPRA 4I39A 4BD1A 1T19A 5L09A 1NYYA 1LL8A 4N1HA 1MWUA 4RVAA 2KLIA 3MXQA 2Z6CA 3RH8B 1SKOB 1ESIA 4YFMA 1ES3A 4R3BA 3IXHA 3DTMA 1OJGA 3NCKA 2B18A 3EEHA 4EQIA 3Q07A 4DXCA 4WZ5C 5CX7A 1K38A 3VOLA 1VHMA 5CHUA 2ZLYA 4PM9A 4EERA 2XFTA 3OCLA 1XPBA 4KENB 5HARA 1IYOA 2Y4AA 3UB7A 3P01A 4EUZA 2XGNA 1LSXA 5FAOA 3OPHA 2PBDP 4C6YA 2KOIA 5DVAA 5AQBA 1SKFA 3LEQA 3MS6A 1BYWA 1VM1A 3T12B 2ZQCA 3BFCA 3Q82A 3EGDC 3O5YA 2WKIA 1IKGA 2PAVP 4JF4A 2VV6A 4LV3A 3WS2A 5HZHA 4DE2A 1HZOA 1NZOA 4E04A 3G4PA 5DKKA 3TSGA 5HW3A 2XD5A 4QJGA 3IHBA 2IWBA 3O3VA 2R9XA 4MN5A 5A91A 2HDRA 1GA9A 2H28A 3LO7A 5GLDA 4UA6A 2W27A 3PAGA 4JF6A 4R38A 4PM6A 4BWIA 3LI8A 2AVXA 1T1CA 3T4KA 4Y0OA 3T4OA 3SOIA 3ICYA 2EWWA 2OLUA 1SDNA 4HHDA 4Y17A 3V39A 1K54A 2WZXA 3S4XA 4GJ4A 1RCJA 2D01A 4GB7A 3VE4A 3SS3A 3IBRA 4JGPA 4FSFA 1I2WA 1DJCA 3CWFA 4P6ZS 3MBZA 5E2FA 2VGLS 1O7EA 4P6BA 5HWTA 4ZJ1A 2OAP1 2Y2MA 2RL3A 3OC2A 1PNEA 3WS5A 1N9LA 3W4OA 2WUQA 3S7PA 5CHMA 3ZG7B 3UE1A 3C4PA 1FQGA 1P9RA 4X53A 3ZDJA 4N1XA 4EW7A 3MJQA 2EFXA 1L0FA 4PM7A 2A3UA 3F1OA 4FOFA 1DRMA 5EFWA 4Y15A 4O7DA 3EEAA 3CJMA 2VV7A 3FV7A 3G32A 2ZL1A 3EGXC 1PWDA 3N6IA 1PIOA 2W1TB 1YLPA 4QU3A 1ZG4A 5J3WA 3IXDA 4OPZA 3JPUA 3SZTA 1ONGA 4P6ZM 2X01A 4B4ZA 2PYPA 3NOPC 2HP5A 3V3SA 1XP4A 3NOTC 1MWTA 1W5DA 4CLCD 3GTCA 1STZA 4M4XA 4WF0A 4KZ7A 4IUKA 1HLUP 2LB9A 5A93A 2OSUA 2WKPA 3FC7A 1P0ZA 4KUOA 2W3FA 2Y2LA 2P08A 1XA7A 5AJGA 5EUAA 3T4QA 4DMZA 4R70A 2WAFA 3PBQA 1ALQA 3G31A 4PHTA 2K7SA 2ZQAA 1KE4A 2HV1A 1BLHA 4GW9A 3CUEC 4P85A 2EXAA 3IQAA 5I94A 4C3QA 1YLJA 3ZHHA 4HJ6A 4ID4A 3PHYA 2Q9NA 2JHEA 1FSYA 2ZC5B 1Z09A 3Q7VA 2Y2QA 3SH7A 3G34A 4FCFA 4PKYG 3JVUA 1PFLA 2EA9A 4MEZA 4HP4A 3UB9A 1Q2PA 1N9BA 4H6JB 3PBTA 2Y59A 3BRMA 2IWCA 1SKOA 3UB8A 4EESA 3ITAA 3UB6A 5HDCA 4X25A 2Y2KA 2W3HA 4FD8A 1WYCA 2YKHA 2J9OA 2HP6A 3JVVA 5HD3A 5D3OA 3S7QA 1S66L 3MKFA 2ZMAA 4WEJA 2WKEA 3ZNYA 1XJ3A 2C5WB 4CLCA 1Y28A 1GSVA 4F3LB 3HLEA 4EXOA 3LGOA 4S2LA 3C7VA 4LV0A 4R4SA 1YAXA 4NG2A 1JWZA 4LCLA 5AQ9A 3S22A 1MXOA 4QD4A 3QHYA 3MXSA 5FEFA 1IEMA 3DTKA 4ZRRA 3UB5P 4EUVA 3UDXA 4GD6A 5J7EA 5FSRA 3IH9A 1VETB 2XQZA 4Y2FA 4KQQA 5KZHA 4OQGA 4HIAA 1FOFA 4QY5A 3NULA 4O8GA 3G30A 1G6AA 2Y2NA 4MBKA 3C7UA 1ODVA 4HH2A 3M6HA 2G7UA 3KYZA 4GS9B 3GMWA 1NY0A 4KZ4A 2ZQ9A 1QMFA 4YINA 3D3OA 2GX5A 3UMEA 4ZDXA 4E6XA 2HPBA 2V8FA 4LENA 3VOZA 3UNWA 2G2UA 3QP4A 4GHIB 4R3AA 5U47A 2J9PA 2ZM8A 3BY8A 2V20A 1Q2QA 3IF6B 2Y2PA 2Y55A 4OOYA 5EOOA 2INWA 1PRQA 2EX6A 1ESUA 1W7FA 3BY9A 5EVLA 2P04A 3HLGA 3W8KA 1FILA 1G28A 3SH9A 3CI6A 3MZDA 2V1BA 4LFUA 3PAEA 2EX8A 5AVEA 1NRJA 2ZC7A 1DP6A 4JLFA 5EM0A 2OAQ1 1EI5A 4A5RA 1BT5A 1K54C 4E3LA 2Z6DA 2JKRI 1IELA 3EQVA 1JWPA 4M3KA 4E3MA 4KG6A 4NXBA 1TS7A 1CEGA 3GDIA 5CRFA 1C3BA 1K6SA 3N7WA 1IFQA 4RX3A 4I3IA 2JKTM 1BLCA 1L2SA 2QJ7A 1E3UD 4ZJ2A 5E43A 5GHXA 4JKTA 4EEPA 5F1FA 4D60A 5CGSA 1H8YA 2DCFA 2P7JA 2GZAA 2O9BA 4Q0JA 2OLVA 1LT0A 3DW0A 2WGIA 5A92A 1GCEA 2W1TA 1OPXA 4GOGA 1BLSA 1V9ZA 4JXWA 1YSPA 3D9YA 3CG5A 3I7JA 3OCNA 5TBMB 2QKPA 1G6OA 3MR0A 4EEUA 1LSVA 3HVFA 3M6BA 1T1BA 1E4DA 1K56A 1PWGA 5F1GA 4G3WA 5FI7A 4HI4A 2PD8A 4U0XA 4HESA 2W0NA 1NLYA 2WGVA 2HJ9C 2L0WA 4UA9A 1ERQA 5AQAA 4NXEA 2J80A 3UN7A 3LR4A 2BASA 1TS0A 3BEBA 2QYBA 1D7EA 4DE1A 4R23A 1W8YA 4EBPA 2PD7A 2ZM0A 4KQDA 3ULFA 1I2SA 4S2KA 4H8RA 2I72A 2PBYA 5IU1A 1YSQA 4MBHA 3LUQA 3HUOA 5L07A 1E3UA 5FI2A 4QWOA 1S1ZA 4H6JA 3KO6A 1PYYA 5GLBA 4XXRA 2J8YA 3IX4A 3OPRA 5FI6A 4MLLA 5GL9A 4CLCB 4KG5A 1KVLA 5G4YA 1JTDA 1JVJA 1WE4A 3UE6A 4DJ2A 3R7WB 2BLSA 2UV0E 3VP0A 2O99A 3LIBA 3MQOA 5FASA 3WS4A 1N9OA 2ZQDA 4OP5A 2WZZA 3IH8A 3FYZA 4F3LA 4ZTKA 3N8LA 4PM8A 1PZOA 3RXXA 3T1XA 1RGYA 3C8CA 4Y0UA 3OOVA 4OOMA 1H3QA 2WAEA 4OVDA 3HLWA 3QNCA 4HH3A 5FQMA 1OTAA 5CHJA 2V0WA 2B02A 3WWXA 1FCMA 4LPZA 5C5KA 3ZCZA 1VETA 4OPQA 3KYEA 5K5BA 3A3DA 3VSKA 5EVIB 3BFGA 4CLCE 4I3AA 3IWOA 3NI9A 2WK0A 3ZG5A 3S7OA 3BWLA 4L9FA 2UWXA 1NLZA 4Q8IA 3QP5A 1K4FA 1LLBA 5JYPA 3N8RA 4GS9A 3QP8A 3K3DA 3CAXA 1XFQA 3B47A 3IHAA 4GLQA 5KIZA 5MC7A 4GNUA 3Q81A 5F82A 3FZCA 4MN6A 4DDYA 4ZBEA 4GHIA 3LY4A 2ACGA 4RX2A 3HUMA 3CITA 3OBFA 3IF6A 2JE5A 4IJGA 2Y8HA 4EBNA 3DTIA 4DF6A 1F9IA 1OTIA 1TS8A 4Y5FA 3UO9A 3IF5A 1FCOA 3W4QA 2WKHA 3M2JA 1GHPA 3B3XA 4GDNA 5TFQA 2DNSA 3BYDA 5A8BA 4B4XA 1G68A 3C38A 1MZUA 2HJEA 5M1AA 3U4LP 3E4QA 2XEPA 1OTEA 4OLDA 5HL6A 1K55A 1NZUA 2V8CA 4OQHA 3MZFA 4RA7A 5FDHA 5HWWA 3HUNA 2XLNA 5DFXA 3P7NA 4F94A 3IBJA 4BD0A 4QY6A 5J8XA 2Q0OA 5L8MA 1MBLA 4DE3A 4X55A 5CTMA 1MPLA 1TD5A 3T1QB 5L2FA 4LV1A 4MBFA 2ZC6B 4KZ6A 2VGKA 4KG2A 1NXYA 4BL2A 4WZ4A 3A3EA 1PI5A 2PRFA 2VLGA 1KVMA 2X02A 3E4OA 3MFXA 2VEAA 3NHQA 3DWKA 4OH0A 2XDMA 3C30A 3HL9A 3GVBA 5KMWA 1BZAA 5CERA 1CI9A 3AGFA 5TBMA 4MMNA 5IT5A 3PBOA 3MFDA 1WA9A 4I3JA 2VK3A 4OKPA 3G2ZA 1N4OA 2GNXA 5DTTA 4Q0IA 4GDBA 1MWSA 3LR3A 4OPRA 3MKEA 3E0YA 4WN5A 4B9OA 2RCXA 2XF3A 2XROA 5HWVA 1W79A 3VFHA 3HLDA 2R78A 4IBRA 5HPIA 3N4IA 4Z1WA 1DJAA 1W8QA 4BQMA 4WUJA 4EETB 2EWVA 3CLOA 5A90A 2JBFA 3EQUA 3VFFA 3G2YA 5EVID 4OONA 1XA1A 1CQAA 4WZ5A 3DAVA 4N92A 4S2OA 1HTZA 3NDEA 2O9AA 2Y2HA 5AQ7A 3UDIA 1LL9A 2VA0A 5DF7A 3VMAA 5CGWA 1XJ2A 4MN7A 3K2NA 1ES2A 4R3JA 4BJPA 1PW1A 4S2MA 4XUZA 3TW8A 4NXFA 3KSGA 4DJ3A 5E2HA 5E2GA 4LCMA 2X71A 3C2WA 1VB6A 3H82B 1XXMA 4ZAMA 1P97A 2XFSA 3DTEA 5FQKA 3GECA 2H10A 3TE8A 2C6WB 4KZBA 3A0SA 3R7WA 1J3WA 5IHVA 5HAQA 3WS0A 5CEDA 2EX9A 3TJZC 3VP3A 2Z2MB 5EVEA 2WKQA 2ZQ7A 4RYEA 4OOLA 1D1JA 1W63M 4HOIA 1YMXA 3TG9A 3SS5A 1E25A 3CPTB 1K57A 1PWCA 3T4SA 3D72A 3U2AA 3KSIA 3V3RA 2XK1A 3HBRA 4S2IA 1HD8A 3E2KA 1F2KA 3MMHA 4BL3A 1MWRA 3PBRA 3EOIA 5EV0A 4R6LA 2WGWB 1GSXA 3NY4A 3T4LA 3JYIA 5EVIA 2LB5A 1OT9A 4EU0A 5G4ZA 1YLYA 1VEUB 2FH5A 3DBAA 4C75A 1LL5A 4BBVA 4BENA 4X69A 1A0KA 3NC8A 1KGFA 4Y0TA 5HPFA 1H5XA 3IWIA 3FKWA 2EXBA 5EOEA 1TDGA 3SS4A 2XD1A 2CC1A 4Q0HA 4BLMA 1T1AA 2QMIA 2J3TD 1UWNX 3V50A 2IWDA 4HNBA 4D2OA 1YLTA 2XA7S 1D06A 2PYRA 2PU4A 3IX8A 3ZQ5A 3LFVA 4LRYC 3IF6C 4KQRA 3RFBA 4NXGA 2B5RA 3LYXA 1U60A 3R4KA 2W3DA 1OTBA 4E6WA 1RP5A 5J4EA 2OWHA 3UPNA 3IWQA 2ZMVA 1K6RA 3IS2B 1ZKJA 2QWSA 2A24B 4NETA 3WS1A 4G3VA 1NRFA 3B42A 3VP2A 5KSHA 2P9VB 2FFYA 5HAPA 1CJFA 4JGOA 2O9CA 3O86A 3RJUA 5FQIA 4OQ0A 3E2LA 1JTGA 3GR2A 2XA7M 4S2NA 4LLOB 1H8ZA 2JC7A 5DTSA 4PKYA 4XUXA 5CGXA 1ZHHB 5CECA 5TGFA 4YNRA 1BSGA 1TF1A 3AGEA 4S2PA 5LBRA 5HFOA 1K25A 2ZMFA 3V67A 2J3WA 3O88A 2HZ5A 2K31A 1UGUA 2HDSA 3FWLA 3HLBA 2J7VA 3MSHA 2BTFP 4KZ8A 2WKRA 3BLMA 2A49A 2M1CA 5FQ9A 4ZJ3A 2DRWA 4UEYA 1FCNA 4UAAA 4X68A 2O0YA 3LR5A 4KQOA 4K0XA 4IHQA 5HAIA 2Z2LB 3S1YA 1F5MA 4N9LA 1S6RA 3H7WB 3VOYA 1OMEA 2H0TA 4LRXC 3GV9A 2PT7A 2W3EA 1GHIA 2B95A 2OV5A 5GHZA 1YM1A 3K3CA 4DXBA 4IUHA 4NK3A 2VZWA 1XJ4A 2Y2GA 4KUKA 4FTXA 5DKLA 4E3IA 5HD5A 3QNBA 4Y13A 3BQ8A 4ETXA 2WYXA 3MZEA 4JXVA 1EWZA 4DKIA 2PR6A 5IS1A 4GD8A 4B93A 4QB8A 3ITBA 3G6OA 3PBNA 4OP8A 1BUEA 1KE3A 4JGQA 1XGJA 1ERMA 3Q1FA 3MQ0A 3ZGAB 4BBUA 3UPOA 1IOUA 2GJ3A 4WLAA 2XR0A 3QP1A 3P09A 3H82A 3S7NA 3L7HA 1NYMA 1FIKA 1IYPA 5F5YA 2W1RA 5HDDA 3QP6A 2H0YA 4L0LA 3A3IA 3SW1A 1GA0A 2EFUA 2L4RA 1KE0A 2WADA 4CLCC 1L0DA 1DP8A 2PHYA 4RQ9A 2ZC4B 4LRZE 1AXBA 3CMZA 3A0RA 3OLOA 2PDRA 1HVBA 2JKRM 1UWPX 4PM5A 4HJ3A 3RXWA 1LI9A 3CZDA 4GZBA 3NBLA 3VSLA 2A2LA 4EBLA 1LSWA 3CPTA 4NKPA 3NJAA 1JWVA 4ARZB 4OQIA 3A3JA 4WELA 4CJNA 2XSSA 2E8JA 3ZG0A 3ZG8B 2P74A 1EROA 1GHMA 2ZOIA 3IX3A 1K57C 3F1NB 4K91A
chains in the Genus database with same CATH topology
3GMWA 3MFDA 4WBGA 1NY0A 1S0WA 3N8SA 4KZ4A 2ZQ9A 1QMFA 2WGWA 4YINA 4OKPA 3G2ZA 4E3KA 1IYQA 1YT4A 1YQSA 4ZDXA 2E8IA 3P98A 1N4OA 3ISGA 2HPBA 4E6XA 5DTTA 1TDLA 1SCWA 4LENA 4GDBA 1MWSA 3IXGA 4OPRA 3VOZA 3MKEA 3UNWA 2G2UA 5FAQA 5M19A 3LY3A 2G2WA 3GQZA 2RCXA 2XF3A 3ZVWA 3ZVTA 5U47A 1ES5A 1W79A 2J9PA 3VFHA 3HLDA 2ZM8A 5EVIC 4IBRA 1MKIA 2V20A 1Q2QA 3IF6B 3N4IA 1DJAA 1W8QA 2Y2PA 4IVIA 4BQMA 2Y55A 3Q7VB 2PU2A 4OOYA 3WRZA 5EOOA 1ES4A 2JCHA 3D4FA 1LI0A 3C5AA 1KDWA 4X6TA 2Y2JA 4BD1A 5JYOA 2EX6A 1ESUA 5A90A 1W7FA 1NYYA 5EVLA 2JBFA 3HLFA 3EQUA 5FA7A 4N1HA 1MWUA 4FH4A 4R4RA 3VFFA 3G2YA 4RVAA 1XKZA 5EVID 4OONA 1XA1A 3HLGA 3W8KA 4HBTA 4WZ5A 1ESIA 4U0TA 3SH9A 4N92A 4S2OA 4YFMA 1HTZA 3NDEA 1ES3A 3MZDA 1MY8A 1M40A 1Z6FA 4R3BA 3IXHA 3PAEA 1NJ4A 2Y2HA 3DTMA 2EX8A 4Z9QA 3BECA 5M18A 5AQ7A 3UDIA 3NCKA 1LL9A 2ZC7A 4EQIA 5DF7A 3VMAA 4EV4A 4IBXA 4JLFA 3Q07A 3VP1A 5CGWA 4DXCA 4WZ5C 4KZAA 1K38A 4IVKA 1EI5A 1ES2A 4R3JA 4A5RA 1CK3A 4OLGA 1IYSA 1BT5A 4BJPA 1PW1A 4S2MA 1K54C 4E3LA 2Y2IA 4XUZA 5CHUA 1IELA 3C4OA 3OPLA 3TOIA 2ZLYA 1DJBA 3EQVA 4PM9A 1JWPA 4M3KA 5E2HA 3UPPA 4E3MA 5E2GA 4KG6A 4LCMA 2X71A 4UHUA 1CEGA 2XFTA 3NDGA 3OCLA 5CRFA 1C3BA 1XPBA 4KENB 1XXMA 4ZAMA 1K6SA 5HARA 1IYOA 2XFSA 3N7WA 2Y4AA 2HP9A 5FQKA 2H10A 2C6WB 4EUZA 2XGNA 4KZBA 4RX3A 5IHVA 5FAOA 5HAQA 4X56A 3OPHA 3WS0A 1BLCA 1L2SA 2R9WA 1E3UD 5CEDA 1TVFA 4ZJ2A 2EX9A 4C6YA 5E43A 2Z2MB 3VP3A 3Q7ZA 5GHXA 4JKTA 1L0GA 2VGJA 5DVAA 5F1FA 3BFEA 5AQBA 3VP4A 1XGIA 4IEDA 5CGSA 1SKFA 2ZQ7A 1H8YA 2DCFA 4QHCA 4RYEA 4OOLA 1I5QA 4OPYA 1VM1A 1YMSA 2OLVA 2P9VA 3GSGA 1YMXA 3TG9A 3DW0A 2WGIA 5A92A 2ZQCA 3SS5A 1GCEA 1KGEA 4LV2A 1E25A 4KZ5A 3BFCA 2ZQ8A 1SDEA 1K57A 3Q82A 1PWCA 2WKIA 4GOGA 1IKGA 5DTKA 4JF4A 3V3RA 1BLSA 4JXWA 2XK1A 4LV3A 3HBRA 3WS2A 3CG5A 4S2IA 3I7JA 1HD8A 3E2KA 1HZOA 3OCNA 5EECA 5GLAA 1NZOA 4DE2A 4P87A 4DRTA 4DE0A 4BL3A 1MWRA 3PBRA 3G4PA 3TSGA 3HVFA 3M6BA 5HW3A 1QMEA 1M6KA 3G35A 1E4DA 2WGWB 4S2NC 2XD5A 1BLPA 3NY4A 4P0MA 1K56A 1PWGA 3JYIA 5EVIA 5F1GA 4QJGA 2GDNA 3IHBA 2ZM2A 2IWBA 3O3VA 2R9XA 3MXRA 5A91A 1CI8A 2HDRA 4GKUA 5FI7A 1YLYA 4U0XA 4JXSA 4MNRA 4HESA 1GA9A 3LO7A 5GLDA 4C75A 1LL5A 3LCEA 4BENA 4X69A 3NC8A 1KGFA 2WGVA 4UA6A 4Y0TA 1H5XA 3OPPA 5BOHA 3IWIA 3FKWA 2EXBA 3PAGA 4JF6A 4PM6A 4UA9A 1ERQA 5AQAA 4FH2A 3UN7A 4Y0OA 5EOEA 1TDGA 3BEBA 3SOIA 4DE1A 4R23A 3SS4A 1W8YA 2OLUA 4EBPA 2ZM0A 1SDNA 2XD1A 2CC1A 3AGDA 4BLMA 4R1GA 1I2SA 5DF9A 2QMIA 4S2KA 3V50A 3V39A 1K54A 2IWDA 1BULA 4H8RA 2WZXA 2I72A 2PBYA 4JBFA 4D2OA 4MBHA 3S4XA 1RCJA 1YLTA 4GB7A 3HUOA 3SS3A 4FSFA 1E3UA 1I2WA 1DJCA 2PU4A 3MBZA 5E2FA 5FI2A 1O7EA 4PMAA 5GLCA 4P6BA 4ZJ1A 2Y2MA 2RL3A 1PW8A 3A3FA 3OC2A 4K0WA 3IF6C 4KQRA 2B5RA 1PYYA 3WS5A 2Q9MA 5GLBA 1U60A 3W4OA 2WUQA 2J8YA 4XXRA 3OPRA 4HEFA 5CHMA 5FI6A 3HLCA 4MLLA 5GL9A 4KG5A 3ZG7B 3UE1A 3C4PA 1KVLA 1JTDA 1FQGA 1JVJA 1RP5A 1WE4A 4X53A 3ZFZA 4E6WA 5FQJA 3ZDJA 2H5SA 5TR7A 3IXBA 3UPNA 1YLWA 3IWQA 2BLSA 4N1XA 1K6RA 2ZD8A 3VP0A 1ZKJA 5HL1A 2EFXA 1L0FA 4PM7A 2A3UA 5FASA 4NETA 3WS1A 2HDQA 4O7DA 3DWZA 3WS4A 3UE0A 3CJMA 1NRFA 2ZQDA 4OP5A 4GN2A 2WZZA 3FV7A 3IH8A 3VP2A 1PZPA 3FYZA 3G32A 5KSHA 1KGGA 1PWDA 2FFYA 2P9VB 1PIOA 3N6IA 4ZTKA 5HAPA 3N8LA 3BM6A 4PM8A 1PZOA 1YLPA 4WMCD 4QU3A 1RGYA 4JPMA 4Y0UA 3O86A 3IT9A 3RJUA 5FQIA 4OQ0A 3E2LA 1JTGA 3GR2A 4OOMA 1ZG4A 3V5MA 3IXDA 4OPZA 1BTLA 1WYBA 4S2NA 2WAEA 4OVDA 3HLWA 3QNCA 1H8ZA 1ONGA 2JC7A 2X01A 2QZ6A 5DTSA 4B4ZA 4XUXA 5CGXA 5FQMA 5CHJA 5FQQA 2HP5A 3V3SA 3WWXA 5CECA 5TGFA 1FCMA 1BSGA 1XP4A 3LEZA 3AGEA 4S2PA 3ZCZA 1ONHA 5HFOA 1K25A 1MWTA 3W4PA 4OPQA 1W5DA 3A3DA 3VSKA 2ZC3B 5EVIB 3BFGA 3O88A 3GTCA 3PBSA 4KZ7A 3IWOA 3NI9A 2WK0A 3ZG5A 2UWXA 1PI4A 2HDSA 4Q8IA 5FATA 1K4FA 1XX2A 1LLBA 3FWLA 3HLBA 5A93A 5JYPA 2J7VA 2OSUA 4KZ8A 4B88A 3BLMA 1FR1A 2A49A 3UE3A 2Y91A 5FQ9A 2Y2LA 3N8RA 1XA7A 4ZJ3A 2DRWA 5EUAA 4KZ9A 4WYYA 1FCNA 4UAAA 4X68A 2WAFA 3PBQA 4KQOA 4DDSA 3IHAA 4K0XA 1ALQA 3G31A 1LHYA 2ZQAA 1KE4A 2EX2A 4JF5A 1VQQA 4GNUA 2Z2LB 5HAIA 3S1YA 3Q81A 1BLHA 4N9LA 1S6RA 5F82A 3SH8A 1OMEA 4P85A 2H0TA 3VOYA 2EXAA 3IQAA 3WRTA 3FZCA 3GV9A 5I94A 4DDYA 4ZBEA 4C3QA 1YLJA 3LY4A 1GHIA 3ZHHA 2OV5A 5GHZA 1YM1A 4ID4A 1CEFA 2Q9NA 4RX2A 3BFDA 3HUMA 4DXBA 1FR6A 1FSYA 4NK3A 2ZC5B 2Y2GA 3IF6A 4E3JA 2JE5A 1SHVA 3Q7VA 3GRJA 1ZC2A 4EBNA 2Y2QA 3SH7A 3G34A 4FCFA 4HBUA 3UDFA 4DF6A 4MEZA 4E3IA 1Q2PA 1N9BA 3QNBA 3NIAA 1K56D 3PBTA 2Y59A 3UO9A 3IF5A 3BRMA 2IWCA 1FCOA 4S2JA 5CEBA 3W4QA 4WMCA 1IKIA 2BG1A 3ITAA 2WKHA 2WYXA 3MZEA 3M2JA 4JXVA 1EWZA 1GHPA 5FAPA 4DKIA 3B3XA 2Y2KA 4GD8A 4GDNA 5TFQA 4PPRA 4FD8A 4QB8A 4WEKA 1WYCA 3RXXA 2DNSA 3ITBA 3PBNA 2J9OA 4OP8A 3BYDA 1BUEA 2HP6A 1KE3A 4B4XA 1G68A 5D3OA 1XGJA 3BLSA 5M1AA 2XEPA 5KSCA 1TEMA 2V1ZA 3MKFA 1ERMA 3HREA 3Q1FA 4OLDA 3ZGAB 3UPOA 3ZG9B 2ZJ9A 1K55A 2ZMAA 3M2KA 1NZUA 1ZG6A 4OQHA 4WEJA 2WKEA 3ZNYA 3MZFA 2HDUA 3FKVA 4RA7A 3HUNA 2XLNA 2XR0A 5FDHA 2C5WB 5G18A 1O07A 4F94A 3P09A 3HLEA 1NYMA 3ZNTA 5HX9A 3UY6A 4BD0A 4R0QA 4E3OA 1IYPA 4N9KA 4QY6A 3BFFA 5J8XA 4S2LA 3O87A 1KDSA 3C7VA 4LV0A 1FSWA 3PTEA 4U3TA 5CTNA 2H0YA 4L0LA 4CPKA 3A3IA 1K55C 4EWFA 1MBLA 4R4SA 4DE3A 4X55A 5F83A 5CTMA 1GA0A 1JWZA 2EFUA 1MPLA 4UA7A 1KE0A 4LCLA 5AQ9A 3S22A 2WADA 1MXOA 1L0DA 4QD4A 3QHYA 4Y7PA 3MXSA 5L2FA 2ZC4B 4KZ3A 1AXBA 3CMZA 4LV1A 4MBFA 2ZC6B 4KZ6A 1IEMA 1HVBA 2VGKA 4KG2A 1NXYA 3UDXA 4GD6A 5GHYA 4PM5A 4BL2A 5FSRA 2FFFB 3RXWA 1LI9A 3CZDA 3IH9A 2XQZA 5DF8A 4WZ4A 4GZBA 3NBLA 3VSLA 4JXGA 3A3EA 4KQQA 5KZHA 4OQGA 1PI5A 4EBLA 5CXWA 1FOFA 1KVMA 1Y54A 2X02A 3OZHA 4QY5A 1JWVA 4WM9A 5EE8A 3DWKA 4OQIA 1J9MA 3G30A 2V2FF 1G6AA 3A3JA 4OH0A 1DY6A 2XDMA 2Y2NA 1K4EA 3HL9A 2QPNA 5EPHA 3GVBA 4MBKA 1L0EA 4WELA 4CJNA 5KMWA 3ZG0A 3C7UA 3ZG8B 2P74A 1EROA 1BZAA 1GHMA 2XH9A 5CERA 4E3NA 1CI9A 1RGZA 3AGFA 3M6HA 2Y2OA 5E2EA 1K57C 3PBOA 1YLZA 4K91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMW A;  3MFD A;  4WBG A;  1NY0 A;  1S0W A;  3N8S A;  4KZ4 A;  2ZQ9 A;  1QMF A;  2WGW A;  4YIN A;  4OKP A;  3G2Z A;  4E3K A;  1IYQ A;  1YT4 A;  1YQS A;  4ZDX A;  2E8I A;  3P98 A;  1N4O A;  3ISG A;  2HPB A;  4E6X A;  5DTT A;  1TDL A;  1SCW A;  4LEN A;  4GDB A;  1MWS A;  3IXG A;  4OPR A;  3VOZ A;  3MKE A;  3UNW A;  2G2U A;  5FAQ A;  5M19 A;  3LY3 A;  2G2W A;  3GQZ A;  2RCX A;  2XF3 A;  3ZVW A;  3ZVT A;  5U47 A;  1ES5 A;  1W79 A;  2J9P A;  3VFH A;  3HLD A;  2ZM8 A;  5EVI C;  4IBR A;  1MKI A;  2V20 A;  1Q2Q A;  3IF6 B;  3N4I A;  1DJA A;  1W8Q A;  2Y2P A;  4IVI A;  4BQM A;  2Y55 A;  3Q7V B;  2PU2 A;  4OOY A;  3WRZ A;  5EOO A;  1ES4 A;  2JCH A;  3D4F A;  1LI0 A;  3C5A A;  1KDW A;  4X6T A;  2Y2J A;  4BD1 A;  5JYO A;  2EX6 A;  1ESU A;  5A90 A;  1W7F A;  1NYY A;  5EVL A;  2JBF A;  3HLF A;  3EQU A;  5FA7 A;  4N1H A;  1MWU A;  4FH4 A;  4R4R A;  3VFF A;  3G2Y A;  4RVA A;  1XKZ A;  5EVI D;  4OON A;  1XA1 A;  3HLG A;  3W8K A;  4HBT A;  4WZ5 A;  1ESI A;  4U0T A;  3SH9 A;  4N92 A;  4S2O A;  4YFM A;  1HTZ A;  3NDE A;  1ES3 A;  3MZD A;  1MY8 A;  1M40 A;  1Z6F A;  4R3B A;  3IXH A;  3PAE A;  1NJ4 A;  2Y2H A;  3DTM A;  2EX8 A;  4Z9Q A;  3BEC A;  5M18 A;  5AQ7 A;  3UDI A;  3NCK A;  1LL9 A;  2ZC7 A;  4EQI A;  5DF7 A;  3VMA A;  4EV4 A;  4IBX A;  4JLF A;  3Q07 A;  3VP1 A;  5CGW A;  4DXC A;  4WZ5 C;  4KZA A;  1K38 A;  4IVK A;  1EI5 A;  1ES2 A;  4R3J A;  4A5R A;  1CK3 A;  4OLG A;  1IYS A;  1BT5 A;  4BJP A;  1PW1 A;  4S2M A;  1K54 C;  4E3L A;  2Y2I A;  4XUZ A;  5CHU A;  1IEL A;  3C4O A;  3OPL A;  3TOI A;  2ZLY A;  1DJB A;  3EQV A;  4PM9 A;  1JWP A;  4M3K A;  5E2H A;  3UPP A;  4E3M A;  5E2G A;  4KG6 A;  4LCM A;  2X71 A;  4UHU A;  1CEG A;  2XFT A;  3NDG A;  3OCL A;  5CRF A;  1C3B A;  1XPB A;  4KEN B;  1XXM A;  4ZAM A;  1K6S A;  5HAR A;  1IYO A;  2XFS A;  3N7W A;  2Y4A A;  2HP9 A;  5FQK A;  2H10 A;  2C6W B;  4EUZ A;  2XGN A;  4KZB A;  4RX3 A;  5IHV A;  5FAO A;  5HAQ A;  4X56 A;  3OPH A;  3WS0 A;  1BLC A;  1L2S A;  2R9W A;  1E3U D;  5CED A;  1TVF A;  4ZJ2 A;  2EX9 A;  4C6Y A;  5E43 A;  2Z2M B;  3VP3 A;  3Q7Z A;  5GHX A;  4JKT A;  1L0G A;  2VGJ A;  5DVA A;  5F1F A;  3BFE A;  5AQB A;  3VP4 A;  1XGI A;  4IED A;  5CGS A;  1SKF A;  2ZQ7 A;  1H8Y A;  2DCF A;  4QHC A;  4RYE A;  4OOL A;  1I5Q A;  4OPY A;  1VM1 A;  1YMS A;  2OLV A;  2P9V A;  3GSG A;  1YMX A;  3TG9 A;  3DW0 A;  2WGI A;  5A92 A;  2ZQC A;  3SS5 A;  1GCE A;  1KGE A;  4LV2 A;  1E25 A;  4KZ5 A;  3BFC A;  2ZQ8 A;  1SDE A;  1K57 A;  3Q82 A;  1PWC A;  2WKI A;  4GOG A;  1IKG A;  5DTK A;  4JF4 A;  3V3R A;  1BLS A;  4JXW A;  2XK1 A;  4LV3 A;  3HBR A;  3WS2 A;  3CG5 A;  4S2I A;  3I7J A;  1HD8 A;  3E2K A;  1HZO A;  3OCN A;  5EEC A;  5GLA A;  1NZO A;  4DE2 A;  4P87 A;  4DRT A;  4DE0 A;  4BL3 A;  1MWR A;  3PBR A;  3G4P A;  3TSG A;  3HVF A;  3M6B A;  5HW3 A;  1QME A;  1M6K A;  3G35 A;  1E4D A;  2WGW B;  4S2N C;  2XD5 A;  1BLP A;  3NY4 A;  4P0M A;  1K56 A;  1PWG A;  3JYI A;  5EVI A;  5F1G A;  4QJG A;  2GDN A;  3IHB A;  2ZM2 A;  2IWB A;  3O3V A;  2R9X A;  3MXR A;  5A91 A;  1CI8 A;  2HDR A;  4GKU A;  5FI7 A;  1YLY A;  4U0X A;  4JXS A;  4MNR A;  4HES A;  1GA9 A;  3LO7 A;  5GLD A;  4C75 A;  1LL5 A;  3LCE A;  4BEN A;  4X69 A;  3NC8 A;  1KGF A;  2WGV A;  4UA6 A;  4Y0T A;  1H5X A;  3OPP A;  5BOH A;  3IWI A;  3FKW A;  2EXB A;  3PAG A;  4JF6 A;  4PM6 A;  4UA9 A;  1ERQ A;  5AQA A;  4FH2 A;  3UN7 A;  4Y0O A;  5EOE A;  1TDG A;  3BEB A;  3SOI A;  4DE1 A;  4R23 A;  3SS4 A;  1W8Y A;  2OLU A;  4EBP A;  2ZM0 A;  1SDN A;  2XD1 A;  2CC1 A;  3AGD A;  4BLM A;  4R1G A;  1I2S A;  5DF9 A;  2QMI A;  4S2K A;  3V50 A;  3V39 A;  1K54 A;  2IWD A;  1BUL A;  4H8R A;  2WZX A;  2I72 A;  2PBY A;  4JBF A;  4D2O A;  4MBH A;  3S4X A;  1RCJ A;  1YLT A;  4GB7 A;  3HUO A;  3SS3 A;  4FSF A;  1E3U A;  1I2W A;  1DJC A;  2PU4 A;  3MBZ A;  5E2F A;  5FI2 A;  1O7E A;  4PMA A;  5GLC A;  4P6B A;  4ZJ1 A;  2Y2M A;  2RL3 A;  1PW8 A;  3A3F A;  3OC2 A;  4K0W A;  3IF6 C;  4KQR A;  2B5R A;  1PYY A;  3WS5 A;  2Q9M A;  5GLB A;  1U60 A;  3W4O A;  2WUQ A;  2J8Y A;  4XXR A;  3OPR A;  4HEF A;  5CHM A;  5FI6 A;  3HLC A;  4MLL A;  5GL9 A;  4KG5 A;  3ZG7 B;  3UE1 A;  3C4P A;  1KVL A;  1JTD A;  1FQG A;  1JVJ A;  1RP5 A;  1WE4 A;  4X53 A;  3ZFZ A;  4E6W A;  5FQJ A;  3ZDJ A;  2H5S A;  5TR7 A;  3IXB A;  3UPN A;  1YLW A;  3IWQ A;  2BLS A;  4N1X A;  1K6R A;  2ZD8 A;  3VP0 A;  1ZKJ A;  5HL1 A;  2EFX A;  1L0F A;  4PM7 A;  2A3U A;  5FAS A;  4NET A;  3WS1 A;  2HDQ A;  4O7D A;  3DWZ A;  3WS4 A;  3UE0 A;  3CJM A;  1NRF A;  2ZQD A;  4OP5 A;  4GN2 A;  2WZZ A;  3FV7 A;  3IH8 A;  3VP2 A;  1PZP A;  3FYZ A;  3G32 A;  5KSH A;  1KGG A;  1PWD A;  2FFY A;  2P9V B;  1PIO A;  3N6I A;  4ZTK A;  5HAP A;  3N8L A;  3BM6 A;  4PM8 A;  1PZO A;  1YLP A;  4WMC D;  4QU3 A;  1RGY A;  4JPM A;  4Y0U A;  3O86 A;  3IT9 A;  3RJU A;  5FQI A;  4OQ0 A;  3E2L A;  1JTG A;  3GR2 A;  4OOM A;  1ZG4 A;  3V5M A;  3IXD A;  4OPZ A;  1BTL A;  1WYB A;  4S2N A;  2WAE A;  4OVD A;  3HLW A;  3QNC A;  1H8Z A;  1ONG A;  2JC7 A;  2X01 A;  2QZ6 A;  5DTS A;  4B4Z A;  4XUX A;  5CGX A;  5FQM A;  5CHJ A;  5FQQ A;  2HP5 A;  3V3S A;  3WWX A;  5CEC A;  5TGF A;  1FCM A;  1BSG A;  1XP4 A;  3LEZ A;  3AGE A;  4S2P A;  3ZCZ A;  1ONH A;  5HFO A;  1K25 A;  1MWT A;  3W4P A;  4OPQ A;  1W5D A;  3A3D A;  3VSK A;  2ZC3 B;  5EVI B;  3BFG A;  3O88 A;  3GTC A;  3PBS A;  4KZ7 A;  3IWO A;  3NI9 A;  2WK0 A;  3ZG5 A;  2UWX A;  1PI4 A;  2HDS A;  4Q8I A;  5FAT A;  1K4F A;  1XX2 A;  1LLB A;  3FWL A;  3HLB A;  5A93 A;  5JYP A;  2J7V A;  2OSU A;  4KZ8 A;  4B88 A;  3BLM A;  1FR1 A;  2A49 A;  3UE3 A;  2Y91 A;  5FQ9 A;  2Y2L A;  3N8R A;  1XA7 A;  4ZJ3 A;  2DRW A;  5EUA A;  4KZ9 A;  4WYY A;  1FCN A;  4UAA A;  4X68 A;  2WAF A;  3PBQ A;  4KQO A;  4DDS A;  3IHA A;  4K0X A;  1ALQ A;  3G31 A;  1LHY A;  2ZQA A;  1KE4 A;  2EX2 A;  4JF5 A;  1VQQ A;  4GNU A;  2Z2L B;  5HAI A;  3S1Y A;  3Q81 A;  1BLH A;  4N9L A;  1S6R A;  5F82 A;  3SH8 A;  1OME A;  4P85 A;  2H0T A;  3VOY A;  2EXA A;  3IQA A;  3WRT A;  3FZC A;  3GV9 A;  5I94 A;  4DDY A;  4ZBE A;  4C3Q A;  1YLJ A;  3LY4 A;  1GHI A;  3ZHH A;  2OV5 A;  5GHZ A;  1YM1 A;  4ID4 A;  1CEF A;  2Q9N A;  4RX2 A;  3BFD A;  3HUM A;  4DXB A;  1FR6 A;  1FSY A;  4NK3 A;  2ZC5 B;  2Y2G A;  3IF6 A;  4E3J A;  2JE5 A;  1SHV A;  3Q7V A;  3GRJ A;  1ZC2 A;  4EBN A;  2Y2Q A;  3SH7 A;  3G34 A;  4FCF A;  4HBU A;  3UDF A;  4DF6 A;  4MEZ A;  4E3I A;  1Q2P A;  1N9B A;  3QNB A;  3NIA A;  1K56 D;  3PBT A;  2Y59 A;  3UO9 A;  3IF5 A;  3BRM A;  2IWC A;  1FCO A;  4S2J A;  5CEB A;  3W4Q A;  4WMC A;  1IKI A;  2BG1 A;  3ITA A;  2WKH A;  2WYX A;  3MZE A;  3M2J A;  4JXV A;  1EWZ A;  1GHP A;  5FAP A;  4DKI A;  3B3X A;  2Y2K A;  4GD8 A;  4GDN A;  5TFQ A;  4PPR A;  4FD8 A;  4QB8 A;  4WEK A;  1WYC A;  3RXX A;  2DNS A;  3ITB A;  3PBN A;  2J9O A;  4OP8 A;  3BYD A;  1BUE A;  2HP6 A;  1KE3 A;  4B4X A;  1G68 A;  5D3O A;  1XGJ A;  3BLS A;  5M1A A;  2XEP A;  5KSC A;  1TEM A;  2V1Z A;  3MKF A;  1ERM A;  3HRE A;  3Q1F A;  4OLD A;  3ZGA B;  3UPO A;  3ZG9 B;  2ZJ9 A;  1K55 A;  2ZMA A;  3M2K A;  1NZU A;  1ZG6 A;  4OQH A;  4WEJ A;  2WKE A;  3ZNY A;  3MZF A;  2HDU A;  3FKV A;  4RA7 A;  3HUN A;  2XLN A;  2XR0 A;  5FDH A;  2C5W B;  5G18 A;  1O07 A;  4F94 A;  3P09 A;  3HLE A;  1NYM A;  3ZNT A;  5HX9 A;  3UY6 A;  4BD0 A;  4R0Q A;  4E3O A;  1IYP A;  4N9K A;  4QY6 A;  3BFF A;  5J8X A;  4S2L A;  3O87 A;  1KDS A;  3C7V A;  4LV0 A;  1FSW A;  3PTE A;  4U3T A;  5CTN A;  2H0Y A;  4L0L A;  4CPK A;  3A3I A;  1K55 C;  4EWF A;  1MBL A;  4R4S A;  4DE3 A;  4X55 A;  5F83 A;  5CTM A;  1GA0 A;  1JWZ A;  2EFU A;  1MPL A;  4UA7 A;  1KE0 A;  4LCL A;  5AQ9 A;  3S22 A;  2WAD A;  1MXO A;  1L0D A;  4QD4 A;  3QHY A;  4Y7P A;  3MXS A;  5L2F A;  2ZC4 B;  4KZ3 A;  1AXB A;  3CMZ A;  4LV1 A;  4MBF A;  2ZC6 B;  4KZ6 A;  1IEM A;  1HVB A;  2VGK A;  4KG2 A;  1NXY A;  3UDX A;  4GD6 A;  5GHY A;  4PM5 A;  4BL2 A;  5FSR A;  2FFF B;  3RXW A;  1LI9 A;  3CZD A;  3IH9 A;  2XQZ A;  5DF8 A;  4WZ4 A;  4GZB A;  3NBL A;  3VSL A;  4JXG A;  3A3E A;  4KQQ A;  5KZH A;  4OQG A;  1PI5 A;  4EBL A;  5CXW A;  1FOF A;  1KVM A;  1Y54 A;  2X02 A;  3OZH A;  4QY5 A;  1JWV A;  4WM9 A;  5EE8 A;  3DWK A;  4OQI A;  1J9M A;  3G30 A;  2V2F F;  1G6A A;  3A3J A;  4OH0 A;  1DY6 A;  2XDM A;  2Y2N A;  1K4E A;  3HL9 A;  2QPN A;  5EPH A;  3GVB A;  4MBK A;  1L0E A;  4WEL A;  4CJN A;  5KMW A;  3ZG0 A;  3C7U A;  3ZG8 B;  2P74 A;  1ERO A;  1BZA A;  1GHM A;  2XH9 A;  5CER A;  4E3N A;  1CI9 A;  1RGZ A;  3AGF A;  3M6H A;  2Y2O A;  5E2E A;  1K57 C;  3PBO A;  1YLZ A;  4K91 A; 
#chains in the Genus database with same CATH topology
 1S4S A;  4WBG A;  3N8S A;  2WGW A;  2K2N A;  1IYQ A;  1YT4 A;  1YQS A;  1SCW A;  1H0M A;  3IXG A;  5M19 A;  2W3G A;  2HF6 A;  3ZVW A;  4LGW A;  1VEU A;  1ES5 A;  5EVI C;  1MKI A;  2L1M A;  3F1P B;  1ES4 A;  3KYQ A;  4FUW A;  1EW0 A;  3C5A A;  4X6T A;  2Y2J A;  5JYO A;  4GCZ A;  4YWZ A;  3HLF A;  5FA7 A;  3ZYT A;  4FH4 A;  2JN7 A;  4R4R A;  1XKZ A;  4HBT A;  4U0T A;  3KSF A;  1MY8 A;  1M40 A;  1Z6F A;  5FDS A;  1NJ4 A;  4Z9Q A;  3BEC A;  5M18 A;  4IBX A;  5TJJ A;  3VP1 A;  2NUP C;  4ESP A;  4X1L A;  4KZA A;  4IVK A;  1CK3 A;  4BMW A;  4OLG A;  1IYS A;  1N9N A;  2Y2I A;  4XT2 B;  3C4O A;  3OPL A;  3TOI A;  1DJB A;  3UPP A;  2HGV A;  4UHU A;  1X0O A;  3NDG A;  1V9Y A;  3LIE A;  2HP9 A;  5FEG A;  4CQH A;  4X56 A;  3IS2 A;  2R9W A;  1TVF A;  4EV4 A;  2A24 A;  3Q7Z A;  1L0G A;  2QJ5 A;  2VGJ A;  3BFE A;  2I9V A;  3VP4 A;  1XGI A;  4IED A;  2V0U A;  4QHC A;  1I5Q A;  2KX6 A;  4OPY A;  1K0K A;  1YMS A;  2P9V A;  3GSG A;  4I38 A;  5EM1 A;  1KGE A;  2KDK A;  4LV2 A;  4KZ5 A;  2ZQ8 A;  1SDE A;  4PAU A;  4HJ4 A;  1DP9 A;  1S4R A;  5DTK A;  3HJK A;  1AWI A;  3KSH A;  3MQQ A;  2VGL M;  3T4J A;  5GLA A;  5EEC A;  4P87 A;  4DRT A;  4DE0 A;  2FZ0 A;  1QME A;  2QHK A;  1M6K A;  3G35 A;  4S2N C;  1BLP A;  4K08 A;  4P0M A;  3A0V A;  2GDN A;  1TS6 A;  2OOL A;  2ZM2 A;  4EQ1 A;  2DMW A;  3MXR A;  1CI8 A;  3LI9 A;  4GKU A;  3MF0 A;  1F98 A;  4JXS A;  4MNR A;  3PXP A;  3LCE A;  3OPP A;  5BOH A;  2J3T C;  5FL3 A;  4L9E A;  4FH2 A;  4G3K A;  3BJN A;  4O0P A;  3LID A;  3TRC A;  3H7W A;  5HSQ A;  5DFY A;  3LIF A;  3T1S A;  3AGD A;  4R1G A;  4WL9 A;  5DF9 A;  4NEE D;  1XJ6 A;  1BUL A;  5F69 A;  4JBF A;  3BQA A;  2JKT I;  3LR0 A;  3NEC A;  2V9A A;  4PMA A;  2VKS A;  4HP9 A;  3PYP A;  5GLC A;  1OT6 A;  1XFN A;  1PW8 A;  3A3F A;  4K0W A;  1OTD A;  4BBT A;  4L9G A;  4AFI A;  5HDS A;  2Q9M A;  3KX0 X;  4HEF A;  3HLC A;  3QP2 A;  3ZFZ A;  4UQI S;  4MDZ A;  5FQJ A;  2H5S A;  4DN0 A;  5TR7 A;  3IXB A;  1YPR A;  1YLW A;  3T4T A;  2ZD8 A;  3H9W A;  4ETZ A;  5HL1 A;  1ACF A;  3B33 A;  2HDQ A;  3DWZ A;  3UE0 A;  4GN2 A;  1PZP A;  1P9W A;  1NWZ A;  1KGG A;  2M7V A;  3BM6 A;  4WMC D;  1W63 Q;  4JPM A;  3IT9 A;  3V5M A;  1MKM A;  1BTL A;  1WYB A;  3NOU C;  4O01 A;  2QZ6 A;  5FQQ A;  5DJU A;  1H8M A;  4II7 A;  3LEZ A;  4MCW A;  1ONH A;  1KOU A;  4YOF A;  5F6A A;  3W4P A;  5L10 A;  3FPW A;  2ZC3 B;  2VV8 A;  3HCY A;  4UQI M;  4Y3I A;  3PBS A;  4ARZ A;  1PI4 A;  2CMN A;  3E98 A;  5FAT A;  1XX2 A;  3T1R A;  4B88 A;  2MJ6 A;  1FR1 A;  3UE3 A;  3LIA A;  2Y91 A;  5F68 A;  3F1N A;  4JGR A;  4KZ9 A;  4WYY A;  1T18 A;  2JKF A;  4DDS A;  1OJ5 A;  1LHY A;  2EX2 A;  4JF5 A;  1VQQ A;  1G5U A;  3SH8 A;  1ZTU A;  3WRT A;  3LIC A;  3UMD A;  3VV4 A;  3CHW P;  1CEF A;  3BFD A;  1FR6 A;  4E3J A;  3T50 A;  1SHV A;  3GRJ A;  1ZC2 A;  3F1P A;  3FG8 A;  4HBU A;  3UDF A;  2IA2 A;  4HQA A;  3NIA A;  2M7U A;  1K56 D;  1S67 L;  3EWK A;  1S1Y A;  4S2J A;  5CEB A;  3BW6 A;  4WMC A;  1IKI A;  2BG1 A;  1Y4O A;  2ZBB A;  5FAP A;  2VJW A;  2ZOH A;  4WEK A;  4PPR A;  2OWJ A;  1SZV A;  3BLS A;  3F1O B;  5KSC A;  1TEM A;  2V1Z A;  2Y79 A;  3HRE A;  4XT2 A;  3ZG9 B;  2ZJ9 A;  3M2K A;  1ZG6 A;  2HDU A;  3FKV A;  5G18 A;  2ZL1 B;  1O07 A;  3ZNT A;  5HX9 A;  3UY6 A;  4R0Q A;  4E3O A;  4N9K A;  2VX8 A;  3FPV A;  3BFF A;  3O87 A;  1KDS A;  1FSW A;  3PTE A;  4U3T A;  2PR5 A;  5CTN A;  4CPK A;  1K55 C;  4EWF A;  1CF0 A;  5F83 A;  4UA7 A;  1JNU A;  4Y7P A;  2YKF A;  4KZ3 A;  1YKD A;  2JKG A;  3E4P A;  2NUT C;  5GHY A;  2FFF B;  4ME4 A;  5DF8 A;  4I5S A;  3PR6 A;  4JXG A;  1GSW A;  5CXW A;  1Y54 A;  3OZH A;  4WM9 A;  1L3L A;  5EE8 A;  1J9M A;  2V2F F;  2V1A A;  1DY6 A;  1K4E A;  2QPN A;  5EPH A;  1L0E A;  3L9K A;  2XH9 A;  4E3N A;  1RGZ A;  2Y2O A;  5E2E A;  3CUE A;  2XRN A;  1YLZ A;  5AVF A;  1S0W A;  3RTY A;  3VE3 A;  1MC0 A;  4E3K A;  2E8I A;  3P98 A;  3ISG A;  1TDL A;  4X1M A;  4HY8 A;  5FAQ A;  3LY3 A;  2G2W A;  3GQZ A;  5DJT A;  3W2Z A;  3ZVT A;  4IVI A;  3Q7V B;  2PU2 A;  3WRZ A;  5I5L A;  2JCH A;  3D4F A;  1LI0 A;  2D02 A;  3HJI A;  1KDW A;  4QPR A;  4I39 A;  4BD1 A;  1T19 A;  5L09 A;  1NYY A;  1LL8 A;  4N1H A;  1MWU A;  4RVA A;  2KLI A;  3MXQ A;  2Z6C A;  3RH8 B;  1SKO B;  1ESI A;  4YFM A;  1ES3 A;  4R3B A;  3IXH A;  3DTM A;  1OJG A;  3NCK A;  2B18 A;  3EEH A;  4EQI A;  3Q07 A;  4DXC A;  4WZ5 C;  5CX7 A;  1K38 A;  3VOL A;  1VHM A;  5CHU A;  2ZLY A;  4PM9 A;  4EER A;  2XFT A;  3OCL A;  1XPB A;  4KEN B;  5HAR A;  1IYO A;  2Y4A A;  3UB7 A;  3P01 A;  4EUZ A;  2XGN A;  1LSX A;  5FAO A;  3OPH A;  2PBD P;  4C6Y A;  2KOI A;  5DVA A;  5AQB A;  1SKF A;  3LEQ A;  3MS6 A;  1BYW A;  1VM1 A;  3T12 B;  2ZQC A;  3BFC A;  3Q82 A;  3EGD C;  3O5Y A;  2WKI A;  1IKG A;  2PAV P;  4JF4 A;  2VV6 A;  4LV3 A;  3WS2 A;  5HZH A;  4DE2 A;  1HZO A;  1NZO A;  4E04 A;  3G4P A;  5DKK A;  3TSG A;  5HW3 A;  2XD5 A;  4QJG A;  3IHB A;  2IWB A;  3O3V A;  2R9X A;  4MN5 A;  5A91 A;  2HDR A;  1GA9 A;  2H28 A;  3LO7 A;  5GLD A;  4UA6 A;  2W27 A;  3PAG A;  4JF6 A;  4R38 A;  4PM6 A;  4BWI A;  3LI8 A;  2AVX A;  1T1C A;  3T4K A;  4Y0O A;  3T4O A;  3SOI A;  3ICY A;  2EWW A;  2OLU A;  1SDN A;  4HHD A;  4Y17 A;  3V39 A;  1K54 A;  2WZX A;  3S4X A;  4GJ4 A;  1RCJ A;  2D01 A;  4GB7 A;  3VE4 A;  3SS3 A;  3IBR A;  4JGP A;  4FSF A;  1I2W A;  1DJC A;  3CWF A;  4P6Z S;  3MBZ A;  5E2F A;  2VGL S;  1O7E A;  4P6B A;  5HWT A;  4ZJ1 A;  2OAP 1;  2Y2M A;  2RL3 A;  3OC2 A;  1PNE A;  3WS5 A;  1N9L A;  3W4O A;  2WUQ A;  3S7P A;  5CHM A;  3ZG7 B;  3UE1 A;  3C4P A;  1FQG A;  1P9R A;  4X53 A;  3ZDJ A;  4N1X A;  4EW7 A;  3MJQ A;  2EFX A;  1L0F A;  4PM7 A;  2A3U A;  3F1O A;  4FOF A;  1DRM A;  5EFW A;  4Y15 A;  4O7D A;  3EEA A;  3CJM A;  2VV7 A;  3FV7 A;  3G32 A;  2ZL1 A;  3EGX C;  1PWD A;  3N6I A;  1PIO A;  2W1T B;  1YLP A;  4QU3 A;  1ZG4 A;  5J3W A;  3IXD A;  4OPZ A;  3JPU A;  3SZT A;  1ONG A;  4P6Z M;  2X01 A;  4B4Z A;  2PYP A;  3NOP C;  2HP5 A;  3V3S A;  1XP4 A;  3NOT C;  1MWT A;  1W5D A;  4CLC D;  3GTC A;  1STZ A;  4M4X A;  4WF0 A;  4KZ7 A;  4IUK A;  1HLU P;  2LB9 A;  5A93 A;  2OSU A;  2WKP A;  3FC7 A;  1P0Z A;  4KUO A;  2W3F A;  2Y2L A;  2P08 A;  1XA7 A;  5AJG A;  5EUA A;  3T4Q A;  4DMZ A;  4R70 A;  2WAF A;  3PBQ A;  1ALQ A;  3G31 A;  4PHT A;  2K7S A;  2ZQA A;  1KE4 A;  2HV1 A;  1BLH A;  4GW9 A;  3CUE C;  4P85 A;  2EXA A;  3IQA A;  5I94 A;  4C3Q A;  1YLJ A;  3ZHH A;  4HJ6 A;  4ID4 A;  3PHY A;  2Q9N A;  2JHE A;  1FSY A;  2ZC5 B;  1Z09 A;  3Q7V A;  2Y2Q A;  3SH7 A;  3G34 A;  4FCF A;  4PKY G;  3JVU A;  1PFL A;  2EA9 A;  4MEZ A;  4HP4 A;  3UB9 A;  1Q2P A;  1N9B A;  4H6J B;  3PBT A;  2Y59 A;  3BRM A;  2IWC A;  1SKO A;  3UB8 A;  4EES A;  3ITA A;  3UB6 A;  5HDC A;  4X25 A;  2Y2K A;  2W3H A;  4FD8 A;  1WYC A;  2YKH A;  2J9O A;  2HP6 A;  3JVV A;  5HD3 A;  5D3O A;  3S7Q A;  1S66 L;  3MKF A;  2ZMA A;  4WEJ A;  2WKE A;  3ZNY A;  1XJ3 A;  2C5W B;  4CLC A;  1Y28 A;  1GSV A;  4F3L B;  3HLE A;  4EXO A;  3LGO A;  4S2L A;  3C7V A;  4LV0 A;  4R4S A;  1YAX A;  4NG2 A;  1JWZ A;  4LCL A;  5AQ9 A;  3S22 A;  1MXO A;  4QD4 A;  3QHY A;  3MXS A;  5FEF A;  1IEM A;  3DTK A;  4ZRR A;  3UB5 P;  4EUV A;  3UDX A;  4GD6 A;  5J7E A;  5FSR A;  3IH9 A;  1VET B;  2XQZ A;  4Y2F A;  4KQQ A;  5KZH A;  4OQG A;  4HIA A;  1FOF A;  4QY5 A;  3NUL A;  4O8G A;  3G30 A;  1G6A A;  2Y2N A;  4MBK A;  3C7U A;  1ODV A;  4HH2 A;  3M6H A;  2G7U A;  3KYZ A;  4GS9 B;  3GMW A;  1NY0 A;  4KZ4 A;  2ZQ9 A;  1QMF A;  4YIN A;  3D3O A;  2GX5 A;  3UME A;  4ZDX A;  4E6X A;  2HPB A;  2V8F A;  4LEN A;  3VOZ A;  3UNW A;  2G2U A;  3QP4 A;  4GHI B;  4R3A A;  5U47 A;  2J9P A;  2ZM8 A;  3BY8 A;  2V20 A;  1Q2Q A;  3IF6 B;  2Y2P A;  2Y55 A;  4OOY A;  5EOO A;  2INW A;  1PRQ A;  2EX6 A;  1ESU A;  1W7F A;  3BY9 A;  5EVL A;  2P04 A;  3HLG A;  3W8K A;  1FIL A;  1G28 A;  3SH9 A;  3CI6 A;  3MZD A;  2V1B A;  4LFU A;  3PAE A;  2EX8 A;  5AVE A;  1NRJ A;  2ZC7 A;  1DP6 A;  4JLF A;  5EM0 A;  2OAQ 1;  1EI5 A;  4A5R A;  1BT5 A;  1K54 C;  4E3L A;  2Z6D A;  2JKR I;  1IEL A;  3EQV A;  1JWP A;  4M3K A;  4E3M A;  4KG6 A;  4NXB A;  1TS7 A;  1CEG A;  3GDI A;  5CRF A;  1C3B A;  1K6S A;  3N7W A;  1IFQ A;  4RX3 A;  4I3I A;  2JKT M;  1BLC A;  1L2S A;  2QJ7 A;  1E3U D;  4ZJ2 A;  5E43 A;  5GHX A;  4JKT A;  4EEP A;  5F1F A;  4D60 A;  5CGS A;  1H8Y A;  2DCF A;  2P7J A;  2GZA A;  2O9B A;  4Q0J A;  2OLV A;  1LT0 A;  3DW0 A;  2WGI A;  5A92 A;  1GCE A;  2W1T A;  1OPX A;  4GOG A;  1BLS A;  1V9Z A;  4JXW A;  1YSP A;  3D9Y A;  3CG5 A;  3I7J A;  3OCN A;  5TBM B;  2QKP A;  1G6O A;  3MR0 A;  4EEU A;  1LSV A;  3HVF A;  3M6B A;  1T1B A;  1E4D A;  1K56 A;  1PWG A;  5F1G A;  4G3W A;  5FI7 A;  4HI4 A;  2PD8 A;  4U0X A;  4HES A;  2W0N A;  1NLY A;  2WGV A;  2HJ9 C;  2L0W A;  4UA9 A;  1ERQ A;  5AQA A;  4NXE A;  2J80 A;  3UN7 A;  3LR4 A;  2BAS A;  1TS0 A;  3BEB A;  2QYB A;  1D7E A;  4DE1 A;  4R23 A;  1W8Y A;  4EBP A;  2PD7 A;  2ZM0 A;  4KQD A;  3ULF A;  1I2S A;  4S2K A;  4H8R A;  2I72 A;  2PBY A;  5IU1 A;  1YSQ A;  4MBH A;  3LUQ A;  3HUO A;  5L07 A;  1E3U A;  5FI2 A;  4QWO A;  1S1Z A;  4H6J A;  3KO6 A;  1PYY A;  5GLB A;  4XXR A;  2J8Y A;  3IX4 A;  3OPR A;  5FI6 A;  4MLL A;  5GL9 A;  4CLC B;  4KG5 A;  1KVL A;  5G4Y A;  1JTD A;  1JVJ A;  1WE4 A;  3UE6 A;  4DJ2 A;  3R7W B;  2BLS A;  2UV0 E;  3VP0 A;  2O99 A;  3LIB A;  3MQO A;  5FAS A;  3WS4 A;  1N9O A;  2ZQD A;  4OP5 A;  2WZZ A;  3IH8 A;  3FYZ A;  4F3L A;  4ZTK A;  3N8L A;  4PM8 A;  1PZO A;  3RXX A;  3T1X A;  1RGY A;  3C8C A;  4Y0U A;  3OOV A;  4OOM A;  1H3Q A;  2WAE A;  4OVD A;  3HLW A;  3QNC A;  4HH3 A;  5FQM A;  1OTA A;  5CHJ A;  2V0W A;  2B02 A;  3WWX A;  1FCM A;  4LPZ A;  5C5K A;  3ZCZ A;  1VET A;  4OPQ A;  3KYE A;  5K5B A;  3A3D A;  3VSK A;  5EVI B;  3BFG A;  4CLC E;  4I3A A;  3IWO A;  3NI9 A;  2WK0 A;  3ZG5 A;  3S7O A;  3BWL A;  4L9F A;  2UWX A;  1NLZ A;  4Q8I A;  3QP5 A;  1K4F A;  1LLB A;  5JYP A;  3N8R A;  4GS9 A;  3QP8 A;  3K3D A;  3CAX A;  1XFQ A;  3B47 A;  3IHA A;  4GLQ A;  5KIZ A;  5MC7 A;  4GNU A;  3Q81 A;  5F82 A;  3FZC A;  4MN6 A;  4DDY A;  4ZBE A;  4GHI A;  3LY4 A;  2ACG A;  4RX2 A;  3HUM A;  3CIT A;  3OBF A;  3IF6 A;  2JE5 A;  4IJG A;  2Y8H A;  4EBN A;  3DTI A;  4DF6 A;  1F9I A;  1OTI A;  1TS8 A;  4Y5F A;  3UO9 A;  3IF5 A;  1FCO A;  3W4Q A;  2WKH A;  3M2J A;  1GHP A;  3B3X A;  4GDN A;  5TFQ A;  2DNS A;  3BYD A;  5A8B A;  4B4X A;  1G68 A;  3C38 A;  1MZU A;  2HJE A;  5M1A A;  3U4L P;  3E4Q A;  2XEP A;  1OTE A;  4OLD A;  5HL6 A;  1K55 A;  1NZU A;  2V8C A;  4OQH A;  3MZF A;  4RA7 A;  5FDH A;  5HWW A;  3HUN A;  2XLN A;  5DFX A;  3P7N A;  4F94 A;  3IBJ A;  4BD0 A;  4QY6 A;  5J8X A;  2Q0O A;  5L8M A;  1MBL A;  4DE3 A;  4X55 A;  5CTM A;  1MPL A;  1TD5 A;  3T1Q B;  5L2F A;  4LV1 A;  4MBF A;  2ZC6 B;  4KZ6 A;  2VGK A;  4KG2 A;  1NXY A;  4BL2 A;  4WZ4 A;  3A3E A;  1PI5 A;  2PRF A;  2VLG A;  1KVM A;  2X02 A;  3E4O A;  3MFX A;  2VEA A;  3NHQ A;  3DWK A;  4OH0 A;  2XDM A;  3C30 A;  3HL9 A;  3GVB A;  5KMW A;  1BZA A;  5CER A;  1CI9 A;  3AGF A;  5TBM A;  4MMN A;  5IT5 A;  3PBO A;  3MFD A;  1WA9 A;  4I3J A;  2VK3 A;  4OKP A;  3G2Z A;  1N4O A;  2GNX A;  5DTT A;  4Q0I A;  4GDB A;  1MWS A;  3LR3 A;  4OPR A;  3MKE A;  3E0Y A;  4WN5 A;  4B9O A;  2RCX A;  2XF3 A;  2XRO A;  5HWV A;  1W79 A;  3VFH A;  3HLD A;  2R78 A;  4IBR A;  5HPI A;  3N4I A;  4Z1W A;  1DJA A;  1W8Q A;  4BQM A;  4WUJ A;  4EET B;  2EWV A;  3CLO A;  5A90 A;  2JBF A;  3EQU A;  3VFF A;  3G2Y A;  5EVI D;  4OON A;  1XA1 A;  1CQA A;  4WZ5 A;  3DAV A;  4N92 A;  4S2O A;  1HTZ A;  3NDE A;  2O9A A;  2Y2H A;  5AQ7 A;  3UDI A;  1LL9 A;  2VA0 A;  5DF7 A;  3VMA A;  5CGW A;  1XJ2 A;  4MN7 A;  3K2N A;  1ES2 A;  4R3J A;  4BJP A;  1PW1 A;  4S2M A;  4XUZ A;  3TW8 A;  4NXF A;  3KSG A;  4DJ3 A;  5E2H A;  5E2G A;  4LCM A;  2X71 A;  3C2W A;  1VB6 A;  3H82 B;  1XXM A;  4ZAM A;  1P97 A;  2XFS A;  3DTE A;  5FQK A;  3GEC A;  2H10 A;  3TE8 A;  2C6W B;  4KZB A;  3A0S A;  3R7W A;  1J3W A;  5IHV A;  5HAQ A;  3WS0 A;  5CED A;  2EX9 A;  3TJZ C;  3VP3 A;  2Z2M B;  5EVE A;  2WKQ A;  2ZQ7 A;  4RYE A;  4OOL A;  1D1J A;  1W63 M;  4HOI A;  1YMX A;  3TG9 A;  3SS5 A;  1E25 A;  3CPT B;  1K57 A;  1PWC A;  3T4S A;  3D72 A;  3U2A A;  3KSI A;  3V3R A;  2XK1 A;  3HBR A;  4S2I A;  1HD8 A;  3E2K A;  1F2K A;  3MMH A;  4BL3 A;  1MWR A;  3PBR A;  3EOI A;  5EV0 A;  4R6L A;  2WGW B;  1GSX A;  3NY4 A;  3T4L A;  3JYI A;  5EVI A;  2LB5 A;  1OT9 A;  4EU0 A;  5G4Z A;  1YLY A;  1VEU B;  2FH5 A;  3DBA A;  4C75 A;  1LL5 A;  4BBV A;  4BEN A;  4X69 A;  1A0K A;  3NC8 A;  1KGF A;  4Y0T A;  5HPF A;  1H5X A;  3IWI A;  3FKW A;  2EXB A;  5EOE A;  1TDG A;  3SS4 A;  2XD1 A;  2CC1 A;  4Q0H A;  4BLM A;  1T1A A;  2QMI A;  2J3T D;  1UWN X;  3V50 A;  2IWD A;  4HNB A;  4D2O A;  1YLT A;  2XA7 S;  1D06 A;  2PYR A;  2PU4 A;  3IX8 A;  3ZQ5 A;  3LFV A;  4LRY C;  3IF6 C;  4KQR A;  3RFB A;  4NXG A;  2B5R A;  3LYX A;  1U60 A;  3R4K A;  2W3D A;  1OTB A;  4E6W A;  1RP5 A;  5J4E A;  2OWH A;  3UPN A;  3IWQ A;  2ZMV A;  1K6R A;  3IS2 B;  1ZKJ A;  2QWS A;  2A24 B;  4NET A;  3WS1 A;  4G3V A;  1NRF A;  3B42 A;  3VP2 A;  5KSH A;  2P9V B;  2FFY A;  5HAP A;  1CJF A;  4JGO A;  2O9C A;  3O86 A;  3RJU A;  5FQI A;  4OQ0 A;  3E2L A;  1JTG A;  3GR2 A;  2XA7 M;  4S2N A;  4LLO B;  1H8Z A;  2JC7 A;  5DTS A;  4PKY A;  4XUX A;  5CGX A;  1ZHH B;  5CEC A;  5TGF A;  4YNR A;  1BSG A;  1TF1 A;  3AGE A;  4S2P A;  5LBR A;  5HFO A;  1K25 A;  2ZMF A;  3V67 A;  2J3W A;  3O88 A;  2HZ5 A;  2K31 A;  1UGU A;  2HDS A;  3FWL A;  3HLB A;  2J7V A;  3MSH A;  2BTF P;  4KZ8 A;  2WKR A;  3BLM A;  2A49 A;  2M1C A;  5FQ9 A;  4ZJ3 A;  2DRW A;  4UEY A;  1FCN A;  4UAA A;  4X68 A;  2O0Y A;  3LR5 A;  4KQO A;  4K0X A;  4IHQ A;  5HAI A;  2Z2L B;  3S1Y A;  1F5M A;  4N9L A;  1S6R A;  3H7W B;  3VOY A;  1OME A;  2H0T A;  4LRX C;  3GV9 A;  2PT7 A;  2W3E A;  1GHI A;  2B95 A;  2OV5 A;  5GHZ A;  1YM1 A;  3K3C A;  4DXB A;  4IUH A;  4NK3 A;  2VZW A;  1XJ4 A;  2Y2G A;  4KUK A;  4FTX A;  5DKL A;  4E3I A;  5HD5 A;  3QNB A;  4Y13 A;  3BQ8 A;  4ETX A;  2WYX A;  3MZE A;  4JXV A;  1EWZ A;  4DKI A;  2PR6 A;  5IS1 A;  4GD8 A;  4B93 A;  4QB8 A;  3ITB A;  3G6O A;  3PBN A;  4OP8 A;  1BUE A;  1KE3 A;  4JGQ A;  1XGJ A;  1ERM A;  3Q1F A;  3MQ0 A;  3ZGA B;  4BBU A;  3UPO A;  1IOU A;  2GJ3 A;  4WLA A;  2XR0 A;  3QP1 A;  3P09 A;  3H82 A;  3S7N A;  3L7H A;  1NYM A;  1FIK A;  1IYP A;  5F5Y A;  2W1R A;  5HDD A;  3QP6 A;  2H0Y A;  4L0L A;  3A3I A;  3SW1 A;  1GA0 A;  2EFU A;  2L4R A;  1KE0 A;  2WAD A;  4CLC C;  1L0D A;  1DP8 A;  2PHY A;  4RQ9 A;  2ZC4 B;  4LRZ E;  1AXB A;  3CMZ A;  3A0R A;  3OLO A;  2PDR A;  1HVB A;  2JKR M;  1UWP X;  4PM5 A;  4HJ3 A;  3RXW A;  1LI9 A;  3CZD A;  4GZB A;  3NBL A;  3VSL A;  2A2L A;  4EBL A;  1LSW A;  3CPT A;  4NKP A;  3NJA A;  1JWV A;  4ARZ B;  4OQI A;  3A3J A;  4WEL A;  4CJN A;  2XSS A;  2E8J A;  3ZG0 A;  3ZG8 B;  2P74 A;  1ERO A;  1GHM A;  2ZOI A;  3IX3 A;  1K57 C;  3F1N B;  4K91 A; 
#chains in the Genus database with same CATH homology
 3GMW A;  3MFD A;  4WBG A;  1NY0 A;  1S0W A;  3N8S A;  4KZ4 A;  2ZQ9 A;  1QMF A;  2WGW A;  4YIN A;  4OKP A;  3G2Z A;  4E3K A;  1IYQ A;  1YT4 A;  1YQS A;  4ZDX A;  2E8I A;  3P98 A;  1N4O A;  3ISG A;  2HPB A;  4E6X A;  5DTT A;  1TDL A;  1SCW A;  4LEN A;  4GDB A;  1MWS A;  3IXG A;  4OPR A;  3VOZ A;  3MKE A;  3UNW A;  2G2U A;  5FAQ A;  5M19 A;  3LY3 A;  2G2W A;  3GQZ A;  2RCX A;  2XF3 A;  3ZVW A;  3ZVT A;  5U47 A;  1ES5 A;  1W79 A;  2J9P A;  3VFH A;  3HLD A;  2ZM8 A;  5EVI C;  4IBR A;  1MKI A;  2V20 A;  1Q2Q A;  3IF6 B;  3N4I A;  1DJA A;  1W8Q A;  2Y2P A;  4IVI A;  4BQM A;  2Y55 A;  3Q7V B;  2PU2 A;  4OOY A;  3WRZ A;  5EOO A;  1ES4 A;  2JCH A;  3D4F A;  1LI0 A;  3C5A A;  1KDW A;  4X6T A;  2Y2J A;  4BD1 A;  5JYO A;  2EX6 A;  1ESU A;  5A90 A;  1W7F A;  1NYY A;  5EVL A;  2JBF A;  3HLF A;  3EQU A;  5FA7 A;  4N1H A;  1MWU A;  4FH4 A;  4R4R A;  3VFF A;  3G2Y A;  4RVA A;  1XKZ A;  5EVI D;  4OON A;  1XA1 A;  3HLG A;  3W8K A;  4HBT A;  4WZ5 A;  1ESI A;  4U0T A;  3SH9 A;  4N92 A;  4S2O A;  4YFM A;  1HTZ A;  3NDE A;  1ES3 A;  3MZD A;  1MY8 A;  1M40 A;  1Z6F A;  4R3B A;  3IXH A;  3PAE A;  1NJ4 A;  2Y2H A;  3DTM A;  2EX8 A;  4Z9Q A;  3BEC A;  5M18 A;  5AQ7 A;  3UDI A;  3NCK A;  1LL9 A;  2ZC7 A;  4EQI A;  5DF7 A;  3VMA A;  4EV4 A;  4IBX A;  4JLF A;  3Q07 A;  3VP1 A;  5CGW A;  4DXC A;  4WZ5 C;  4KZA A;  1K38 A;  4IVK A;  1EI5 A;  1ES2 A;  4R3J A;  4A5R A;  1CK3 A;  4OLG A;  1IYS A;  1BT5 A;  4BJP A;  1PW1 A;  4S2M A;  1K54 C;  4E3L A;  2Y2I A;  4XUZ A;  5CHU A;  1IEL A;  3C4O A;  3OPL A;  3TOI A;  2ZLY A;  1DJB A;  3EQV A;  4PM9 A;  1JWP A;  4M3K A;  5E2H A;  3UPP A;  4E3M A;  5E2G A;  4KG6 A;  4LCM A;  2X71 A;  4UHU A;  1CEG A;  2XFT A;  3NDG A;  3OCL A;  5CRF A;  1C3B A;  1XPB A;  4KEN B;  1XXM A;  4ZAM A;  1K6S A;  5HAR A;  1IYO A;  2XFS A;  3N7W A;  2Y4A A;  2HP9 A;  5FQK A;  2H10 A;  2C6W B;  4EUZ A;  2XGN A;  4KZB A;  4RX3 A;  5IHV A;  5FAO A;  5HAQ A;  4X56 A;  3OPH A;  3WS0 A;  1BLC A;  1L2S A;  2R9W A;  1E3U D;  5CED A;  1TVF A;  4ZJ2 A;  2EX9 A;  4C6Y A;  5E43 A;  2Z2M B;  3VP3 A;  3Q7Z A;  5GHX A;  4JKT A;  1L0G A;  2VGJ A;  5DVA A;  5F1F A;  3BFE A;  5AQB A;  3VP4 A;  1XGI A;  4IED A;  5CGS A;  1SKF A;  2ZQ7 A;  1H8Y A;  2DCF A;  4QHC A;  4RYE A;  4OOL A;  1I5Q A;  4OPY A;  1VM1 A;  1YMS A;  2OLV A;  2P9V A;  3GSG A;  1YMX A;  3TG9 A;  3DW0 A;  2WGI A;  5A92 A;  2ZQC A;  3SS5 A;  1GCE A;  1KGE A;  4LV2 A;  1E25 A;  4KZ5 A;  3BFC A;  2ZQ8 A;  1SDE A;  1K57 A;  3Q82 A;  1PWC A;  2WKI A;  4GOG A;  1IKG A;  5DTK A;  4JF4 A;  3V3R A;  1BLS A;  4JXW A;  2XK1 A;  4LV3 A;  3HBR A;  3WS2 A;  3CG5 A;  4S2I A;  3I7J A;  1HD8 A;  3E2K A;  1HZO A;  3OCN A;  5EEC A;  5GLA A;  1NZO A;  4DE2 A;  4P87 A;  4DRT A;  4DE0 A;  4BL3 A;  1MWR A;  3PBR A;  3G4P A;  3TSG A;  3HVF A;  3M6B A;  5HW3 A;  1QME A;  1M6K A;  3G35 A;  1E4D A;  2WGW B;  4S2N C;  2XD5 A;  1BLP A;  3NY4 A;  4P0M A;  1K56 A;  1PWG A;  3JYI A;  5EVI A;  5F1G A;  4QJG A;  2GDN A;  3IHB A;  2ZM2 A;  2IWB A;  3O3V A;  2R9X A;  3MXR A;  5A91 A;  1CI8 A;  2HDR A;  4GKU A;  5FI7 A;  1YLY A;  4U0X A;  4JXS A;  4MNR A;  4HES A;  1GA9 A;  3LO7 A;  5GLD A;  4C75 A;  1LL5 A;  3LCE A;  4BEN A;  4X69 A;  3NC8 A;  1KGF A;  2WGV A;  4UA6 A;  4Y0T A;  1H5X A;  3OPP A;  5BOH A;  3IWI A;  3FKW A;  2EXB A;  3PAG A;  4JF6 A;  4PM6 A;  4UA9 A;  1ERQ A;  5AQA A;  4FH2 A;  3UN7 A;  4Y0O A;  5EOE A;  1TDG A;  3BEB A;  3SOI A;  4DE1 A;  4R23 A;  3SS4 A;  1W8Y A;  2OLU A;  4EBP A;  2ZM0 A;  1SDN A;  2XD1 A;  2CC1 A;  3AGD A;  4BLM A;  4R1G A;  1I2S A;  5DF9 A;  2QMI A;  4S2K A;  3V50 A;  3V39 A;  1K54 A;  2IWD A;  1BUL A;  4H8R A;  2WZX A;  2I72 A;  2PBY A;  4JBF A;  4D2O A;  4MBH A;  3S4X A;  1RCJ A;  1YLT A;  4GB7 A;  3HUO A;  3SS3 A;  4FSF A;  1E3U A;  1I2W A;  1DJC A;  2PU4 A;  3MBZ A;  5E2F A;  5FI2 A;  1O7E A;  4PMA A;  5GLC A;  4P6B A;  4ZJ1 A;  2Y2M A;  2RL3 A;  1PW8 A;  3A3F A;  3OC2 A;  4K0W A;  3IF6 C;  4KQR A;  2B5R A;  1PYY A;  3WS5 A;  2Q9M A;  5GLB A;  1U60 A;  3W4O A;  2WUQ A;  2J8Y A;  4XXR A;  3OPR A;  4HEF A;  5CHM A;  5FI6 A;  3HLC A;  4MLL A;  5GL9 A;  4KG5 A;  3ZG7 B;  3UE1 A;  3C4P A;  1KVL A;  1JTD A;  1FQG A;  1JVJ A;  1RP5 A;  1WE4 A;  4X53 A;  3ZFZ A;  4E6W A;  5FQJ A;  3ZDJ A;  2H5S A;  5TR7 A;  3IXB A;  3UPN A;  1YLW A;  3IWQ A;  2BLS A;  4N1X A;  1K6R A;  2ZD8 A;  3VP0 A;  1ZKJ A;  5HL1 A;  2EFX A;  1L0F A;  4PM7 A;  2A3U A;  5FAS A;  4NET A;  3WS1 A;  2HDQ A;  4O7D A;  3DWZ A;  3WS4 A;  3UE0 A;  3CJM A;  1NRF A;  2ZQD A;  4OP5 A;  4GN2 A;  2WZZ A;  3FV7 A;  3IH8 A;  3VP2 A;  1PZP A;  3FYZ A;  3G32 A;  5KSH A;  1KGG A;  1PWD A;  2FFY A;  2P9V B;  1PIO A;  3N6I A;  4ZTK A;  5HAP A;  3N8L A;  3BM6 A;  4PM8 A;  1PZO A;  1YLP A;  4WMC D;  4QU3 A;  1RGY A;  4JPM A;  4Y0U A;  3O86 A;  3IT9 A;  3RJU A;  5FQI A;  4OQ0 A;  3E2L A;  1JTG A;  3GR2 A;  4OOM A;  1ZG4 A;  3V5M A;  3IXD A;  4OPZ A;  1BTL A;  1WYB A;  4S2N A;  2WAE A;  4OVD A;  3HLW A;  3QNC A;  1H8Z A;  1ONG A;  2JC7 A;  2X01 A;  2QZ6 A;  5DTS A;  4B4Z A;  4XUX A;  5CGX A;  5FQM A;  5CHJ A;  5FQQ A;  2HP5 A;  3V3S A;  3WWX A;  5CEC A;  5TGF A;  1FCM A;  1BSG A;  1XP4 A;  3LEZ A;  3AGE A;  4S2P A;  3ZCZ A;  1ONH A;  5HFO A;  1K25 A;  1MWT A;  3W4P A;  4OPQ A;  1W5D A;  3A3D A;  3VSK A;  2ZC3 B;  5EVI B;  3BFG A;  3O88 A;  3GTC A;  3PBS A;  4KZ7 A;  3IWO A;  3NI9 A;  2WK0 A;  3ZG5 A;  2UWX A;  1PI4 A;  2HDS A;  4Q8I A;  5FAT A;  1K4F A;  1XX2 A;  1LLB A;  3FWL A;  3HLB A;  5A93 A;  5JYP A;  2J7V A;  2OSU A;  4KZ8 A;  4B88 A;  3BLM A;  1FR1 A;  2A49 A;  3UE3 A;  2Y91 A;  5FQ9 A;  2Y2L A;  3N8R A;  1XA7 A;  4ZJ3 A;  2DRW A;  5EUA A;  4KZ9 A;  4WYY A;  1FCN A;  4UAA A;  4X68 A;  2WAF A;  3PBQ A;  4KQO A;  4DDS A;  3IHA A;  4K0X A;  1ALQ A;  3G31 A;  1LHY A;  2ZQA A;  1KE4 A;  2EX2 A;  4JF5 A;  1VQQ A;  4GNU A;  2Z2L B;  5HAI A;  3S1Y A;  3Q81 A;  1BLH A;  4N9L A;  1S6R A;  5F82 A;  3SH8 A;  1OME A;  4P85 A;  2H0T A;  3VOY A;  2EXA A;  3IQA A;  3WRT A;  3FZC A;  3GV9 A;  5I94 A;  4DDY A;  4ZBE A;  4C3Q A;  1YLJ A;  3LY4 A;  1GHI A;  3ZHH A;  2OV5 A;  5GHZ A;  1YM1 A;  4ID4 A;  1CEF A;  2Q9N A;  4RX2 A;  3BFD A;  3HUM A;  4DXB A;  1FR6 A;  1FSY A;  4NK3 A;  2ZC5 B;  2Y2G A;  3IF6 A;  4E3J A;  2JE5 A;  1SHV A;  3Q7V A;  3GRJ A;  1ZC2 A;  4EBN A;  2Y2Q A;  3SH7 A;  3G34 A;  4FCF A;  4HBU A;  3UDF A;  4DF6 A;  4MEZ A;  4E3I A;  1Q2P A;  1N9B A;  3QNB A;  3NIA A;  1K56 D;  3PBT A;  2Y59 A;  3UO9 A;  3IF5 A;  3BRM A;  2IWC A;  1FCO A;  4S2J A;  5CEB A;  3W4Q A;  4WMC A;  1IKI A;  2BG1 A;  3ITA A;  2WKH A;  2WYX A;  3MZE A;  3M2J A;  4JXV A;  1EWZ A;  1GHP A;  5FAP A;  4DKI A;  3B3X A;  2Y2K A;  4GD8 A;  4GDN A;  5TFQ A;  4PPR A;  4FD8 A;  4QB8 A;  4WEK A;  1WYC A;  3RXX A;  2DNS A;  3ITB A;  3PBN A;  2J9O A;  4OP8 A;  3BYD A;  1BUE A;  2HP6 A;  1KE3 A;  4B4X A;  1G68 A;  5D3O A;  1XGJ A;  3BLS A;  5M1A A;  2XEP A;  5KSC A;  1TEM A;  2V1Z A;  3MKF A;  1ERM A;  3HRE A;  3Q1F A;  4OLD A;  3ZGA B;  3UPO A;  3ZG9 B;  2ZJ9 A;  1K55 A;  2ZMA A;  3M2K A;  1NZU A;  1ZG6 A;  4OQH A;  4WEJ A;  2WKE A;  3ZNY A;  3MZF A;  2HDU A;  3FKV A;  4RA7 A;  3HUN A;  2XLN A;  2XR0 A;  5FDH A;  2C5W B;  5G18 A;  1O07 A;  4F94 A;  3P09 A;  3HLE A;  1NYM A;  3ZNT A;  5HX9 A;  3UY6 A;  4BD0 A;  4R0Q A;  4E3O A;  1IYP A;  4N9K A;  4QY6 A;  3BFF A;  5J8X A;  4S2L A;  3O87 A;  1KDS A;  3C7V A;  4LV0 A;  1FSW A;  3PTE A;  4U3T A;  5CTN A;  2H0Y A;  4L0L A;  4CPK A;  3A3I A;  1K55 C;  4EWF A;  1MBL A;  4R4S A;  4DE3 A;  4X55 A;  5F83 A;  5CTM A;  1GA0 A;  1JWZ A;  2EFU A;  1MPL A;  4UA7 A;  1KE0 A;  4LCL A;  5AQ9 A;  3S22 A;  2WAD A;  1MXO A;  1L0D A;  4QD4 A;  3QHY A;  4Y7P A;  3MXS A;  5L2F A;  2ZC4 B;  4KZ3 A;  1AXB A;  3CMZ A;  4LV1 A;  4MBF A;  2ZC6 B;  4KZ6 A;  1IEM A;  1HVB A;  2VGK A;  4KG2 A;  1NXY A;  3UDX A;  4GD6 A;  5GHY A;  4PM5 A;  4BL2 A;  5FSR A;  2FFF B;  3RXW A;  1LI9 A;  3CZD A;  3IH9 A;  2XQZ A;  5DF8 A;  4WZ4 A;  4GZB A;  3NBL A;  3VSL A;  4JXG A;  3A3E A;  4KQQ A;  5KZH A;  4OQG A;  1PI5 A;  4EBL A;  5CXW A;  1FOF A;  1KVM A;  1Y54 A;  2X02 A;  3OZH A;  4QY5 A;  1JWV A;  4WM9 A;  5EE8 A;  3DWK A;  4OQI A;  1J9M A;  3G30 A;  2V2F F;  1G6A A;  3A3J A;  4OH0 A;  1DY6 A;  2XDM A;  2Y2N A;  1K4E A;  3HL9 A;  2QPN A;  5EPH A;  3GVB A;  4MBK A;  1L0E A;  4WEL A;  4CJN A;  5KMW A;  3ZG0 A;  3C7U A;  3ZG8 B;  2P74 A;  1ERO A;  1BZA A;  1GHM A;  2XH9 A;  5CER A;  4E3N A;  1CI9 A;  1RGZ A;  3AGF A;  3M6H A;  2Y2O A;  5E2E A;  1K57 C;  3PBO A;  1YLZ A;  4K91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...