2V33A

High resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
b'EAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCSASCEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E1 ENVELOPE GLYCOPROTEIN
publication title High Resolution Structure of Domain III from Class II Fusion Protein of Semliki Forest Virus
rcsb
molecule tags Viral protein
total genus 17
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2007-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2v33A00
2I69A 4UTCA 3J2PA 2HG0A 3J27A 5KVFE 2P5PA 2V33A 4UT9A 2H0PA 4BZ2A 4ALAC 1SVBA 3N44F 3N42F 3MUUA 4L5FE 1UZGA 1Z3RA 2JV6A 5LBVA 4FFZA 3G7TA 3C5XA 1Z66A 2JSFA 3IRCA 2R69A 5B1CA 5GZNA 1OKEA 3C6EA 5IREA 1URZA 4FG0A 4X42A 3UYPB 2R29A 4AL8C 1OK8A 3UAJA 3UZEC 1OANA 1RERA 2ALAA 5KVGE 3UZVA 1S6NA 4GSXA 5AAWC 4AM0Q 5LCVA 4UTAA 5KVEE 3P54A 3UZQB 1ZTXE 3N43F 5GZOA 4BZ1A 5H37A 5LBSA 4UTBA 4FFYA 5KVDE 3N40F 4UT6A 4GT0A 3WE1A 2JQMA 5AAMC 5JHMA 5IZ7A 2GG1A 1PJWA 3N41F 5JHLA 1TG8A 3VTTA
chains in the Genus database with same CATH superfamily
4RMSA 3IDGB 2XXCB 1EHLL 5I73B 3JTSB 2WANA 3E8UH 4TVPE 1AIZA 1GYCA 3J27A 2RFXA 1FLRH 1I3VA 3ABGA 3ATFA 4JHAL 1GYAA 1XB8A 2EDQA 1RIUL 4IKNA 4BKTC 4OZFH 4MCNA 4NFCA 3VW3L 3MAWA 4G1MB 5C92A 2VQUA 1LO5B 2UWEE 4PGBB 2FJUB 3VMPA 1E4XL 1WV7T 3TA4D 3MUUA 1OIOA 4S0HA 2HVJA 5HJ3B 3GHPA 2IWKA 4LK4A 5I1KH 2H3XC 2J8OA 1FIGH 3WIFA 2PPEA 2Q7YA 3RPIB 2O6EA 5CINL 1FG2B 4MAYD 2NX5D 1F41A 5IJVA 4QRRD 4QRAA 4YIQB 5EBGA 4KH2A 4U6XA 2OP4L 1AQDA 2QELA 1KBBA 4GMTL 2LE9A 3FT4B 4Z18A 4Y88A 5ES4B 1HI6B 1QSED 3TIDB 2R8SH 5DVLA 5C0FA 4XNQB 2QLYA 1OTSC 2RD0A 3MC0A 1E4HA 2Z8RA 3PGCA 4F9PA 4U33A 2IOIA 4DGYL 5F6IB 4J2XA 3FTVA 1U93A 5LKNA 2XWJA 2HKHL 3SE4A 2KS0A 4K94C 1RZIA 2AXGA 5L8KB 2VOTA 1TZGH 1FZKA 1I8KB 1YNLL 4ODVL 4Q9QH 2IFFL 2NMSA 4ZQTA 4I77H 5CD3B 1ZV9A 1N26A 3VXSA 3CPUA 2YOAA 1I3GL 2CBOA 1G9MH 3FQTA 32C2A 1CN4A 4NM4L 4DTGL 3NEEA 1N0XL 2PTVA 2HN7A 3QIUA 1D9KA 4HIIB 3RA7L 1VGEH 2YFNA 4HIJA 2DQHH 5CP3H 1HZLA 4Z7OE 3QDGD 5BS0A 4E9QA 3AGVA 1C5BL 1TCRB 4NFBA 4D3CL 5LXVA 1K6QH 1OAZL 5F88B 3SDYH 3WLWD 1XL6A 2XETA 3ULVH 2BZ7A 5DJYA 5T1MA 3TBSB 5GGUA 4I89A 3L2LA 4JKPH 1WDAA 5BOJA 2OULB 5LGJA 1OSZA 4KRPB 3MN8A 4HLEA 3QIBC 4EI5D 1KACB 3EFFA 4PRDB 4KPHH 2JK5A 4DN4H 1LO3H 2P5WA 3D08A 2ZKMX 2Y7LA 3S8FB 5GIRB 2OJZH 4EI6B 1N5AB 4A7SA 3HLAA 2A77H 2X4PA 3MGOB 1F3JB 3NJMA 3HE6D 4X5QA 1IARB 4F58H 1E50A 4E9RA 4HU8A 1FC2D 1MFCH 3R7RA 4LHUA 2ZP0T 1KB9K 4K71B 4OI7A 4UM8B 3FH8A 5CIPA 1Q1JH 1M3IA 1W0WB 3CMGA 3D0LB 2KKQA 4XZUB 1QRNB 4AKOA 4MA7L 5D1XA 1G87A 5I0XA 1CBVH 1XGYH 3DIDA 3PUUA 4ACTA 5J11C 3L3IA 3OWEA 4AWJC 2P8MB 3LZOA 4WEUD 2BY1A 4LDEB 4GG6B 9PCYA 1X4YA 1YEGL 2EDBA 1RKRA 4OGXH 3WKML 1T0NB 1IM3A 3RNQB 1H3UA 3FKUS 2EQDA 5GSRA 5C0JA 3L1FA 2X3AA 4PWIA 5ISZB 3MRQA 2ZX8A 3L4ZA 2Y9RT 3BP5A 2CO6A 2WWKO 4FQLH 2ADJB 5LDSA 3TBTB 4U0RC 1MVYA 4JUTA 1A4AA 5EO9B 3DVNA 3GMNB 3QDJA 4W4OC 5IB3B 2EIKB 3WAJA 1WAEA 3QUYA 2H5UA 3VD3A 4FTVE 4JLRA 3EJCA 4H25A 4GUCA 1XCTA 4NGHL 3SDCB 4TUKH 3PF2A 2XWBB 2JXMB 3I9GH 2JFCA 3PHSA 5HGBB 1CZ8L 1L3WA 1JGUH 3ARED 1CFNA 4JFHD 2XCMC 1IKNC 2DLTA 3KPSD 1H5BC 4G8FA 4RMWA 5C1MB 4HX1B 3UJIL 1I8AA 1Z9LA 3OXSA 5ANMB 2OMTA 4CSZA 2QPDB 1JZ7A 4XBEL 2JB6B 1P5UA 1NTDA 4POZC 1FLTX 4G6MH 4HWZA 1OAUH 3VVVA 4ELMB 4EMZA 4QHMA 3UYPB 5CXPA 2AC0A 3BKJH 2JVUA 1GGBH 2Z35A 4RAUB 5FK9A 4PW3A 2PR9A 2YGVA 4HCGA 2E7MA 3EJZC 2IFGA 1X7TA 1SFHA 1OT4A 3APMA 2FL5B 1QWNA 3OHXC 3L08A 3G6JB 1MQ8A 3C60C 5I76A 1WWWX 2UX7A 2WOBA 5EUOE 2B3IA 2WBXA 3P54A 3UZQB 2GJZA 1FSKB 1JPSL 4XGZA 1KXQA 1WTGT 3AROA 4K15A 1VFBA 2DTSA 4ZTOL 3S88L 1AYRA 5HVGB 4HKZA 4JL1A 5IIEB 1F6FB 5F7NC 3CFDA 4DUXA 1HNFA 3BMVA 3ZYJA 4MMXB 1IGYB 4YBLB 1I7TA 2DQGH 5KW9L 5TTRA 4BFEA 3QWRD 4FNQA 1RK1A 3BT2L 4GKOA 2ZOKB 4FL4C 4OD1L 2CE6A 4WCYH 3ECWA 4PTUB 5KAQG 4HJGA 3KHQA 4Q9RH 3NFSL 2MCPH 2HJKB 4EZKA 5D2LF 3TV3L 2FB4H 1KT2A 4JFXB 5F9WC 4XPHH 1TLKA 5C0BE 2XN9B 5EF3A 1MELA 5I1EH 4OLXH 5FOJA 2MNUA 5DJ8B 2AK1H 3VD9A 1SN0A 3NJGA 3FU8A 3HW7A 4UM9A 5HYQB 1WA1X 1BF5A 3BN9C 2WO2B 1JWSB 3D12B 2ZXQA 1U41A 3AM8A 4AEHL 4ADGA 2QQQA 3DUSA 3LKOB 3IDYB 2O5YL 4L0PB 1YMHB 1DQQB 1N59B 2A9CA 2BW5A 5I30H 3FXIC 4CDHA 1QQDA 4NKDA 4DK5A 1R0AH 4PFEA 4NENB 4UNIA 4V11A 2WNXA 2EEXA 2Z7UA 2CDFB 2OTUB 3LEVL 7TAAA 4WTWA 1R3HA 1RUKL 5ENWA 4U7MA 2YD2A 2J56A 4RWYL 1BV8A 3RWHB 3MRFA 1E6OL 2FQGA 3TXAA 1FH2A 3L3JA 2WV3A 1OGAE 4KK6D 4YSCA 4F9PC 1CYGA 1PLBA 4O51A 4PV9B 4XE5B 4M3HA 5HDBB 1ILUA 4YHLH 5I1DB 4R6UA 4FABL 4OLUH 3SE4C 4IEFA 1E3ZA 3SE8L 4Y2DD 4JCLA 1F13A 4O58H 1ED3A 3F04A 4QY8A 4HIXL 1RIHL 5D1ZB 5DHYB 3RKDD 3K6SA 1F3RB 3P02A 2PETA 5IUCA 1J9SA 1NCGA 4MZRA 1S7SA 3C5ZD 5CZKA 3C8KB 1NM9A 3AABA 4IKJA 3QIUC 1D9KC 5HHME 3HOGA 1AG0A 4Z7VF 2RALA 2NNXA 4MS6A 2C4XA 4P9ML 1DVUA 2D8KA 4X2UA 2IOMA 5A2BA 3RY5A 3U46A 4NOBA 5DU7A 1FDLL 1T2XA 4Y19B 2EE2A 3EG9A 2EIZA 4JDTH 4PJIA 5C0BD 5LHDA 4FQIH 3ARBA 2WGNB 1AD0B 1VCBC 3TZVD 4EQ3A 5DLLA 5IEKB 2CIKB 2D9CA 2VC2L 4C8XA 3GMPB 4L3ED 1I82A 3IFOA 5FFGA 1A3RH 3A4DA 4PI2A 4UT6A 4G70B 1UH2A 3DX4A 4KWUA 3GO1H 15C8H 4FG4A 2ZKWA 1TEYA 3UC0H 5AWNL 4KZ0A 1DVTA 1PPIA 7FABL 2YQ3A 4KITB 2H47C 4F8NA 1JPGA 3U0TA 3ZPDA 1U6AH 1I4FA 5EORH 1FL6B 3FB7B 1OTUC 1G7MA 4R9HA 1EZLA 4P8QA 4K3JH 4XAWL 1EZVY 5HI5C 2IPKB 5C97A 5D1XC 3TASA 3BX7C 1USZA 5K33A 1W91A 1EMTL 1S46A 1HQ4A 2GITB 5HHPB 2ZCHH 4PRAB 3BAIA 4L4VB 1QEWA 2HG5B 3UMNA 4L8CA 5D2NA 5HY9A 1OGAD 4CBPA 4ZMPA 3VQ1C 1LE5A 4G43B 2OXHA 2ZONA 4BKLB 3ZVVA 2VGLM 3QUXB 4DK3A 3I2CL 4RX4D 3SBPA 1YEEL 1L0QA 1YY8B 4N8VA 1ZY9A 3LQAL 5BUGA 1ZDQA 4DZ8B 3BUIA 4Z7UB 5FGCB 2YK1H 4G6KH 4YBQC 1KCUH 1GS7A 3WFBH 2AQQA 1SQ2N 3BWAA 1BAFL 5FB8A 2DTML 4LPUA 4ANKA 2G0KA 4LCYB 3NACH 5CEXA 4E9WA 3B34A 4RFEA 3V6FA 1E8WA 1URIA 2O6FA 1OM3L 3Q3GB 4I1RA 1BF8A 3QG7H 3P4NA 4GYBA 5FDYA 1BQLH 2Y7QB 2BXYA 5BMFL 1MREH 3QRBA 4KO5A 2J3SA 4FQPA 5BV7L 2BFVH 4X7TA 2KUTA 3PREA 3QYNA 5SV3A 2VXTL 1ZJBA 5TPWH 1AHWB 1UXWA 1P5UC 5EA0L 4AT6A 1QLFB 5IWLA 1YRKA 4EF3A 3VI4A 3FH7A 5LQBH 4R97B 1OAKL 2NY7H 1KXQE 3SYOA 5IK3A 5EV7A 3ZR5A 1MWAL 1E4JA 4L1HA 1E2WA 3FH5A 5D1QB 5EU4A 1JYXA 3UGXA 1KTLB 4DQOH 4FQ2L 3TJEL 5KVEH 1A1OB 1S9WA 2EDRA 1QPPA 1INEH 2ZQKA 3AU1B 3OLIA 5EOCJ 1VZGA 3MCKA 4XP1L 1NEUA 1SBSL 3QH3B 4F57H 2RQ8A 4FFWD 4ZX3A 2IWEA 4UQ3A 4ZUTB 1EZVX 5HPOA 3A67H 3OC8A 4BH7A 1QATA 2WQRA 1S7XA 1F8TH 2VO8A 1GR7A 5GS2D 3PPEA 3OJVC 1WGVA 3HN3A 1FNEA 3QRLA 4GKSA 4PJGF 1CLYH 5DO2D 4HP5A 3GNML 4M5TA 3OF6A 1JNLL 3KEDA 4FXKA 3OKKB 5T3XH 2VDMH 4Y4KA 3AACA 2X4SA 3Q2NA 3F01A 3GFUA 1YQVH 3GSNB 4TOYH 2YZ8A 1S3KH 2WQ8A 1U91A 3KCWA 3OAUL 3LNEA 1EV2E 4LXFA 3FW6A 4CRPA 2Q76A 1BM3L 1PU0A 1CTOA 2KHAA 3H54A 1FORH 4M5YH 1QNZL 3CTTA 5HGHB 1OGTB 1CTNA 2VB5A 2W9DH 4U1KB 4HIHA 4MRBA 1KBGL 3AM8C 5ERWA 3HB3B 3VACA 1A4JA 1Z3RA 4HOMA 3RI5F 5DJAA 3UGEA 3ZE1E 1J5IA 2BSSB 4MSWA 2NDGA 3ASOB 1VPOL 1S7UB 3GXDA 4CMMB 5BVJA 5F96L 3O6FD 4YSSA 3TESA 1U8CB 4GEJA 1WEJH 2IF7A 3FUNA 4N24A 3SHSA 2YBRB 1DBBL 1DSWA 2C1PA 4BRJA 2ADIA 3KVDD 3H9SB 4IOFD 5I1GH 2FYYA 3TONA 2B5IC 4F7EA 3E38A 3CVHL 1OPGH 3BVDB 1BXXA 1YYLL 3TOPA 4RZCA 2OLDA 3IGAB 1FE8L 1RLBA 1OGSA 3ATAA 1MPAL 5HGAB 3N44B 1A3LH 1U8JA 2O5NA 4OJYA 1P4UA 4KKQA 4LMQI 4NXSA 4XO5A 3T08A 4R2GD 4PJXF 1P9MA 2WLLB 1UWGH 4PJIE 3AS3A 5GJTH 3GQFA 4F8LA 2GUOA 1WPCA 1XEUA 1IM9A 4TS6A 3TBYA 1CURA 4ZFOB 1IZJA 4L8SA 3L4WA 1WAAA 2YBGA 3O45A 3U6RA 3WE6A 4G3YH 4F7CB 1T89A 1HILA 4G7VL 4QHKI 5FPIA 3W81A 1VJSA 4RAVA 1DBAL 2NY1D 3A21A 4HPYL 3SOBL 3WEXA 3UAEA 5LCVA 4P9HL 4H26A 3WFDL 4AM0A 1VFAB 4OU3A 5C7XH 1G6RA 4KRMB 2NUPB 1KYFA 4OCMC 3QI9B 4LOVA 3WXWH 2AI0L 5CS7A 1C08B 2L4OA 3ARBC 4FNPA 3QZWA 4JFFA 4Q58C 2XIBA 3CWGA 3BVVA 1EUUA 1X5XA 1AKJD 4ZXBD 3D39D 5IJDC 3SDXF 1L0PA 3OR7B 1H3PH 1R17A 4U1IB 2YGOA 3QQ4A 1TVHA 3LNGA 4L4TB 5F6HI 5AW3B 3ZBMA 2OTPA 3MV9A 3P0YL 5IVXF 1W8OA 4CN6A 1EEYA 2WVVA 1MHPH 5D2NE 1BZ9A 3IF1A 3O3UN 4GQRA 1INDH 1THAA 4GAGL 4M48L 3S4SA 2F5BH 3B9VA 3LPGA 1SLVA 4OM1H 5KOMC 4B5EA 4R4NC 1AG6A 2O6CA 5AOJA 4HUVB 4ZO8A 3TEXA 3L9RA 1MWAA 1XMEB 4UBDD 4DP0X 3QSKB 2NTFA 3GMQB 1JZFA 4YBHA 1RSYA 4QT5A 1OLLA 2H6UA 2A6IA 4KUCF 4JM2A 5AKSA 3UJJH 4DZBA 3BKYH 3US9A 2XSKA 1DBKH 5D2NC 2VR5A 3RGHA 5AB1A 2CDGB 4YMPA 3N42F 2Y5TA 2YXWA 4OIFA 4Z7VB 4XN1A 3ZL1A 1KFAH 3KS0J 4MNQD 4NO0B 4UV7H 2HX9A 2DKMA 5CLYA 4D9LL 3GPSA 3LKSA 3TA3B 2FT8A 4X6DF 5BRZB 3RZCA 1RZ8A 4DETA 1K3ZA 4P23A 5EU3B 4PVBA 4WO4B 1COBA 3HUJA 5CLTA 4AYFB 1AXIB 3SBQA 4Z3IA 3B2XA 3QWQB 2F2HA 4O2EA 2JMRA 1CGYA 2FECI 1KN2H 1UG9A 4UQ2A 2EDWA 4CKQA 3DO7A 2XN2A 3AB0B 1EZUA 1OSYA 1N0LB 3VI4E 4MYPA 3LEYL 4OIBA 4OW6A 3GUTA 3D5OF 1AH1A 1BGXH 2N4IA 5IREA 3G5WA 1Z5LB 1CDUA 4HUCA 3NIDE 1DQLH 3RIFK 3MO1A 3KH4A 2NY0C 4PLKC 4O00A 2CJ3A 5BRPA 3MRRA 4ZD3H 5ID1A 5AKRA 1KCSL 1F90L 2FGWL 2NY2B 5IWLC 4A2LA 3L81A 3M8OH 4HK0B 4FFYH 4H88H 4HUXA 2BMKB 3C09C 1NCNA 4NO5A 1XGTA 3AW5A 3TM6A 2HRLA 5MERB 3WS3B 3LHPL 5EPMA 3U7AA 5FYKU 2IC2A 3JV6B 1BFTA 2XFXB 4ENEC 5CWSB 4OJCA 4XI5C 3KNBA 3O4LB 1OVZA 3U6XA 1QI5A 1QYGL 3CVHA 3MNVB 2A73A 4IRZL 3U0WH 5MEPA 2XA3A 5ICZB 5BCAA 4PJ7B 4K8RH 4IIZA 3RVVD 5JHDD 4GO9A 5E5MB 3NFPB 1YZZA 4OFDA 4QRPD 4BSWB 1CO1A 4CC1A 4YQXH 3B3BA 1A9EB 1MFUA 1ZJAA 1FV1B 3FZUC 5F70A 4C55A 3GF8A 2P42B 3ZTEA 5DHVH 3AUVA 3KYNB 1QRKA 5BVPH 5AVTB 1P53A 3QUZA 3SGEI 5KSAD 4AVHA 1RUQL 3QFDA 1DTUA 2ZWNA 4V33A 3RX5A 4FXKC 4LU5H 1XL4A 4PRBA 3S2CA 4Y4KC 1KLFA 3VGAB 4ISVB 3RVUD 1CS6A 2WXNA 1PAMA 4M43H 3HG1E 3UZVB 4OUUA 4OLYH 3RTQA 4GMSH 4D0DB 3VXNA 5CCGE 5AVVB 3RJDA 3NJJA 1R3LB 2YAOA 3TLRA 1B4JH 2KBGA 3L6FB 4M1GL 1CFQA 1FWXA 4QXGL 1A6WL 1LK2A 2D0GA 3HCVA 1HINL 1HK6A 4YHIB 2HZHA 1I9JH 5E56A 3T3PB 3MLSH 2WBJB 3ME0A 2C9VA 4X80H 1KJ3L 1SJHB 1CFVH 2OK0L 5TQ0L 3CBRA 3EFOA 7CGTA 1R3JB 2IANA 3TJHD 4IRSA 2AJVL 2CK0H 1AO7B 1F4WH 3VFMB 3IMTA 5DD0H 1IAIM 3RB5A 1E8ZA 1JFQL 1UKTA 4OLVL 4AC2A 3V95A 2YMOA 1AGDA 4HKJA 1JZ4A 1RJZB 4LOEA 1N6VA 4WTQA 2J73A 4KJPC 1ZLEA 3I6GB 2CJUH 3PY9A 4PJGB 1T21B 1SDAB 2D31B 3AS0A 1MRDH 1WLHA 2VUYA 1YPZE 4JJHA 3U7WL 1YEIL 3WTSA 3STZA 4ABQA 4G9FB 4WU7B 2E5EA 3EXLA 4JFPB 2DMBA 4LPXA 3FTUA 3WUWB 2YD0A 4JGNA 1VESA 3UJTL 4DP8X 3LQAC 4UB0H 1RU9H 5IEHB 4YDZA 5JXED 3LN4A 4L8SC 1BQUA 4IGBD 4A7QA 1V54B 1ZS2A 4U1GB 4RFOH 4I9WE 1T89C 4M7KH 3NCBB 3GMMA 2BNQB 1QLEL 2QVIA 5JMRA 1XF4B 5ACZB 4XPTL 3P4MA 4HW6A 3MV9E 4OZHF 3I3EA 5AENA 4OV5A 3HG1D 2VABA 5IOPB 1KZYA 5D7LA 4YXLL 4CDGC 43CAB 3NCXA 4Z9KB 2GFBA 1M53A 3KW7A 4ZFQA 3OKDA 5EBLB 3FU7A 1SMAA 1XGQB 4QGYA 3CFMA 1XTMA 2NDFA 3ZQXA 5H94B 3B2PA 3ARYA 1EA9C 1J1PL 4PWFA 2J2ZB 8FABA 3FFDA 3R06B 5E1QA 5F7AA 5B1KA 2FD6L 1YC8A 1S4IA 4W93A 4X9HA 3WDIA 3RVTC 4QRRB 4ZUSB 3OC5A 1RFDL 4RCAA 4ZT1A 3HR5B 1FL3A 3LN5B 4U3SB 2BO0A 2CCLA 1I7ZB 4OFYA 4H1LA 4HSAC 1HAWA 3P77A 5DRZA 4NN6C 4QCIB 4EKXA 1OW0A 1QSEB 5CIPH 5AOZA 3B5TA 4U6TA 1L4IA 1OAXH 2C3WA 3A0OA 3DX6B 5JPMA 5EEZA 3T0VA 5C0NC 4HD9A 4PJDA 3VWJA 4XPGL 1DUYA 4KDVA 2ZYIA 3HUJE 3QDAA 4JM2C 1IEAB 1U8IA 4TN9A 5DC4B 2Q8AH 2GK0A 4YX2L 5KSVA 3OB0H 2QSCH 1JF6A 3OKYA 4IRZA 4LVOB 5C07B 4GBXA 4HWBL 5EU7E 2A99A 1UUNA 3UCRA 4M7LH 1J9RA 1T1YB 1SMOA 4NN7C 4XPFL 2P49B 2YA2A 2AKRA 4KKRA 3BJ91 2KERA 2MPAL 4AJVA 1K8DB 2JWYA 2ZYHA 2JJUA 5IG7B 4F2EA 2OSYA 2A74B 3MFGB 2X41A 1H15B 1UJ3B 2PCXA 3B8YA 3QDGB 4IIQA 4PGZA 4RA3A 3RZCC 3US0A 4FC3E 2YLHA 1ETB1 2CD0A 3LKPB 2LU4A 5IB1B 3VJ6B 2CHZA 2J71A 3EFDL 4JE0A 2Y3NA 5LBSL 2YMXL 5EU7C 2BVYA 1AI1L 3DOHA 3LPWA 5ILTH 1MCCA 5IKCA 2VDKL 3GJFA 4EI5B 1U3JA 1WVZA 4HFUH 5CBAB 5JORA 5IGXH 1J88A 1LWRA 1KLGB 3BIBX 1NEPA 3OKLB 4G6AC 4L05A 2UWEB 4MMYB 2DWDB 2YAFA 1EJFA 4MA8H 1RVFH 1ZGLP 4QJ5B 2JKSA 1FZJA 2E7BA 5I6PA 1XF3B 2CLRB 4JFYA 4MS8D 5IB2B 1RIUH 3FB6B 1ZIAA 1NBYB 3VW3H 2UVEA 5F1NA 3OSKA 2WZPD 1S9VA 1YC7A 3ULVD 3FQ2A 2BP3A 1X9LA 3FFCE 3W9DA 4FRWA 3FCTB 4UNUA 1ORQB 3WIIL 4MJID 2ZCLL 3AAZA 2CGYA 3KLKA 4KI5F 1LL1A 1K4DB 1IILE 2E59A 4YHYC 3E8VA 3IJEA 1IFHL 3CVDA 1TZIB 3N42B 4FDWA 5TQ2L 5DJ0B 1ZHBA 2CR6A 2ICWA 1U8NA 3H0TA 1BQSA 3K6NA 5D93C 4UMGA 2OP4H 3HJ0A 4FFZL 4GMTH 3VTMA 2NUTA 3GRWL 2NTSP 5CP7A 5D6CB 3MV7A 1HSBA 3ARGA 4J6IA 3P4OB 3V7AE 2YD9A 4N85A 4GEIA 2ERJC 1EBPA 2W38A 3FOMA 4ODVH 3RPBA 2Z9TA 4Z7OB 3MRHA 3QUZC 3QXAB 2HB0A 4JJ5A 3KLHD 3ARFA 2N1KA 3IFPB 3VYPA 4QEGA 3AREB 5E99L 3U7YL 3BGMA 4NM4H 2Y4SA 4HS8L 1N0XH 4NQVB 4DTGH 1A2YA 4YGVB 3KPSB 3OG4B 3VXMA 5JQ6L 3MV8D 3RTQC 4IRJB 1HWGB 4D3CH 1OAZH 1KCKA 3RGVA 3ZHNA 2LLGA 1DQVA 3PU7A 5I2IB 2IANE 4LSUL 4A39A 1LK3H 2R7EA 5HSFA 1EANA 2QZQA 1WFIA 1I1AC 4AG4L 4CU7A 3TL5A 5EUKB 2F54D 3STBA 3DV6A 4ZW6A 3K3QA 1TTCA 1HNGA 1UD5A 5F0PB 2WWNA 3G5VA 4WI5A 3WDJA 1C7TA 1RPKA 3FFCD 3PGFH 3IRCA 4O02L 1JZHA 1IBFA 1YQ2A 2ZKYA 4GUPB 1A8JH 4LESA 5F89A 2HT4D 3ZSTA 2LR4A 3AQDA 3BWUF 3NJIA 5DQJB 1VFMA 1W8EA 4L1BA 5D4QA 1NGPL 3D0VA 1G43A 4E36A 2PXYA 3N1GC 5ANHA 3N06B 2I27N 5IMLB 4RH4A 4LEEA 3TNMB 2XA8H 1T4WA 1HJCA 2H2PC 3L3OA 1KEGL 1XX9C 5DHMC 4GXUM 1E3FA 1S7QB 3HG0A 1WBZB 1M57B 3L7EA 4ZTEA 2D7TL 3BQUD 4HWBA 1XF1A 5K9KB 3DSFL 1UB6B 2CSPA 3QNXA 4OKVB 2RGSA 4E5XB 3DLQR 3WEMA 3S3DB 1NBVL 3DI2B 1AC6A 1KTDA 4HCRH 2JCWA 4FTVB 3UPRB 3OPUA 3HG2A 4PWKA 5SWZD 4V2BA 3QNZB 5HYIA 3TFKC 4KTEH 3NSXA 3UL4A 3MLPA 2APXA 2KZ1B 5LBSA 3MR9A 2HT3D 4KMTL 3NCFB 2IBGA 2NYZA 1IU1A 3V9CA 1FZOA 4P57A 4NGHH 1AP2A 2O30A 4U1JA 3OMIB 5JOFB 4LMQE 4TPRH 1CZ8H 4W6YB 5D7HA 5IHWA 4A38A 4Z76A 3QCUH 3BZFB 5FA4B 4LLDA 4AV0A 4LKXB 2G5BA 5EZLA 1G4RA 3UJIH 1EEZA 4PJDE 5IMMA 4PWJA 4GRMB 1FQ9C 4HFWB 4RGOL 4TTDC 4ESKA 1MHCA 3QA3B 4JGMA 3BZ4B 2XWZA 2BS9A 5BQ7B 4NUGH 1XTLA 3EH1A 2CHDA 4XNZC 1HZKA 1OW0C 2NLJB 4WK0B 3EYQC 5EUOB 1FGVL 1MW3A 1ROCA 1HHJB 1IFRA 4WFHE 2DS4A 3V0WL 3VWJC 1BYNA 4N6RA 2BHUA 3FSWA 1EAOA 4JPIB 2IOOA 3JZ7A 3GS4A 4YFEA 2EO7A 3NCYP 1DJSA 4P04A 4GBXC 5LBVA 4FFZA 1RHHB 3GRWA 1JPSH 5C0EA 2A7BA 1UWFA 1NFDB 4Q6IB 4ZTOH 2NXZD 3S88H 2N0KA 2QVMA 5BO1H 2EVFA 2FDBP 4LAQL 4RETB 4JN1L 4WUUD 5F7HA 4FKEA 1V05A 4IIQC 1EX0A 3SKUD 1F4YL 5L9DH 4B7LA 3B9DA 3UDWA 5KW9H 1FBIH 3BZDA 3CDYA 5C0BB 3MJ6A 4YL9A 1TZAA 4BINA 3O0LA 1INQB 2X9YA 3CXHJ 4NRZA 4OD1H 2HVJB 4XVTL 4MXWL 1WK0A 3E3QE 3T6VA 3WIFB 3TZVB 5DJXB 4YSAA 4APQA 2DJMA 3B56A 5FC9A 3IJSA 4NZTH 4L3EB 3W56A 5A40E 1ZGLM 3DVGB 3TV3H 3V6ZB 3LKNB 3ZQ9A 2JELL 1NCAL 4PIBA 4KK8C 1HXYA 4WKZA 3E6HA 3PJSA 3VFRA 4H5SA 4XHQA 2HTKC 3B7SA 1PZ5B 3WN5A 4Z3JA 4LKCB 5DJDA 2ALAA 2Q1EA 1CDBA 3U9UB 4PRNA 5IROC 2YRZA 3K8KA 3KL5A 1R5WA 3J7HA 4AEHH 1AD9A 1RSFA 4AQAB 1F58H 1XBRA 4LLVB 2C3GA 3FTZA 1GZHA 1XHHA 2DI8A 3HMXL 3L1OL 1RZIB 4KO7A 4X99B 1XH3B 3HG4A 3S96B 4AGLA 3BPLC 2HAZA 3LQZA 2XIIA 4J3OF 5K1VA 5LG6A 4MLSA 1DL7L 4IJ3C 3VX1A 3MV7E 4N2NA 4OI9A 2XUWA 1OGAB 2V7HA 4GO8A 4AQOA 3PFQA 1GGCL 3DK0A 3QIUB 4E9XA 2CBPA 2FATL 4B9ZA 4QTFA 3VX0A 5H8DA 5E70A 3OG6B 1G7IA 1E6OH 1M1SA 3G5XB 3EBGA 2AABL 1MCRA 1ECYA 1O5PA 2G2PA 3GIVA 1TEFA 4LQ1A 2VM3A 3EYOA 3PWJB 4JS7A 4F37F 3RWIA 4PJ8A 3VXME 5DLML 1ND0B 2OL3L 1LDSA 4WY7L 4FABH 12E8H 1BOGB 4PG2A 5B39B 3W37A 3SE8H 2J5WA 1PLGL 2VXUH 4HIXH 3IAQA 3ARFC 3HLAB 4W9LC 2QZ5A 2YZ1A 5IJKA 4BFOA 4F7MB 3GT6A 2GEQA 1A65A 1M6OB 4A37A 1H8OA 2BIIA 4G42B 4OQTL 3EKCA 4UWQB 1OPOA 2DBLL 4ODUA 2WZAA 2BZDA 4P9MH 3QEHA 1YN7A 3RGVC 3UTZA 3D4YA 3RGBA 2K7QA 4W4NA 2WUBH 5EIIA 3NDZE 1FI8C 4N5EC 3HAEB 2ZWYA 4OZIA 3JTTB 2WD0A 3ZDYB 2A9DA 3Q6GL 4WFGE 3IJHA 3ZDZE 2Y72A 3BIAX 2X2JA 3W9EA 5CZVL 1OE1A 1IM3B 2NY5H 4UDUB 3X3GH 5JZ7D 4XNBA 4PBVC 3SKJH 3LRSB 3UO1L 1G1KA 1HKLL 5AWNH 4X7SL 2H41A 3MRQB 3CSFA 4QTHA 4ZZFA 3NK4A 1SEQL 4FXGA 3KYAA 1QABA 1RZGA 2MOQA 2WOYA 3DVNB 4V2CB 1IV8A 4M6OL 4KJWC 4F8TA 5C3LD 2WYHA 4JRYD 3GSVA 2PXYC 3QUYB 3KM1A 3ILEA 1SMDA 1UWEL 1EMTH 4X6EB 1XCTB 3V52L 2QV2A 4S10A 4FG2A 1OE2A 3DJTA 3QULA 4MJ6B 5FF6A 3ZL4L 1MJUL 5IW3A 4YK4B 3L3OC 4DFHA 4PY8J 3EJQA 3MGTB 4QHUA 4FQ1L 1T0MA 4TUOA 3WGUB 2QMJA 4LDOB 2BVTA 4K3DL 3T6XA 4ANUA 1DCEA 1L9TA 1SM3H 2H9GA 3PIQA 5JIKA 4EDXA 3GSXA 3LQAH 1X5IA 1IBZA 1QP1A 3PABA 2WSKA 1XV8A 1A7BA 4I48A 5T1LD 2WTPA 3QFJA 4I13B 4QRQB 4RDQF 5DZOA 1J1OL 4X8JB 3EGSA 5FO2A 1BAFH 4HKXB 2DTMH 4UIMB 5J89A 1L7IL 4Y5XB 1RH8A 3CK0H 1IC5L 3LZFL 2BY3A 1EDQA 2XRAH 2OX5A 3SSGA 5B38G 4NJAL 3QIWA 5EO0A 1OM3H 3T0WA 2Z65C 5IV2B 3TWYA 1M71A 2A9MH 2VZOA 3HRZA 3IM1A 3O6FB 3ESVF 4YSEA 3QJXA 4CSTA 1IJ9A 3KLLA 5IMOA 2GJZB 2Y69B 2ARJA 4XNAA 5BV7H 5T3XD 1EGJL 1TG8A 3SEPA 4KAQL 3FUDA 4ZX6A 4M6ML 2PW2A 2WWMC 3GXMA 5KN5B 1FFPB 2EC8A 4HKZB 4PV1C 2H26A 3OAYK 1F00I 3VAEA 1ZA3B 4N2DA 1Q0XL 4X0KA 4GXVL 1I7TB 3H2WA 3L4CA 3MXWL 5KSUA 5I66A 4WFED 3WDHA 2BVQA 3HNVH 5FA3A 3V5HA 1KBVA 1EAJA 5DMYA 5DJCB 4HJGB 4CVZA 1GCYA 2EDNA 1QX1A 2CHXA 3FQYA 1KT2B 4R2GB 1KYAA 3TJEH 5E03A 3GSQB 4CJ1A 1JI1A 1E2VA 2A1WL 5F7EH 1MWOA 4M4RA 5C0RL 3CV5A 4YEEA 1JGIA 4N2KA 3ARSA 3WIHL 2L3BA 4BUHA 2PPCA 3RL2A 5JYLA 5KS9B 2AXFB 1KJ2H 4A6YL 3VNZA 2I9TB 1LMIA 1KC5L 5C0AE 4NM8L 3WU1A 3E80A 3BAEL 1LO2L 4OGQC 4G80A 2XV3A 1YAIA 2D9QB 3B9KD 4G11A 5C09D 1O6TA 3MLYL 4XCEB 2WINB 3UDWC 2WP3T 2R51A 5C08D 4PB0H 4DAGL 1OTSD 3QJUB 3SDDD 2OMYA 1IAKB 3GNMH 3KW8A 1JNLH 1X9QA 4DEPB 3ESUF 1AKJB 3OKNB 4ZXBB 3D39B 4Q2ZA 2V4LA 5ALBL 5CR8A 5I5JA 2IXQA 5B7FA 3S8GB 4OQTA 1R3HB 3CSGA 3QK0A 1TMCB 3ZDWA 1U3HB 2K70A 1NUGA 3EOBB 1BM3H 3ZE1B 5GS0C 3DX0A 2CJTA 1QNZH 1TQCB 1BVOA 1SBBA 4DKEL 4XP9L 3LH8A 5DA4A 4AITA 3IT8D 3EOYG 1VERA 1IE4A 3HS8A 3UBXG 3FTWA 1GZHC 2FSEA 1DLFL 1FYTD 2VUKA 1JV5B 2G2RA 5F96H 4JGJA 5HDQH 4AGOA 3BXNA 3ULVF 5JPNA 1AY1L 3O8XA 5AB2A 3WHE1 3QIBD 2ZUQC 3RWFA 3JYBA 1BWWA 2EYTA 3CMOL 1EDYA 1MCWW 5CEZL 1BZ7A 2BZCA 4IMKA 3PJNA 1ZSDB 2OMWA 3CVHH 3FO2A 5LN4A 3U9PH 1MFEL 3QPKA 1QBAA 4PU2A 2HTLD 1TTAA 3DGCR 3VE0A 3LSOA 4MNQB 5CEYB 1N10A 3CG8A 5I1JL 2QHRH 3U46B 3NCEB 1WIOA 2EZ0D 2K8MA 1MPAH 1FVEB 1TJIL 1YNTF 4LCUA 4UT7L 4XCNB 1I8UA 5C0AD 4PJ8C 2Y23A 2X4NB 2FJGB 3SO5A 3QJSB 4C56A 3IFOB 4N5UA 1HC1A 4OLZL 4PG2C 5B1AB 3M1CA 4FMFA 4Z1PA 3TO4D 3AWFA 4M1DH 5EN2A 4X9GA 3CZFA 1MG2C 2X4UA 3FDWA 1LP9F 3H4HA 4LCWA 1C5DB 3O6ML 5T8IA 2IQAB 3QO1A 5IJKC 1JPGB 2VXVL 1T3FB 4B9KC 3I85A 1GC1H 1IBHA 1DBAH 1BCIA 1TQTA 2V7NB 4HPYH 2B77A 4QF1A 3SOBH 5MP6H 4P9HH 5FECA 1CQKA 5I1IL 1G7QA 2CLZA 2J1YA 5I6LA 1OV8A 1XR8A 1ITCA 4BQBA 1QBLH 3AY4A 3Q7JA 2C4FT 3E0GA 1GIGH 2MQ0A 1KPRB 4YE0A 1BG9A 1OARL 2WQVA 3D3VA 1OE3A 3QZBA 4L1SA 3BCFA 5L4IA 5TF1L 4G1EA 1OQXA 1EGJA 1UKQA 1XZWA 3P0YH 4B9CA 4P46D 4N8VB 2VXSH 5E08L 2VM4A 3KGSA 2ED7A 1PS3A 3T2NL 3G6DH 1UT9A 4MWFA 4XNXH 4ZSOA 2E3VA 4FXGC 1JGLL 1GJUA 5JHDB 3WEOA 1YVLA 1X6LA 2V9RA 3KGTA 4QRPB 2IDTA 4POZD 2XC8A 4JO5A 4LEBA 2BNRA 2X2YA 1U8MA 1U58B 4LSDA 4TYUA 5KZCD 1WFNA 3KGUA 3QFJE 1KIQB 3VXRD 4WI0B 2H0FA 3WIHA 5I1LA 4JDVB 4R8WL 4OJEH 1WH0A 3BH8B 4BSVB 2XDHA 4HLJA 2AJZB 4D9LH 3H3PL 1UXWB 1NCDL 2BRQA 3TF7C 4Z7WB 2QDWA 3VFTA 1RK0A 5ICXA 3GB7A 2QVKA 4XB7A 3VI4B 4K8RD 4ZW8A 1YAZA 2AP2A 1Q1PA 2LTQC 1NWPA 4WTZG 4N2AA 3ARDA 3T1FB 3RHWK 5E6UB 5HI4C 2DYPD 3BRGC 2XVKA 5E2WL 5HI3C 3NIDB 2JH2A 4ZX4A 3QIWC 4B97A 3AGWA 4F80A 4XVUC 4PTTA 5C0IA 1FL5A 5IJBC 2ITEA 3HRZC 4PRHA 2GW5A 4M93C 1ES0A 3DX1A 5C2UB 4XB3A 2DJSA 4GXFA 2DMKA 2A4ZA 1K5NA 5DGRA 4BH7B 1ONQB 1S7XB 2H32B 4XMWA 5IFHL 2HFFB 5I8OH 3VFUA 3QG6B 4JN2A 4NO2A 3AG1B 4G8GA 1F90H 2FGWH 4HUNB 3M07A 4J28A 4QXWA 4ZMWA 5I19L 2X2IA 4HGMA 4GKSB 3PE9A 4ETQA 1TR7A 1ASPA 2UYLB 4YPGA 3V0AC 4XN8A 2Y07L 3F7LA 3IU3A 4Y4KB 2BOCA 1IQDA 1PVHA 2Y6SD 4N3UA 2AANA 2ZPKL 2DIBA 3T0EA 4GRWH 4MZ2A 1QYGH 4X6FA 4L37B 4PCYA 4ZOEA 3C6SA 1U91B 2FEEL 5KYWA 5MEOB 1TFPA 4BQ8A 1T6BX 3NSFA 3P0GB 1JERA 4UIKH 3IGUA 2MCAA 1QI4A 3KPOB 4IGBB 3SO3C 4OV6F 3LN9A 4F2MB 2CJSA 4WNQB 3DDFA 4XP4H 5DWPA 1Y07A 4HIHB 4AEEA 3KYMB 5ERWB 5MENA 1A9BB 1QTSA 3FTGA 3MOAL 4KKNA 3VYNA 1QVOA 4NNPL 3HG1B 3NP4A 4PD4K 4KZEL 4X8GA 1MKFA 5GS1A 4KZDL 1KOAA 4TQHA 1JNJA 4U6HB 2KI6A 1RUQH 5F8RC 1PX3A 1NBZB 2BPBA 1SEBB 2CKBL 2E27L 3GJFH 3IN0A 4LOFA 5DYOA 1SY6A 4YN3A 4BV1A 2OSLA 4PPTA 4DW2H 5LNDA 1D6VL 3DROA 3O6KL 4BHUI 4XRCB 2Y2TA 3F7KA 3BAWA 4YDVA 1J12A 3IJYA 4B50A 1UFGA 1PZUB 4ZPVA 4R96A 4RZCB 4M8QB 5IBUB 3OGOE 4F1ZA 5IESL 1U9KA 4MB5A 1V55B 3N9GL 1PFCA 3SQRA 3WMQA 2DQTH 1YEHH 5J3HD 3W11C 3QC5X 2IAMA 1DANT 1KJMA 2CLVB 3AMLA 4M1GH 4LSPL 2VITB 4P06A 5D7KE 5BS0D 2FGZA 1A6WH 1WWCA 4N0CD 3NJFA 4XOEA 2XWTA 2IH3A 4RGNE 1ZOXA 3MACH 5CILH 4PJ9C 5BNXD 3MZGB 4YUEL 1KJ3H 5EEVA 2GUOB 4B9YA 5JPNC 3MRCB 3O8XC 5CLXA 1FNLA 4UINL 4RISL 1U8HB 3KYOB 2AJVH 4FLSA 5AVRB 3O45B 4IMKC 1HCVA 1UASA 2GIXA 1JFQH 4OLVH 1YPZB 2FUTA 1DQJB 3MRIA 4LCWE 4YS4A 2FX9H 4Y4HA 3V4VH 4YAQB 1G6RB 1GZPB 1FGNL 4OAWB 1JGEB 4IHOA 1C1EL 3EO0A 4MKMA 3U7WH 1HVXA 2YPVL 3UBXI 1TTBA 1SJXA 2BSTB 3CDGB 4HHGA 4Q6KA 3O2VL 5CF3A 2DEYX 3IRPX 3O4OC 3MV9B 4NHUB 4KV5E 3REVA 3UJTH 4OGAD 4QMEA 2OTWB 4RESB 5PAZA 1EEYB 3K2KA 2O93L 3Q43A 3L45A 3GI8L 2DQJH 3LPPA 3D3VE 3BWZA 4LGRB 4Z95L 3S4SB 5JW5A 1AGCB 4K4KA 2J55A 3BIKB 3VUAA 2HA1A 1HXMA 2EE0A 1L3NA 4AMKH 4XPTH 3L9RB 1YYMH 2ED9A 1UA3A 2CO4A 2G4GA 4QT5B 1ETZB 4YXLH 3FQ1A 5HYSB 3AY4C 4ZSOE 5IHLB 4XWGL 4JM2B 1ZK9A 3HC4L 1UXSA 3CSPA 3JWOL 1AHMA 1J0YA 3QDJD 4G6JL 4MJIB 3CAFA 4LHQB 5D7KD 5AW6B 5D6DA 4O9HL 1ZS8A 3IDUA 2Y5TB 2FLRT 4LNRA 4RGND 3C6EA 4WHDA 4CVXA 3T2LA 5CFAA 2VL4A 4HGWB 4P23B 3WFHA 1KFGA 5GHWH 5FOBA 1F4XL 3FT2B 4U05A 1I31A 4NKIL 3FUKA 3Q2CA 4O2EB 1PZSA 3DOSB 4OTXL 3QDHA 1A7NH 4FG6C 3WOVA 1FNSL 1HH6B 3VFVA 2BSRA 1W6WA 3V4PH 3BUBA 4XPGH 3MBWB 4HBCL 4A7VA 3W39A 4N1HB 2LAAA 3ZGHA 1LP9B 3NEOA 4OCWL 3GUTB 1L9OA 4YE4H 4UU9B 4N2EA 1PZAA 5AW9B 3WO3B 1LEKB 4HWBH 4MXQD 4GW5B 1D5XB 2X1PA 4LRNH 4R90L 3GLDA 4XPFH 3ZMNA 1SFDA 2JE8A 3GD1C 3DX8A 4K7FA 1ZTXE 4G5ZL 4P59L 2WXQA 3JWDL 5H37A 4TKWA 5ID1B 3AC0A 2VIRA 2CQVA 3CHXA 1D5ZA 4PRHE 3ABMB 3VMOA 2AV7A 3QCVH 1TXKA 2W88A 3B3IA 3MGAA 1FCCA 3AT9A 4I0PD 4NO5B 1OAQL 4P5RA 2YMXH 3ARDC 4X4XA 5LBSH 1JZGA 4ELKA 1QA9A 2DKUA 2CKBA 2VDKH 2XX1A 2VDLH 4G8GE 4P2QD 5K9QG 2QADB 1CG9A 2ENQA 4PJ5E 3LZLA 1M2VB 1ZWIB 1R5VB 1SYSB 4D0BA 2FBOJ 4P2AA 2UV3A 1G0YR 3FFCB 2IGLA 5FDWB 2R59A 4PM1A 2Z91B 2LQRA 5DEFA 5FYKL 1NAKL 3R1GL 4J3WA 5I75B 4UTBL 2GY5A 4TLSA 4IS6A 2Y7OA 3ULAB 4HJJH 5C0CE 1T5WB 3HI1A 5EEYA 2CIIA 2PP9A 3KJ4B 4GG8A 4P5MA 3WIIH 2ZCLH 5J4MA 5GSVA 3QFDB 1GAFL 1R0AL 2N59A 1WZLA 1IFHH 4OBRA 2N3JA 4PRBB 5TQ2H 5IQ7H 1KLFB 4X9YA 1LEIA 4E2OA 5DZJA 2Z92A 1DN0A 4PJFA 3T0EC 4PRIA 1BMWA 4NS0A 1DCLA 1HIMH 2GI7A 2ICEA 1ZHLA 3RAJH 3VGEA 4B41A 2BVEA 3VXNB 4FFZH 4HPOH 5EMYA 5JA9A 3D2TA 4C47A 1AAJA 3OLGA 1OCRB 3GM8A 4CGUB 5SWZB 4MCZB 2BIMA 4P2OC 4JKLA 4A66A 5DSCA 5GZNA 2JCCA 1TQSA 1HHGA 2NT1A 2O5ZL 3DJ9A 2YPVA 5TE7L 1J9TA 3TPUB 4RDQG 8CGTA 5GS1C 3CU7A 4YEFA 4GAYA 3TN0A 3EFOB 4ZPTA 1EVTC 3K5RA 3MNMA 1D7FA 4Y1AD 4BSJA 4IU3B 4LSQL 5L2JB 5E99H 3U7YH 4IRSB 4NHCL 1KIUA 1R3KA 5TF0A 5E0FA 2HJLB 2WY3B 5JQ6H 1DUZB 2BCMA 3FOLA 4UQBA 1MLCB 5D7IA 1NJ9A 1XMWA 4JZNA 1I1RA 4RMQA 5GGSA 1D5IH 4PJ5D 5DFVC 4BCYA 1O6SA 4LSUH 3VFGL 4HXAH 5FX3A 4LOUD 1HHKB 3DI3B 3THML 3WTWA 4AG4H 3KCPB 2W07B 3ZE0E 1HL5A 1NANH 4R83A 4YSRA 4Y5YA 2ZXGA 2FWOB 4N22A 1KCBA 1EO8H 2BVUA 4E0RA 1TETL 5AOMA 1O9VA 5JLZB 4MQXD 5F3HB 4DK6A 1CT8A 3N40F 5JR1L 4D94A 2X7LB 4HCFA 4O02H 3ZQWA 3LN4B 4MAZA 1CXEA 4OFPA 4Q56A 3SQBA 1V3MA 4HIPA 1DLHA 4JFSA 5AB9A 2ATAA 4WENB 4F7KA 2F9BT 4DP9X 3QWOA 3ZTNL 4A7UA 1E90A 2YAQA 1EVUA 3V5KA 4AUUA 2VZ3A 3QQNA 2XZAL 2YOCA 2CDEA 4KVPA 5IB4B 4OV5B 4Y4HC 2AW2A 1T2QL 3FS9A 4BXVA 5AW2B 1F97A 2WLYA 3BD4A 2WJ7A 4R4ND 3W0WA 3NUKA 1G7LA 2AJSL 4JRLA 5DURD 3FQUA 4P49A 5T3ZE 5B3JF 2VLKA 3INUL 3V0VA 4C4KT 8FABB 2QTVA 2XQ0A 1ZHNA 3IRZA 5GISL 3VXTA 2QV4A 1Q9OA 1GOFA 3SJVD 1UM6L 1NMBL 1ZLSL 3AQXA 4RMRA 1Y1DA 4D9QD 2X4TA 3HZKB 4YSTA 4CNIB 4QOKD 1FA4A 2K6ZA 1VACB 3LPFA 2JV6A 3P77B 1CFSA 2OM5A 4XMVA 5IBLC 4NRYB 2JIXD 2CA4A 4KHTH 2MCMA 5JPMB 5I71B 3BHBA 3L16A 3MRMB 5JHBA 1LXMA 4F15B 3QS2A 3ZN6A 3GZOA 4LCCC 4ORGA 2WNWA 4HZLA 4QAWA 3T8VA 5KSVB 2E75C 1S9KC 1CXLA 1BFSA 5IHUH 1B0WA 3LKQB 4PY7A 4DH2A 2D3NA 2PO6A 4IOSA 5D6DC 3S98A 4X98B 5H2BA 1S7TA 4RGOH 5KSBF 2OJ1A 4B9JA 4BH8B 4WI3A 3HS0A 3RFZA 3BPNC 4JHUA 2PTTA 4Z7QF 1F1AA 4KOBA 1BD2A 3QUKA 3WJLA 4AGQA 2HX7A 2OBGA 2YGNA 4QHLA 4K3EH 2F53A 3W82A 5IHHA 3UBXA 5JIIA 3TEZA 4H2AA 3OVUB 3P9LA 5J06A 3SQOL 1FGVH 2NY0D 3GTNA 4PLKD 3T09A 4AGNA 2OJEB 1CICA 1LEGA 5IKCB 1XIWD 2A0LC 4ZDHA 3LB6D 3V0WH 3GMLA 4R7NA 3SPJA 2DICA 4M6NL 2OYKA 4GKNA 2AV1A 2VLJE 4PY8I 4JM4L 4UANA 1M1XB 1R4XA 2J6EH 2V2XB 2YUVA 2UXFA 4L29A 3WLBB 1YSOA 3V9EA 5GRJL 1XSJA 2VE6B 2E9IA 4JFYB 4LAQH 4JN1H 3R4DA 4WI9A 5F7UA 3VM7A 2NRDA 1F4YH 4XTRD 5F1NB 1S9VB 2Q9OA 4M7LT 3MOBL 2FZ3B 4XVTH 1AGBB 2QLVB 3QISA 2PKDA 5I6MA 5J7CC 5EULV 1C9SA 2J8HA 2EVGA 1CD1B 2XHNA 3FZUD 4N9GA 2L7UA 4JPKH 2V3FA 4JFDA 3HE7C 1NOAA 1ZHBB 2JELH 1U8NB 3U0PA 1NCAH 3H0TB 3QAQA 3GHBL 4KO9A 4P3DB 5I15L 1NC2D 2IDCA 4MB3A 2RACA 5I0ZA 3G9VA 5C6TL 4NUPA 5TDNB 4B60A 3ZSSA 2X0WA 3MRBA 4XE0A 1U8LA 5JTWA 2FJHB 1ZXQA 3DYOA 3MV7B 4PRIE 1E65A 3MBXH 4U3CA 3ARGB 3EBHA 4MDJA 3PS6A 3U9WA 4AVKA 1KCVL 3HMXH 3L1OH 4JRYB 5E8OB 1NZRA 1LDPL 1J0IA 3WV0A 1IGJB 3FOMB 1JV2B 2H3NA 1BZDA 4OFQA 3VI3E 3QXWA 3ILQC 2L7QA 3QJHB 3DYPA 1WCQA 4YC2C 2JCCE 2F58L 3BGMB 2KZKA 4NEHB 4PR5B 1TUPA 2C1OA 1NCCL 3J8F7 5B8CA 5K9QI 2FATH 1R75A 2VAAA 4FI6A 3QXUA 2ICEC 1CQYA 3P9MB 4JDEA 4QXUH 4XOAA 5KBPA 4TVSa 3LD8B 5FCUH 3D69B 3ZZLA 3MLXL 3NIGF 3IBOA 2AABH 3L5XL 3WEAA 1KB5H 3PNWA 2DM3A 2P24B 4G7QB 3F64A 4L2LA 4Y1TA 3TBBA 1IZKA 2EADA 5T1LB 3TV8A 3C5JA 4OD2B 4ODWB 1OKEA 3F7VA 3NRQA 4X6BA 1ET5A 5DR5H 2VNCA 5DLMH 5GZNC 2OL3H 3T77B 5GRXG 1UM5L 3X17A 4ZI8A 5D7IE 3P3YA 5EDSA 3NJKA 4EUPA 2AJXL 1LWHA 5E9DD 4YPJA 1WCBA 4JG5A 1HEZB 2FIRT 3IDGA 3KPQB 3FUJA 3TN0C 4RBPH 3G5VB 2WB1A 1RJCA 3ENEA 3JTSA 1LILA 2XKNB 5D1ZI 5GGSY 2LLNA 3CIQA 4TTGA 4BK5A 4Y89A 4JL2A 3X12B 5I24A 4ODHL 2P80A 3ZDZB 3D1MC 2VDMB 3W2DL 3FU6A 3IMSA 2F7QA 4G1MA 2PXYB 1LO5A 4AMWA 4J3SA 3K0YA 4PGBA 1PDKA 4IBLT 4PJBF 1EJOL 2DM7A 1JCVA 3N43F 3Q6GH 3CXDL 4K7PX 2JKNA 5FW8A 4YHNA 3RPIA 1KYOJ 3JWOC 4AENB 4Y5YC 4ZMLA 1MHHB 1DDTA 1FG2A 4XVJL 5CZXC 2WP3O 4UUJB 1BZEA 1T6VN 2FWSA 5CZVH 1WZ1L 1QHQA 3QJTB 1IVTA 3NAAL 4TNGA 4Q4EA 4JFFD 3FULA 2BVPB 3UO1H 4B9PA 1EWHA 4X7SH 2H8PB 4HZAA 3FT4A 2A9NL 4JB9H 3W0WE 1MY5A 1HI6A 1DZ0A 4LDLB 2B0SL 5FUOL 1JFHA 4MJJA 1SEQH 1EHAA 1UA6L 2VLKE 2VJXA 4L2YA 5IMKB 3ETBF 3DTDA 4EN3C 5T5NF 1B88A 2WXFA 3MNZB 2HP4A 4PS3A 3S0PA 2XBZA 1RZ7L 3EJPA 3MR9B 3ORJA 2TRHA 1BLIA 2YQBA 4U1SA 5F9OH 1FZOB 4RLDA 3B9KB 1GVIA 5C09B 1AP2B 4N6QA 4UV4L 4EVNB 5CD3A 2NCEA 3BFOA 3ZL4H 1MJUH 5C08B 1MSPA 2JKTM 3ZRFC 1HCYA 2VW4A 3H3BC 4FQ1H 4RFNB 4FJYA 2PTUA 3SDDB 4B9GA 5JOPE 1BW8A 2GHZA 4J2QA 4LLDB 5C0ND 4HIIA 1WZAA 4K3DH 2YEZB 5EZLB 2G5BB 1CWVA 4XNMB 3DRTB 2QQLH 2GBTA 3W57A 1TCRA 2QPUA 4N2HA 5B1BB 3JWDC 1TSHA 3TBSA 4A63A 2FBJL 1A7QL 1P1ZB 3QEGH 3NPSB 1J1OH 1EXGA 2G9HA 2YAPA 4AV5A 1L7IH 3KL0A 2R2EB 1B4RA 3KJ6H 3RZCD 1HYSC 5GIRA 1U42A 3TU6A 4EI6A 1BD2E 1N5AA 3UAJD 1J8HE 2BC4A 3C12A 1FYTB 1QZNA 3QQ3B 2F53E 1SLUA 4WU5B 4FYRA 3MGOA 1F3JA 3V4UL 4A2HA 2P9RA 4JO8A 5EOCH 4AXWB 2PO6C 2V8LA 5C0EB 1EAPA 5C9JB 1EGJH 4KAQH 3QNFA 2DQIH 3K0WA 4M6MH 2W9LA 3D0LA 2X4OA 4UM8A 4XZUA 1QRNA 1GXEA 3HS0C 3RFZC 1YEJL 4JO3L 4AVJA 4G6AD 1H6EA 1Q0XH 4PS7A 1BZQK 3WJLC 3MXWH 4OFIA 2P8MA 2EKSB 4NNXB 4F92B 4NRZB 5EG6C 1BEYL 4AJWA 2HLFC 3U4AA 3ATBA 1CICC 3FTYA 1K8IB 5C0AB 4AX3A 1F02I 1OCOB 4APQB 3IJSB 1CL7L 1QW9A 4I2XA 4W70A 3A23A 4NZFA 5ISZA 4S1RL 2A1WH 3TO4B 2X40A 4M7ZC 5F1SA 1XO8A 5C0RH 1HXYB 1EO7A 2OR9L 5CSGA 2ADJA 3I75A 2GHWB 1ODUA 2V5MA 3E6HB 5FHAH 4M61B 3TBTA 4A6YH 3VFRB 4ODSL 4NM8H 5JOPD 3WN5B 1UADC 3CHRA 4JFDE 3WSQL 4FI8A 3L54A 2FQEA 5T1KD 1LO2H 2YGPA 4PRNB 1A6ZB 1XGRB 2Z1PA 1Z3GH 3KLAB 3NABL 2RHEA 4S0TD 2XWBA 2JXMA 3MRJA 4YLQT 5DEGA 3ARRA 5HGBA 1VA9A 3ZYZA 5IQOA 5AG8A 1QFWL 3LNHA 3L1GA 1A66A 1QSFA 2OZ4L 2XTSA 1DZBA 4HX1A 2YRLA 5ALBH 5ANMA 5DXWA 1X4XA 3B2DC 4Z7AA 2JB6A 1JSYA 1QAWA 1KTRL 3QUZD 2J88L 3H42L 4FJZA 4ELMA 1J8HD 1TLMA 4P46B 3UYPA 5IHZB 3ROLB 1NKOA 1G7IB 4BJLA 2CZNA 2IV8A 3VXUD 3ZYIA 3KPNB 1BVKA 3BGFB 3VH8B 1W2KT 4YJZL 4DKEH 4XP9H 1EEUA 4Y4FC 1NIAA 4RRPM 3A22A 1OCZB 5LUMA 3QZOA 4OLEA 1C12A 2FL5A 1QEXA 3H3KA 3SD5A 3TS8A 3AWEA 1E7UA 2DIEA 4XMKL 3G6JA 1AY1H 3CQPA 1I1AD 5KVMC 3WUWG 1Z9MA 5FYLL 1Q9LB 3VXRB 2P3YA 5A2KH 4DHLA 5IIEA 1AFVL 1LQSR 1QACA 1MFEH 4ODUB 2TRYA 3FK3A 4WJ5B 1PBYA 3QEHB 4KQ4L 1IGYA 3UTZB 5I1JH 3ILPB 4X5XA 2Q5BA 5BUPA 3K6OA 4ZMOA 5EIIB 2ZOKA 1MI5E 1TJIH 4ZX5A 4UT7H 3HMWL 4PTUA 5L6YL 3FHAA 3HBQA 2HJKA 4JPWL 4OLZH 2DWTA 4JFXA 2PPDA 5LAXB 5LO7A 3UYOD 2BWIA 5D7SL 4EDWH 5GZOD 2VZUA 2PWGA 3EJYD 4PGCA 5DJ8A 1SNRA 5I73C 4NSKA 5I0DA 2GABA 3PRZA 2VXVH 1AQMA 5EF1A 1TVBA 5HYQA 1HE8A 1XWVA 3B2VL 4BK5C 3JUZA 3NTCL 1UGNA 2IPTL 3VD0A 2Y5QA 3F8UB 3JT0A 3U2SA 1I3UA 5JNYB 4JVPA 3MLVL 3LKOA 1YMHA 4Y1SA 1DQQA 1N59A 2RCSL 3QULB 1UENA 1MFAL 3IDNB 1OARH 4NENA 3B2UC 4Q0XL 1RJYB 2CDFA 1KJVB 2OTUA 3EUUA 5TF1H 5D7LD 2WHVA 1WBYB 4R0LB 4K5LA 1H0DB 1WA0X 3I3BA 3PIQB 1NLBL 2EDHA 3ESPA 3GSXB 4QKXB 1RL1A 3QE5A 1PSKH 2OQJB 4KUZL 5E08H 1CF8L 5AYUL 4PG9A 3NIGB 3HHRB 1MFBL 2J5LB 4I48B 2Z0UA 2LVCA 3I74A 1JGLH 2BXZA 1ZT4A 2LTQB 4DNLA 5F6IC 4PV9A 1HHHA 1BQHB 2I69A 5FO7B 5I1DA 2A2QT 1DDHB 4NB7A 2OX5B 1TTFA 1ZEAH 3ZT6A 4MASA 3BKCL 3WY2A 5DHYA 5D1ZA 3IXTB 2MQGA 5E1AB 3U4EB 2QHLA 1J87A 5F7WC 5CGYD 4PV8B 1GHFL 1KCRL 5AKTA 4I0KA 3M88A 4I7ZC 5AEAA 3TBWB 3CZKA 3DRQA 1FFTB 1FZMB 2AXJA 5IMOB 2VDQH 3GSNL 3QJFB 3NZUA 4PGEB 4KQ3H 1EHXA 2M8XA 3H3PH 1UZGA 3U1PA 4MVBD 5C2BH 1I3RB 4Y19A 3BDBA 4F24A 2XV6B 3BP6B 3HHMA 4DEWA 3P11L 3DJRA 5I66B 2FT6A 4KRPC 5IEKA 4FF9A 2CIKA 4OF3A 2UUDH 2XY1A 3GMPA 2FQDA 5FA3B 3CFTA 4AYGA 4NQCD 5IBTL 1CB4A 3L9BA 2OZ4A 5EBMB 1QRNE 1SVZA 4Y2OB 3A4FA 3K2UH 2CA3A 5E2WH 1MLBB 1I1FA 1T7VA 4MZIA 4NKQB 4N2GA 2V0AA 1QUNA 4WW1A 3JT2A 4I18B 4M4RB 4XNYL 1RXLA 3TVMD 3KDMB 5CMAB 5DUBA 2R0LL 4N87A 5E0QA 1FL6A 3QR2A 2PP7A 2NYYC 2Z8VC 4K71C 5L4FA 4I2XE 3NZSA 4E9LA 1PG7L 2IPKA 4FEIA 4G80B 2OMBA 5KVDL 5A2IH 5ISZE 1CGTA 5I19H 2VDPB 5HHPA 1A6TB 2X38A 4PRAA 3PHQA 2R39A 4JFQB 3WKYA 2FO4A 3ULUE 2HG5A 2HTKD 5KYNA 1YYCA 2OMYB 4OJFH 5ADOL 4G43A 5ALCH 4BKLA 5IROD 4FKHA 3MX0B 1UWXH 3GEWB 1YLBB 4HHAA 5AL0A 3IJ7A 4Q2ZB 2RTTA 5CGTA 3ILDA 2IXQB 2ZPKH 2OSXA 1IGIH 3O6LH 4W9CC 5EOTA 3D50A 1FNAA 4ZFOL 5HJGA 5L4MA 4Z7UA 2WWOA 4FMVA 4JPVH 5GGQH 4ZOAA 1QSFE 3LXUX 1X7QA 5J57B 2DYSB 3N6YA 3QPQD 2F68X 1DVZA 3L3DA 5ANME 2F8VA 4AJYV 2W0LA 1HH9B 4TVUA 5BQDA 3GLEA 4AL8L 1G9NL 1A7RH 2UUDK 3MOAH 1AGFA 1AXSB 4ELME 2FSEB 4PJEF 1SVCP 3FNKA 1OB1A 3Q3GA 5IF0B 2E76C 3TH2T 4KZEH 2GSIB 3NG5A 2G2RB 4KZDH 3BXNB 2R69L 3K2MC 5JPNB 1XCQB 1ADQL 4U1NA 3PWPA 2NNAB 3UADA 5EBWB 3OKMA 4X0NA 1D6VH 3FO1B 3O6KH 4G9DA 5E2UH 1IGFL 3O2WH 3P73B 4XO9A 1AHWA 1A4CA 4JHWL 2ZD0A 5HJDA 4GQPH 1OWWA 1QLFA 1FHGA 3DMMB 4RGNB 5DVPA 2EXTA 3T2PA 3EW3B 3ZT7A 3GI9L 4GW4A 4K7PH 5DMGD 5IESH 3D05A 5LXGL 2SODB 1EPFA 1UKSA 1G7JB 3CHSA 3VRLE 1OAJA 3EDDA 4LSPH 1M05B 1ZLDA 2FX7L 4IOIB 4BFFA 5SWSD 4L5FE 1YMMA 1KTLA 3RGVD 3OPZL 2HXAA 2HVBA 5EC2A 3B5GA 1A1OA 1UWXK 3U1QA 3ISYA 3DXAA 4N5ED 3D25B 2HX8A 3SCMD 4LCWB 3TYGL 3AU1A 1PYWB 3BLKA 4KX9A 4NZRL 1SDDA 2JSFA 3QH3A 3QO1B 4HUKB 4RISH 4DVRL 1FSKC 4I0CC 4ZUTA 2PCYA 1LHZA 4PN6A 2WXGA 2Q7AA 3TCLB 1N3NB 2EEAA 1E4WL 2EO9A 2VW7A 5DRNB 3QHFL 2ZUTA 2ZJSL 5FECB 4MMXC 4YBLC 3P30H 4JZOB 2ETWA 2DZEA 1T4KB 1CD8A 5E2VL 1XR8B 2O61B 2WM0A 5AVYB 2X6MA 1Y18B 3PWUB 3OKKA 4I0PB 5E7BA 3D3VB 4JNXA 3FN9A 3PWVB 2YPVH 5SWQA 1ID2A 1IGCL 4WWID 4CSSA 4UQAA 2UXTA 4LQFL 5I16B 5AAPA 2P7TB 4J7RA 2W80C 2OW7A 3U2IA 3NVQA 3LVTA 4JO4L 1I1CA 3NGBB 3GI8H 5EC1B 4MWFB 1KUMA 4ZSOB 2QPFA 5HGHA 1OGTA 1F0LA 4U1KA 1U33A 3GTTA 3QXDB 1QHOA 3BAJA 1UOVA 4R7XA 4WRLA 3IDYC 1FAIL 3MUHL 2CMRL 3NN8B 4MBOA 4CMMA 5JIMA 2B20A 3DARA 4XWGH 2IDUA 1U8CA 1WAAF 3MROB 3HC4H 5AYQA 3DKHA 4KKCC 2N1TE 3JWOH 4G6JH 1NDMB 3H9SA 3MLUH 3HRPA 2QMKA 1RHFA 3KR3L 4YDIH 2NZ9C 4LRIA 1MFVA 1DFBL 3ZXAC 2MOGA 4ZZKA 2J1WA 4Y7MA 1RK0B 3IGAA 1S78D 2QTEA 1PLAA 1CU4H 4X5RA 1F6LL 2MCG1 1CYXA 4OI8A 2YGQA 4OTXH 4QJ3B 3LDBB 2NXYD 4PP1D 3RWCB 3QB7C 5KBMA 4TNWF 5LWYL 4Y19E 2AEQL 2WLLA 4HBCH 2L04A 5D1ZC 3Q44A 1WICA 2BK8A 2H2SC 4OCWH 3BDYL 5C0IB 4ZFOA 5CSZB 5F9AC 1GTNA 3KBPA 2V17L 4QKTA 3NMEA 1R3IH 4PVMA 3ZKMC 2R4RL 1EEQA 4R90H 4Y1AB 3LPOA 3OZ9L 1K5NB 1KTKE 3EF4A 2ZUVA 4N2IA 2G9KA 1F6AB 3OXRB 4ZNCD 4G5ZH 5HP5A 2EH7L 2H1PL 4P59H 1NGQL 2W8CA 4JN2B 4JY5L 5F2FA 1AACA 1BBDL 2NUPA 3UEQA 1O7DC 5KANG 2V37A 3CFQA 1C08A 4D8PA 2DBJA 4PB9H 4PJ5B 3HJEA 4M02A 1U3ZA 3NCMA 3HNTL 2R69A 3OR7A 1ADQA 3S8WA 4F7PB 5F21B 3N55A 4KY2A 4JZJB 4OM0L 4YPGB 5IW6B 3OTTA 1SF5A 3IU3B 2BOCB 3N85L 3BZEA 4KKLC 2HKAA 1G7PA 5A3IC 3VRIA 1XT5A 4BGLA 3MJ8A 4P3WA 3POHA 2N7SA 4G8AC 5C0CB 2VRAA 3DUHA 4J8RA 3MA9L 1QO3B 3AZUA 3BEVB 5E8PB 5FYKH 4HUVA 2WTOA 1NAKH 4J3XA 1CFMA 3DV4B 1IAOA 2ITCA 3GMQA 1EHKB 4Z7UE 4GUOA 4LB8A 2XPYA 4UTBH 3ML8A 3T6ZA 3EDFA 3CSYB 3WTVA 4Q74A 5B39G 3RDTA 2YFOA 1RZFL 2CDGA 5DYOB 2ARWA 2C34A 2HFGH 2OSLB 4Z7VA 5DURB 4GINA 4TULL 3TA3A 4HULB 5BRZA 4DP5X 5EU3A 4F33A 2VZ1A 2MNWA 4LHUG 2YRPA 3PWPE 4AYFA 2ICES 4D9RE 4UILH 1PTZA 5ESVA 3EGDB 4QOKB 4LLWB 4P2RD 2IAMB 1EH9A 4NC1E 2JIXB 2IH3B 2RB8A 4J4PA 5TE7H 1N0LA 5C71A 5E94B 1DEDA 1WO2A 1MCJA 2XWRA 4U7SA 2GC4C 4LSQH 5F93C 2VUOA 4NHCH 1YMME 4J5VA 3K91A 3EUDA 1K2DB 2Z31D 1AHWC 3ZE0B 4NC1C 5BZDB 1T7ZA 4ADJA 3DXAE 3SD2A 3TFBA 4HIEB 4MNHB 4NDMA 4X4YB 5I0YA 3GZPA 4HK0A 4Z77B 2HLAA 3S34L 2BMKA 2DLEA 4FNUA 1EFQA 4R97C 1DJXA 2ZICA 3D2UD 1UATA 2RR3A 3GS7A 4FNLL 3THMH 4N2BA 3JV6A 4AEFA 2WXKA 2XFXA 3LRGA 1GGYA 3CNKA 4LSRL 5CWSA 4GFXA 1RMFL 2QGDA 1IEHA 3APNA 4DGIL 2J21A 3LEXB 3O4LA 1U8KB 3F83A 1QBMH 5JR1H 3KWWB 5ICZA 3REVB 1FJ1B 4GQ9H 4PJ7A 1VIWA 1IC7H 1NCUA 5E5MA 1UD4A 3NFPA 3V4LA 1Q9KB 1E5BA 5FYJH 3NFNB 5JW5B 1NH6A 1C8QA 1DR9A 2WQUA 2XZAH 3F6IA 4TSCL 1FV1A 5EEWA 1HCFX 3IU4H 1BP3B 3KYNA 4PREB 3FT3B 1T2QH 2FEJA 3I6LE 3ZKXB 1ZV5A 4CU6A 2AJSH 3CSBA 1UXSB 1SOSA 4TVPL 3MRLB 3Q48A 4PHZA 5EU6D 2AZUA 1FO0H 5FGRA 4IBYA 4EUPH 1N6QH 1YECH 3UZVA 2X53A 4TSBH 4JKNA 1S8DB 2FJFA 4D0DA 1ZLSH 2BNUB 1JDDA 1PZCA 4YR6A 3NSYA 4TSAL 4WI7A 3ISWA 3Q13A 1DVFA 1R3LA 4FE9A 2VM9A 2J57A 1NC2B 2B1OA 5AW7B 4C59B 3M1BB 5FOBB 1ZANL 1U3YA 3IJ8A 4AYID 3L6FA 4GQZA 2DEXX 4UOW1 4X8CA 3T2OA 2C5DC 3IGFA 3RVWD 2OFQA 4F8OA 3HB3C 3D0AA 4RDBA 1J5OH 3ARTA 3ERXA 2BSRB 4MXVF 5KVDE 5DZLA 2WBJA 1DJYA 1R1CA 1DQIA 1SJHA 4WHTB 1XF5B 4XCFH 5IR1B 5CEZH 3NCJL 1R3JA 4P5SA 3TC9A 1EO5A 1AO7A 4LF3B 3L3KA 5HI3D 2OMNA 5D2LE 2YPLA 3NZHL 2VWEE 3FQWB 4K7FB 5KAQF 3DC0A 4K5NA 4QNPF 1E42A 3RE0A 5TDPB 2CM5A 2VIRB 3QCTL 4HK3N 3I6GA 2VLJB 4PJGA 1T21A 2D31A 4IKKA 4MB1A 4X4XB 3SQOH 4YZFF 2EYSB 1PD0A 3ISRA 4G9FA 4WU7A 4JFPA 2PWDA 3GKWH 2JTYA 3AT8A 2VWEC 3ZE2F 4YHML 1IBYA 5DHEA 4JHVA 4M6NH 1KIRA 3NOIA 1CG9B 4ONOA 1YA5A 4FHJA 4JM4H 2Z0BA 1WSST 1I7UB 1QWUA 5DD5H 5E9DB 4J23A 3QDMD 3S48A 2HT2D 1W0VA 3QYCA 4FQHB 4YLBA 3CLEH 1A7OL 2EDMA 2YD7A 3ZDXF 5CN3A 1D7DA 1XF4A 3RP1A 1ULVA 1NM4A 3FB8B 3EH3B 4YFLI 2XBTA 5IOPA 1G9NC 1U30A 4GRWF 5JMOC 43CAA 4DUVA 4IS6B 3LMJH 1RUMH 5F7YC 2A83B 1PZBA 4B0MM 4PCTA 2CIIB 4GG8B 5B7EA 4KKAC 1CDJA 4P5MB 1DJZA 1RP8A 4HMCA 4YDJA 2VXQL 5GSVB 3CH1B 1U2YA 2J2ZA 4HDIA 4P07A 5TE6H 5HYJE 1MCNA 5TFSL 3P3SA 4PSPA 4XO3A 2TAAA 3QRFM 2Z92B 4MAYA 4NFDA 2NX5A 2VAJA 3D87B 1KENL 1URZA 4KKBC 2J8UF 4QRRA 2WW8A 3GHBH 2NPLX 2NY6D 3HR5A 4LZKA 1XGZA 3LN5A 4U3SA 5DC0A 1SXBA 1E4KA 3FQXB 4QCIA 1QSEA 3VI3B 4Z7VE 3BUYB 2AF2A 3VGBA 3NCCB 4XC1L 4EXKA 3IAGC 4ZQKA 3DX6A 5DSCB 2JCCB 4JFZH 4PJXA 5BRZE 3CXHK 3FSAA 5KANI 4Q6YA 4PSRA 1S7VA 1PG7X 1IEAA 3LIUA 3H4FA 4OF7A 3CC5B 2CUIA 3W11D 3TN0B 4QIRA 5T5FL 4DO4A 1T1YA 3CD4A 4FP8L 1MNNA 2Y36L 1A6AB 3FRPB 1K8DA 2XTLA 4NPYB 4PJ9D 3TA3C 2A74A 2ZG2A 3FOLB 1UJ3A 3QDGA 2FNBA 4JZNB 4PS4L 1I9IL 3IFLL 3O11B 1CLZL 3HEIB 3LKPA 4QRUB 2VJ0A 3UTPE 3L5XH 4HC1L 2WC7A 3VJ6A 1HCZA 1ZE3C 4HUWA 4OD3L 2HMIC 4ANVA 4WHCA 1OT2A 1TQBB 1KJ2B 2A38A 5EZPA 4POYA 3PUCA 2PPAA 4N0YH 4EI5A 5E4OA 5JIDA 2R0ZL 4YXHL 3AB0C 1NC4D 4J4PC 2Y7SA 3PV7A 4MQSB 4ES9A 2AJXH 2GTZB 4KFZC 4AZ8B 4ERSH 2WGXA 2LU7A 4FQJL 1KLGA 4TM9A 4U6VL 1QZ1A 3OKLA 3HBGA 2BSED 4P0DA 4XODA 1DJWA 1MJJB 3Q5OA 4PUBL 3VXQB 2UWEA 1VFOA 2K1MA 5LLIC 2DWDA 1YCSA 4N8VG 5KVFE 3D6GA 5C70A 3EHBB 3HE6A 1Z1WA 3VFSB 3U1SH 4GP8B 5HYJD 2YA0A 2CLRA 1KBKA 3W2DH 5IB2A 3BISA 1SVBA 1IGTA 1QW8A 3Q1EA 2YSSB 1WC7B 3FAWA 1UOLA 3MPCA 4MQ7A 3SE9H 1HL8A 2ISDA 4AE0A 1EJOH 3T4YA 3Q1SH 4Q9BA 1ORQA 3QJQB 1Y0LA 1EIBA 1K4DA 2CUAA 2W91A 1JK8B 1G7LB 1WGOA 2Y3AA 3N41B 3PP3H 1TZIA 3FQUB 2IMNA 1OO2A 1UB5B 4XVJH 5DJ0A 3V0VB 1H19A 4M9PA 2D7QA 2J44A 3AXHA 5JHLL 1QFUH 1ZHNB 1AR1D 4QHKJ 3IMUA 2MNJB 1GS6X 2A9NH 5KWYC 1MCFA 2K8QA 3SKMB 2B0SH 5FUOH 4JFUA 4G5AA 3RX7A 5D6CA 4B95C 1UA6H 3HN8A 3FPXA 2C3HA 3T1WA 2BINA 3TX4A 1DJHA 43C9B 2AQ1A 1RZ7H 1Q38A 4KXAA 2HVKA 2PWFA 3K1KC 4IHBA 5ECGA 4ORGB 4UV4H 5F6HJ 3QXAA 5GRUL 4AC4A 5T1JA 4C83A 1MG3C 4XCCL 4QRTB 3IFPA 2GJ6E 4FQXD 2WAQA 3AREA 1NFIB 4KJYA 1RUPH 3VGAC 1RURL 3X1NA 3FUMA 3KPSA 3T65B 2Y7NA 4LGPB 4PJHF 1ZA6B 2G4EA 2B4CL 3BH9A 3UAFA 3VG0L 1Z5YD 3HS0B 1K5WA 3SPVB 2PTTB 5AW8B 2B1AL 4AM0Q 5I2IA 2FBJH 4DKFL 2D03L 3VD1A 1J8HB 1A7QH 5DI8A 4QHLB 4WK4B 5J1SC 2ZF9A 2BJML 2XXFA 3VXUB 3P9LB 2YPLE 2F7RA 3FB5B 1JZ8A 5EUKA 5K1NA 3IGLA 2VXQA 2XNAA 3FO0H 1OZUA 1LEGB 5FUCE 1E4XI 1LO4L 2WBJC 3GMLB 4NKMA 1CDHA 6FABL 6PAZA 1AQKL 4PJGE 2AFNA 1KF9B 1HS6A 1URLA 4GUPA 3V7MA 2EXYD 3ZX1A 3GDCA 2ICWJ 3VDCA 3KXFD 4G9FE 3MLZL 5LG1A 5DK0A 4QWWC 1N8OE 3TBCA 5INDB 2EYRB 2R1WB 3LNFA 2V6HA 4UQEA 3RYMA 1YEJH 2BERA 3MI6A 4JO3H 3UCQA 1LE9B 3AG4B 3TNMA 4U3HA 2VR9A 4Y16D 5GRWA 3QWRA 5DRXB 2XIDA 3MVSA 4XVSH 1NSNH 2YWYA 1S7QA 1WBZA 1RUAL 4TQPA 5T5FA 1P0SE 2FVNA 5K9KA 4NPJA 2D7PA 4N9GB 3SKOA 1YN6B 2CRYA 3QPXH 3MBED 2CGZA 1GTFA 1RIVH 4YL4A 3ULSA 4E5XA 5CO1A 4S1SH 1JWMB 4S1RH 4O5LH 5FFOA 1U8OB 2OR9H 1B0RB 4ONFL 3CH8A 4U1GC 4XBGB 3UTQB 1VHPA 2GJ6D 4ODSH 2ENPA 3RU8L 5F72S 3DURB 1DVYA 4HC1A 4JDZA 5IBUG 3WSQH 3N50A 3T0ED 3BVTA 2NX5E 4UTAL 4QRRE 4V1DE 1M9WA 2I85A 4NWUL 1E8XA 3GBDA 3X13B 1NICA 5EZOH 4HAFA 3DGDA 1J18A 5D70H 1A6PA 2Y25A 3RBSA 5EH1A 2H3NB 2JKWA 1QSEE 4P2OD 4L18A 4XBMA 5FA4A 1B2WL 2XZQH 4DVBA 1UCBL 5DDHA 2G75B 3CBKB 4LKXA 3DJSA 5MEND 1N64H 2W59A 4XXWA 4PJXE 4MAYC 5B8CB 4AYBA 4OZGF 2WN3A 2BCKA 3NSJA 4YGAB 2P5ED 2J88H 4JDEB 1KB3A 3VNYA 3H42H 4YFDB 3A6CH 2FTAA 1XCWA 3BZ4A 2YEQA 4NN5B 4NYLB 1E6JL 1M7IB 2EIJB 1JXFA 1MCWM 2X6CA 5DFAA 1E4KC 1T04A 2NLJA 2WLIB 3PNWB 5KVGE 1E9QB 1U92A 2NNRA 2G3MA 3FCSB 1CGWA 5CD5D 1HHJA 3RIAF 2MFNA 1P4IH 1A1NB 1QD0A 3BOVA 3QZWG 3HFMH 3QDGE 4RAHA 4YSUA 4OT1L 4BWUA 4Y2DA 4JPIA 5AVWB 3TBVB 4XMKH 2EDOA 2D2CC 4NCC2 1WCBB 4QR7A 1TNNA 3S5LB 4LVOC 3JV5A 4WKXA 4AUJA 1RHHA 4BZ1A 5FYLH 1MF2L 1RAMA 3PAUA 3C5ZA 3MZTA 3SBRA 1MI5B 4JMXA 5J9PB 1LO0H 1NFDA 1PKQA 1SJMA 1S7WB 4Q6IA 5T33L 2PP8A 3ES6B 3PP4L 1DQML 4GRLD 2A74C 4ORZC 3NBNA 1UJ3C 5IVXE 3S4SG 2CO1A 3WLWC 4NQTA 3GHEH 5IVNA 3M6DA 4ONGH 5C0BA 3V55A 5K9OA 1PDKB 2WMPA 4HKBB 1INQA 5AAWA 2YUZA 1N68A 4LBAA 3HMWH 3IDMB 1T2JA 4WQOA 3TZVA 2JKLA 3BKML 5DJXA 2BHYA 1XD1A 3HVDA 4EI5C 4YHNB 5HYSG 4JPWH 4L3EA 4NQCB 3DVGA 3SPHA 4XX5A 6CGTA 2LT9A 3LIZL 4UQ9A 3LKNA 3V6ZA 4V1DD 2X6UA 1UCTA 5D7SH 5IVZB 2J8UB 1V10A 4JKKA 4JKWA 3MNWB 3BDXA 4XC3H 4LPCA 1YNKL 1PZ5A 3HE6C 3TVMB 4LKCA 1KXTB 2L0DA 3D34A 3U9UA 3QO0B 3BFWA 2IPTH 2BVOA 1JGDA 5T1DL 35C8L 4AQAA 4YDNA 4LLVA 2WIIB 3PV6B 4X6DE 3BD5A 2ADYA 3B7RL 4X99A 3MLVH 4X5WA 5TK4A 4U1SB 3S96A 1XH3A 3WNLA 2NY3D 3L1EA 1HHIB 4LFHG 5F7KC 3MRNA 2RCSH 5IBLD 3NYKA 3K6DA 3OX8A 4HAKA 1OGAA 1ORSB 1F4HA 3UYRL 5SX4I 2L8AA 2FWUA 3EDEA 3HI6H 2D0FA 3S3CB 4ZFGL 4RX4A 4MTMA 2ZXCA 1NLBH 3WD5L 2NQCA 4KUZH 2G3NA 4M4PA 3MJ9H 3WAKA 1YEKL 3G5XA 1N6UA 5IB5A 4OZIF 4GW1A 3NQIA 4Y0GA 4AYMC 2UZXA 1KULA 4JFHE 1TDQA 3GSRB 2WSDA 1FPTH 3MLTB 4PJCF 3PWJA 1MCOL 3CQFA 3KPSE 2G9HB 1ND0A 2DLFL 5TGBB 2IG2H 2ZOTA 3JUYA 3C5SA 4MRCA 2BHZA 5G2NA 5KJRH 1BOGA 5B39A 2X9ZA 3OJ2C 3PLYA 4WW2F 3PJLA 4QHPA 5F44A 4MDRA 3SPCA 2BC4B 2UZIH 3CIAA 3V4VB 3GXFA 3BC9A 3VWKD 1XFPA 1CE6B 3IPEA 4F7MA 1GHFH 3AREC 5K59F 4YHPB 3Q8AA 2DMCA 1M6OA 2QVFB 4G42A 3GSNH 5FKAA 1EAPB 1MIML 2AK4D 2X4OB 4IRJC 3GBEA 3RB7A 3S6CA 1JMZA 2X9XA 4UTAA 4KUCD 3W3BA 1B9ZA 5E95B 2WXOA 2MTPA 3P11H 3HAEA 3LH9A 3JTTA 2GUYA 4PJAF 3NJHA 4HU2A 5IBTH 2K6YA 3WFCL 4Z3TA 2XQYA 4Q14A 1MJ8H 4ZAKD 4JANB 4MD0B 4YDKL 2JF1A 2EDYA 5DMJB 4UDUA 5SWSB 3SPGA 4I2XB 3LRSA 3QEQD 1PZ2A 1NUFA 1NOLA 2WBKA 1WFTA 5CJ8A 2IPUG 4DP2X 5B3SB 4GSDL 3CFNA 3I75B 3SCMB 4HH8A 2ESVD 2XZCL 2AQNA 3V7AG 5G4NA 4YXKH 1YY9D 3HE7D 2QGBA 4XNDA 1PG7H 1MRFH 1MOEA 2D2OA 3IMVA 1HN1A 4X6EA 3DBSA 3UEZA 4NQDD 2E8YA 3CZUB 3MRJB 5DEGB 3LX9A 4MJ6A 2WVUA 1YUHB 3MGTA 1ACYL 4FD0A 2CPCA 1QSFB 4UT6L 1P6FA 1ZDSA 1R34A 2R0KL 3F12B 3EOTH 4HJSA 1L9RA 1QG3A 5FHBH 4OCLC 3B7YA 2W60B 2EEFA 2DH2A 2YXMA 3BP4B 5D7JD 3V4PB 4KTDL 2D7OA 5DTFB 4FTDA 2X4QB 3M46A 4LPYA 4QRQA 1OF0A 2I32A 4X8JA 1BVKB 4HKXA 2NW3B 4UIMA 3VXPA 4Y5XA 4PLOB 3LNDA 3EO1B 4AL8H 5DD1H 1E9PA 2A9BA 1BFVL 4LLUA 1G9NH 4BCZA 4A2GA 1JGVL 4ZMNA 3CX2A 4WWKD 3M17B 5HDOA 1C12B 1YEFL 1A6UL 3LIZA 5ETUA 5IV2A 3QYMA 3UABA 5JW3H 3F58H 1XDTT 3D85D 2R69H 4F3FB 3O6FA 1ADQH 1VZHA 1F4AA 3N0PB 4KZCA 5I18L 2EVJA 3PYCA 2FR4B 3RKPA 4XXWC 5KN5A 1BMZA 1FFPA 1L9QA 4JHWH 1ZVNA 5HD8D 1JK9A 2VDLB 5F9JB 1ZA3A 2NY4D 4XNUL 4H0HB 2EDEA 2HFEB 3A47A 2F8OA 2F7IA 3K80A 2Y1AA 4YNYB 2QGEA 1L9NA 4P5TB 4X5XB 4UZSA 1WQVT 5JQHC