2V33A

High resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
EAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCSASCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution Structure of Domain III from Class II Fusion Protein of Semliki Forest Virus
rcsb
molecule tags Viral protein
molecule keywords E1 ENVELOPE GLYCOPROTEIN
total genus 17
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2007-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2v33A00
3IRCA 2JSFA 3G7TA 4BZ2A 2HG0A 2I69A 2ALAA 2P5PA 5IREA 1RERA 5LCVA 2JQMA 2R69A 3N43F 2H0PA 4FG0A 5AAWC 5H37A 4AL8C 1OANA 5AAMC 3UZEC 4AM0Q 4BZ1A 3MUUA 3J2PA 1S6NA 1URZA 1PJWA 1Z3RA 4GT0A 3VTTA 5GZNA 3N44F 4L5FE 5JHMA 1Z66A 3WE1A 3N42F 2V33A 4UT6A 4UT9A 5LBVA 3UYPB 4UTAA 5B1CA 4ALAC 3UZVA 3J27A 2JV6A 5KVDE 3UZQB 5KVEE 2R29A 4UTCA 5KVGE 3UAJA 5GZOA 1SVBA 5IZ7A 3N41F 3P54A 4FFYA 5KVFE 5JHLA 4UTBA 1ZTXE 3N40F 2GG1A 4GSXA 1OKEA 3C5XA 4FFZA 4X42A 1TG8A 5LBSA 1OK8A 1UZGA 3C6EA
chains in the Genus database with same CATH superfamily
1JL8A 5HYJD 1O7SA 3TT1L 5I1GL 4OD2B 4Q58C 4J1UA 3JTSB 5C0FA 2AQPA 2YO3A 4PJEA 5BVJA 3OSVA 1S7XA 1MJJA 2B08A 3TVMC 5C0IA 2CDEB 5I0WA 2CHWA 3ATDA 4P46A 1PY0A 2B14A 4LNVA 4Y4FA 1WHPA 4Z7OF 4ZD3L 2G3ZA 2KH2B 3LZNA 1TEYA 1ZJBA 3WO3B 2F5AH 2L4OA 4FQPA 2R0KL 1OQOA 1ZHBB 4P57B 4ATWA 2HZHA 2VQ1B 5FFOA 4ODSH 4UDTB 1AFVH 1AGCA 2BSBA 1C5BH 3IFOB 4MNQE 2CKBB 4DGYH 5E2JA 4D7PA 4G42B 5D8JH 5T5FA 2F7OA 4QMEA 5C0AA 4DGYL 3CJJA 2Q0ZX 5AZ2L 3SDYH 3ZKND 1OV8A 3DPBA 2X4QB 4P23B 3I6KB 4N2GA 1TTCA 1HNGA 4PRIE 3CV5A 3L9RB 4BFNA 1MFDH 3DOHA 4WFFD 3RWDA 1SHWA 3X3GL 5DRZB 3WDHA 4HK3N 1MZYA 4FNLL 4IKJA 5GGSY 3CX5K 2XFXB 1MFEH 5IOPB 2R1YB 2ZZUT 2H0EA 4XCNB 1CL7H 1EIBA 1KBBA 1RJLB 1VADA 4OZFH 4XBEL 4N0RA 3FRPG 3MREA 4TVPH 2DN7A 1T1YB 4GRWE 2NXZD 5LN8A 4Q0XL 4QJ5B 4LARH 5IP4A 1CF1A 3KL0A 2MJWA 4R5VA 4MX7A 3IRCA 4WWOA 3ABLB 2A73A 3FT2B 4TNWF 2G0KA 3N06B 3QUXA 3FSAA 4MRBA 5ALCH 1P4IH 4NZ8A 3GIZH 3VD9A 3PWUA 3QRGH 4JQXA 1CS6A 1NLDL 4MDIB 3ULSB 1UA7A 3ZHKA 2CMRL 1E4XL 1TQUA 4QT5A 5LGYA 1JRHI 3D2UD 4JDZA 4PP1C 5C7ZA 2O6EA 4P07A 4OF5A 1V3JA 1A7NL 4WU7A 4FA8A 2OZ4H 1Q9KA 2ENPA 4ZX5A 4BUGA 4ZUWB 1IAIM 4NO5B 2IH1A 4PJXB 4D9RE 3VRIB 1IAIL 5T8IA 2EXWC 4ZI8A 2O5XL 1DLFH 2AQTA 3BPCA 5FFLA 5I8EB 4ETYA 4G8IA 1H8NA 1WWBX 1D5RA 2OMBA 3HMXA 2LE9A 2VM4A 3KPPA 4JPVH 5E9DB 5DSCB 1J8HA 3IJSB 4LCIH 3FMGH 1BFOA 3VYPA 1COBA 2X4RA 4N0CC 3OX8A 4S11A 2J6EH 5E2TH 4PS7A 1UEMA 3UYPB 3V4PL 1KENH 4ZOCA 5TH2B 2A73B 4R7XA 4Y19A 2CJTA 2WBJD 3HG1A 3EKCA 4JFVA 1YEJL 4Z7UA 4BKTC 4XI5C 1E4HA 2FQDA 3QRBA 1Y1DA 5KVFE 4ZDHA 3ISYA 1GHFH 3ESNA 3TH3T 4JKNA 4ZZKA 1KLUA 1G7LB 2IJ0C 4R84A 3Q5OA 4C56A 3H42H 1J18A 4BM7A 3IDNB 1YEDB 1GSMA 3MNZB 4JO3H 1KWGA 5D7KE 2QQKL 5CXPA 2EDWA 2PW2B 1NIFA 4P2RD 3UTOA 2YMXH 1UWGH 1FV1A 3MXWH 5IQNA 4RSVA 1HINH 2MPAL 2BP3A 4Y4KC 4X9GA 1VZGA 1MFAH 3CLWA 1QFHA 4PRHB 1U8HB 4RWHA 3VGBA 4M3HA 2WLYA 2XPGA 5IV2A 1U91B 4PR5A 4WFGE 3SDDC 2B59B 1VFAB 3P4OB 4PP1D 3L3IA 4RGMB 4AYFA 3OKLB 1JVOA 3GSWB 4YHIB 1TDQA 3TURA 1T2QL 2K45A 4JDTL 1HYSD 1K6QL 3CLFH 2CMRH 3BIKB 3FU8A 5IVOA 3MRCA 3MA7B 4IDJH 4WDIB 1WDAA 2WZAA 4A6YB 1P4IL 3RVXD 2CDEA 3LZPA 1VGEH 2W9DL 4N8PA 2PTUA 2YKKA 1BLNA 1TJMA 3VFUB 3F7LA 4BDVA 3BPNC 4HLZG 4DGIH 4OD2A 4P2AA 1PLCA 4G6JL 1VB9A 3RFZB 4EVNA 4JAMB 4QR7A 2HWZL 4S10A 4XHQA 5FGCE 3SDCB 4PVLA 4LPVA 1F11B 3CFQA 2F7RA 3D18B 3HRZB 3MNVA 4H26B 4LXFA 5GRUL 4L4TE 3AMKA 3AREB 4DF9A 2IWKA 3GRWH 2BC4B 4NQVA 1E5ZA 4RMTA 4YHYB 1YQVL 4DN3H 3GSNH 3SQOL 3U9PL 2TSBA 2YFOA 1PDKB 3AROA 3EJCA 2ETWA 1YEWA 3H55A 1V10A 2XACC 5DSCA 2IDFA 4X9HA 3D9AL 5DRWA 3HPJB 1N8OE 4PWFA 1QRND 1BECA 3FSVA 3OGOE 5IB2A 5D70L 3MGOA 1C08B 3FF7A 4DP1X 5J4MA 5D7EA 1G1YA 5F3BB 2WVVA 5DJDA 1DSWA 3H9SE 43CAB 5CKGA 1CURA 5JPNC 3OTTA 3UEZA 2J2ZA 3NAAL 1OCZB 2NY4B 1NCBH 2DD8L 3GUFA 1ZA3A 4H2CA 2VLMD 2BP8B 4X9IA 3W9DB 4FKEA 3ZTNL 1SXBA 5DHYA 4N2CA 1I9RL 3K4ZA 4W9HC 4XC1H 3ZQ9A 3WOVA 1LO5A 4QHLB 3D2TA 2G3NA 3OJDA 1HHGA 2QR0B 4LP4A 4YQXH 3TO4D 1BFSA 5EB9A 4DOHE 3AQZA 1XB3A 4GQRA 1VADB 3BO8A 4JFXA 5GS1C 4UTBL 4J3BA 4G8EB 3B2PA 2CCLA 5EUOE 3OR6A 1F4WH 1A6ZA 2DQEH 1ZHNB 4BH8A 3X3FL 1WO2A 2F58L 1BG1A 2NR6A 1WAAE 3MRMA 4JANB 2Z1PA 3RA7H 1GS8A 4Q2ZB 3IS0X 4WO4B 3NJKA 1BXVA 4FTVB 5I8EA 1UA6H 3ZKSD 1DVFC 3V7AE 4FZEL 1L9QA 5DMGD 3T0EA 5LDUA 4XP9L 1G7MA 1MY7A 1LO2L 5LQBL 2NZ1A 1LEGB 3QUMH 2XV6B 4FYQA 1T22B 3NJMA 1BJ8A 3UZEA 3D3VA 4P2OC 1N12A 1SN0A 3CZSA 4AEHH 5HDBF 2IFFL 1N0LA 4HYTB 1B90A 3QUHA 4K9EC 2VZ1A 4AQ8C 1OHQA 3TV8A 2AK4E 5B3JE 1ODUA 5KVDL 1NC4B 4TPRL 4RA3A 4KUZL 4P59H 3BKJH 1Q72L 2NXZB 3QNXA 2WLJA 4AVIA 4ZFOB 3LQZA 1DBAL 2G30A 3BWUF 4ZS6D 2WXNA 3EG9B 1BBDL 4LLVA 5I1LA 3QFJA 1WP6A 2FUQA 5MHSD 2CR6A 3T0VA 5FV1L 1OTTC 4FLSA 2YPLA 3KPMA 3QWNA 4OLYH 2YIHA 3BX7C 1OW0A 3HC3L 4M02A 4M6AA 1NA8A 2AVGA 1Z3GH 5DEZA 3O3UN 1GKEA 4G8AC 4P23D 2OI9B 3FFCA 5FYKE 1ZLUH 1U3HD 1HH6A 4LF3A 5D1ZB 4PV8B 5I8CB 2WSKA 3WIFB 1QLRA 4JN1L 4POUB 1T7VA 4KZDL 1N68A 4MXQC 1OCRB 4KTEH 1WISA 3WNPA 5B21A 4NRZA 3JVGC 4U6VL 4P9ML 4ZFOL 1ITCA 2N0MA 1AXIB 1P4LA 1LYQA 3KEDA 4UOQA 3ALXA 4P2YA 3RDTA 3W11C 4XGZB 1C16B 4XX1E 1OAZH 3E8UH 4FLHA 4MMZC 2YD5A 4LVOB 1EV2E 1W72A 1I7RA 2V37A 1NGWB 5F7KC 4X8JB 4XN4A 2R56L 4E42B 3ZX1A 1DDTA 1R33A 1BWMA 4JHBA 3EH4B 5DS8A 2HT2C 1U92A 3VG0H 3QEUB 3GWJA 4YHLH 4OUUB 5GQBA 4DW2L 4PCKA 4QRUA 3VD1A 2Y23A 1HN1A 3BAEL 2XZQH 4R2GC 3RWGA 1LL1A 1ET7A 4GSDH 3FQ2A 32C2B 1ZT7B 1EFXA 5J3HC 2BHFA 2HN7A 3ABZA 4PREA 3GBNH 3K2KA 1OOAA 4X6EA 5KYWB 3V0VB 2GBVA 3ARSA 2DYPA 2VMDA 3C12A 4JRWA 2WY3B 2QQNH 3C60B 1BZEA 5AUMB 4NM8H 1AQDA 2A74C 2GK0A 3ZZ1A 2X7LB 3RE0A 1WHOA 1KPVB 1G5AA 1LP9E 3QAZC 4NRYA 4XPAL 5DO2C 2FHFA 3P4MB 4MJ6A 4UNIA 1GKOA 4JKLA 4WI8A 5EC1A 3C6SA 2D4FA 4Y1AB 1HZHH 1SYVA 5TE6H 1I8LC 2VO5A 2JKXA 3DRQA 5DMKA 2HX9A 2QVTA 5SWZB 2PCYA 3VXSE 1NCCL 4M48L 1D5ZB 4LLAA 4NERA 4X6DE 5DK0B 1D7FA 3C5ZC 3N43B 5ICYB 3WTWA 4PWHA 5AAMC 1ITBB 1GGYA 4H1LG 3US1A 4ZPTB 1CC3A 3BSGA 4YE4L 4WI6A 1Y6MR 5T5NF 3ZZQA 2Y2TA 3HI1A 1CFQB 4ELKB 1G6RB 1KGCD 2WNWA 3SDYL 2ED8A 3RWGB 2VDPL 3GRBA 2J6EA 4TULL 1WFTA 2FLMA 5EU6E 1D5XA 3L4YA 3TV3L 3FT9A 1CFVL 2BSEA 2NXYC 4UCFA 3L4VA 1KELL 1XGQB 5IWLA 4L2YA 2NX5B 4IBSA 5HJGA 3S3SA 1DVQA 2C7UB 2BNQA 5F89B 5T3XL 2HFGH 4KVNH 4NQUA 2UXVA 3FFDA 4IDLA 4YLBA 3RA7L 4PHXA 3WKNA 1KJ2H 1CDYA 3RGVD 2YN5A 3VD3A 4HC1A 3V6OE 5IROD 3SZ6A 4CL7A 4GUPB 1H6TA 1UWXK 3LZFH 4GMTH 5F9JA 4UYQA 2D0GA 1YEFL 2A6IA 3J27A 3L4TA 1OHZA 1MI5A 1CD1A 1CYXA 2ZX9A 1NAMB 3EO1B 3K46A 3O6LL 1DJSA 3B2UC 5D9SA 4APQC 4HPOH 4TUJA 3MUHL 4F93B 4TSAH 4X5LA 4XWGH 4P2QE 4PI0A 5EOQH 1EZUA 2EE6A 1FVCA 4WF7A 1TQBC 2OA9A 1LEIB 5GPRA 2YR3A 3NJFA 1F6LL 4E9TA 3L3HA 2Z31D 2VDLH 1J88A 2Z0BA 3WXWH 5I8OH 1V05A 1ZV9A 3UAFA 2R27A 4PWEA 2CUAA 2ZUWA 3D0VB 5IT2H 4H25B 1KEMH 3QXAB 2FO4A 2HP4A 3GFUA 4M6ML 4PJGA 4ZPVA 3OKDB 4JLRB 4PJIB 4H2AA 5CCKH 2J20A 2FIRT 1DUYB 1DJWA 2BC4A 5CHNB 1JGEB 1IC4H 4LRNH 3DVFA 3U0TB 2VRKA 2NW2A 2YD0A 3LN5A 4HWZB 2CO6B 4XB7A 1UGNA 3ELAT 3EXLA 1JPFB 4ZODA 1NFDF 3AW5A 4YK4C 4M5ZH 2F74A 3RKDC 1YJDL 1AR1D 4DCQA 3Q6FA 4NQEE 4L48A 4NQDD 2GKIA 1RZ7L 5FX3A 2F61A 1XGRA 3JV0A 4K5PA 5JW5A 4FXKA 4M8VA 3T2LA 4HKZA 4KI1A 3QORC 4PTTA 3SO5A 2AJVH 4N8VB 4WV1B 2NNRA 1Q0XL 4NZUL 3EFFB 1HL8A 4LGRB 4X2UA 1PFCA 2Y4SA 4AZ8A 5KBLA 4ZW7A 3QO0A 4YR6A 1WIPA 2QVIA 3CH1B 1X5XA 3RL1A 3IDYC 4HZ1A 1T6VN 4BZ1A 3PHSA 4APQD 1WH0A 2LHAA 3DBSA 2ZSWB 4LOUD 4H40A 1GVIA 4P99A 3RTQC 3TIEB 2J71A 4Y89A 2IXQB 3V0GA 3SE6A 6PAZA 2XQBH 3HZYB 1L5GB 2VR7A 1ZDSA 1T83A 5HHQB 3IDXH 4DPRA 3GLEA 1U8IA 3BE1H 1TQTA 2DQIL 4EIGB 5AOZA 5LBSA 4FADA 1VGKB 2ZWKA 3L1FA 1WJ3A 1A6TA 5GRYA 1I1FA 3S96A 5KSBB 3VXRE 3DURA 2PR9A 4XPTH 1FC2D 4I18C 5I1IL 1D7DA 4XOBA 5T5FH 2P8LB 3VFPB 4Z3IA 3QUYB 1IC0A 1S78D 4AGOA 1N7MH 1FORH 2VTFA 4FD0A 1FO0A 1ZLVK 3T4AB 3W9DA 4D9QD 5FR3A 4B9JA 1K4CB 4NJ9H 3WS6C 3DETD 1KEGH 1FNFA 2V33A 4G8IB 4IBTA 2XI9A 4YSOA 3N85H 2DH3A 2H0JA 2AGJH 1H9DA 1JCVA 2B2XL 4L1HA 3PWPE 1MLBB 2DLTA 2ZYHA 4O4YL 5ILTL 2ESVA 3C6LB 4UZSA 2Z65C 3GYRA 4LLYB 4AY0A 4GAJH 1EZLA 5IB4A 4I18A 2Y1ZA 4UQAA 4XMLL 2LU5A 2YXVA 1AQKH 1YNLH 3NCWA 3ELQA 2W0KA 2JFCA 4UT7L 4GW5A 4KROB 2L04A 4WO4A 4G9FE 3IDYB 3MV9B 3VRLE 4L37B 5T1DL 2K78A 3CDGB 3B3IA 4L1DA 4F33B 6FABH 4OZHA 5IW6B 2NY0C 1Z5HA 1FL6B 3CFUA 3DROA 3PRZA 1IGJB 3ES6A 2BIIA 3PY9A 4DK6A 1XF2A 4OCLC 4PJ6A 2WQSA 4MX7B 5I1JH 4UTCA 3SKNB 4ZZFA 1GXEA 5IHLB 2NYKA 4K94C 3J07A 4Q74A 2AV7B 5AVSB 5C6TH 2B8OT 1D5MB 4Q6KA 3X12A 4JZJC 1G6VK 1XBDA 4GXUN 3A22A 4LLDB 4WO0A 3X11B 2H0PA 2JQZA 4W68A 3ARDC 5KYUA 3SJVA 1AKPA 2NTFB 4PJ5A 4ORZC 1MHCB 2WD0A 5AZ2H 3HG0A 4HAFA 4KK8D 4A7GA 3GKZA 3UBXA 3R4DA 1AS7A 1M7XA 3TU6A 2B3IA 4AGNA 3LD8C 3VVVA 1EK3A 5I0ZA 3LIZH 5TQ2H 1S7RB 4XNUH 4FLQA 3GXIA 5MI0B 4BSWB 2I9LB 1F3JA 5FO9A 1V8HA 4PEEA 5ECGA 4PRPE 5SWSD 2FTAA 4ZW5A 1R17A 4M7JL 5D7JD 3VU2A 5DZ9A 2OMYB 5JIHA 2PYEE 4UNVA 3U2SA 4XO9A 4BA8A 1FG2B 3FT1A 3HB3B 1WVZA 5HGAA 4JFFD 1SN2A 5DUMH 2IG2H 5JQIB 5AFAA 2DBJA 2R2EA 5C09B 1KGUA 1SHSA 1TU2B 1BFTA 2X4NA 5TDOA 1MFEL 3S8FB 4JFTA 5E94B 2CWRA 4FE9A 5JHLA 2WZ6A 4P2OA 2MOGA 4R4FL 2ICEA 1RJYA 4PJIA 1B2WH 2C9QA 3G6JF 1HNYA 4I2XE 4O2CB 4F7CB 2I69A 5HHOE 3B9KA 3QI9B 4GIAA 3TZVC 1DJGA 2CR0A 4JJHA 5TF1L 1AR2A 2W9EH 1RUQL 3DIDA 4MJIB 5JNYA 1PIGA 1VDGA 4G8FB 4BKLB 1DQTA 1MCBA 4TNWK 3L3GA 4CVXA 3C2AL 1CGSL 2Q3XA 2J1ZA 5CEXB 5FHAL 5AALA 4L8DA 2BNRE 2Q8BH 4C8XA 3OXRA 4H0HB 1OAUL 5L8JB 4JFPA 1QKZL 1FLRL 1NJ9B 5HPMB 1YYCA 1RU9H 4N22A 4PLKC 4PJ7B 3U0PB 2YK1H 3VGFA 4F1ZA 1AQHA 3AABA 1EAPB 4GUPA 2VN7A 5E8OB 2DY2A 1RIVH 3BEWA 2DW5A 3CZKA 4NKDA 5GRVK 1MVUA 4FFVD 5I82A 2H6UA 4QHKI 4H8QA 1E27A 3K0WA 3QUYA 3Q2NA 1IAOB 3QSKB 2NY1D 5E6RB 4XP5L 1A6ZB 1KN4L 2M2DA 3DMMD 3DURB 4ZO6A 3W9EA 2GHZA 2X70A 3DOSB 4UQDA 5GZNC 3TBBA 3WIIL 2WPGA 2YRBA 3VJ6B 2QSTA 4JRXE 3ECQA 4AW7A 1BF5A 2YSTA 5T1KA 1WBYB 3MYJA 3QFDA 1PPIA 2XY1A 2CA3A 3O2WH 3LOWA 1NDTA 3T8VA 1Z32X 3WNOA 4AX3A 3I9IA 1XGTA 4BFKA 5C9JB 1KXTB 2FLRT 4N5UA 1QI3A 4E5XA 4B96A 3CUPB 3ZE0E 2VZVA 1SN5A 4UILL 1TQBB 1FFOB 4ZPTA 3K6SB 1RK0A 4ONGH 3QPQC 3NSDA 2FCBA 4PJ7A 2E7DA 1GRWA 3OB0H 2XV0A 2IGFL 3ZDWA 5ENWB 4WUUB 4P9HL 5SWZD 3TN0D 2HX8A 4DUWA 2Q6WB 5CO1A 2AMUA 4EXPX 2VDKL 3N5AA 4AIXA 3D9AH 3TIDB 5BO0D 4YBLC 4RGNC 5CJXA 3KLHC 1T89C 2CLVB 2W65B 2ZKYA 5ANME 4CVUA 4O9HH 3L4UA 5LCVA 3T3MF 3VSQA 4PJAF 1DO6A 3L3JA 3Q3GB 3LYRA 4HUMB 3FCUB 5CINL 1IIKA 5KYWA 2BRQA 2H1LM 4IU3A 4U3SB 4KZ0A 3C8HA 1YQVH 2YEQA 5AYTA 5GS0D 2YOCA 3UP6A 5DVKA 4Z18A 5IQ9B 3WN5C 5L2KA 3LNGA 1C8QA 2FR4A 1NIAA 1CLZL 3PV6B 4JFYB 3CN4A 2YHGA 5HYEA 2VLJD 4RQQB 2DRUA 3F58L 4IM8A 3TM6A 1SY6L 1K8DA 3GSUA 4IKNA 5E1AB 5KYYB 2FRGP 3BEVA 4P3DA 2WNGA 1JPST 1MAML 3ASOB 5EF0A 1TZAA 3Q01A 1RH8A 3HNSH 3MO1A 4IKIA 1A8JH 2P7TB 1OE3A 1J8RA 2OP4L 4E5XG 1NFKA 2XKUA 3JWDC 3V9CA 4NBXB 2EYRB 4PY7A 5C0AD 4AEEA 2FAUA 5BV7H 5I73C 3GUTA 4MJHA 4OCYH 3QAZB 1SVBA 4Z3FA 3VXSA 3BHBA 5A16B 1AAJA 3QPQD 4ADGA 2MPAH 4FJZA 1IEAA 2BJML 3CZEA 4UOZA 2OR7A 4OKDA 2E0PA 1PZBA 1IGIL 4MYPA 4PRBA 1BGXH 1KF9B 1RULL 4C83A 1CDHA 5IFHH 2EDFA 2GABA 2QBWA 4WTXA 1G9EA 4HIHB 2HKHL 2EIZB 5ES4B 1D5MA 5HP5A 4YPGA 4BSVA 1KLUB 5F96L 1ES0A 4HIJB 1G7JB 2DBLH 2YGNA 1F42A 4ELKA 4OUOA 2F53E 2OTWA 2PR4L 4PW3A 5FKAB 1XF3A 3X14B 4X5QA 1KYAA 5DZAA 2R0ZL 1ZD6A 2EAEA 3MV7E 3T5WA 2HLAB 4Y1AE 5HHNA 2DQFA 4TRPL 2R56H 3RWJA 2AEOA 3CZUB 4JVUA 2XXMB 4G7QB 5FCUL 2QQLL 4RMVA 5DR5L 1VKXA 5B8CA 1NBQA 2IF7A 4MA3A 2MKLC 1WQVT 1ORSA 1BVZA 4EN3D 3G08B 2OQJA 2W9LA 1Q72H 3BUDA 3SDAA 1TMQA 5AWNL 2P28B 4YNYB 3QCVH 4FL4B 5F3HB 2HH0H 2GJ6B 3HNTH 2ADIA 1EHKB 3TO2B 3F05A 4AEHL 1G0XA 2MOVA 1LEKB 3VFGL 3OMAB 4GKSA 4LIQH 2D7PA 3FFCE 4WCYL 4EOWH 2YFNA 1ZLWH 1N6QL 4C56D 3V79C 4LO9A 5K69A 1KLFB 2WJ7A 4N85A 1GL4B 3I02A 2NXZC 3MRRB 3QIBA 4K94L 4IMLA 4AQAA 4FFWC 1NC4D 2C4FT 2MEJB 3H56A 1LNUA 1AGBB 5I23A 2QJDA 3MODH 4I4WA 5JIQA 3V7AG 3OKOB 4OGYH 2WTOA 2ZX6A 3Q8BA 3PP3K 4U0QB 3H6AA 4L2LA 4YAQA 1AIFA 1FNGA 1ICTA 1KZYA 1IFGA 2C9SA 4PB9L 1HE7A 1X4YA 2ED6A 4P9HH 5I0XA 4JB9H 2DMGA 2NZ9D 2OX5A 2I85A 2ARJA 4HCRA 2QADD 1ZTXH 5C2BH 5KZCB 2XG5B 3FOMA 2BZCA 4PTUA 3KPOB 4LCWE 1J9SA 5IF0B 1A3LL 1VCAA 4HKZB 3RZWA 4W4OC 3L3GB 4YHLL 1F4XH 4K3EL 1N5YL 1KEML 1JFQL 1PL3A 1N5YH 4EQ2A 2J21A 5EO1A 4C58B 3MV7B 2W81C 1MRDH 3IXTA 1CWVA 4C55A 5HJBA 2JLLA 1AD0B 4Z95L 3S5YA 4ORGB 1E9QA 2IFFH 3S4SG 4OZGE 4U1IB 1AHWB 3K91A 4P5TC 2XIBA 2P48B 1TCRA 5HHVH 1CBVL 1S7WA 3ZYOA 1O6VA 4JRXA 2FR4B 5EZJB 4HX1B 2VZOA 1NCTA 1MFBH 4BWTA 4FQLL 5C0RL 1QFUH 2LTQB 3RX9A 3AS0A 4NFCA 3FT4B 1N6QH 4JRYB 4LRIC 5HHXL 3KJ4C 3B2MA 3T3PB 3RDTB 2WCSA 1KV7A 2V9QA 3TBCA 4ACTA 2W88A 3KCPA 4OFKA 4A2EA 2Z1KA 5ADPH 4N6RB 2BVOB 3QORA 3QYMA 1MCSA 2FJGB 1S7RA 4KKBC 1CXEA 2PPAA 2X2IA 3OGCB 3OKMB 2J1KA 4FTVE 3FCTA 4PRHA 4Z7VE 1QBLH 4NS0A 3ZKNC 3O11B 3H7LA 1KB5B 4D8PA 1RUKH 4WW2F 2MNJB 3B6SA 1PLBA 2QADC 4LGSB 2YRPA 3RY6A 3C5JB 3OJ2C 3S35H 2WXRA 5IHWA 2VDMH 4PFEA 3U1QA 3GS0A 5FKPB 1K8DB 2EEFA 4IMLB 4YZWA 4X4XB 2HFTA 5F9AC 4DP6X 2AXGA 1FVEA 1O5PA 3OB8A 2OSLA 4PU2A 5F7NC 3CC5B 4U1NA 1MCKA 2WLMA 4HALA 4KK9C 3DROB 2Y3AA 3JVFC 4PV9B 4XPFH 3OX8B 4XP9H 4HUWA 2O4EA 4NM8L 1XCQA 2DL9A 3UX9B 5TDNA 2X4TB 2Z34A 1I1AA 4YC2C 3VMPA 2D3VA 2CO2A 3S3DB 3V2AR 4LQFH 2ENSA 1EJ6A 1JV5B 1FZMA 2AAVA 2VN6A 2ATAA 1ZGLA 4I9XA 4G43A 1QNZL 4AL8H 5TQ0L 4ZTEA 3WS3B 2KUTA 3MYZA 5H35B 5JYLA 2EXSA 1A4JA 2X7LA 2IGTA 5GJTH 2OKMA 4P4KD 2OZNA 4IIQB 1ZHKB 3MGTA 3P02A 3TFBA 3QBTB 2DJMA 1UWYA 3B7UX 4GH7B 5E51A 4MJIA 2WAQA 4WCYH 5KYNA 4M1CC 2W60A 3V6ZB 1T03H 1I1CA 3M1BB 1FORL 4XCFH 4XPGH 3RKPA 5IG7B 2GJJA 4JL1A 4WWKC 5A1AA 1JYWA 4HGWA 3AS1A 3ZE0B 2ZCKH 1INQB 3KPQB 1SXNA 5FGCB 3IT8D 4LVHB 4O51B 4X6CB 5J1AA 1R5IA 3N42B 4QHLA 1SY6A 1JDDA 2B20A 1XR8A 3D69B 1RFDH 3D52A 2R2EB 3NZSA 3TA3B 1DE4A 4AC2A 2XTLA 5AVTB 1ZK9A 2XQBL 4POZD 3MRNA 4H88L 2ZOLB 3JT2A 5E2WH 5JXAL 2DH2A 1GYCA 3MJ6A 1PLAA 3JYCA 3CVHH 4ABUA 4D9LH 3L9RA 1ED3B 3P4NA 3UL4A 1HSBB 1KYUA 1GAFL 2N56A 3ZE2B 4AQOA 2FVNA 4M7LH 2ID5A 1VFAA 3P4OA 4NJAL 4G5ZL 1UJ3B 3LH2H 1SOXA 2WAHA 2NNXA 3K6OA 4TLKA 3ZO9A 4E9VA 2BIQA 1QW8A 3NCXA 2WQWA 4LBEA 1P4BH 3ILQD 3LMJH 4LKCA 5D2NB 4LNRA 4GRWB 3LKSA 4FQQA 3ZL2A 1ZA6B 5J12C 2XDHA 3W56A 1PZ5A 2CBTA 1M6OA 4WV1C 5C08A 2OMZA 2F2HA 3WU1A 5HI3D 3MU3A 4M5YH 3ROLB 1S3KH 1RUPH 2BW4A 1YCSA 2EKJA 2Y5EA 1IIIA 4QTFA 4XP6L 1WD8A 3HE7A 5LGHH 4AE0A 3ZRSA 1KPUA 5LXGL 4QOKD 2AQ2A 4X7DC 4NQVB 4PG9A 1OAKL 3DX4A 1KZQA 2JB6B 4LSUH 3PF2A 1B4RA 3RVWD 1ZTXE 3CFKA 3OXSA 4KXBA 3UJIH 1XF4A 3PV6A 3QRFM 2Y7QB 3BESR 1DVTA 3IVKA 4ZFOA 2ZUSA 4YHMH 1N5AA 4JFHD 1DN2A 3RPKA 4IK6A 3WFZA 5I74B 1WF5A 3F85A 1FP5A 2FX8H 2ROYA 2E7LC 3QNZB 4DGVL 1FWXA 5B38G 2DQJH 4NZJA 2JCCF 3F83A 2Z93A 2OTUB 4G71B 1R3HB 3E1F1 4WWNA 1A02N 1EXHA 3NACL 3I84A 5E8EA 1ET5A 3VH8A 4LEBA 1KV3A 1W0VB 2BIOA 5E1QA 1GC1C 4UAHA 2F19L 3HAEG 4K7PH 5HDWA 1OGAA 2C8NA 4HEMA 3MBXH 1RIVL 3F12A 4QHNB 1IBFA 4YEFA 1CL7I 4PGCB 1NBZB 3SZKC 5JO5B 4LCIL 4NHCH 5C8JB 2E27H 1UQSB 1FQ9C 1RZKL 1UADC 2VWEE 3FKUS 2Z91B 3TVMB 4PJCB 3SY0B 2C9AA 3SGKA 4XO5A 4MFHA 5KBPA 1C5BL 3LY6A 1QSEA 3OSKA 5KYUB 4TNEA 1HJCA 1BQHB 1QHPA 4WAFA 4NWUH 2J25A 4E5XB 4G8EA 2BOBB 4NLHA 4ZO7A 3MBED 3RX7A 1XGUB 3IGUA 4CA4A 2MHAA 2XZZA 3BSZA 5BQ7A 1MFAL 4X6CA 4RX4A 5JIDA 4Z7UB 2WMPA 5C0JA 2XU9A 4OKVB 4PJHA 2P24A 2WV3A 3NFPB 5FKPA 1UWGL 5CGBA 5DFVC 2R1YA 1KJVA 4PJ5E 2YBRB 5BUGA 4GSQA 3ARGC 2XYCA 5DFAA 5TD4A 1CGWA 3LZLA 3S36H 1D3CA 3FS9A 5LXGH 3TO2A 4M4PA 5DJCA 4AK1A 4F8LA 5T5NG 3HN8A 4JRYE 3ZK0A 2MTPA 3QG6B 1JTTA 4MA8L 5T1KD 5FGSA 4G72B 3OKMA 1THCA 3F7PC 4KRPC 1QO3A 3ARGB 3AG3B 1SHXA 4MNQB 2HFFA 3ABGA 3QDHA 4IBVA 2MCG1 5B8CB 4G6FB 3TXAA 5EORL 5AW6B 5KBDA 3QIWC 4M43L 4DGVH 4XPAH 2NUTB 2XX1A 3WJJC 1LJMA 1KTRL 1YC7A 1IC7L 3MJ8B 4G6JH 3QI9C 4K71B 3TZVB 5KUKA 1MFCH 3HZMA 4TQIA 4J27A 5EOTA 4GG6A 4N9GB 3X14A 2VN3A 4R0LB 3WFBL 2LV4A 2OW6A 2ZWNA 3IMBA 2BFVH 5DQDH 1PEZA 1H6FA 4HPHA 3FQXA 3F65A 4PV9A 3TA4D 1NOFA 3MPCA 3PDOA 2H32A 5AWNH 2J6EL 3L17A 4FEIA 5F1NA 2RTTA 3PQYD 3V4PH 2QKSA 4Z7OB 1IM9A 3FQWB 1A7NH 4G6KL 4QHMA 3PJSB 4HKJB 2OYKA 3RGVB 1T7XA 3UOAB 5I1CL 2NDFA 3KAAA 4GBXD 4NQSB 4Y8AA 2WK2A 2VMCA 1NCNA 5L88L 5DZPA 1O5DT 1JGLH 3VXRA 5SV4A 1D6VL 4P5SA 1BMWA 4R4BA 1UC6A 2ED7A 3CXDH 4G5ZH 2IV8A 1F86A 4YFDB 2AAAA 1NPUA 2ZX7A 4LVOC 2H8PA 1DHKA 1T5KA 2XPYA 3ATBA 1OAYH 2A1WH 5C0ND 3I3DA 4RCAA 5DVNA 4AIZA 1KB5L 5HYQA 2AC0A 3B9VA 3MRLA 4NUGH 4U7SA 5D96B 4UV4L 3PLYA 1ACZA 4NUGL 3SDXA 5JIMA 2XT1B 3HPLA 2FYYB 5AVQB 3GT6A 3T65B 3FFCB 5IFAL 3OAUH 2BSRB 5JHDD 1PCSA 3KWTA 5AB0A 4JO2H 5CMAA 2ORBH 3UFIA 4OI8A 3X12B 2J4WH 4P2RA 1PJ9A 2KI6A 3GSUB 3Q5TA 1CICA 4TVPD 4G2AA 4IU2B 1SGKA 1XSOA 5E99H 3N6YA 5J6HA 3T0DA 1Q0YH 3FFCD 4BIKA 1L9RA 2JKLA 1E90A 2X89D 2QTVA 4ILDA 1TJXA 2A0LC 4OZHB 1CVRA 3KYKL 1G1OA 1WAAF 3PWJA 4RZCA 5EV7A 5F0JB 5CIPH 5HDRA 4YX2H 5C97A 5E4AA 5DHXB 3U48A 2XNAB 3KL3A 1TYJA 4JZNA 2Y1VA 3IKCA 1FVCB 5M94B 5DK0A 3UCQA 1CTMA 4Y7OC 2B77A 3B7RL 1H0DB 3FQTB 3KJ6H 1CG9A 1SYVB 1ZIBA 2XV3A 3B7TA 3Q5YA 2G2NA 3KYOB 4NPYB 4AMKL 5FYLE 3T0EB 4QPEA 1B3JA 1MEXH 2XIIA 3LCYA 4QYOA 1J5DA 3ILPB 5DEGA 2CDFB 2WB7A 1QFOA 3BQUA 1RERA 4OJAA 1HCZA 3QHFH 1OP5K 4PJDF 1A6VH 2DWYA 5H37A 5E5MB 1XB6A 1PX4A 2CQVA 3V0VA 3MMEA 1UG9A 1S5IL 4XB8A 2D9CA 1NINA 4GYBA 4NQDB 4BUHA 2YBRA 3K8KA 3MHZA 4MBOA 5A2LH 1DO5A 3P9WB 5E6ID 4U6XB 3OJVC 4KMTL 1LMIA 1NEUA 5CFHA 4OLUL 4KNUA 1UZ8A 5BO1L 4TVUA 1QHOA 2Z4QA 2J8UB 2R1XA 1PZUB 4UBDD 4ZG1A 5C0CE 3O4OC 3RTQB 5F6IB 4GMSH 1PAMA 3LEYL 4OFYD 2JKNA 1AGEB 3JTTB 4Z0BL 2XWTA 1LEKA 2K70A 4C4KO 2ZKWA 5F0LB 1AKJA 4AEFA 1AC0A 5H4YA 5CIPA 1QABA 4UILH 4CU7A 1NL0H 4P23A 2IQAB 3VRLF 3KGUA 5KANI 2DJUA 5TE7H 3KPTA 4CN6A 1LO2H 1H3GA 3U0PA 3K2UL 2PXYD 4PGCA 4XWOC 3SCMB 2NY3C 2YMXL 4Y2NA 4X8GA 4AIZB 5A43C 2XN9A 4OCXH 3VXSB 5F93C 3LXBA 5DUML 1QW9A 5FUZH 1E28B 3BKCL 3F7YA 1WA2X 5BMFL 5DD3L 1D2PA 4JR9H 3VYNA 1HL9A 4FQXC 2FL5B 4MSWA 4CW1A 5E8EB 4N1HB 2AFNA 4X7EC 4K23H 3QZWB 2DKSA 3VXTA 2M1KA 4YZFE 5HHVL 4GQ9L 5LBVA 4HK0B 2CO6A 4FQHB 5I19L 4JG5A 3TJEH 3KH4A 4Z7NF 4P2OB 2XJKA 4R7LA 3T0AA 4N3TA 2AQ1A 4A7TA 3RNQA 5IREA 4LDOB 2HFEB 3B56A 3NJXA 2WUCL 3HG1D 3DX3A 3HC3H 1R3KB 3O8XB 3T0ED 4AGLA 3GI8H 5AKVA 5FB8B 3BP5B 3KDMA 4XCFL 1FI8C 1KPUB 2J8HA 3BFWA 4QEGA 3WLBB 2C5DC 2J3SA 1DSFL 1F6AA 4JY5L 5C86A 1DL7L 5EBGA 2Z7ZA 2XN2A 3I50H 4GG8A 1G6RH 3DJTA 4I5BA 1DVYA 2VDQL 2VQ4A 1L6ZA 2NSXA 1J87A 2EH8H 5EN3A 3P30L 2BFGA 1BM7A 1YLBB 3OZLA 1U3JA 1A1OB 5CEYB 3V0WL 3V4PA 3FRPA 2X4OA 4YOKA 4ETQA 4KZDH 2HT4D 1QPPA 2IIJA 2HYMA 3EFDH 4N20A 1AE6H 1SBSH 4X80H 4KTGA 2A3TA 4QRAA 1IE4A 1EXUB 4RZKA 5DJXB 1KNOB 1JF6A 4RLDA 4DKFH 5KSAB 3QXDB 4U6HA 4L8CA 3GHBL 1L9SA 3QULA 4KITB 1UXWA 4CVWA 4MRCA 5GGQH 3CHPA 3Q06A 3PIQB 4R26L 3ZRFC 2ZG1A 1U2YA 2CH8A 3V0DA 1FHGA 2VSMB 2WMPB 5C0JB 1SJXA 4KJPD 4L4VA 1WZKA 3CHXA 4Y2OA 1IGFL 4U05A 5BOJA 2G60L 3DJZA 3ARDA 1LO5B 3OAYH 1NCWL 1KBVA 2OJEB 4NUPA 3APCA 5KWYC 2B16A 1FL6A 3BGAA 3EO0B 5B1KA 5ICUA 4UNTA 2Q7YA 3TBTB 3P3TA 4P49A 5IJCC 4YSSA 4LEEA 3VG0L 3O0LA 2PLTA 5E5MA 1E2WA 5I18L 1XL4A 4CAGA 3PWNA 5IHHA 3T0EC 1CK0L 3ZL4L 2R9HC 3BXNA 3ML8A 4PRDB 3SBWA 1L7IL 4R7DA 3DX1A 3VRIA 4I2XB 2EDDA 3U46B 1TZGL 1PZ2A 3IBEA 1G7MB 2JKTM 4P0DA 2NY4D 4JG0H 5GSRB 2GCYA 3NESA 3K8MA 3VWJC 3RWJB 4E9RA 1HZHL 1U8MB 4Y2DB 4M93B 5E2UH 4AOFA 1BQ5A 3GMRB 1NDGA 4FJYA 1JV2B 1V27A 2FB4H 5DJCB 3V95A 1XF1A 2J1XA 2IPTH 5CCHE 3VFNB 3FN0H 2P8MB 3LKPB 4ES8A 3BGFC 3ENEA 3TN0B 3U4EA 2NY0D 1I85A 4L4VD 2DMCA 1L4IA 5ITFA 3FQUA 3MODL 2WWMD 2H3NB 3O9WC 2OSLB 4KTEL 3CMOH 1S8DB 1G7JA 1Z7JA 5DHVA 4XNZC 1KCUL 5KN5B 1JPSL 2IH8A 4QRSB 4DKFL 4JFFE 4JL2A 1O7DE 3HR5A 4MQ7B 4CVZB 3EADA 4IJ3C 2OZ4A 5AQ0A 3PHQB 1AE6L 4X80L 5EUOA 3AU1B 3GLZA 5GGQL 4U6HB 4QDGA 1QVOB 3ZDYB 4LMQI 2Z91A 3QDJD 4U1SA 2XFGB 1HOCA 1TLMA 4P8QA 4LMQE 5CN2A 2Q8AL 3O3EA 4HJ1A 2OYMA 3O0RH 1E67A 3QW9A 2NUPB 4LP8A 4H0GA 2ADGB 2F53D 3NA9H 3QFGA 1VLXA 3EYUH 2XZCH 4TLUA 1A1OA 4X0KA 3ULVF 2EIDA 4R97B 4X4YA 2H2SC 3B9KD 4NAMA 3IFOA 3C6EA 1U3HB 1PMYA 1U8JB 2HLFD 2VZUA 3W2DL 1JUFA 1HYRC 4FQCL 4IRJD 4CVXB 3CN3A 3N1PC 4KKRA 4RFNB 1MZZA 4K9JA 1WAEA 2NY4C 3BSHA 1HCYA 2VR5A 5IMLA 4KBPA 1DR9A 1O7DC 2NR6C 4TSAL 5K59E 3TF4A 3DK2A 1U8QB 1RJYB 1NAMH 1N2RB 2G3XA 4MXWL 1OB1B 4QKTA 5TE4L 4FQLH 4XBEH 3E7JA 3BZFB 2K7PA 2WZ0A 5F1NB 1CGUA 5CZRA 4FGMA 4J4PC 3TH2T 2PXYA 2ZCLH 3ZMEA 2LLLA 3QXAA 4I88A 1ZXKA 2WKOF 3CDZB 2Q7NA 3K4AA 1CBVH 1E6JL 1CT8B 1JD9A 1N8ZA 2C3VA 2HX7A 1TVBA 3N9GH 1YY8B 2H7WA 4XB3A 3ECBA 4GG6B 1J5IA 5SX5H 1G0DA 1HEJC 4WSJA 3TYFA 2WNKA 3ZMRA 3H2WA 3NIGF 4E41A 5KVGH 3CZNA 2YLHA 1IFHH 3ARXA 4LBEB 5KVEE 3U4KA 4GO6B 3SGEI 2SODB 5BOZG 4Z7QB 1NIBA 3MNDA 2EDNA 4Y88A 4YVUA 1SOSA 1GC1L 3L8QA 5GGRB 5DK3A 3S5ZA 4DQAA 2QT6A 3JWDL 2BWQA 2X28A 3CHRA 4BFRA 5J06A 1DBAH 4Q6IB 2O1AA 2O5XH 3VFWA 4HJEA 3IFNH 2UZYB 5DMGC 2GBUA 4WTZA 5GJTL 1QLFA 3IU3B 3AU1A 1GOGA 4KI5F 4L4JA 3FYEB 4P2OD 3BLKA 3MKGA 3MLVH 4P3CH 4QXUL 1QBBA 2HG5B 4IIZA 4JCMA 5I5RA 3AS3A 4Y4KB 1E4KC 3RVXC 4P23C 2VERA 3FN3A 3KPQA 3DSNB 3DUSB 3TBVA 3JWOC 3CSTA 2Z92A 2E7BA 1RURH 2XTJD 2EVJA 1YEEL 1CLOL 2HG0A 3VFMA 2AEQH 4YDIL 4AQ1A 1VEOA 1JGUH 4MAUL 4OCRL 3EGDB 4MXQD 3IGLA 4WFGD 2BP8A 2PPFA 1NWPA 5DS1A 3V6FB 1KB9J 1KLGA 4L9DA 5JXEA 2D7QA 1KGYE 4JDEA 4KX8A 1AZUA 2G5BB 4R96A 1DLFL 3MFFA 2OMVA 2DEYX 4NB7A 3WO4C 5JO5A 1S7VB 4YVNA 43CAA 4F2MA 2BHUA 3JSSA 4JO1H 1YEGL 2NSQA 3P73B 1DVSA 3C5XA 3X2QB 4CN4A 3PAYA 4R7DB 4RWYH 3AXHA 5HJDA 1T03L 2YRZA 4ZUVB 3RAJL 5MI0C 4CDGC 2EDHA 1NMCB 4PJIE 4C4BA 3ESMA 2EDRA 1BYOA 2DKUA 4A7QA 1QBML 2XWCA 3QNZA 4H5SB 5PCYA 5EMYA 3RG1C 1KPRA 1BZDA 1PSKL 2VKWA 4JFEA 2ZOOA 4HIQA 4JM2D 3UC2A 1PY9A 3DHJA 5CFAA 2XA8H 4HLEA 3OZ9L 2YD1A 1UT2A 1NFAA 3BGMA 4BSJA 1T1YA 1H15B 3QDGD 3MLXL 1EGJL 1F11A 3ATEA 1QRNE 4XN1A 2DM2A 2XVKA 1PKOA 4ODTL 4MJ2A 2HJKB 4BCZA 3EDKA 1AGFA 4BQ9A 3PPEA 3T08A 3V6BR 5I15H 4Y19D 5F7WC 1JZGA 2NY0B 3L95B 3CBKB 1FRGH 2YXFA 3C5SB 4NCDA 5TQ2L 1ND0B 4U1GC 1I1RA 2ENQA 4FKKA 5D7IF 2G2PA 1JZ8A 4XP5H 1P4UA 3HE7C 2HKAA 4ETQB 1IAMA 1TQWA 3CFBB 3E6HA 4FQ2H 5IVZB 2WKLA 3V4LA 4P4RA 4PGZA 5ISZA 3H4FA 3LRLA 1JGIA 2ADGA 5F8RC 3KWVA 4JFZH 3DYOA 4X4MA 3U30B 1ZHBA 1CB4A 3L9YA 2NY5C 2ZG2A 5GHWL 4G9FB 4F3FA 2GT9B 1G1CA 3KPRA 3G5ZA 1P7QA 3R0MA 1KEGL 2C1OA 2H9GB 2NXYD 4MD0B 3SQRA 1JSYA 1RZGB 4WGKA 3MC0A 4A6YL 1KT2A 2IDSA 2R4SL 4HKJA 4Z7NE 4PJFA 2FQGA 3CBJB 5I1LB 5D5MB 5LB1A 3FQRB 4RGOH 4U1HA 2KZ1B 2K0RA 1MHHA 1K3ZA 1QLEB 1U8OB 2NW3A 4U33A 2JNZA 4PJGB 4ZPVB 1X7SA 3WN6A 2WZ5A 5CLYA 3VXQB 3GLAA 5ESQA 1NC2A 3I3BA 4URTB 1XGPB 3K71B 3ZE1E 3JUYA 3GIZL 4YSAA 1L9MA 1AYRA 1WT5C 3PL6B 3Q6GL 1NOLA 2R83A 4HS8H 4J12A 1GMEA 3DO4A 1IKNC 5KS9F 2NY5L 3EH5B 2V5RA 2YZ8A 3UZVA 3KGTA 4MAYC 3P77A 5JOFB 3O2DL 4G70B 4I3RH 5C0BA 1PKQE 3PXJA 1BXXA 2N7AA 2FECL 2HA1A 4L3AA 1BX2A 1CD8A 1H19A 3WS3A 1HWHB 1FGVL 1X4ZA 3D39B 3QQDB 4HWUA 4Y5YC 5D5MF 4P4KA 4EUPA 2NLJA 4J6IA 2GJPA 3SPIA 1LQBC 1BPLB 1D6VH 1FZKA 2XQYK 4XN7A 3ZTNH 1UFGA 3KPLB 3MRDA 4PJGF 1OSZB 1QP1A 3LNHA 4YDVA 4MHHG 2JMRA 2Q76B 1UTDA 1SJHA 4KO9A 4CADB 5D8JL 4U0RB 1K3IA 3VFSB 2GFBA 1W6LA 3MACH 4AV0A 2FJHA 5GSVB 3EGDA 2R0KH 3ARBA 4IRZL 2CBPA 1B88A 3HUJF 1D9KD 3CDCA 3WY1A 2DMKA 3IDXL 5IUSA 4W4NA 1M1XB 1RD6A 2H1XA 2NX5A 4BA0A 5J6HB 3OQRA 2ITDB 1LNUB 3RWEB 2AJYH 1CJYA 3TNMA 1I1YB 5J6GA 1AFVL 2AQSA 4L1LA 3FK3A 4MDJB 4WWID 3WGUB 1L9TA 2HG5A 5AL0A 1JZ2A 1P6AB 4KK9D 2QQKH 4LSVH 5C0DB 5CAYB 5HYIA 5F7AA 2WINA 1UA6L 4LARL 4HWBH 1F4YH 1UM5L 3EOAA 5LGJB 2R2BA 3CC1A 4GT0A 4P2CG 5EG6C 1K85A 5ACZB 3GI9L 2FYYA 2OMXA 2EXYD 3MJGX 1VPOH 1C16A 1KFAL 1P6WA 4NX0A 3FUDA 5EBWB 4KAQL 2PP9A 4AW4A 3RKDD 1DCEA 1JHLH 1SM3L 4ZXBB 4Q4IA 1L3NA 1J1OH 2E7LA 1OAYL 2A1WL 2PPDA 3O9WA 4BINA 3N1MC 4YQXL 1E5BA 3JWNE 5D71L 1KXVC 1DCLA 1YJDH 1QUNB 1J9RA 3DV4B 5HDQH 1CGYA 3ARED 2CBOA 3SBPA 2VJ0A 3A21A 3E6FA 3N1GC 3PABA 4L3ED 3RPBA 4E41B 3AGVA 1NIEA 3PFQA 4JDTH 4Y16B 4PJBF 4QAMB 3M46A 3PWJB 1BSIA 1BFVL 4ZFGH 4XPTL 5I1IH 1GW0A 1MVFA 1OSEA 1XH0A 5TGBA 5KVMC 2BVPA 1RVFH 2BM3A 1DLHA 1OT1A 3T77B 2HVBA 3BPOC 1ZWIB 4GKOA 5I2IA 3OXSB 3FQRA 4U1HB 5F9DC 4FMVA 1JERA 4F2FA 3UGXA 4OJFH 4H8WH 4EZJA 1G7PA 4B41A 2ZUUA 3O4LA 2ZWYA 3V4UH 3MROA 3NSXA 3DHPA 4MXVE 1P6FA 2WQVA 5DGQA 3EBIA 4WHYG 1G9NC 1HEHC 3QC6X 4HWEH 1KWKA 2F5AL 2CPUA 4NNPH 1WCBA 5SX4I 1MF2H 2V3DA 3JV4A 2PTTB 4EKJA 2H4EA 2DTSA 4FXGC 3F58H 3QQ4A 3N1FC 1TQCB 3LRKA 1EZSA 1A6WH 5ADOH 2HAZA 2VZTA 4XP4H 4KZEH 2A77H 2I26N 2JKJA 4N5EC 3P0GB 4TUJB 3CVHL 3DX6B 1SMAA 2H0FA 2PW1B 3QO1B 4AUJA 4KZEL 2CJUH 3VXPB 4NQXB 4DOHB 1NBCA 1UA3A 2FEDD 4DP2X 1VAHA 2KQNA 4IOSD 2FATL 1UM5H 4BK4A 2V5MA 4K7PY 3UTZB 1I3GL 1W0WA 5KG9A 3QDGA 4AENA 3Q9PA 2UX6A 3QH3B 3BPLC 1CDGA 1P5VB 1X5HA 3MUZ1 4CSSA 2X1PA 3QUKA 2MFNA 2XWTB 3WFDH 3JV5A 1M4KA 5I1DB 1NKOA 3AREC 3ILEA 2IAMA 1YEDA 3MV9D 4N0FB 5FLVA 4NYLB 1MDTA 5DK2B 4M00A 1VFOA 1A22B 4DKTA 3T4YB 3IE4A 4Y1TA 2UXFA 1B0WA 2X1QA 1BP3B 5MEPA 5E7FA 1BVNP 3S6CA 5ESAB 1A25A 3CSGA 2VRQA 4UQ3B 5FOBB 5IW6A 1U6AL 1LO0H 2LVCA 4QRTA 1R1CA 1BFOB 3QQ3A 3MI6A 2UY6B 3UZEC 1A21A 35C8L 5K59F 1FAKT 3TL5A 3MOAH 5JIIA 4NKDB 3BYTA 4JM4H 5CZXC 1ERNA 2CM6A 4PGEA 3FFOA 4ICXA 2GSGB 5FA3B 4OLVH 3FPYA 1QWHA 3ARDD 1YYLL 1JYXA 4IOSA 2EYSA 3P54A 3GXUB 2FDBP 1A6VL 2GG1A 5IBLC 4XH2B 5HVWA 4Y9CA 4OFQA 5KS9E 5HHNB 5AW3B 4W93A 2ZG3A 1MWAL 5FLUA 1WGVA 4AK2A 1MF2L 3L6FA 1IGYA 3ZN6A 3VH8G 1DJZA 2VN4A 4KV5F 5CN3A 1A1NB 2DWXA 2VDRL 4JJOA 1Y18A 4LLQA 4YPJA 2HLEB 1Y1UA 3LJ3A 5EZOL 3WY2A 1OPGL 4P46C 4LOFA 5BW7C 4HS6B 4RMBA 2IWGA 1ZSHA 1U95B 3QUMA 1FCCA 5GRWA 2X12A 4HWNA 4ANVA 2AXGB 1SYSB 2APTA 3HA0A 2VSKB 1ES0B 1HSAA 2EC9T 4ANWA 2R59A 5EIVA 2Y9RT 2PO6A 3BWAB 3PP4H 3MUY1 5MEQB 1NWOA 5IMMA 3VGEA 1W72L 1G7QB 3ARGD 4MNQD 1LQSR 4PJAE 1QBLL 3IPEA 1WGOA 1J1PH 1RZIB 4AEIL 2ZNWA 2J73A 2AI0L 3D09A 1QOKA 5ADPL 1JUFB 1YPZE 4FQQB 1X5MA 5EEUA 4OAWA 4ZMWA 2ZP9A 2J2ZB 1V7NL 1OL0A 1PX8A 3DGGA 4ONHA 5EOQL 3OAUL 4MQSB 1MWOA 2QL1A 2QQQA 2H3XC 2O5YL 3DO7B 1PKQA 1E40A 4UOW1 5KOVC 1KN4H 5IHUL 1CXKA 4F15B 3K1KC 3WHXA 4IOIA 1L0XA 1QLRB 2ZOKB 2CIKA 2WIIB 4KUCF 3QIBD 3NJJA 35C8H 3QFJE 4HF5L 3ALWA 3NCCB 2O5NA 4XBGA 3MSPA 5EWIH 4AIEA 5CM1A 3RVTC 1USZA 2JJSA 3KM2A 3QRLA 5DUPL 5FYLD 3QHTC 1KIRA 2CHXA 2BS71 2J88H 5T3XE 1IC5L 2OMTB 3CTTA 2BVYA 1S7SA 2GTWA 3CWGA 4M4RB 4G59C 3ATAA 2AHIA 5CILL 2IQ9L 4JM2F 3US9A 5GIRB 3CPUA 4LSSH 4YHZH 2AV7A 1MW3A 5EIIB 3UG5A 1JK9B 2YQBA 4HJUA 3UAAA 4M8RA 4Y19B 2B4CL 3QNXB 4LAQL 4ORGA 4XVUD 2Z31A 4PJ9D 4E2OA 1KYOK 1E4XI 4IRSD 2BP5M 5C0EA 2N01B 1RIUH 3FU7B 3TJHC 5E56A 5KBMA 1BQLH 3SOTA 1BJ1J 2VIRA 4IIQA 4JUTA 1YN6A 3B9DA 3DV4A 3BPCB 4IOIB 4F27A 3K72B 1DQLH 4Z7WB 1QA9A 1QWNA 1NKGA 3TGXA 3H9ZA 2MCPH 4UAOB 3ZGHA 1GZHC 3HBZA 3TBWA 4NCC1 4QOKE 2ZT9C 1HDMB 3OAYK 4QRRD 5F88B 4CBPA 4F37F 2LLNA 1QR1B 1I53A 5KSAD 4XVOA 3POHA 1M7IA 2AABH 5HYSG 1T4KB 2YOAA 4YAQB 3D33A 4ERSH 1Z3GL 5JHLH 3KE0A 2F18A 2IAND 4UUJB 4AKQA 4H44C 2YXMA 3EFOA 4N2MA 3NIDB 1RZ7H 2BSED 4BFGA 4UANA 5C9JA 1RFDL 3CC5A 2X9XA 4PRIB 3SYQA 3HE6D 1MNNA 3NK4A 3QJVB 3QFDB 4G9DA 3GXDA 5DWPA 1EAQA 2KZKA 5AB1A 1BMGA 2G75B 1EHXA 3T04D 2EZ0D 1EERB 1TG8A 2BY0A 4ELMB 3S88L 1NL0L 2XTJC 2K7QA 4N0FA 5LUMA 4OI9A 5F7HA 1SBBA 3AG1B 3EGXA 2DQGL 1AKJD 3QWQB 4ZS7L 4Y9FA 2WM0A 1ZANL 3QHZL 3M6DA 3DGDA 3QUZD 1DANU 2VW7A 3PGCA 4WW1B 1ACYL 2FJHB 5GSVA 1XH3A 3BRFA 4ZT1A 1JXKA 3GBMH 4YXHH 1IGYB 1PW3A 5LWYH 5I17A 4AGMA 1MLCA 2RQEA 4Z77B 3R7RA 2EIBA 5IM7B 4M56A 4GRLA 3ALPA 4J8QA 4RWYL 2LLGA 3QFJD 3QQ9D 1QTPA 3VXPA 3LNFA 1TSHA 3QUML 4J8RA 2B5IC 2BVOA 2QFPA 2QSCH 3AACA 3H9YA 3OB0K 3EFFA 2P5EA 4NHUB 3RVVC 3UABA 4JM2A 5DA4A 3QG7L 1CG9B 2KZBA 4KKAD 3U7WH 4I0PD 3U9UB 4QRPA 1AQDB 5BRZB 3BH8B 5F7DB 1OT2A 1SQ2N 4LQFL 5GS2D 3KCWA 2V17H 4JDZB 4F9LA 2ZYSA 4M3JA 2ICCA 3FT4A 1MPAL 5E2VH 4KKLC 4YLQT 1HESA 3K71A 1PJWA 2ZUVA 1FCGA 2C3VB 3BZ4A 3QDMD 5C0GB 5ESQB 4DO5A 1YN7A 3FO2A 4WK4B 5I6OA 1OARL 3GS7A 5I1EH 1RZ8A 2BDNL 3IRPX 4JKKA 3U6RA 1WWCA 1DBBL 2AGJL 5CD5D 3B7SA 2EIJB 1AP2B 1NCAL 2WKGA 5CP7B 1DFXA 5G5DB 1FAIL 2W80C 3WHE0 3LVTA 4O2EA 1VF5C 3SDCA 4GJTB 3OLDA 3TBSB 2BNRD 2XVLA 2P5PA 1DVFD 2DDQL 3ULUC 3NCYP 3WKYA 5D4HA 2OCFD 4GFXA 4U31A 5AOLA 3EJUA 1GS7A 5DLML 2DDQH 2NY2B 5J1TC 3VXTB 2XWXA 1JP5A 1YY9C 2VH5L 3ARVA 1LEIA 1F4AA 3ESUF 1CF8L 3MRPB 3H9HA 1M56B 3PJNA 3R1GL 3CN0A 3OAZK 4OZGF 1M42A 4TVSa 2NY3D 3I9PA 1C7TA 4TQ8A 3V4PB 3FUFA 3VXUA 2V9UA 3WJMA 4GSXA 1NGXA 2LAGB 5BCAA 4ONHB 4D0BB 1N6UA 2CGYA 4ZAKB 1BEYL 1BWWA 4D9LL 1CGTA 5I6PA 1KC5L 2K3TA 4ZS6C 4NJAH 2GK2A 2YPLD 1T7ZA 2DQTL 4AUYA 3C5ZA 4OD1H 8CGTA 1W0YT 1MW1A 1OOWA 3UMTA 3WO4B 6PCYA 2JJUA 4UT6H 1YEFH 1OCOB 4PG2A 3ABKB 1DBKH 4PRPB 5LBGA 3Q8FA 4GSDL 3CQFA 4YXLL 4GRWH 2IPKB 1SEBA 3O6FC 2DQJL 3KNBA 4FQIH 4NQDA 3WYRA 5H94A 1D7CA 1F56A 1XSKA 4WKZB 2A0LD 5DA0B 2R2CA 3G6JA 3U7WL 3VFGH 5MEOB 5FYLL 2XY2A 2Q8BL 1ROWA 3BW9B 3GJEB 4Y16A 2JTYA 3I6SA 4Y5XC 5GRJL 4RMSA 2O6DA 2FJSA 4JKWA 5C08E 1HKLL 4CADA 4R0LC 1IMHC 5IVNA 2FL5A 5HDBE 3V52L 5DJ2A 3ULVC 3FOLA 3BN9D 4PS8A 3X1EA 5MENA 4AVJA 3D51A 2IEPA 3K6IA 1FL3B 2BNQD 5KYXA 4F2MB 3S37H 3QJHA 1X9UA 2DM4A 1IBZA 2NY7L 5L0QB 1DBBH 4GRMA 3GSNB 5GJSL 3ZO0A 1ZEAH 4N2IA 4OLEA 4LAJH 2R23B 3BQVA 3ZYJA 2XQYA 3O2VL 5L4FA 2BXYA 4HJIA 1E8WA 4P5TD 3VXME 1XF3B 4KQ3H 2Y5TA 4RRPA 3PGCB 3QB7C 4UDUA 2HN7B 5GZNA 3CFDA 4ODTH 2I7SA 5CN1A 5EUKA 1OCWH 5C0DA 4KWUA 2IPKA 3NFPA 3QUZB 3T8MA 1ZLWK 4DP4X 1TZHB 5AG9A 5KEZA 1EO8L 2BERA 4HIJA 4KHTL 4N0YL 4FG2A 2X89A 1XMEB 4NYLA 1FYTB 4TSBL 1AZRA 2FJFB 4PRIA 1U92B 2ZXCA 1QQDB 15C8H 4JQXC 3EYOB 5IBUB 1E42A 3RJDA 2Z8VC 2YK1L 2J5LB 3G5WA 3KLDA 1JAEA 4L4TD 2EABA 3WY4A 1EEUA 3ZW3A 4DKEH 5G2NA 5KSAA 4L23A 2GPZA 1SOQA 3FCSB 1IKFH 4FQCH 2CNYA 3QISA 1QR1A 4A7SA 5J5EA 1FZKB 3TBWB 2PYFA 2WXKA 3F12B 1CXHA 3HAEA 3QJQB 5FS5A 5IB3B 4PP2B 4L05A 1DJXA 1L7IH 1USQA 1U8LB 1UT1A 1X5ZA 1ORQA 4PWJA 2BIMA 2JWYA 4I5BB 1UVQA 4JFZL 4KX7A 3W0WD 4R7NA 2NNAA 1ZS8A 4X5RA 5FHAH 2C9UA 3U82B 3HC4L 4Y4FB 4QKXB 4NO2A 2HRLA 3JWOH 4G8GA 3BP7B 1S7XB 4EKXA 4EUPG 1J05B 4MJID 1X5YA 4U6YB 4BJLA 4K5LA 4PRID 2IG2L 1CZ8L 4OR1A 1MWAH 1B2WL 1IM3B 3MRJB 5D5MA 1AQKL 2CU9A 2OMWB 1Q1JH 1QSFA 4FG6D 1DQDH 3EH1A 5GRVL 5IROC 3U0WH 4GAJL 1A6UL 4HFUH 1PYWA 2YGQA 4QRQB 4HULB 5A2FA 2KHAA 3ARWA 4LDLB 5IESH 12E8H 2CNZA 1AVAA 2B1OA 2YZ1A 3WNNA 4ZFZB 3PHAA 3B2UD 5KOMC 1DBMH 3CXDL 1HL5A 5C09D 3S3CB 1MSPA 3JWDH 4AMKH 2D7OA 1QKZH 5CEZE 3G5YB 3UC0H 3QDAA 4WJG3 4ZUSA 1BYPA 4XBPB 4XP1H 4HJ0C 4PJBB 1TQVA 3QZBA 2X88A 4PQXA 2H32H 3DMMB 3SKOB 3U6XS 4OI7A 4HIXL 1A14L 2FE0A 4BV1A 1II4E 1LILA 2JXMB 2ADFH 5D7LB 4DKEL 2J5LC 5AKSA 5E6YA 5T3ZH 4FHJA 3H4HA 3FAWA 3D4ZA 4S1QH 4U1KA 4XXWC 4GKNA 2WXGA 5LGJA 1OZTG 4MBRA 3RWHA 4IS6B 1G7QA 1NDMB 4MQ7A 3HMWH 2C7UA 4KFZC 5ABZA 2ODHA 5IGXH 2SEBB 3HC0B 5E9DD 5INCA 4AKOA 3QEGL 1T7WA 5G5DA 1KIPB 1KXQE 3OAWA 5EIQA 4M43H 3STBA 4ZAKD 5CKAA 1CL7L 4FULA 1QX1A 2NPLX 2VKXA 1CR9L 2R69A 3QA3B 4A7GF 1EXGA 3IJSA 4JQIL 5LN4A 5BRZD 2A9MH 2F0CA 2AXFB 1PF3A 1N0LB 2OLDA 5AG8A 1C9SA 4O00A 5E8OA 1KTDB 1RXLA 1YDPB 2N59A 1PNDA 2P52A 3NUKA 2A6JB 1XEDA 4YDVB 2YQ3A 5BMFH 5DEGB 4PLJD 1S9YB 1XL6A 4MWFA 1CFBA 4Z7WE 3U36B 3VQ1C 2KERA 4HOZA 3C6SB 3P73A 5C7XH 4XMLH 2HFFB 1RAMA 4NO5A 3AC0A 4HGKC 3CFJB 3ASWA 5B3NA 4CDHA 1ODAA 1S7UA 4XO4A 2OV0A 2CIIA 3VDCA 3WXVL 1OAKH 3HS9A 4LVEA 2GUOA 1QEWA 3PHOB 3R06B 3RIAF 1T0NB 2N1TE 4UU9A 3UTQA 3EYQC 3OR6B 1UACL 2WNXA 1U33A 4BQCA 2F9BT 5K9OA 1I82A 4KTYA 2R0ZH 5BV7B 2IDUA 3DOIA 4WW2B 1QPXA 5DRNB 3UP1A 4KQ4H 2Q2LA 2ZJSH 1GH7A 5MEND 2BOCA 3BGFB 5I24A 4GRWF 4UT9H 1PG7H 1Q4NX 4S2SB 1G7IA 2EXTA 5HD8C 4ATTA 1GHFL 4I3SL 4YUEH 1C5DB 4H7VA 3N41B 2EDXA 5K9JL 4ZAKC 5IQ7L 1ET8A 2K3HA 5DJXA 1M7IB 1MCPH 3EJYC 4ELDA 1JVKA 1KB5A 4I1PA 1QASA 4LKCB 2CUHA 5D2NA 3MV8E 2F7PA 4KVNL 1MJ8L 4YL4A 2YGPA 3G6AB 4XCCH 4JREB 4NXKA 3ULUF 2WVUA 1R5WB 1KJMA 2UV3A 4PY7B 3M1CA 1LWHA 1JZ4A 1WBZA 1NZRA 4NN7C 1L6XA 4JM0A 4YDLC 2QEJA 4C4KT 1I9IL 5B7FA 1W8NA 2I24N 2X9WA 2NY1B 5KBNC 3W5NA 3BEVB 4P3DB 5HDOA 1I7ZB 4Q14A 2YPLB 3KPMB 2AK4A 3HHSA 1E5AA 4FZ8H 3O4LB 4K8RH 2LTQC 1R3KA 4HHGA 4TNVF 3SCMC 5GGSB 2ZD0A 2AEIT 3VFOA 4M1CD 4ADJA 4OIBA 1DEEA 4FQJL 2ZWZA 3VI4A 3UH8A 4AITA 2E7CA 2J4WL 2BVPB 3PQYA 4FQHA 5HHXH 4PJCF 2FWOB 1MIMH 1DBML 3Q2CA 4WRLA 2AQ3A 4IRSC 5ETUB 3EH3B 3B43A 3ROLA 3G9AB 2FZ3B 3M07A 4ENZA 3O6ML 5FW7A 3KMDA 1JI2A 3QIWD 1JRHL 2G5RA 1UXMA 4NKMB 3V0WH 4UOW0 3WENA 5IMKA 4H1LH 3QI9D 3KXFE 1KIUA 1DVFB 2MMXA 5D7KD 3ZXAC 4BFBD 1PG7L 3D25B 4KKZA 1YYLH 2CO4A 1MI5B 5I5JA 1LP9A 3TYGH 3HE6A 2QFRA 3G6DH 5C07E 1Q9KB 2A5UA 1PZAA 4IK7A 1NMAH 1I31A 1KCVL 3BUYB 2V2WB 4HJJH 4RMUA 2OMXB 1ZVYA 1P1ZA 2DWEA 5HGHB 1RJZA 1SFDA 3MRMB 4ZMZA 3T8XB 1H5BC 1C5DA 2BJMH 4UB0L 3R0NA 5FDWA 3L1OH 1Z6JT 1JZ5A 1BVLA 2JELL 4F37K 1DE4B 5FHBL 2Q87A 1KCRL 5B1CA 4PBWD 5DFTA 4DP8X 3TCLA 4XN2A 1FVEB 2VNCA 3K6FA 4N8VG 2LABA 3TCXA 2D7TL 5T1KB 3CZFB 2HSIA 4W9ZA 4HGWB 1EBAA 1CICD 3P0YH 2ERJB 2EE9A 4AYSA 3HI1B 5EUKB 2ZXEB 5AVYB 5LHDA 3DX9B 3IU3A 3HAEH 1RPQA 4K8RD 4JFFB 1TETL 4H8HA 4AQEA 3IGAA 1P69B 4PUBL 1WLHA 4F7TB 4A66A 4D3CL 5B39A 1EJOH 1FH5H 5DD1H 5IB4B 3QO1A 3POCA 1YEIL 2GTZA 3QUXD 4HS8L 4DZ8B 5GS2H 3NSCA 3O4LE 5BRQA 3A6CH 3F7VA 3VCLA 1S9YA 3U36A 3H2PA 3OXRB 4HP5A 4Q97A 3DJRA 4I0PC 4CKVX 1BQLL 5L4IA 1A7OH 1MW2A 2DB8A 3QYCA 1P9MA 3SHSA 5IB1B 1NOAA 2A2QT 1N64H 3DVGB 5ELIA 1X6NA 2OS7A 2YKLL 3BAEH 3BW9A 5J57B 1XGPA 2B4CH 1CFTB 4LAQH 3GJFA 3CVIH 3PL6D 4LL4A 4UTAA 5JHDB 2YAHA 4F7CA 3IGKA 5DI8A 1RSYA 1P7KB 2VXSH 4OF6A 2NMSA 2RACA 1W72H 2LT9A 5EOCJ 3Q1SL 4Y2OB 4IRZH 3SO3B 5FECB 4WEMB 1JS4A 3RFZC 1OKEA 3OKKA 3U4BL 4F7PA 1YPZF 1RJLA 2CKBL 4JPKH 2OK0L 3RL2B 3AWFA 3E8UL 4Z6AT 5BVPH 4H25A 3ZSSA 2WLZA 1INDL 4WY7H 3IDGA 1ZVHA 4NUQA 3TH4T 1B0IA 3VU1A 4B6ZA 1F3RB 1IFHL 4ZNCD 1I7RB 5C07B 3THML 2D03L 3MUGB 2ORBL 3TN0C 5BQDA 4RGMC 4EDXA 1A66A 4BZ2H 3G3LA 2YXWA 5IHUH 3X1GA 1KCUH 2AKRA 2ZOKA 2QV2A 4B5EA 3MRQA 1PX3A 1NGQH 4IRSB 4LKXB 3VD4A 5FO9B 4ERSL 2AJXL 2X9YA 2I27N 3C60D 3CVDA 3VQMA 3NDYE 4PM1A 4RVBA 6TAAA 3AUWB 1XIWB 1RLBA 4FXKB 4QXVA 4BQBA 4EDXB 3AG2B 5E6UB 3ZKMD 1FV1B 1BXUA 43C9A 4DP5X 1PQZB 3LKOA 3N0AA 4QI3A 4B95C 3LIZL 2P46B 1JXFA 1Z3RA 1J9CT 3VI3B 1HXMA 3MLUL 3L4ZA 3WTVA 3UTSA 3MDJA 3STLA 3O3AA 5IMMB 4I4WB 4H0IA 3CSBA 4ZMYA 1XGQA 1HAWA 3W2DH 4F5CA 1M2VA 2WXIA 5ALBH 2HMID 1FFTB 4G6FD 2KC0A 4OZIE 1E9QB 2ALAA 1SLXA 3K0YA 1I8IB 3IXTB 4FHKA 3NFSL 4YE4H 3ZMNA 1HHJA 4HEPG 1T7YA 5HGBA 4YHKL 4KDTC 3CZJA 4K7PL 1A2YA 2A9NH 1OE1A 3CCHA 3G04A 4HUXB 4KI5C 5D7HA 4UBDC 5DQ9A 4YBHA 5JPMC 2NUTA 1QNZH 4NIKB 2APXA 1TJIL 1V3KA 2CDFA 2VXQA 4PTUB 1DQQB 3LPPA 2ICEC 2ALWA 4NNYB 3WBDA 3REWB 4NI6A 1YEKL 5JW3L 1A5FL 1ORSB 1P53A 4XNYL 1JPSH 5FCSH 3M1OA 1XH1A 4KVCH 2BCKB 1V55B 2Y5QA 3FRUA 3QWRD 3UMNA 1OZUA 2LU4A 3ML9A 3SOBH 3LQAC 1EH9A 3ZHLA 4DNLA 3THMH 3CCHB 2HT3C 1P84K 4QRBA 5CR1A 5K9QG 1J0JA 2V17L 4ESKA 1CE1L 2F54E 5FKAA 1DVUA 1PY4A 3FFDB 4FABL 2Z3FA 3ESPA 4P2QD 4RFOL 5SWSE 2Q2EB 5D5ME 3EGXB 4NZRH 1GGCL 1WAPA 3DUHA 2GITA 3UZQB 4OGQC 2HCZX 5F1IB 4L5FH 3N0PB 1D9KB 5KVGL 5IUCA 2E4FA 1CCZA 3H7BB 4WI4A 1U8KA 3VXUE 2WQXA 5DS8B 1I1AD 3S37L 3GDCA 2IDQA 1TTRA 2V0AA 1B4TA 3Q8EA 4KKPA 3L9BA 4B7IA 1HI6A 4XNMA 5AVZB 5DRZA 2WN3A 4U1KB 1PQZA 1T89A 3ZSTA 4EN3C 1YRKA 2D7NA 1EDQA 3IDIA 4G9FA 2EXYC 5B8CC 4X6FB 3HW7A 3SDXB 5JQ6H 4ALAC 5EORH 2KL6A 2EO7A 3LS5H 1WPCA 3L5JA 5F88A 5TE4H 2OXGA 4XVJL 4RETB 4JHZA 4G7VL 4N25A 4JFDB 3Q2WA 1R3JA 2A4EA 1I7TB 1DQJA 3MGOB 3NEEA 3GKWL 2O6FA 2UUDK 4XAWH 4U4BA 4DO6A 3BAJA 3G5YA 2VIRB 2QSCL 3SPJA 5B7MA 1B0GA 4IQHA 4M6NL 5I1AB 2HT4C 4DPAX 2F74B 3DTXA 1NC2B 4HC1L 3E2HB 1LDPL 4X5WB 1MAKA 4WUUD 3MROB 1TMCB 2AEPH 2IH9A 5JDJA 5KBKA 1KB3A 2O6PA 4LEXH 3CFCH 5GRXG 5I16B 4NBYB 3VI4B 2FGWL 1TCRB 1CO1A 1SEQH 4EI6B 1JGEA 1JGLL 2XA8L 3K2MC 4PJFB 3W0WA 3QXTA 5AOIA 3MV7D 1GGTA 2CHZA 2EQDA 4KXZI 1KPRB 1HYSC 4HIEA 4W9IC 2R9HD 1WZ1L 3S36X 3VFUA 4WI2A 1FNEA 1A7PH 4FG0A 3MAWA 3MLSL 3QGVA 5TFSH 4E42A 1KULA 4XBGB 43C9B 3CLEH 3C8DA 3DXAB 5IJKC 3OLIA 1MCWW 2CHNA 4UT9A 2VDMB 1E6JH 1FVDA 3C09B 1EAOA 5FV2A 3RWIB 1QRKA 1BPVA 5DLMH 1FRGL 2NY6D 4CNIB 1GMIA 2OBGA 3GMNB 4MJJA 3F7VB 3VCLB 1A6PA 4ICWA 2P5EB 3VVWA 4DP0X 5JUEL 4L3EA 3BJ91 1OK8A 5GXBB 1UD6A 3FQ1A 3AT0A 1HVXA 5D7JC 3K6NA 3F64A 1TF4A 4WEBH 2FH6A 5IJVB 1S7TB 1OM3L 1WICA 5HXMA 2XJLA 4OCWL 2PW2A 1FFOA 1HI6B 5AB2A 2VQUA 1BEYH 4N26A 4TQHA 3BFQG 2EXWD 4DK3A 5GRZA 4EI5A 5BS0E 3NTCL 1IQWH 1AXTH 3FT3A 3MCKA 3P40A 3LNEA 1TZGH 4PJ7F 5D7IA 3ZRCC 1AJ7H 2DQCH 3M86A 5AZEH 3L7EB 5DC9B 1Y6NR 1G7LA 5CP7A 2DTMH 4C56B 4YBQD 1D9KA 4EXKA 2DQTH 1SJMA 4PYGA 1RMFH 4Q8BA 3EBAA 4QO1B 3JWNH 5K1JA 2AV1B 2N0KA 2XOTA 3SKJL 2D73A 1G6RA 2Y7NA 1A14H 1BVLB 4NT6B 1VHPA 3TN0A 7PCYA 5AAWC 1IGCL 3CXFA 5D1ZI 4NNXB 1URZA 3FSWA 5I28A 2X4UB 3EDEA 3EYVB 3KPRE 3WEXB 2D31A 3ZKXB 2QKIA 5KSBE 4K55A 3BD4A 2GIXA 1Y0LA 3TVMA 5F70A 2ENYA 1XAUA 5D4IA 4XX5A 1YYML 3M8OH 5C6TL 4GFTB 1EDYA 3CD4A 1O9ZA 4NBZB 1U2CA 1ZLEA 2MRYA 5I1GH 2ESVB 3QDJB 2P80A 5D96C 4K3JL 2YEZB 4PLKD 4H4NA 1OAQH 4UTAH 4PG2C 3VH8B 5IBTL 5E00B 1I9EA 3IKCB 4ZRGA 1YVLA 4NFBA 4X9FA 2QKIB 4PS4L 4E68A 4ISVA 4KMTH 5CZVH 4MNHB 3NZHH 1J0IA 4G7YL 1FAIH 3SPCA 2H6OA 1G1KA 2NZIA 2OTPA 3ECUA 2H2SD 3HS8A 5F97E 4OTXH 3QC5X 5SWSB 4EI0A 3NZHL 1FFRA 2FWOA 4JQIH 4J3OD 4QXUH 5FUCE 2VSCA 1YEJH 2V2TA 1R0AH 2HLFC 2ESVE 3GK8L 4PSPA 1F18A 3J7HA 4Y5VA 3ZYIA 2R69L 4HJGB 3C09C 4NC0B 4H13C 5HBBA 1FO0H 5JA8B 3ZLQC 1IEBB 2OMUA 2VXVH 3OV6A 2BOBA 3HHSB 4BBWA 5D1XA 2HTKC 2JELH 1J9TA 3OM3B 1X6LA 1E27B 4TKWA 1JZJA 1NCUA 2BSRA 4FNTA 3T8XA 1C8PA 4FTVD 2OMYA 4AVHA 5DWUL 1W0WB 2V2WA 2YD8A 4R7VA 1EXUA 2B1AH 2DQHH 5JQHC 3DWTA 2VDQH 2ZUXA 4IJ3B 5EFIB 4X4YB 5BXFB 3GGWA 3WJMB 3V10A 2W0PA 4Z7AA 4HD5A 3SBWC 4JPIB 1I9IH 1AZCA 5EO9B 1JMXA 5FUCC 4MMZA 5I76B 3LPWA 2NY2D 3CBRA 4KTDH 3BIBX 4P04A 3OC8A 3WFDL 2NSMA 1WG3A 1Q9OB 1GGBL 1MCJA 1RZQA 1CFNB 2RD0A 5HI3C 4GG6F 4DESA 3O2WL 4D3CH 4F24A 4XZ4A 1S9XB 2ZYIA 1CXLA 4X98B 4ZQTA 3UJJL 3DTUB 1T20A 1WFIA 4QRRE 4WLCA 4PSRA 1MCPL 2JCWA 1K5WA 1JVLA 4F58H 5CLZA 5CS7A 4G9FD 4QRRA 1TEFA 1QHQA 2ZP0T 1J11A 1BZ9A 1LO0L 2KKQA 4RAUA 1WC7A 2P4AB 5E94A 3O8XC 4HZAA 4LSRL 4ZYKA 3HRZA 3VWJB 5LG6A 4XAKE 3T6ZA 2ATKB 2R7EA 3IPFA 1QZNA 5D6DA 5TGBB 4ODVH 4CMHC 3QT2A 5ILTH 3QJXA 3CU7A 4KU1A 4NSKA 4UV7L 5MERB 2NNCA 4ZNEE 3QIUD 5FM4A 1EO5A 4MNHA 5FF6A 2J57A 4LSQL 1NFIA 2NX5E 2QGEA 4X4ZA 1M9WA 3H53A 5BO1H 5F7DA 4LPUA 1I9JL 4H8WL 4ZUVA 4DN4L 5I76A 4MKTA 1W2KT 4AYFB 5EZIL 2BSCA 4MGXA 4F7EA 4FJ6A 4NRXB 1A7RL 3BYYA 2VDPB 3NIDE 4XPBH 1NCBL 2LAAA 1PIFA 3UC0L 2H6PB 1CFSA 1UB6A 3L1OL 4X6FA 3AY2A 1K4CA 4N2EA 3GI8L 4WHCA 2WLIB 3AS2A 4IHOA 1AKJB 5E6IA 5TK2A 4CC4C 1S6NA 4HBQA 2B1HH 2CK0L 3DX0A 4YWGL 4Y9BA 3Q9QA 4O58H 3NIGB 4PRPD 3WFHB 4CVZA 3MBWA 1H5BA 4BHUI 2CRYA 5E1HB 4J3VA 2FWUA 3DUSA 3T09A 1ZGLP 3F04A 3IJ7A 4Z7QF 1HEZA 5L2KE 4TVPL 3EF7A 4KMLB 5DJ6A 2CDGB 2G9HA 2AI0H 1KB5H 4JFQA 5K93A 5LKNA 1MCLA 3PIQA 3TS8A 2I9TA 2F5BH 3N43F 1WA1X 3QJZA 2PO6D 4TUOB 2B15A 1CUOA 1JPEA 1LDSA 5JIKA 5ANMA 2P44B 4HIIA 1QLFB 4MA8H 3C08L 4ISVB 1GW6A 4IW4C 1QNIA 1C12A 4J4PD 3M17A 4R5XA 4O5LL 2W9DH 1BBJB 2Q20A 4WUKL 3G5VA 3P9MA 4UQ2A 5H35A 2ZKHH 3AG4B 3DX6A 3FH7A 4NWTL 2ZAIA 3BKYH 4LVNB 1HHHA 1NFDA 5BOPA 1THAA 5L4JA 2F54B 1IM3D 3VX1A 1QSVA 2XNAA 2QSQA 2DF3A 1O0VA 4IBLT 4FS0A 5HGBB 3KYNA 4N90D 3PWUB 4WI5A 2GHWB 5D1QC 3V4VA 4AG4H 5ALCL 3LDBB 1MH5A 4HAKA 4OLXH 3ZT7A 2XN1A 2DIBA 3P4LA 4LB8A 5DEFB 4MB5A 4QO1A 1E2ZA 3W0WB 3BJLA 4LSPL 2DICA 1T66D 4OZFG 4RAUB 4ZTPL 3TA3C 3NQKA 4AE1A 1GPOL 1T21B 5GIRA 3T1FB 4LSPH 4LSVL 1H8OA 3TJEL 1WIUA 1VFMA 1L5GA 5B39G 3I75B 1RCYA 3MJ7B 2V5YA 2PNDA 4LIQL 5C09A 1LTXA 2VYRE 4HJTA 4TNVK 3RJOA 3D0VA 4X5WA 4ZJ9A 5DO2D 4YWGH 4FNLH 2F7QA 3QUKB 3OBAA 3BP4A 1KBPA 4WJ5A 1M9SA 2DV6A 2RCSL 3HBGA 4K3DL 5CJQH 5KTEL 3MCYA 5C2UB 2BK8A 3DLQR 3X13A 4WJKB 3WHXB 2QGBA 4RGOL 2E76C 2RALA 2FNBA 3P0VH 1N19A 3SKOA 2WC7A 4BSWA 4BRVA 2KBGA 4W4OA 1OK0A 5IV2B 2MNUA 3HB3D 1B4LA 1XDTT 2F8IA 4OIFA 5TE7L 4OGXL 3TV3H 2RBLA 3CVHB 3SEPA 3EOYG 3FO9A 1XZ0A 1GY2A 3S3PA 5FW6A 1P2CA 4BELD 2APVA 3EJSA 4XNMB 1N26A 4ZFZA 4DKAA 2GSIB 4Y5VC 1IBDA 2IADA 4Z7VB 5KSUA 3WFEL 1NTDA 2J8OA 3RU8H 3Q43A 3FB7A 3I75A 2GJ6D 1AGBA 1BJMA 4LSRH 3GDBA 4XRCA 3S9DB 3BGMB 4PJ9B 1HSAB 1TSRA 1VPOL 2V3FA 4HZLB 1WFJA 1SNRA 3RGVC 5BUPA 1U41A 5TH2A 2H47C 3CAFA 2XPZA 3N1QC 4Y2DC 3GSNL 3SQOH 4AM0Q 3CSPA 3RWCA 3GEWB 1E3FA 5F3HA 5E2VL 4ZMAT 5LJYH 1ORQB 4XP4L 1U6AH 4KJQD 4NO3A 4OZFB 1KTBA 1Q38A 3H3PH 1LE5A 3H0TA 1T22A 2XBDA 2C7FA 3Q13A 3DHUA 5EUOF 3LZRA 3RVUD 1FGNH 1L7TL 1OAJA 5E1GA 3Q05A 2EDTA 3NJIA 1WK0A 1BVKA 1RK7A 3JXAA 4PRDA 4CBZA 4OFDA 3CSYB 1GZHA 4I89A 3LEXA 5LAXA 1T5WA 3BRGC 1A2YB 3ARUA 3D3VE 4OJFL 2P5WA 4MAYA 4OT1H 3QR0A 4MCZB 3EYUL 3DNKA 2I07A 4HIPA 3ZTDC 3WMSA 2YBGA 1EEZB 1K9TA 4HEPA 3S96B 5KSBA 3NCMA 2BZ7A 1KOAA 3OL2A 3R4RA 1QTYT 1WBYA 3MRGB 1AI1H 3MYJB 4R3SB 1XHHA 4EBQH 2QR0A 1N9PA 3I02B 5E8PA 5SX5K 3NCEB 2FWSA 3SE9L 2XZAL 3QZOA 5IR1A 1MFVA 3F2LA 3QUYD 5GS0L 4FEMA 1TTFA 3FB8B 1CI3M 2PWGA 3NJGA 2A6KA 5F1KC 5F9WB 4YBLB 5GS0H 4K9EL 2GFBB 4HHWA 4WNQA 4ZTOL 1ONQB 4MCMA 1QFWM 3N42F 4MD4B 1JPGA 5L2JA 3FU6A 1BVKB 2ITFA 3FW6A 3KDPB 3U4AA 3DRQB 1EHAA 3ZVVA 2CUMA 3KYOA 1X44A 4NPYA 4EO5A 5I6XC 4LOUC 1A6AB 4WFHD 2VAAA 3FQTA 3D39E 3CPLA 3C87A 4DW2H 1VEPA 1FVDB 3RWIA 5AUMA 4XNAA 4B7LA 3MR9A 3FYIB