2V3AA

Crystal structure of rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN REDUCTASE
total genus 110
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3aA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA02
2GR3A 3CTYA 3BHKA 2YM2A 4Z2RA 1VQWA 1JRYA 2AR8A 2Y6RA 4Z44A 3ALMA 1VRQB 4J56A 1JEHA 4JN9A 2EQ7A 2NVKX 3GMCA 4USRA 1PXAA 5FS8A 2BACA 1CL0A 3H8LA 3B6DA 1BWCA 1GRBA 1DOEA 2BC0A 2VQ7A 2XVHA 3EANA 3UOVA 2XFUA 4U2TA 4A9WA 3I3LA 1KF6A 4AP1A 1ONFA 2OLOA 1MXTA 2NPXA 2GRTA 2YLSA 3KVEA 4B68A 4EQXA 3DK9A 3QFBA 3ATQA 5FS9A 4BK1A 4OPUA 4BURA 3DJDA 5KXJA 1IUXA 2YG3A 2C75A 3ADAB 5BUKA 3OC4A 1D7YA 1GRFA 1JRZA 2RGHA 2YVFA 2GF3A 1LQUA 1PDHA 3K7MX 3NTAA 4GRTA 1K0JA 2JKCA 2B9YA 3WE0A 3PVCA 1S3EA 2X50A 2Y6QA 3GDPA 4BJZA 4APNA 2XLPA 5BVAA 3AE8A 3RHAA 4A7AA 1E1LA 2VRLA 3LOVA 4B63A 1L9DA 1Y56B 1ZMCA 2YAUA 3BI5A 4H4XA 1NHRA 3LZXA 4B67A 1BKWA 2C7GA 3GSIA 1FEAA 2XYOA 1TDEA 3G5RA 4EM3A 2XDOA 3NHOX 4H4UA 1F8WA 4XXGA 4H4TA 5HXIA 2BK3A 3FPZA 2BXRA 1AOGA 4AP3A 4CCRA 3DK4A 1XANA 4H2PA 2VVLG 4YTMA 2DKHA 1YQ3A 2ACZA 2Q7VA 2GAHB 3H8IA 4IVMB 5BULA 5M0ZA 2BS3A 3C4NA 3SGLA 3AXBA 1TRBA 2YR5A 3SM8A 3VRAA 5ER0A 3UKAA 1JNZA 5FS7A 4CCQA 4CRTA 3AYLA 1CHUA 2EQ9A 4P9SA 3UKLA 1N4WA 1BGNA 1HYUA 3KKJA 1PHHA 2XLRA 2YG7A 4N9XA 1COYA 5J60A 5LV9A 1ZOYA 1L0VA 1CJCA 2X8CA 5KVIA 1S2YA 3BHFA 3NGCX 4MJWA 2WESA 1KFYA 1YY5A 1S2QA 3CPIG 1Q1WA 1GT8A 4EQWA 2BABA 3FBSA 2EQ6A 2R0GA 3T37A 1O94A 1YQZA 3NK1X 1P2EA 2B7RA 1D5TA 2TMDA 1H6VA 5CKUA 2C64A 4K5RA 4TM4A 2ARDA 3S5WA 3DJEA 3UKFA 4EMJA 2CVJA 4ADWA 2YG6A 3UTGA 2R9ZA 1GERA 1CC4A 2HQMA 1EL7A 1GESA 1MOKA 2B76A 1PBDA 1GXFA 5IQ1A 2C3CA 1L9EA 3OZ2A 4H4WA 2QA2A 3L1RA 4U8KA 2XVFA 2JB1A 4GR1A 2DKIA 4Z24A 3VQRA 4D03A 3CNSA 3L8KA 1RSGA 3GMBA 2YR6A 1E39A 1DODA 2YR4A 3NK2X 1GRGA 4EQRA 4EMIA 2EQ8A 4UDRA 1GTEA 4J34A 4YXDA 4EIQA 3AEBA 4JNAA 4EM4A 3EAOA 2YLXA 4FX9A 3EF6A 1IUVA 2R4EA 2FJAA 3RNMA 1IUUA 4H7UA 3QSEA 1GV4A 1ZY8A 4JQ9A 3DA1A 4RSLA 3ICTA 3NN6X 2C72A 3V3NA 3P1WA 4I58A 4H4ZA 2R45A 3UKQA 2XFQA 1QO8A 3CNJA 1H7WA 1DOCA 2YVGA 4GDPA 1TDKA 2C73A 1DJQA 1PN0A 3D1CA 3AE6A 1DOBA 1H86A 1LV0A 4HA6A 5C2TA 2APGA 4C3YA 3BI4A 1LTXR 2Z5XA 3DGZA 3G5QA 4YSHA 4JY2A 2GEWA 1TDNA 1B37A 4K22A 5EB4A 4J33A 2WHDA 3DMEA 2VRMA 3AYJA 2H88A 1K0LA 4XWRA 4OPLA 4AOSA 5BRTA 3C96A 3QVRA 1BGJA 1V59A 2GH5A 2Q0KA 2GMJA 2WU2A 3AD8B 3DJJA 4H4PA 2WPCA 4J31A 2PYXA 1VG0A 3ATRA 4Y4MA 1N4VA 2FJDA 3II4A 1W4XA 5GRTA 3NK0X 1REOA 2ZZBA 3GD3A 3NNEA 2YLRA 4U8NA 5JCIA 4NTEA 3S61A 4X4JA 3KD9A 2XFPA 3P4PA 2Z5YA 4FDCB 4ZCCA 4DNAA 2F5ZA 1PBEA 4RG3A 2GR0A 2WOVA 2JB2A 1NEKA 2B9WA 1EBDA 2OA1A 3PS9A 1KDGA 1F3PA 2BK4A 3ICSA 1NDAA 1O95A 2W0HA 2FJEA 3LB8A 3SFEA 5KWFA 4GUVA 1XDIA 4Y4LA 1H84A 3EPTA 3NLCA 2CULA 3KU9A 4OPGA 3BI2A 2R0PA 1LPFA 3AD7B 3K7QX 4K8DA 4KX6A 4B65A 1GETA 1NENA 2IVDA 1OJCA 3UP4A 3P4QA 1CC2A 2XLUA 1JRXA 5J7XA 2R4JA 4H4SA 3FMWA 1Q1RA 4H2RA 5U63A 1PXBA 2C3DA 1TDFA 2FJBA 3ZDNA 1OJAA 4C5OA 3RP7A 2Q0LA 1GNDA 3M13A 4JNQA 1D4EA 5IPYA 4C3XA 1ZDLA 4IA6A 4U2SA 2FBWA 4TM1A 3K30A 2O9ZA 1SEZA 1DXLA 2C67A 1GRAA 2A89A 1M6IA 1GREA 3K7TA 4OVIA 2RGOA 3M0OA 4TLXA 5U1OA 1F8RA 3AE2A 3REDA 2WBAA 4IV9A 2RGJA 1E6EA 4REKA 5HHFA 4A65A 2J3NA 2XCGA 1BZLA 5KRQA 2BS4A 2V5ZA 3NTDA 3V3OA 2WETA 3FIMB 2E1MA 1FL2A 2YLTA 3CIRA 3NKSA 3COXA 4Z26A 4YKGA 4TM3A 1IUSA 1DNCA 3RP8A 1OJ9A 3UP5A 4A6NA 3AE7A 4U8PA 4O5UA 4BV6A 1BF3A 4TLZA 1GSNA 1D7LA 1CF3A 3P9UA 2GQWA 1Y56A 1Q9IA 4H4YA 2TPRA 1PS9A 2XFNA 3QJ4A 1CC6A 3AEGA 1IUTA 1FECA 4KPRA 4YT0A 1VG9A 1E7PA 2WPFA 3NRNA 5CQFA 3CGCA 1CJ4A 3ITJA 3AE9A 4LU6A 3URHA 3UKKA 1P2HA 4FK1C 2OALA 3SFDA 4C77A 4I59A 2ZZCA 3CNTA 4A5LA 4J57A 4YWOA 3QVPA 4IVOB 1FEBA 3SQPA 4LIIA 5KOWA 2V6OA 2VZ2A 2OAMA 2WOIA 4TM0A 3NH3X 2VVLA 3DGHA 3GRTA 1XHCA 4ICYA 2X8GA 2BCPA 4B69A 4IA5A 4U8LA 1LVLA 3F8RA 1ELIA 3GWDA 2PHHA 1H83A 1YQ4A 4AT2A 3UCLA 2UZZA 5U25A 1K4QA 2YLZA 2WDVA 3LXDA 2CFYA 3KPFA 5FMHA 3V76A 4Y4NA 2WP6A 3AE4A 5TR3A 1QLBA 4O5QA 4U2LA 3ALJA 1OJDA 3RP6A 4J2WA 5L46A 1FCDA 1TYTA 1NHQA 2I0ZA 4NEVA 3VRDB 1NAAA 3JSKA 1H82A 2C66A 2BCGG 3IF9A 3CN8A 4DSHA 1B4VA 3IC9A 4U8OA 4OPDA 4BK2A 2CDUA 2QAEA 1JU2A 2JAEA 4JY3A 3ZYXA 2IIDA 1LJ1A 2XVEA 5EB5A 2V61A 1GTHA 1XPQA 5HY5A 1GEUA 1B8SA 4H50A 4Z43A 2JB3A 3GRSA 1D4CA 4CBQA 2X99A 1O5WA 2Q6UA 4YSYA 2YWLA 3B3RA 1JOAA 3CNDA 1DJNA 1PJ5A 1GRHA 4GDEA 3ALLA 3CNPA 2XLTA 1KNPA 3M12A 2H89A 4GCMA 1K0IA 2VVMA 1CBOA 2WPEA 3H4KA 4NEWA 1PBFA 4HB9A 2BYBA 4K5SA 4CY6A 1NG4A 4BK3A 2JK6A 4H2NA 2E4GA 4H2QA 2A8XA 3QFAA 2WS3A 1RYIA 2WEUA 3NIXA 5IQ4A 2YVJA 1PXCA 2B9XA 4OPCA 3O0HA 2GR1A 4CNJA 3UTFA 4U8MA 1OJTA 1EL5A 2ZZ0A 4FK1A 1KSUA 1N4UA 3GYJA 2GVCA 4PABA 2V60A 4USQA 3UKHA 1YKJA 4C74A 5C3JA 2BA9A 1VDCA 3GYIA 2YM1A 1KSSA 2E5VA 1QJDA 1EL9A 1Y0PA 1GALA 3NG7X 3AEEA 2A87A 1ZX9A 4B1BA 2GQFA 4E0VA 2GR2A 3G5SA 2XLSA 3QSMA 1PJ6A 4M52A 4NTDA 4YSXA 4H4QA 4GF7A 1IUWA 4H4RA 2AAQA 2X8HA 4OPTA 3VR9A 3LADA 1L9CA 3AECA 4UDQA 4YTPA 3BNUA 5EOWA 1CJ3A 4B66A 3KA7A 3NT6A 1ZP0A 4NTCA 4Z25A 3IHMA 2IVEA 3C4AA 2GV8A 1TDOA 5FS6A 3UOXA 3UOZA 2WP5A 5HYMA 2C70A 3GDNA 3LJPA 1NPXA 1PBCA 4WX1A 4XWZA 1CJ2A 1E1KA 3AWIA 3P4RA 2ZBWA 4A79A 3UKPA 3UTEA 4K7ZA 4U8JA 3AEFA 4YKFA 2BS2A 2C65A 1F8SA 2GB0A 2B7SA 2R0CA 3AE3A 4A6NB 1LQTA 4EMWA 3AE5A 3CPHG 1NG3A 2X3NA 2YQUA 4ZN0A 1M64A 3AYIA 2V3AA 1Z6LA 4YTNA 1ZK7A 1RP0A 2YG4A 3CGBA 3P4SA 2V3BA 3NN0X 2VOUA 1N1PA 3Q6JA 1MO9A 2QA1A 4K2XA 5EBKA 2BK5A 2BC1A 3CGDA 4CNKA 2WDRA 2WP9A 2YLWA 3DH9A 2XVJA 3VR8A 3GWFA 1UKVG 3QSSA 1B5QA 1GRTA 2OLNA 1PJ7A 2R46A 4ZCDA 5JCKA 1GOSA 3NYCA 3F8PA 4H4VA 5M10A 1KNRA 3AB1A 4DSGA 2GAGB 4UDPA 4B64A 2VQBA 2XFOA 4YSZA 5JCLA 1H81A 3I6DA 4Z2TA 4DGKA 2XVIA 3CGEA 4WCTA 3FG2P 3AD9B 3GD4A 4X9MA 4AOXA 4J36A 4OCGA 1E1MA 4Z2UA 3BNMA 3R9UA 3LZWA 1S3BA 4NZHA 1NHPA 5KVHA 4LA1A 4BJYA 4UP3A 2WU5A 3F8DA 4OPIA 1NHSA 2WQYA 3PO7A 4CY8A 3IHGA 3ISHA 4ECHA 3NYFA 2WDQA 1ZOVA 3ABVA 1EL8A 3DK8A 2AQJA 3D8XA 3UOYA 4A99A 2WOWA 3VRBA 3AEAA 4JDRA 5DBJA 3HZLA 2QCUA 3CPJG 4AT0A 5JCNA 5KOXA 1ZMDA 2RABA 1TYPA 4X9NA 4EQSA 2JBVA 3NYEA 1H7XA 2C76A 1ZKQA 1X31B 1GPEA 3ICRA 4U8IA 1PBBA 5JCMA 4EIPA 1D4DA 3IWAA 1JNRA 2BXSA 3AEDA 2GMHA 2YG5A 1IJHA 3UTHA 3AE1A 4RG4A 1F6MA 1E1NA 3DJGX 4PAAA 5GSNA 3Q9TA 1FOHA 3KLJA 3E1TA 4D04A
chains in the Genus database with same CATH superfamily
3CTYA 4Z2RA 1VQWA 1JRYA 4Z44A 2FKPA 2Y6RA 2PMQA 4JN9A 3T14A 2EQ7A 3DGBA 1KCZA 3H8LA 1GRBA 2BC0A 3CYJA 4AP1A 3RRAA 2YLSA 4B68A 3DK9A 3HPFA 5FS9A 3DESA 3VCNA 3ADAB 3OC4A 1D7YA 2RGHA 1K0JA 3WE0A 2X50A 2Y6QA 3VFCA 3LOVA 3ENLA 2YAUA 3BI5A 4B67A 3CMMA 3GSIA 1FEAA 4H4TA 2BK3A 1AOGA 4CCRA 2OQHA 2VVLG 4YTMA 2ACZA 2GAHB 2YR5A 3SM8A 1H2IA 3P0WA 1CHUA 3UKLA 5J60A 1PHHA 3SXIA 2NQLA 3DG3A 1CJCA 3NGCX 2WESA 3CPIG 1S2QA 1Q1WA 2I5QA 3NFUA 2PSNA 1P2EA 1H6VA 4TM4A 3THUA 4ADWA 5IDZA 4X2PA 2HQMA 1GESA 1PBDA 2B76A 1GXFA 4H4WA 3ZLFA 2XVFA 4GR1A 4M6UA 4D03A 2YR6A 2YR4A 3D46A 2EQ8A 3PG6A 1STZA 3AMZA 4JHMA 4YXDA 3EAOA 1IUVA 2R4EA 1N60C 1GV4A 4JQ9A 3ICTA 4H4ZA 2HXTA 1H7WA 1DOCA 3D1CA 1KD0A 1ELSA 5G5HB 3BI4A 3DGZA 4JY2A 3U4FA 3QN3A 1V59A 2GH5A 2GMJA 3ATRA 2FJDA 3H8AA 5GRTA 1REOA 3NNEA 4NTEA 4E4UA 3CT2A 4X4JA 3KD9A 2JB2A 2B9WA 3ICSA 2GGJA 2W0HA 3EPTA 2HNEA 2R0PA 3AD7B 3T0KA 1JRXA 4MKSA 2OG9A 4GGHA 2C3DA 2GDQA 3UCDA 2FJBA 3ZDNA 3R07C 3M13A 5IPYA 1ZXIC 2DW6A 2O9ZA 3S47A 1GRAA 2A89A 1M6IA 3K7TA 3M0OA 5U1OA 3AE2A 2WBAA 3AM9A 3TWBA 5EU9A 2V5ZA 3NTDA 3FIMB 3N6JA 1FL2A 2YLTA 3CIRA 3NKSA 3UP5A 3RP8A 4TLZA 2PGWA 4E4FA 7ENLA 1Y56A 1Q9IA 2XSXA 2QGYA 3QJ4A 3AEGA 1FECA 3CK5A 4KPRA 2WPFA 3ITJA 3AE9A 4KWSA 4K2SA 4C77A 3DFHA 3TQPA 3EUB3 3QVPA 4IVOB 3NH3X 1XHCA 2BCPA 3STPA 1LVLA 3SBFA 1K4QA 2WDVA 4Y4NA 1ECQA 2WP6A 3RP6A 5L46A 1FCDA 5KMPA 3RO6A 4NEVA 2I0ZA 1NAAA 1MNSA 2C66A 2BCGG 3VA8A 2QJMA 2QAEA 1XPYA 4EWJA 2XVEA 2V61A 1GTHA 1GEUA 1B8SA 1SJBA 4YSYA 1KN0A 3HW2A 4GDEA 3ALLA 3CNPA 2XLTA 2MNRA 2VVMA 2ZC8A 4H2QA 4G7FA 1WUFA 1PXCA 2B9XA 2GR1A 2XH0A 3UTFA 4U8MA 2PGEA 1EL5A 2OX4A 3GYJA 5G5GB 3TW9A 4M0XA 4USQA 1YKJA 2BA9A 1VDCA 3GYIA 4MMWA 3SZ0A 1QJDA 1EL9A 2POZA 4IL2A 3TOYA 1GALA 2PA6A 3AEEA 2GGGA 1ZX9A 2GR2A 1N61C 4M52A 3G5SA 4NTDA 3ZVIA 4H4QA 3IJQA 3VR9A 4J3ZA 4HCDA 3JW7A 4UDQA 3BNUA 4B66A 1ZP0A 3IHMA 3C4AA 2GV8A 1TDOA 3ES7A 2PU0A 4XWZA 1JROA 6ENLA 3UKPA 4U8JA 4YKFA 4DYEA 4EMWA 3AE5A 2CHRA 1Z6LA 4YTNA 1ZK7A 2YG4A 2GGHA 3MUCA 3Q6JA 1N1PA 2VOUA 2GL5A 2GSHA 3OPSA 2WP9A 3VR8A 3QSSA 4ZCDA 1GOSA 1L8PA 3NYCA 3CB3A 2GAGB 3ES8A 4Z17A 2XVIA 3FG2P 3GD4A 3AD9B 4AOXA 4J36A 4Z2UA 3A7UA 4NZHA 1NHPA 4LA1A 3F8DA 1NHSA 2WDQA 1ZOVA 2AQJA 3D8XA 3DFYA 3CPJG 1SB3B 1ZMDA 3U9IA 2JBVA 1ZKQA 3ICRA 3ZVHA 1JNRA 3AE1A 4RG4A 3D47A 1RVKA 1VDVA 4KT2A 3KLJA 3E1TA 1VRQB 4J56A 4USRA 1CL0A 3B6DA 1BWCA 3EANA 2XVHA 2OO6A 1ONFA 1MDRA 4BK1A 3DJDA 1IUXA 2AL2B 3VCCA 1P48A 2YVFA 2GF3A 1LQUA 1PDHA 3NTAA 2JKCA 4BJZA 3PVCA 2OPJA 3SZCA 3RHAA 4B63A 1NHRA 3Q45A 2OQYA 4H4UA 3QTPA 5HXIA 3FPZA 4AP3A 2AL1A 3R0UA 1YQ3A 2Q7VA 3H8IA 1WUEA 5M0ZA 2BS3A 1R0MA 3UKAA 4A3RA 1N4WA 2XLRA 1COYA 4HCLA 5KVIA 3BHFA 1KFYA 3FBSA 2EQ6A 3T4WA 2R0GA 4HCHA 1FO4A 1PDYA 3T37A 1YQZA 1O94A 2C64A 4K5RA 3UKFA 2PODA 2R9ZA 1GERA 3SN4A 1CC4A 2C3CA 4U8KA 2DKIA 2E5AA 3L8KA 3GMBA 4II3A 3NK2X 4EQRA 4UDRA 4J34A 2AKZA 4EM4A 2FJAA 3RNMA 4HNCA 4H7UA 3QSEA 4RSLA 3NN6X 3V3NA 3P1WA 1QO8A 5FJRA 1DJQA 5C2TA 2PTXA 3TCSA 3G5QA 1F9CA 4YSHA 2XH4A 1TDNA 4E5TA 5EB4A 3NVWB 2H88A 2QJJA 4OPLA 4AOSA 3NS1B 4TVYA 5BRTA 3VC5A 3AD8B 2Q0KA 2WU2A 2WPCA 2PYXA 1VG0A 2P3ZA 3NK0X 3GD3A 3QPEA 5JCIA 4DHGA 3RCYA 4FDCB 4ZCCA 1PBEA 4RG3A 4H2HA 2WOVA 3D9XA 1NEKA 3PWGA 1EBDA 3PS9A 1KDGA 1NDAA 2FJEA 1H84A 3NLCA 2CULA 3BI2A 4K8DA 4B65A 1GETA 3FXGA 5J7XA 2R4JA 4H4SA 3FMWA 1Q1RA 1PXBA 1KKOA 1OJAA 3RP7A 4K1WA 1D4EA 2XH2A 3K30A 1SEZA 2C67A 4OVIA 3I6EA 1F8RA 1ONEA 4REKA 5HHFA 2J3NA 2WETA 3GD6A 4YKGA 4TM3A 1DNCA 1OJ9A 4A6NA 3AE7A 4U8PA 4O5UA 1XS2A 2AL2A 3V4BA 3CAWA 4YWSA 3FVDA 1CC6A 1SJAA 1E7PA 1JPMA 1CJ4A 4LU6A 3URHA 1JCTA 3HYVA 4I59A 2ZZCA 3CNTA 4A5LA 4J57A 3FJ4A 3GO2A 1FEBA 4ICYA 2X8GA 1MDLA 1H83A 1SJCA 2UZZA 5U25A 3LXDA 2CFYA 3N4EA 3ALJA 1OJDA 1TYTA 3AN1A 4GIRA 3JSKA 3P3BA 1H82A 3CN8A 3IC9A 4BK2A 3SN0A 4JY3A 5HY5A 4H50A 2JB3A 3GRSA 1D4CA 2X99A 1O5WA 3CNDA 1FFUC 1GRHA 2OZ3A 3M12A 2H89A 1K0IA 2QQ6A 3H4KA 4HB9A 4K5SA 1NG4A 4BK3A 2JK6A 1RYIA 4OPCA 3V5CA 2PTZA 4TVWA 1OJTA 4IP4A 1N4UA 1N62C 4PABA 3SSZA 2V60A 3UKHA 2YM1A 1KSSA 3DEQA 2W3SA 3NG7X 4B1BA 3T6CA 2X8HA 3NVYB 2GGIA 1L9CA 4YTPA 5EOWA 3SZWA 1W6TA 3NT6A 5FS6A 3ZVHB 3LJPA 4GMEA 4MGGA 3AEFA 1LQTA 3CPHG 3AYIA 3P4SA 2V3BA 3NRZB 2RDXA 2QA1A 3TJ4A 5EBKA 2BK5A 2OKTA 2WDRA 1GRTA 1R6WA 5FJPA 1KNRA 3AB1A 4DSGA 5KMQA 4UDPA 2XFOA 3CXOA 3IJLA 4Z2TA 4X9MA 3ZLGA 3R9UA 1S3BA 5KVHA 1X2HA 3N4FA 2WU5A 4OPIA 3T2ZA 4ECHA 3NYFA 3DK8A 1EL8A 2WOWA 1PDZA 3AEAA 5DBJA 3MQTA 5JCNA 3BOXA 4AT0A 5KOXA 3IK4A 1RM6B 2C76A 1GPEA 4U8IA 5JCMA 4EIPA 1D4DA 3VC6A 2YG5A 3UTHA 4PAAA 3NXLA 5GSNA 4D04A 2GR3A 1X2GA 3BHKA 2YM2A 2NVKX 3IJIA 2PU1A 1MRAA 1NU5A 3SYIA 2VQ7A 2XFUA 4U2TA 4G6GA 2GRTA 4EQXA 3QFBA 3ATQA 2ZADA 5KXJA 2DW7A 4GFIA 3FCPA 1GRFA 3K7MX 5BVAA 3GDPA 4A7AA 4HYRA 1L9DA 1Y56B 1FFVC 4H4XA 2XYOA 4EM3A 3G5RA 3NHOX 4XXGA 3DK4A 2DKHA 4IVMB 5BULA 4FP1A 3SGLA 3AXBA 2PP1A 3VRAA 5ER0A 5FS7A 4CCQA 1T3QC 1HYUA 3KKJA 4G73A 4N9XA 2YG7A 1L0VA 2X8CA 1DTNA 1S2YA 2PTYA 1JPDX 3BSMA 3VDGA 1YY5A 4EQWA 2BABA 3NK1X 4NWZA 1D5TA 5CKUA 3NO1A 1EC7A 4EMJA 1FHUA 2PP0A 1EL7A 1L9EA 2QA2A 3L1RA 4IZGA 3VQRA 3CNSA 1RSGA 3R10A 3R25A 4EIQA 3EF6A 2QVHA 1IUUA 3EEZA 4J1OA 3SQSA 3FV9A 4I58A 2R45A 3OZMA 1TDKA 2C73A 1LV0A 4HA6A 3QKEA 3DERA 4C3YA 4G8TA 2Z5XA 2GEWA 3N6HA 2WHDA 3DMEA 3AYJA 1EC8A 1K0LA 3DJJA 2QDDA 4H4PA 4J31A 4A35A 3MKCA 3II4A 1W4XA 2ZZBA 2YLRA 3NZGA 2XFPA 3P4PA 2F5ZA 4E8GA 3NVZB 2GR0A 5KWFA 2BK4A 3LB8A 1O95A 3SFEA 2FYMA 4Y4LA 1XDIA 3SR6B 4KX6A 3R11A 3SY4A 2BRAA 3P4QA 3RR1A 1CC2A 4H2RA 5U63A 1TDFA 4C5OA 4JNQA 4C3XA 3R0KA 4TM1A 3MWCA 1DXLA 2RGOA 3HYWA 2RGJA 3TWAA 2XCGA 5KRQA 2BS4A 3V3OA 2E1MA 5FJUA 3COXA 1IUSA 4E6MA 4IHCA 2ONEA 1D7LA 1CF3A 3P9UA 1E9IA 2TPRA 4GYPA 1WYGA 4YT0A 3KPKA 3UKKA 4JN7A 4FK1C 2OALA 3SFDA 4KPLA 2QDEA 4H1ZA 3I6TA 2V6OA 4TM0A 2WOIA 3DGHA 2VVLA 4B69A 4IA5A 2AKMA 4H83A 1ELIA 3GWDA 3OZYA 2PHHA 1YQ4A 2YLZA 5FJTA 3SX6A 4ENLA 3UJFA 3V76A 2OZTA 1QLBA 4O5QA 4U2LA 4J2WA 3FYYA 3VRDB 4DSHA 1B4VA 4FI4A 4OPDA 1OEPA 3ZYXA 4GYPC 4HNLA 5KMSA 2IIDA 1LJ1A 5EB5A 1XPQA 4CBQA 4ZA0A 2Q6UA 3DG7A 3DG6A 3B3RA 1JOAA 3TTEA 1DJNA 4GCMA 1N63C 1CBOA 1PBFA 1TKKA 2E4GA 3QFAA 2WS3A 2WEUA 5IQ4A 1VQZA 4CNJA 2ZZ0A 4FK1A 2GVCA 5C3JA 2E5VA 3BJSA 2O56A 2BRYA 3L5OA 4II2A 3UJSA 3GY1A 1PJ6A 4GF7A 2AAQA 4OPTA 2XGZA 3LADA 1FHVA 3KA7A 3V5FA 4NTCA 2C4CA 2IVEA 3UOXA 4ROPA 2C70A 3GDNA 3UTEA 2W55A 2BS2A 2C65A 1F8SA 2GB0A 2B7SA 2R0CA 4A6NB 2YQUA 2X3NA 1RP0A 4KEMA 4CNKA 2BC1A 3CGDA 2YLWA 2XVJA 3GWFA 3JVAA 1UKVG 2W3RA 1B5QA 2OLNA 1PJ7A 5JCKA 4H4VA 4B64A 3PWIA 5JCLA 1H81A 4DGKA 1P43A 3CGEA 1TE6A 4OCGA 4HPNA 4UP3A 1N5XA 3PO7A 4CY8A 3ISHA 3UOYA 3VRBA 2OVLA 4GISA 3HZLA 2RABA 4EQSA 3NYEA 1X31B 3HYXA 3IWAA 2BXSA 3K1GA 2MUCA 1IJHA 1F6MA 3Q9TA 1FOHA 2HZGA 2AR8A 3ALMA 1JEHA 1SJDA 3GMCA 1PXAA 5FS8A 2BACA 3UJ2A 4H19A 1DOEA 3UOVA 4A9WA 3I3LA 3HRDC 1KF6A 2OLOA 2NPXA 1MXTA 3KVEA 4OPUA 2YG3A 2P8CA 2C75A 5BUKA 1JRZA 3EKGA 4GRTA 2B9YA 1S3EA 4APNA 2XLPA 3AE8A 1E1LA 2VRLA 1ZMCA 3UXLA 3LZXA 1BKWA 2C7GA 2PS2A 1TDEA 2XDOA 3Q4DA 1F8WA 5ENLA 2BXRA 1MUCA 1XANA 4H2PA 3GC2A 4DXKA 3C4NA 3SN1A 1TRBA 1JNZA 4CRTA 3AYLA 2EQ9A 4P9SA 1BGNA 5LV9A 1ZOYA 2OFJA 4MJWA 3UCCA 1GT8A 4GAVA 5BOEA 2B7RA 2TMDA 3TJIA 2ARDA 3S5WA 3DJEA 2CVJA 2YG6A 3DDMA 3UTGA 3CXBA 5IQ1A 1MOKA 3OZ2A 2W54A 2JB1A 4Z24A 1E39A 1IYXA 1DODA 1GRGA 4EMIA 1GTEA 1JDFA 3GYXA 4JNAA 3AEBA 4FX9A 3RITA 2YLXA 1EC9A 1ZY8A 4ZOHB 2PCEA 3DA1A 2C72A 5J04A 3UKQA 2XFQA 3CNJA 2YVGA 4GDPA 3NVVB 1PN0A 3AE6A 1DOBA 1H86A 1S7MA 4ZCWA 2APGA 1LTXR 1B37A 4K22A 1NELA 4J33A 1N5WC 2VRMA 2HXUA 4XWRA 3C96A 3QVRA 1BGJA 4BURA 4Y4MA 1N4VA 4DN1A 4U8NA 3S61A 3SJNA 2Z5YA 3MY9A 4DNAA 2OLAA 4G6HA 3B9JB 2OA1A 2P0IA 1F3PA 4GUVA 3KU9A 4OPGA 2P8BA 1LPFA 1EBHA 3K7QX 3A7AA 1NENA 2IVDA 1OJCA 3UP4A 1JRPA 2XLUA 4HN8A 1KKRA 1TZZA 4JN8A 2Q0LA 2E3TA 1GNDA 1ZDLA 4IA6A 4G74A 4U2SA 2FBWA 4TLXA 1GREA 3REDA 3T8QA 4IV9A 1E6EA 4A65A 1BZLA 5BOFA 4DX3A 3I4KA 4Z26A 4BV6A 4GGBA 1BF3A 1GSNA 3P93A 1BQGA 2GQWA 4H4YA 1YEYA 1PS9A 2XFNA 1IUTA 3RGTA 1VG9A 3NRNA 3T9PA 5CQFA 3CGCA 3V3WA 1P2HA 2QJNA 1BKHA 5KMRA 4YWOA 4GAPA 3SQPA 5KOWA 4LIIA 2PPGA 2VZ2A 2OAMA 3GRTA 3DIPA 4U8LA 3SZFA 3F8RA 2P88A 4AT2A 3UCLA 3UJEA 3KPFA 5FMHA 3KUMA 3AE4A 5TR3A 4G9KA 3PK7A 1NHQA 4A6GA 3IF9A 4U8OA 2CDUA 1JU2A 2JAEA 3MZNA 4Z43A 4F4RA 2GGEA 2XH7A 4Z1YA 2YWLA 1PJ5A 1KNPA 3H70A 3UXKA 2WPEA 4NEWA 2BYBA 4CY6A 4H2NA 2A8XA 3S5SA 3NIXA 2YVJA 3B97A 3O0HA 1KSUA 4C74A 3OTRA 5FJOA 3QLDA 3PFRA 1Y0PA 4DWDA 2A87A 2GQFA 4E0VA 3QSMA 2XLSA 4YSXA 4H4RA 1IUWA 3A7RA 3AECA 3OP2A 4IP5A 1CJ3A 4Z25A 1FIQB 5KNLA 3UOZA 2WP5A 5HYMA 1NPXA 1PBCA 4WX1A 3H12A 1CJ2A 1E1KA 3AWIA 3P4RA 2ZBWA 4A79A 3JZUA 4K7ZA 3R1ZA 3UJRA 3ZLHA 3AE3A 3T2YA 1NG3A 4ZN0A 1M64A 2V3AA 3CGBA 3UGVA 3NN0X 1MO9A 4K2XA 3DH9A 2R46A 3F8PA 5M10A 1EBGA 4YSZA 2VQBA 1V97A 3I6DA 5JRBA 4WCTA 4K8GA 2OZ8A 1E1MA 3H7VA 3BNMA 3LZWA 3OW1A 3T31A 4BJYA 2WQYA 3IHGA 3ETRB 3ABVA 4IL0A 4A99A 4JDRA 2QCUA 2PP3A 3MSYA 1TYPA 4IT1A 4X9NA 1H7XA 1PBBA 2PTWA 3T2KA 3AEDA 2GMHA 3DJGX 1E1NA 4NNJA
chains in the Genus database with same CATH topology
2GR3A 3CTYA 3BHKA 2YM2A 4Z2RA 1VQWA 1JRYA 2AR8A 2Y6RA 4Z44A 3ALMA 1VRQB 4J56A 1JEHA 4JN9A 3T14A 2EQ7A 2NVKX 3GMCA 4USRA 1PXAA 5FS8A 2BACA 1CL0A 3H8LA 3B6DA 3SYIA 1BWCA 1GRBA 2BC0A 3EANA 1DOEA 2VQ7A 2XVHA 3UOVA 2XFUA 4U2TA 4G6GA 4A9WA 3I3LA 1KF6A 4AP1A 1ONFA 2OLOA 1MXTA 2NPXA 2GRTA 2YLSA 4EQXA 3KVEA 4B68A 3DK9A 3QFBA 3ATQA 5FS9A 4BK1A 4OPUA 3DJDA 5KXJA 1IUXA 2YG3A 2C75A 3ADAB 5BUKA 3OC4A 1D7YA 1GRFA 1JRZA 2RGHA 2YVFA 2GF3A 1LQUA 1PDHA 3K7MX 4GRTA 3NTAA 1K0JA 2JKCA 2B9YA 3WE0A 3PVCA 2X50A 1S3EA 2Y6QA 3GDPA 4BJZA 4APNA 2XLPA 5BVAA 3SZCA 3AE8A 3RHAA 4A7AA 1E1LA 2VRLA 3LOVA 4B63A 1L9DA 1ZMCA 1Y56B 2YAUA 3BI5A 4H4XA 1NHRA 3CMMA 3LZXA 4B67A 1BKWA 2C7GA 3GSIA 1FEAA 2XYOA 4EM3A 1TDEA 3G5RA 2XDOA 3NHOX 4H4UA 1F8WA 4XXGA 4H4TA 5HXIA 2BK3A 3FPZA 1AOGA 2BXRA 4AP3A 4CCRA 3DK4A 1XANA 4H2PA 2VVLG 4YTMA 2DKHA 1YQ3A 2ACZA 2Q7VA 2GAHB 3H8IA 4IVMB 5BULA 5M0ZA 2BS3A 3C4NA 3SGLA 3AXBA 1TRBA 2YR5A 3SM8A 3VRAA 5ER0A 3UKAA 5FS7A 1JNZA 1H2IA 4CCQA 4CRTA 3AYLA 1CHUA 2EQ9A 4P9SA 3UKLA 1N4WA 1BGNA 1HYUA 3KKJA 1PHHA 2XLRA 2YG7A 4G73A 1COYA 4N9XA 3SXIA 5J60A 5LV9A 1ZOYA 1L0VA 1CJCA 2X8CA 5KVIA 1S2YA 3BHFA 3NGCX 4MJWA 2WESA 1KFYA 1YY5A 1S2QA 3CPIG 1Q1WA 1GT8A 4EQWA 2BABA 3FBSA 4GAVA 2EQ6A 2R0GA 3T37A 1YQZA 1O94A 3NK1X 4NWZA 1P2EA 2B7RA 1D5TA 2TMDA 1H6VA 5CKUA 2C64A 4K5RA 4TM4A 2ARDA 3S5WA 4EMJA 3DJEA 3UKFA 2CVJA 4ADWA 2YG6A 3UTGA 2R9ZA 1GERA 1CC4A 2HQMA 1GESA 1EL7A 1PBDA 1MOKA 2B76A 1GXFA 5IQ1A 2C3CA 1L9EA 3OZ2A 4H4WA 2QA2A 3L1RA 4U8KA 2XVFA 2JB1A 4GR1A 2DKIA 4Z24A 3VQRA 4D03A 3CNSA 3L8KA 1RSGA 3GMBA 4II3A 2YR6A 1E39A 1DODA 2YR4A 3NK2X 1GRGA 4EQRA 4EMIA 2EQ8A 3PG6A 4UDRA 1GTEA 4J34A 4YXDA 4EIQA 3GYXA 3AEBA 4EM4A 4JNAA 3EAOA 4FX9A 2YLXA 3EF6A 1IUVA 2R4EA 2FJAA 3RNMA 1IUUA 4H7UA 3QSEA 1GV4A 1ZY8A 4JQ9A 3DA1A 4RSLA 3ICTA 3NN6X 2C72A 3V3NA 3P1WA 4I58A 4H4ZA 2R45A 3UKQA 2XFQA 1QO8A 3CNJA 1H7WA 1DOCA 2YVGA 4GDPA 1TDKA 2C73A 1DJQA 1PN0A 3D1CA 3AE6A 1DOBA 1H86A 1LV0A 4HA6A 5C2TA 1S7MA 2APGA 4C3YA 3BI4A 3DGZA 1LTXR 2Z5XA 3G5QA 4YSHA 4JY2A 2GEWA 1TDNA 1B37A 4K22A 5EB4A 4J33A 2WHDA 3DMEA 2VRMA 3AYJA 2H88A 1K0LA 4XWRA 4OPLA 4AOSA 5BRTA 3C96A 3QVRA 1V59A 2GH5A 4BURA 3DJJA 1BGJA 2GMJA 4H4PA 2Q0KA 2WU2A 2WPCA 3AD8B 2PYXA 1VG0A 3ATRA 4J31A 4Y4MA 1N4VA 2FJDA 3II4A 1W4XA 5GRTA 3NK0X 1REOA 2ZZBA 3GD3A 5JCIA 2YLRA 3NNEA 4U8NA 4NTEA 3S61A 4X4JA 3KD9A 4FDCB 2XFPA 2Z5YA 3P4PA 4ZCCA 4DNAA 2F5ZA 1PBEA 4RG3A 2GR0A 4G6HA 2WOVA 2JB2A 3D9XA 1NEKA 2B9WA 1EBDA 2OA1A 3PS9A 1KDGA 1F3PA 2BK4A 3ICSA 1NDAA 2W0HA 3LB8A 1O95A 2FJEA 3SFEA 5KWFA 4GUVA 1XDIA 4Y4LA 1H84A 3EPTA 3NLCA 2CULA 3KU9A 4OPGA 3BI2A 2R0PA 1LPFA 3AD7B 3K7QX 4K8DA 4KX6A 4B65A 1GETA 3SY4A 3T0KA 1NENA 2BRAA 2IVDA 1OJCA 3UP4A 3P4QA 1CC2A 2XLUA 1JRXA 5J7XA 2R4JA 4H4SA 3FMWA 1Q1RA 4H2RA 5U63A 2C3DA 1PXBA 1TDFA 2FJBA 3ZDNA 1OJAA 4C5OA 3RP7A 2Q0LA 1GNDA 3M13A 4JNQA 1D4EA 5IPYA 4C3XA 1ZDLA 4IA6A 4G74A 4U2SA 2FBWA 4TM1A 3K30A 1SEZA 1DXLA 2C67A 2O9ZA 1GRAA 2A89A 1M6IA 1GREA 3K7TA 4OVIA 2RGOA 3M0OA 4TLXA 5U1OA 3HYWA 1F8RA 3AE2A 3REDA 2WBAA 4IV9A 2RGJA 1E6EA 4REKA 5HHFA 4A65A 2J3NA 2XCGA 1BZLA 5KRQA 2BS4A 2V5ZA 3NTDA 3V3OA 2WETA 3FIMB 2E1MA 1FL2A 2YLTA 3CIRA 3NKSA 3COXA 4Z26A 4YKGA 4TM3A 1DNCA 1IUSA 3RP8A 1OJ9A 3UP5A 4A6NA 3AE7A 4U8PA 4O5UA 4BV6A 1BF3A 4TLZA 1GSNA 1D7LA 1CF3A 3P9UA 2GQWA 1Y56A 1Q9IA 4H4YA 2TPRA 1PS9A 2XFNA 3QJ4A 1CC6A 3AEGA 1IUTA 1FECA 4KPRA 4YT0A 1VG9A 1E7PA 2WPFA 3KPKA 3NRNA 5CQFA 3CGCA 1CJ4A 3ITJA 3AE9A 3URHA 4LU6A 3UKKA 1P2HA 4FK1C 2OALA 3HYVA 3SFDA 4C77A 4I59A 2ZZCA 5KMRA 3CNTA 4A5LA 4J57A 4YWOA 3QVPA 4GAPA 4IVOB 1FEBA 3SQPA 4LIIA 5KOWA 2V6OA 2VZ2A 2OAMA 2WOIA 4TM0A 3NH3X 3DGHA 2VVLA 3GRTA 1XHCA 4ICYA 2X8GA 2BCPA 4B69A 4IA5A 4U8LA 1LVLA 3SZFA 3F8RA 1ELIA 3GWDA 2PHHA 1H83A 1YQ4A 4AT2A 3UCLA 2UZZA 5U25A 1K4QA 2YLZA 2WDVA 3SX6A 3LXDA 2CFYA 3KPFA 5FMHA 3V76A 4Y4NA 2WP6A 3AE4A 5TR3A 1QLBA 4G9KA 4O5QA 4U2LA 3ALJA 1OJDA 3RP6A 4J2WA 5L46A 1FCDA 5KMPA 1TYTA 1NHQA 4NEVA 2I0ZA 3VRDB 1NAAA 3JSKA 1H82A 2C66A 2BCGG 3IF9A 3CN8A 4DSHA 1B4VA 3IC9A 4U8OA 4OPDA 4BK2A 2CDUA 2QAEA 1JU2A 2JAEA 4JY3A 3ZYXA 2IIDA 1LJ1A 2XVEA 5EB5A 5KMSA 2V61A 1GTHA 1XPQA 5HY5A 1GEUA 4H50A 1B8SA 4Z43A 2JB3A 3GRSA 1D4CA 4CBQA 2X99A 1O5WA 2Q6UA 4YSYA 2YWLA 1KN0A 3B3RA 1JOAA 3CNDA 1DJNA 1PJ5A 1GRHA 4GDEA 3ALLA 3CNPA 2XLTA 1KNPA 3M12A 2H89A 4GCMA 1K0IA 2VVMA 1CBOA 2WPEA 3H4KA 4NEWA 1PBFA 4HB9A 2BYBA 4K5SA 4CY6A 1NG4A 4BK3A 2JK6A 4H2NA 2E4GA 4H2QA 2A8XA 3QFAA 2WS3A 1RYIA 2WEUA 3NIXA 5IQ4A 2YVJA 1PXCA 2B9XA 4OPCA 3O0HA 2GR1A 4CNJA 3UTFA 4U8MA 1OJTA 1EL5A 2ZZ0A 4FK1A 1N4UA 1KSUA 3GYJA 2GVCA 4PABA 2V60A 4USQA 3UKHA 1YKJA 4C74A 5C3JA 2BA9A 1VDCA 3GYIA 2YM1A 1KSSA 2E5VA 3SZ0A 1QJDA 2BRYA 3L5OA 1EL9A 1Y0PA 1GALA 3NG7X 3AEEA 2A87A 4II2A 1ZX9A 4B1BA 2GQFA 4E0VA 2GR2A 4M52A 2XLSA 3G5SA 1PJ6A 3QSMA 4NTDA 4YSXA 4H4QA 4H4RA 1IUWA 4GF7A 2AAQA 2X8HA 4OPTA 3VR9A 3LADA 1L9CA 3AECA 4UDQA 4YTPA 3BNUA 5EOWA 1CJ3A 3SZWA 4B66A 3KA7A 3NT6A 1ZP0A 4NTCA 2C4CA 4Z25A 3IHMA 2IVEA 3C4AA 5KNLA 2GV8A 1TDOA 5FS6A 3UOXA 3UOZA 2WP5A 5HYMA 2C70A 3GDNA 3LJPA 1NPXA 1PBCA 4WX1A 4XWZA 1CJ2A 1E1KA 3AWIA 3P4RA 2ZBWA 4A79A 3UKPA 3UTEA 4K7ZA 4U8JA 3AEFA 4YKFA 2BS2A 2C65A 1F8SA 2GB0A 4EMWA 2B7SA 2R0CA 3AE3A 1LQTA 4A6NB 3AE5A 3CPHG 3T2YA 1NG3A 2YQUA 2X3NA 4ZN0A 1M64A 3AYIA 2V3AA 1Z6LA 4YTNA 1ZK7A 1RP0A 3CGBA 2YG4A 3P4SA 2V3BA 3NN0X 3Q6JA 1N1PA 2VOUA 1MO9A 2QA1A 4K2XA 5EBKA 2BK5A 2BC1A 3CGDA 4CNKA 2WDRA 2WP9A 3DH9A 2YLWA 2XVJA 3VR8A 3GWFA 1UKVG 3QSSA 1GRTA 1B5QA 2OLNA 1PJ7A 2R46A 4ZCDA 5JCKA 1GOSA 3NYCA 4H4VA 3F8PA 5M10A 1KNRA 3AB1A 4DSGA 2GAGB 4UDPA 5KMQA 5JCLA 2VQBA 2XFOA 4B64A 1H81A 3I6DA 4YSZA 4Z2TA 4DGKA 2XVIA 5JRBA 3CGEA 4WCTA 3FG2P 3GD4A 3AD9B 4X9MA 4AOXA 4J36A 4OCGA 1E1MA 4Z2UA 3BNMA 3R9UA 3LZWA 1S3BA 4NZHA 1NHPA 5KVHA 3T31A 4LA1A 4BJYA 4UP3A 2WU5A 3F8DA 4OPIA 1NHSA 2WQYA 3PO7A 4CY8A 3IHGA 3ISHA 3T2ZA 3NYFA 2WDQA 4ECHA 1ZOVA 3DK8A 1EL8A 3ABVA 2AQJA 3D8XA 3UOYA 4A99A 2WOWA 3VRBA 3AEAA 4JDRA 5DBJA 3HZLA 2QCUA 5JCNA 3CPJG 4AT0A 5KOXA 1ZMDA 2RABA 1TYPA 4EQSA 4X9NA 2JBVA 3NYEA 1H7XA 2C76A 1ZKQA 1X31B 1GPEA 3ICRA 4U8IA 1PBBA 5JCMA 4EIPA 1D4DA 3HYXA 3IWAA 1JNRA 2BXSA 3T2KA 3AEDA 2GMHA 2YG5A 1IJHA 3UTHA 3AE1A 4RG4A 3DJGX 1E1NA 1F6MA 4NNJA 4PAAA 5GSNA 3Q9TA 1FOHA 3KLJA 3E1TA 4D04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR3 A;  3CTY A;  3BHK A;  2YM2 A;  4Z2R A;  1VQW A;  1JRY A;  2AR8 A;  2Y6R A;  4Z44 A;  3ALM A;  1VRQ B;  4J56 A;  1JEH A;  4JN9 A;  2EQ7 A;  2NVK X;  3GMC A;  4USR A;  1PXA A;  5FS8 A;  2BAC A;  1CL0 A;  3H8L A;  3B6D A;  1BWC A;  1GRB A;  1DOE A;  2BC0 A;  2VQ7 A;  2XVH A;  3EAN A;  3UOV A;  2XFU A;  4U2T A;  4A9W A;  3I3L A;  1KF6 A;  4AP1 A;  1ONF A;  2OLO A;  1MXT A;  2NPX A;  2GRT A;  2YLS A;  3KVE A;  4B68 A;  4EQX A;  3DK9 A;  3QFB A;  3ATQ A;  5FS9 A;  4BK1 A;  4OPU A;  4BUR A;  3DJD A;  5KXJ A;  1IUX A;  2YG3 A;  2C75 A;  3ADA B;  5BUK A;  3OC4 A;  1D7Y A;  1GRF A;  1JRZ A;  2RGH A;  2YVF A;  2GF3 A;  1LQU A;  1PDH A;  3K7M X;  3NTA A;  4GRT A;  1K0J A;  2JKC A;  2B9Y A;  3WE0 A;  3PVC A;  1S3E A;  2X50 A;  2Y6Q A;  3GDP A;  4BJZ A;  4APN A;  2XLP A;  5BVA A;  3AE8 A;  3RHA A;  4A7A A;  1E1L A;  2VRL A;  3LOV A;  4B63 A;  1L9D A;  1Y56 B;  1ZMC A;  2YAU A;  3BI5 A;  4H4X A;  1NHR A;  3LZX A;  4B67 A;  1BKW A;  2C7G A;  3GSI A;  1FEA A;  2XYO A;  1TDE A;  3G5R A;  4EM3 A;  2XDO A;  3NHO X;  4H4U A;  1F8W A;  4XXG A;  4H4T A;  5HXI A;  2BK3 A;  3FPZ A;  2BXR A;  1AOG A;  4AP3 A;  4CCR A;  3DK4 A;  1XAN A;  4H2P A;  2VVL G;  4YTM A;  2DKH A;  1YQ3 A;  2ACZ A;  2Q7V A;  2GAH B;  3H8I A;  4IVM B;  5BUL A;  5M0Z A;  2BS3 A;  3C4N A;  3SGL A;  3AXB A;  1TRB A;  2YR5 A;  3SM8 A;  3VRA A;  5ER0 A;  3UKA A;  1JNZ A;  5FS7 A;  4CCQ A;  4CRT A;  3AYL A;  1CHU A;  2EQ9 A;  4P9S A;  3UKL A;  1N4W A;  1BGN A;  1HYU A;  3KKJ A;  1PHH A;  2XLR A;  2YG7 A;  4N9X A;  1COY A;  5J60 A;  5LV9 A;  1ZOY A;  1L0V A;  1CJC A;  2X8C A;  5KVI A;  1S2Y A;  3BHF A;  3NGC X;  4MJW A;  2WES A;  1KFY A;  1YY5 A;  1S2Q A;  3CPI G;  1Q1W A;  1GT8 A;  4EQW A;  2BAB A;  3FBS A;  2EQ6 A;  2R0G A;  3T37 A;  1O94 A;  1YQZ A;  3NK1 X;  1P2E A;  2B7R A;  1D5T A;  2TMD A;  1H6V A;  5CKU A;  2C64 A;  4K5R A;  4TM4 A;  2ARD A;  3S5W A;  3DJE A;  3UKF A;  4EMJ A;  2CVJ A;  4ADW A;  2YG6 A;  3UTG A;  2R9Z A;  1GER A;  1CC4 A;  2HQM A;  1EL7 A;  1GES A;  1MOK A;  2B76 A;  1PBD A;  1GXF A;  5IQ1 A;  2C3C A;  1L9E A;  3OZ2 A;  4H4W A;  2QA2 A;  3L1R A;  4U8K A;  2XVF A;  2JB1 A;  4GR1 A;  2DKI A;  4Z24 A;  3VQR A;  4D03 A;  3CNS A;  3L8K A;  1RSG A;  3GMB A;  2YR6 A;  1E39 A;  1DOD A;  2YR4 A;  3NK2 X;  1GRG A;  4EQR A;  4EMI A;  2EQ8 A;  4UDR A;  1GTE A;  4J34 A;  4YXD A;  4EIQ A;  3AEB A;  4JNA A;  4EM4 A;  3EAO A;  2YLX A;  4FX9 A;  3EF6 A;  1IUV A;  2R4E A;  2FJA A;  3RNM A;  1IUU A;  4H7U A;  3QSE A;  1GV4 A;  1ZY8 A;  4JQ9 A;  3DA1 A;  4RSL A;  3ICT A;  3NN6 X;  2C72 A;  3V3N A;  3P1W A;  4I58 A;  4H4Z A;  2R45 A;  3UKQ A;  2XFQ A;  1QO8 A;  3CNJ A;  1H7W A;  1DOC A;  2YVG A;  4GDP A;  1TDK A;  2C73 A;  1DJQ A;  1PN0 A;  3D1C A;  3AE6 A;  1DOB A;  1H86 A;  1LV0 A;  4HA6 A;  5C2T A;  2APG A;  4C3Y A;  3BI4 A;  1LTX R;  2Z5X A;  3DGZ A;  3G5Q A;  4YSH A;  4JY2 A;  2GEW A;  1TDN A;  1B37 A;  4K22 A;  5EB4 A;  4J33 A;  2WHD A;  3DME A;  2VRM A;  3AYJ A;  2H88 A;  1K0L A;  4XWR A;  4OPL A;  4AOS A;  5BRT A;  3C96 A;  3QVR A;  1BGJ A;  1V59 A;  2GH5 A;  2Q0K A;  2GMJ A;  2WU2 A;  3AD8 B;  3DJJ A;  4H4P A;  2WPC A;  4J31 A;  2PYX A;  1VG0 A;  3ATR A;  4Y4M A;  1N4V A;  2FJD A;  3II4 A;  1W4X A;  5GRT A;  3NK0 X;  1REO A;  2ZZB A;  3GD3 A;  3NNE A;  2YLR A;  4U8N A;  5JCI A;  4NTE A;  3S61 A;  4X4J A;  3KD9 A;  2XFP A;  3P4P A;  2Z5Y A;  4FDC B;  4ZCC A;  4DNA A;  2F5Z A;  1PBE A;  4RG3 A;  2GR0 A;  2WOV A;  2JB2 A;  1NEK A;  2B9W A;  1EBD A;  2OA1 A;  3PS9 A;  1KDG A;  1F3P A;  2BK4 A;  3ICS A;  1NDA A;  1O95 A;  2W0H A;  2FJE A;  3LB8 A;  3SFE A;  5KWF A;  4GUV A;  1XDI A;  4Y4L A;  1H84 A;  3EPT A;  3NLC A;  2CUL A;  3KU9 A;  4OPG A;  3BI2 A;  2R0P A;  1LPF A;  3AD7 B;  3K7Q X;  4K8D A;  4KX6 A;  4B65 A;  1GET A;  1NEN A;  2IVD A;  1OJC A;  3UP4 A;  3P4Q A;  1CC2 A;  2XLU A;  1JRX A;  5J7X A;  2R4J A;  4H4S A;  3FMW A;  1Q1R A;  4H2R A;  5U63 A;  1PXB A;  2C3D A;  1TDF A;  2FJB A;  3ZDN A;  1OJA A;  4C5O A;  3RP7 A;  2Q0L A;  1GND A;  3M13 A;  4JNQ A;  1D4E A;  5IPY A;  4C3X A;  1ZDL A;  4IA6 A;  4U2S A;  2FBW A;  4TM1 A;  3K30 A;  2O9Z A;  1SEZ A;  1DXL A;  2C67 A;  1GRA A;  2A89 A;  1M6I A;  1GRE A;  3K7T A;  4OVI A;  2RGO A;  3M0O A;  4TLX A;  5U1O A;  1F8R A;  3AE2 A;  3RED A;  2WBA A;  4IV9 A;  2RGJ A;  1E6E A;  4REK A;  5HHF A;  4A65 A;  2J3N A;  2XCG A;  1BZL A;  5KRQ A;  2BS4 A;  2V5Z A;  3NTD A;  3V3O A;  2WET A;  3FIM B;  2E1M A;  1FL2 A;  2YLT A;  3CIR A;  3NKS A;  3COX A;  4Z26 A;  4YKG A;  4TM3 A;  1IUS A;  1DNC A;  3RP8 A;  1OJ9 A;  3UP5 A;  4A6N A;  3AE7 A;  4U8P A;  4O5U A;  4BV6 A;  1BF3 A;  4TLZ A;  1GSN A;  1D7L A;  1CF3 A;  3P9U A;  2GQW A;  1Y56 A;  1Q9I A;  4H4Y A;  2TPR A;  1PS9 A;  2XFN A;  3QJ4 A;  1CC6 A;  3AEG A;  1IUT A;  1FEC A;  4KPR A;  4YT0 A;  1VG9 A;  1E7P A;  2WPF A;  3NRN A;  5CQF A;  3CGC A;  1CJ4 A;  3ITJ A;  3AE9 A;  4LU6 A;  3URH A;  3UKK A;  1P2H A;  4FK1 C;  2OAL A;  3SFD A;  4C77 A;  4I59 A;  2ZZC A;  3CNT A;  4A5L A;  4J57 A;  4YWO A;  3QVP A;  4IVO B;  1FEB A;  3SQP A;  4LII A;  5KOW A;  2V6O A;  2VZ2 A;  2OAM A;  2WOI A;  4TM0 A;  3NH3 X;  2VVL A;  3DGH A;  3GRT A;  1XHC A;  4ICY A;  2X8G A;  2BCP A;  4B69 A;  4IA5 A;  4U8L A;  1LVL A;  3F8R A;  1ELI A;  3GWD A;  2PHH A;  1H83 A;  1YQ4 A;  4AT2 A;  3UCL A;  2UZZ A;  5U25 A;  1K4Q A;  2YLZ A;  2WDV A;  3LXD A;  2CFY A;  3KPF A;  5FMH A;  3V76 A;  4Y4N A;  2WP6 A;  3AE4 A;  5TR3 A;  1QLB A;  4O5Q A;  4U2L A;  3ALJ A;  1OJD A;  3RP6 A;  4J2W A;  5L46 A;  1FCD A;  1TYT A;  1NHQ A;  2I0Z A;  4NEV A;  3VRD B;  1NAA A;  3JSK A;  1H82 A;  2C66 A;  2BCG G;  3IF9 A;  3CN8 A;  4DSH A;  1B4V A;  3IC9 A;  4U8O A;  4OPD A;  4BK2 A;  2CDU A;  2QAE A;  1JU2 A;  2JAE A;  4JY3 A;  3ZYX A;  2IID A;  1LJ1 A;  2XVE A;  5EB5 A;  2V61 A;  1GTH A;  1XPQ A;  5HY5 A;  1GEU A;  1B8S A;  4H50 A;  4Z43 A;  2JB3 A;  3GRS A;  1D4C A;  4CBQ A;  2X99 A;  1O5W A;  2Q6U A;  4YSY A;  2YWL A;  3B3R A;  1JOA A;  3CND A;  1DJN A;  1PJ5 A;  1GRH A;  4GDE A;  3ALL A;  3CNP A;  2XLT A;  1KNP A;  3M12 A;  2H89 A;  4GCM A;  1K0I A;  2VVM A;  1CBO A;  2WPE A;  3H4K A;  4NEW A;  1PBF A;  4HB9 A;  2BYB A;  4K5S A;  4CY6 A;  1NG4 A;  4BK3 A;  2JK6 A;  4H2N A;  2E4G A;  4H2Q A;  2A8X A;  3QFA A;  2WS3 A;  1RYI A;  2WEU A;  3NIX A;  5IQ4 A;  2YVJ A;  1PXC A;  2B9X A;  4OPC A;  3O0H A;  2GR1 A;  4CNJ A;  3UTF A;  4U8M A;  1OJT A;  1EL5 A;  2ZZ0 A;  4FK1 A;  1KSU A;  1N4U A;  3GYJ A;  2GVC A;  4PAB A;  2V60 A;  4USQ A;  3UKH A;  1YKJ A;  4C74 A;  5C3J A;  2BA9 A;  1VDC A;  3GYI A;  2YM1 A;  1KSS A;  2E5V A;  1QJD A;  1EL9 A;  1Y0P A;  1GAL A;  3NG7 X;  3AEE A;  2A87 A;  1ZX9 A;  4B1B A;  2GQF A;  4E0V A;  2GR2 A;  3G5S A;  2XLS A;  3QSM A;  1PJ6 A;  4M52 A;  4NTD A;  4YSX A;  4H4Q A;  4GF7 A;  1IUW A;  4H4R A;  2AAQ A;  2X8H A;  4OPT A;  3VR9 A;  3LAD A;  1L9C A;  3AEC A;  4UDQ A;  4YTP A;  3BNU A;  5EOW A;  1CJ3 A;  4B66 A;  3KA7 A;  3NT6 A;  1ZP0 A;  4NTC A;  4Z25 A;  3IHM A;  2IVE A;  3C4A A;  2GV8 A;  1TDO A;  5FS6 A;  3UOX A;  3UOZ A;  2WP5 A;  5HYM A;  2C70 A;  3GDN A;  3LJP A;  1NPX A;  1PBC A;  4WX1 A;  4XWZ A;  1CJ2 A;  1E1K A;  3AWI A;  3P4R A;  2ZBW A;  4A79 A;  3UKP A;  3UTE A;  4K7Z A;  4U8J A;  3AEF A;  4YKF A;  2BS2 A;  2C65 A;  1F8S A;  2GB0 A;  2B7S A;  2R0C A;  3AE3 A;  4A6N B;  1LQT A;  4EMW A;  3AE5 A;  3CPH G;  1NG3 A;  2X3N A;  2YQU A;  4ZN0 A;  1M64 A;  3AYI A;  2V3A A;  1Z6L A;  4YTN A;  1ZK7 A;  1RP0 A;  2YG4 A;  3CGB A;  3P4S A;  2V3B A;  3NN0 X;  2VOU A;  1N1P A;  3Q6J A;  1MO9 A;  2QA1 A;  4K2X A;  5EBK A;  2BK5 A;  2BC1 A;  3CGD A;  4CNK A;  2WDR A;  2WP9 A;  2YLW A;  3DH9 A;  2XVJ A;  3VR8 A;  3GWF A;  1UKV G;  3QSS A;  1B5Q A;  1GRT A;  2OLN A;  1PJ7 A;  2R46 A;  4ZCD A;  5JCK A;  1GOS A;  3NYC A;  3F8P A;  4H4V A;  5M10 A;  1KNR A;  3AB1 A;  4DSG A;  2GAG B;  4UDP A;  4B64 A;  2VQB A;  2XFO A;  4YSZ A;  5JCL A;  1H81 A;  3I6D A;  4Z2T A;  4DGK A;  2XVI A;  3CGE A;  4WCT A;  3FG2 P;  3AD9 B;  3GD4 A;  4X9M A;  4AOX A;  4J36 A;  4OCG A;  1E1M A;  4Z2U A;  3BNM A;  3R9U A;  3LZW A;  1S3B A;  4NZH A;  1NHP A;  5KVH A;  4LA1 A;  4BJY A;  4UP3 A;  2WU5 A;  3F8D A;  4OPI A;  1NHS A;  2WQY A;  3PO7 A;  4CY8 A;  3IHG A;  3ISH A;  4ECH A;  3NYF A;  2WDQ A;  1ZOV A;  3ABV A;  1EL8 A;  3DK8 A;  2AQJ A;  3D8X A;  3UOY A;  4A99 A;  2WOW A;  3VRB A;  3AEA A;  4JDR A;  5DBJ A;  3HZL A;  2QCU A;  3CPJ G;  4AT0 A;  5JCN A;  5KOX A;  1ZMD A;  2RAB A;  1TYP A;  4X9N A;  4EQS A;  2JBV A;  3NYE A;  1H7X A;  2C76 A;  1ZKQ A;  1X31 B;  1GPE A;  3ICR A;  4U8I A;  1PBB A;  5JCM A;  4EIP A;  1D4D A;  3IWA A;  1JNR A;  2BXS A;  3AED A;  2GMH A;  2YG5 A;  1IJH A;  3UTH A;  3AE1 A;  4RG4 A;  1F6M A;  1E1N A;  3DJG X;  4PAA A;  5GSN A;  3Q9T A;  1FOH A;  3KLJ A;  3E1T A;  4D04 A; 
#chains in the Genus database with same CATH topology
 3CTY A;  4Z2R A;  1VQW A;  1JRY A;  4Z44 A;  2FKP A;  2Y6R A;  2PMQ A;  4JN9 A;  3T14 A;  2EQ7 A;  3DGB A;  1KCZ A;  3H8L A;  1GRB A;  2BC0 A;  3CYJ A;  4AP1 A;  3RRA A;  2YLS A;  4B68 A;  3DK9 A;  3HPF A;  5FS9 A;  3DES A;  3VCN A;  3ADA B;  3OC4 A;  1D7Y A;  2RGH A;  1K0J A;  3WE0 A;  2X50 A;  2Y6Q A;  3VFC A;  3LOV A;  3ENL A;  2YAU A;  3BI5 A;  4B67 A;  3CMM A;  3GSI A;  1FEA A;  4H4T A;  2BK3 A;  1AOG A;  4CCR A;  2OQH A;  2VVL G;  4YTM A;  2ACZ A;  2GAH B;  2YR5 A;  3SM8 A;  1H2I A;  3P0W A;  1CHU A;  3UKL A;  5J60 A;  1PHH A;  3SXI A;  2NQL A;  3DG3 A;  1CJC A;  3NGC X;  2WES A;  3CPI G;  1S2Q A;  1Q1W A;  2I5Q A;  3NFU A;  2PSN A;  1P2E A;  1H6V A;  4TM4 A;  3THU A;  4ADW A;  5IDZ A;  4X2P A;  2HQM A;  1GES A;  1PBD A;  2B76 A;  1GXF A;  4H4W A;  3ZLF A;  2XVF A;  4GR1 A;  4M6U A;  4D03 A;  2YR6 A;  2YR4 A;  3D46 A;  2EQ8 A;  3PG6 A;  1STZ A;  3AMZ A;  4JHM A;  4YXD A;  3EAO A;  1IUV A;  2R4E A;  1N60 C;  1GV4 A;  4JQ9 A;  3ICT A;  4H4Z A;  2HXT A;  1H7W A;  1DOC A;  3D1C A;  1KD0 A;  1ELS A;  5G5H B;  3BI4 A;  3DGZ A;  4JY2 A;  3U4F A;  3QN3 A;  1V59 A;  2GH5 A;  2GMJ A;  3ATR A;  2FJD A;  3H8A A;  5GRT A;  1REO A;  3NNE A;  4NTE A;  4E4U A;  3CT2 A;  4X4J A;  3KD9 A;  2JB2 A;  2B9W A;  3ICS A;  2GGJ A;  2W0H A;  3EPT A;  2HNE A;  2R0P A;  3AD7 B;  3T0K A;  1JRX A;  4MKS A;  2OG9 A;  4GGH A;  2C3D A;  2GDQ A;  3UCD A;  2FJB A;  3ZDN A;  3R07 C;  3M13 A;  5IPY A;  1ZXI C;  2DW6 A;  2O9Z A;  3S47 A;  1GRA A;  2A89 A;  1M6I A;  3K7T A;  3M0O A;  5U1O A;  3AE2 A;  2WBA A;  3AM9 A;  3TWB A;  5EU9 A;  2V5Z A;  3NTD A;  3FIM B;  3N6J A;  1FL2 A;  2YLT A;  3CIR A;  3NKS A;  3UP5 A;  3RP8 A;  4TLZ A;  2PGW A;  4E4F A;  7ENL A;  1Y56 A;  1Q9I A;  2XSX A;  2QGY A;  3QJ4 A;  3AEG A;  1FEC A;  3CK5 A;  4KPR A;  2WPF A;  3ITJ A;  3AE9 A;  4KWS A;  4K2S A;  4C77 A;  3DFH A;  3TQP A;  3EUB 3;  3QVP A;  4IVO B;  3NH3 X;  1XHC A;  2BCP A;  3STP A;  1LVL A;  3SBF A;  1K4Q A;  2WDV A;  4Y4N A;  1ECQ A;  2WP6 A;  3RP6 A;  5L46 A;  1FCD A;  5KMP A;  3RO6 A;  4NEV A;  2I0Z A;  1NAA A;  1MNS A;  2C66 A;  2BCG G;  3VA8 A;  2QJM A;  2QAE A;  1XPY A;  4EWJ A;  2XVE A;  2V61 A;  1GTH A;  1GEU A;  1B8S A;  1SJB A;  4YSY A;  1KN0 A;  3HW2 A;  4GDE A;  3ALL A;  3CNP A;  2XLT A;  2MNR A;  2VVM A;  2ZC8 A;  4H2Q A;  4G7F A;  1WUF A;  1PXC A;  2B9X A;  2GR1 A;  2XH0 A;  3UTF A;  4U8M A;  2PGE A;  1EL5 A;  2OX4 A;  3GYJ A;  5G5G B;  3TW9 A;  4M0X A;  4USQ A;  1YKJ A;  2BA9 A;  1VDC A;  3GYI A;  4MMW A;  3SZ0 A;  1QJD A;  1EL9 A;  2POZ A;  4IL2 A;  3TOY A;  1GAL A;  2PA6 A;  3AEE A;  2GGG A;  1ZX9 A;  2GR2 A;  1N61 C;  4M52 A;  3G5S A;  4NTD A;  3ZVI A;  4H4Q A;  3IJQ A;  3VR9 A;  4J3Z A;  4HCD A;  3JW7 A;  4UDQ A;  3BNU A;  4B66 A;  1ZP0 A;  3IHM A;  3C4A A;  2GV8 A;  1TDO A;  3ES7 A;  2PU0 A;  4XWZ A;  1JRO A;  6ENL A;  3UKP A;  4U8J A;  4YKF A;  4DYE A;  4EMW A;  3AE5 A;  2CHR A;  1Z6L A;  4YTN A;  1ZK7 A;  2YG4 A;  2GGH A;  3MUC A;  3Q6J A;  1N1P A;  2VOU A;  2GL5 A;  2GSH A;  3OPS A;  2WP9 A;  3VR8 A;  3QSS A;  4ZCD A;  1GOS A;  1L8P A;  3NYC A;  3CB3 A;  2GAG B;  3ES8 A;  4Z17 A;  2XVI A;  3FG2 P;  3GD4 A;  3AD9 B;  4AOX A;  4J36 A;  4Z2U A;  3A7U A;  4NZH A;  1NHP A;  4LA1 A;  3F8D A;  1NHS A;  2WDQ A;  1ZOV A;  2AQJ A;  3D8X A;  3DFY A;  3CPJ G;  1SB3 B;  1ZMD A;  3U9I A;  2JBV A;  1ZKQ A;  3ICR A;  3ZVH A;  1JNR A;  3AE1 A;  4RG4 A;  3D47 A;  1RVK A;  1VDV A;  4KT2 A;  3KLJ A;  3E1T A;  1VRQ B;  4J56 A;  4USR A;  1CL0 A;  3B6D A;  1BWC A;  3EAN A;  2XVH A;  2OO6 A;  1ONF A;  1MDR A;  4BK1 A;  3DJD A;  1IUX A;  2AL2 B;  3VCC A;  1P48 A;  2YVF A;  2GF3 A;  1LQU A;  1PDH A;  3NTA A;  2JKC A;  4BJZ A;  3PVC A;  2OPJ A;  3SZC A;  3RHA A;  4B63 A;  1NHR A;  3Q45 A;  2OQY A;  4H4U A;  3QTP A;  5HXI A;  3FPZ A;  4AP3 A;  2AL1 A;  3R0U A;  1YQ3 A;  2Q7V A;  3H8I A;  1WUE A;  5M0Z A;  2BS3 A;  1R0M A;  3UKA A;  4A3R A;  1N4W A;  2XLR A;  1COY A;  4HCL A;  5KVI A;  3BHF A;  1KFY A;  3FBS A;  2EQ6 A;  3T4W A;  2R0G A;  4HCH A;  1FO4 A;  1PDY A;  3T37 A;  1YQZ A;  1O94 A;  2C64 A;  4K5R A;  3UKF A;  2POD A;  2R9Z A;  1GER A;  3SN4 A;  1CC4 A;  2C3C A;  4U8K A;  2DKI A;  2E5A A;  3L8K A;  3GMB A;  4II3 A;  3NK2 X;  4EQR A;  4UDR A;  4J34 A;  2AKZ A;  4EM4 A;  2FJA A;  3RNM A;  4HNC A;  4H7U A;  3QSE A;  4RSL A;  3NN6 X;  3V3N A;  3P1W A;  1QO8 A;  5FJR A;  1DJQ A;  5C2T A;  2PTX A;  3TCS A;  3G5Q A;  1F9C A;  4YSH A;  2XH4 A;  1TDN A;  4E5T A;  5EB4 A;  3NVW B;  2H88 A;  2QJJ A;  4OPL A;  4AOS A;  3NS1 B;  4TVY A;  5BRT A;  3VC5 A;  3AD8 B;  2Q0K A;  2WU2 A;  2WPC A;  2PYX A;  1VG0 A;  2P3Z A;  3NK0 X;  3GD3 A;  3QPE A;  5JCI A;  4DHG A;  3RCY A;  4FDC B;  4ZCC A;  1PBE A;  4RG3 A;  4H2H A;  2WOV A;  3D9X A;  1NEK A;  3PWG A;  1EBD A;  3PS9 A;  1KDG A;  1NDA A;  2FJE A;  1H84 A;  3NLC A;  2CUL A;  3BI2 A;  4K8D A;  4B65 A;  1GET A;  3FXG A;  5J7X A;  2R4J A;  4H4S A;  3FMW A;  1Q1R A;  1PXB A;  1KKO A;  1OJA A;  3RP7 A;  4K1W A;  1D4E A;  2XH2 A;  3K30 A;  1SEZ A;  2C67 A;  4OVI A;  3I6E A;  1F8R A;  1ONE A;  4REK A;  5HHF A;  2J3N A;  2WET A;  3GD6 A;  4YKG A;  4TM3 A;  1DNC A;  1OJ9 A;  4A6N A;  3AE7 A;  4U8P A;  4O5U A;  1XS2 A;  2AL2 A;  3V4B A;  3CAW A;  4YWS A;  3FVD A;  1CC6 A;  1SJA A;  1E7P A;  1JPM A;  1CJ4 A;  4LU6 A;  3URH A;  1JCT A;  3HYV A;  4I59 A;  2ZZC A;  3CNT A;  4A5L A;  4J57 A;  3FJ4 A;  3GO2 A;  1FEB A;  4ICY A;  2X8G A;  1MDL A;  1H83 A;  1SJC A;  2UZZ A;  5U25 A;  3LXD A;  2CFY A;  3N4E A;  3ALJ A;  1OJD A;  1TYT A;  3AN1 A;  4GIR A;  3JSK A;  3P3B A;  1H82 A;  3CN8 A;  3IC9 A;  4BK2 A;  3SN0 A;  4JY3 A;  5HY5 A;  4H50 A;  2JB3 A;  3GRS A;  1D4C A;  2X99 A;  1O5W A;  3CND A;  1FFU C;  1GRH A;  2OZ3 A;  3M12 A;  2H89 A;  1K0I A;  2QQ6 A;  3H4K A;  4HB9 A;  4K5S A;  1NG4 A;  4BK3 A;  2JK6 A;  1RYI A;  4OPC A;  3V5C A;  2PTZ A;  4TVW A;  1OJT A;  4IP4 A;  1N4U A;  1N62 C;  4PAB A;  3SSZ A;  2V60 A;  3UKH A;  2YM1 A;  1KSS A;  3DEQ A;  2W3S A;  3NG7 X;  4B1B A;  3T6C A;  2X8H A;  3NVY B;  2GGI A;  1L9C A;  4YTP A;  5EOW A;  3SZW A;  1W6T A;  3NT6 A;  5FS6 A;  3ZVH B;  3LJP A;  4GME A;  4MGG A;  3AEF A;  1LQT A;  3CPH G;  3AYI A;  3P4S A;  2V3B A;  3NRZ B;  2RDX A;  2QA1 A;  3TJ4 A;  5EBK A;  2BK5 A;  2OKT A;  2WDR A;  1GRT A;  1R6W A;  5FJP A;  1KNR A;  3AB1 A;  4DSG A;  5KMQ A;  4UDP A;  2XFO A;  3CXO A;  3IJL A;  4Z2T A;  4X9M A;  3ZLG A;  3R9U A;  1S3B A;  5KVH A;  1X2H A;  3N4F A;  2WU5 A;  4OPI A;  3T2Z A;  4ECH A;  3NYF A;  3DK8 A;  1EL8 A;  2WOW A;  1PDZ A;  3AEA A;  5DBJ A;  3MQT A;  5JCN A;  3BOX A;  4AT0 A;  5KOX A;  3IK4 A;  1RM6 B;  2C76 A;  1GPE A;  4U8I A;  5JCM A;  4EIP A;  1D4D A;  3VC6 A;  2YG5 A;  3UTH A;  4PAA A;  3NXL A;  5GSN A;  4D04 A;  2GR3 A;  1X2G A;  3BHK A;  2YM2 A;  2NVK X;  3IJI A;  2PU1 A;  1MRA A;  1NU5 A;  3SYI A;  2VQ7 A;  2XFU A;  4U2T A;  4G6G A;  2GRT A;  4EQX A;  3QFB A;  3ATQ A;  2ZAD A;  5KXJ A;  2DW7 A;  4GFI A;  3FCP A;  1GRF A;  3K7M X;  5BVA A;  3GDP A;  4A7A A;  4HYR A;  1L9D A;  1Y56 B;  1FFV C;  4H4X A;  2XYO A;  4EM3 A;  3G5R A;  3NHO X;  4XXG A;  3DK4 A;  2DKH A;  4IVM B;  5BUL A;  4FP1 A;  3SGL A;  3AXB A;  2PP1 A;  3VRA A;  5ER0 A;  5FS7 A;  4CCQ A;  1T3Q C;  1HYU A;  3KKJ A;  4G73 A;  4N9X A;  2YG7 A;  1L0V A;  2X8C A;  1DTN A;  1S2Y A;  2PTY A;  1JPD X;  3BSM A;  3VDG A;  1YY5 A;  4EQW A;  2BAB A;  3NK1 X;  4NWZ A;  1D5T A;  5CKU A;  3NO1 A;  1EC7 A;  4EMJ A;  1FHU A;  2PP0 A;  1EL7 A;  1L9E A;  2QA2 A;  3L1R A;  4IZG A;  3VQR A;  3CNS A;  1RSG A;  3R10 A;  3R25 A;  4EIQ A;  3EF6 A;  2QVH A;  1IUU A;  3EEZ A;  4J1O A;  3SQS A;  3FV9 A;  4I58 A;  2R45 A;  3OZM A;  1TDK A;  2C73 A;  1LV0 A;  4HA6 A;  3QKE A;  3DER A;  4C3Y A;  4G8T A;  2Z5X A;  2GEW A;  3N6H A;  2WHD A;  3DME A;  3AYJ A;  1EC8 A;  1K0L A;  3DJJ A;  2QDD A;  4H4P A;  4J31 A;  4A35 A;  3MKC A;  3II4 A;  1W4X A;  2ZZB A;  2YLR A;  3NZG A;  2XFP A;  3P4P A;  2F5Z A;  4E8G A;  3NVZ B;  2GR0 A;  5KWF A;  2BK4 A;  3LB8 A;  1O95 A;  3SFE A;  2FYM A;  4Y4L A;  1XDI A;  3SR6 B;  4KX6 A;  3R11 A;  3SY4 A;  2BRA A;  3P4Q A;  3RR1 A;  1CC2 A;  4H2R A;  5U63 A;  1TDF A;  4C5O A;  4JNQ A;  4C3X A;  3R0K A;  4TM1 A;  3MWC A;  1DXL A;  2RGO A;  3HYW A;  2RGJ A;  3TWA A;  2XCG A;  5KRQ A;  2BS4 A;  3V3O A;  2E1M A;  5FJU A;  3COX A;  1IUS A;  4E6M A;  4IHC A;  2ONE A;  1D7L A;  1CF3 A;  3P9U A;  1E9I A;  2TPR A;  4GYP A;  1WYG A;  4YT0 A;  3KPK A;  3UKK A;  4JN7 A;  4FK1 C;  2OAL A;  3SFD A;  4KPL A;  2QDE A;  4H1Z A;  3I6T A;  2V6O A;  4TM0 A;  2WOI A;  3DGH A;  2VVL A;  4B69 A;  4IA5 A;  2AKM A;  4H83 A;  1ELI A;  3GWD A;  3OZY A;  2PHH A;  1YQ4 A;  2YLZ A;  5FJT A;  3SX6 A;  4ENL A;  3UJF A;  3V76 A;  2OZT A;  1QLB A;  4O5Q A;  4U2L A;  4J2W A;  3FYY A;  3VRD B;  4DSH A;  1B4V A;  4FI4 A;  4OPD A;  1OEP A;  3ZYX A;  4GYP C;  4HNL A;  5KMS A;  2IID A;  1LJ1 A;  5EB5 A;  1XPQ A;  4CBQ A;  4ZA0 A;  2Q6U A;  3DG7 A;  3DG6 A;  3B3R A;  1JOA A;  3TTE A;  1DJN A;  4GCM A;  1N63 C;  1CBO A;  1PBF A;  1TKK A;  2E4G A;  3QFA A;  2WS3 A;  2WEU A;  5IQ4 A;  1VQZ A;  4CNJ A;  2ZZ0 A;  4FK1 A;  2GVC A;  5C3J A;  2E5V A;  3BJS A;  2O56 A;  2BRY A;  3L5O A;  4II2 A;  3UJS A;  3GY1 A;  1PJ6 A;  4GF7 A;  2AAQ A;  4OPT A;  2XGZ A;  3LAD A;  1FHV A;  3KA7 A;  3V5F A;  4NTC A;  2C4C A;  2IVE A;  3UOX A;  4ROP A;  2C70 A;  3GDN A;  3UTE A;  2W55 A;  2BS2 A;  2C65 A;  1F8S A;  2GB0 A;  2B7S A;  2R0C A;  4A6N B;  2YQU A;  2X3N A;  1RP0 A;  4KEM A;  4CNK A;  2BC1 A;  3CGD A;  2YLW A;  2XVJ A;  3GWF A;  3JVA A;  1UKV G;  2W3R A;  1B5Q A;  2OLN A;  1PJ7 A;  5JCK A;  4H4V A;  4B64 A;  3PWI A;  5JCL A;  1H81 A;  4DGK A;  1P43 A;  3CGE A;  1TE6 A;  4OCG A;  4HPN A;  4UP3 A;  1N5X A;  3PO7 A;  4CY8 A;  3ISH A;  3UOY A;  3VRB A;  2OVL A;  4GIS A;  3HZL A;  2RAB A;  4EQS A;  3NYE A;  1X31 B;  3HYX A;  3IWA A;  2BXS A;  3K1G A;  2MUC A;  1IJH A;  1F6M A;  3Q9T A;  1FOH A;  2HZG A;  2AR8 A;  3ALM A;  1JEH A;  1SJD A;  3GMC A;  1PXA A;  5FS8 A;  2BAC A;  3UJ2 A;  4H19 A;  1DOE A;  3UOV A;  4A9W A;  3I3L A;  3HRD C;  1KF6 A;  2OLO A;  2NPX A;  1MXT A;  3KVE A;  4OPU A;  2YG3 A;  2P8C A;  2C75 A;  5BUK A;  1JRZ A;  3EKG A;  4GRT A;  2B9Y A;  1S3E A;  4APN A;  2XLP A;  3AE8 A;  1E1L A;  2VRL A;  1ZMC A;  3UXL A;  3LZX A;  1BKW A;  2C7G A;  2PS2 A;  1TDE A;  2XDO A;  3Q4D A;  1F8W A;  5ENL A;  2BXR A;  1MUC A;  1XAN A;  4H2P A;  3GC2 A;  4DXK A;  3C4N A;  3SN1 A;  1TRB A;  1JNZ A;  4CRT A;  3AYL A;  2EQ9 A;  4P9S A;  1BGN A;  5LV9 A;  1ZOY A;  2OFJ A;  4MJW A;  3UCC A;  1GT8 A;  4GAV A;  5BOE A;  2B7R A;  2TMD A;  3TJI A;  2ARD A;  3S5W A;  3DJE A;  2CVJ A;  2YG6 A;  3DDM A;  3UTG A;  3CXB A;  5IQ1 A;  1MOK A;  3OZ2 A;  2W54 A;  2JB1 A;  4Z24 A;  1E39 A;  1IYX A;  1DOD A;  1GRG A;  4EMI A;  1GTE A;  1JDF A;  3GYX A;  4JNA A;  3AEB A;  4FX9 A;  3RIT A;  2YLX A;  1EC9 A;  1ZY8 A;  4ZOH B;  2PCE A;  3DA1 A;  2C72 A;  5J04 A;  3UKQ A;  2XFQ A;  3CNJ A;  2YVG A;  4GDP A;  3NVV B;  1PN0 A;  3AE6 A;  1DOB A;  1H86 A;  1S7M A;  4ZCW A;  2APG A;  1LTX R;  1B37 A;  4K22 A;  1NEL A;  4J33 A;  1N5W C;  2VRM A;  2HXU A;  4XWR A;  3C96 A;  3QVR A;  1BGJ A;  4BUR A;  4Y4M A;  1N4V A;  4DN1 A;  4U8N A;  3S61 A;  3SJN A;  2Z5Y A;  3MY9 A;  4DNA A;  2OLA A;  4G6H A;  3B9J B;  2OA1 A;  2P0I A;  1F3P A;  4GUV A;  3KU9 A;  4OPG A;  2P8B A;  1LPF A;  1EBH A;  3K7Q X;  3A7A A;  1NEN A;  2IVD A;  1OJC A;  3UP4 A;  1JRP A;  2XLU A;  4HN8 A;  1KKR A;  1TZZ A;  4JN8 A;  2Q0L A;  2E3T A;  1GND A;  1ZDL A;  4IA6 A;  4G74 A;  4U2S A;  2FBW A;  4TLX A;  1GRE A;  3RED A;  3T8Q A;  4IV9 A;  1E6E A;  4A65 A;  1BZL A;  5BOF A;  4DX3 A;  3I4K A;  4Z26 A;  4BV6 A;  4GGB A;  1BF3 A;  1GSN A;  3P93 A;  1BQG A;  2GQW A;  4H4Y A;  1YEY A;  1PS9 A;  2XFN A;  1IUT A;  3RGT A;  1VG9 A;  3NRN A;  3T9P A;  5CQF A;  3CGC A;  3V3W A;  1P2H A;  2QJN A;  1BKH A;  5KMR A;  4YWO A;  4GAP A;  3SQP A;  5KOW A;  4LII A;  2PPG A;  2VZ2 A;  2OAM A;  3GRT A;  3DIP A;  4U8L A;  3SZF A;  3F8R A;  2P88 A;  4AT2 A;  3UCL A;  3UJE A;  3KPF A;  5FMH A;  3KUM A;  3AE4 A;  5TR3 A;  4G9K A;  3PK7 A;  1NHQ A;  4A6G A;  3IF9 A;  4U8O A;  2CDU A;  1JU2 A;  2JAE A;  3MZN A;  4Z43 A;  4F4R A;  2GGE A;  2XH7 A;  4Z1Y A;  2YWL A;  1PJ5 A;  1KNP A;  3H70 A;  3UXK A;  2WPE A;  4NEW A;  2BYB A;  4CY6 A;  4H2N A;  2A8X A;  3S5S A;  3NIX A;  2YVJ A;  3B97 A;  3O0H A;  1KSU A;  4C74 A;  3OTR A;  5FJO A;  3QLD A;  3PFR A;  1Y0P A;  4DWD A;  2A87 A;  2GQF A;  4E0V A;  3QSM A;  2XLS A;  4YSX A;  4H4R A;  1IUW A;  3A7R A;  3AEC A;  3OP2 A;  4IP5 A;  1CJ3 A;  4Z25 A;  1FIQ B;  5KNL A;  3UOZ A;  2WP5 A;  5HYM A;  1NPX A;  1PBC A;  4WX1 A;  3H12 A;  1CJ2 A;  1E1K A;  3AWI A;  3P4R A;  2ZBW A;  4A79 A;  3JZU A;  4K7Z A;  3R1Z A;  3UJR A;  3ZLH A;  3AE3 A;  3T2Y A;  1NG3 A;  4ZN0 A;  1M64 A;  2V3A A;  3CGB A;  3UGV A;  3NN0 X;  1MO9 A;  4K2X A;  3DH9 A;  2R46 A;  3F8P A;  5M10 A;  1EBG A;  4YSZ A;  2VQB A;  1V97 A;  3I6D A;  5JRB A;  4WCT A;  4K8G A;  2OZ8 A;  1E1M A;  3H7V A;  3BNM A;  3LZW A;  3OW1 A;  3T31 A;  4BJY A;  2WQY A;  3IHG A;  3ETR B;  3ABV A;  4IL0 A;  4A99 A;  4JDR A;  2QCU A;  2PP3 A;  3MSY A;  1TYP A;  4IT1 A;  4X9N A;  1H7X A;  1PBB A;  2PTW A;  3T2K A;  3AED A;  2GMH A;  3DJG X;  1E1N A;  4NNJ A; 
#chains in the Genus database with same CATH homology
 2GR3 A;  3CTY A;  3BHK A;  2YM2 A;  4Z2R A;  1VQW A;  1JRY A;  2AR8 A;  2Y6R A;  4Z44 A;  3ALM A;  1VRQ B;  4J56 A;  1JEH A;  4JN9 A;  3T14 A;  2EQ7 A;  2NVK X;  3GMC A;  4USR A;  1PXA A;  5FS8 A;  2BAC A;  1CL0 A;  3H8L A;  3B6D A;  3SYI A;  1BWC A;  1GRB A;  2BC0 A;  3EAN A;  1DOE A;  2VQ7 A;  2XVH A;  3UOV A;  2XFU A;  4U2T A;  4G6G A;  4A9W A;  3I3L A;  1KF6 A;  4AP1 A;  1ONF A;  2OLO A;  1MXT A;  2NPX A;  2GRT A;  2YLS A;  4EQX A;  3KVE A;  4B68 A;  3DK9 A;  3QFB A;  3ATQ A;  5FS9 A;  4BK1 A;  4OPU A;  3DJD A;  5KXJ A;  1IUX A;  2YG3 A;  2C75 A;  3ADA B;  5BUK A;  3OC4 A;  1D7Y A;  1GRF A;  1JRZ A;  2RGH A;  2YVF A;  2GF3 A;  1LQU A;  1PDH A;  3K7M X;  4GRT A;  3NTA A;  1K0J A;  2JKC A;  2B9Y A;  3WE0 A;  3PVC A;  2X50 A;  1S3E A;  2Y6Q A;  3GDP A;  4BJZ A;  4APN A;  2XLP A;  5BVA A;  3SZC A;  3AE8 A;  3RHA A;  4A7A A;  1E1L A;  2VRL A;  3LOV A;  4B63 A;  1L9D A;  1ZMC A;  1Y56 B;  2YAU A;  3BI5 A;  4H4X A;  1NHR A;  3CMM A;  3LZX A;  4B67 A;  1BKW A;  2C7G A;  3GSI A;  1FEA A;  2XYO A;  4EM3 A;  1TDE A;  3G5R A;  2XDO A;  3NHO X;  4H4U A;  1F8W A;  4XXG A;  4H4T A;  5HXI A;  2BK3 A;  3FPZ A;  1AOG A;  2BXR A;  4AP3 A;  4CCR A;  3DK4 A;  1XAN A;  4H2P A;  2VVL G;  4YTM A;  2DKH A;  1YQ3 A;  2ACZ A;  2Q7V A;  2GAH B;  3H8I A;  4IVM B;  5BUL A;  5M0Z A;  2BS3 A;  3C4N A;  3SGL A;  3AXB A;  1TRB A;  2YR5 A;  3SM8 A;  3VRA A;  5ER0 A;  3UKA A;  5FS7 A;  1JNZ A;  1H2I A;  4CCQ A;  4CRT A;  3AYL A;  1CHU A;  2EQ9 A;  4P9S A;  3UKL A;  1N4W A;  1BGN A;  1HYU A;  3KKJ A;  1PHH A;  2XLR A;  2YG7 A;  4G73 A;  1COY A;  4N9X A;  3SXI A;  5J60 A;  5LV9 A;  1ZOY A;  1L0V A;  1CJC A;  2X8C A;  5KVI A;  1S2Y A;  3BHF A;  3NGC X;  4MJW A;  2WES A;  1KFY A;  1YY5 A;  1S2Q A;  3CPI G;  1Q1W A;  1GT8 A;  4EQW A;  2BAB A;  3FBS A;  4GAV A;  2EQ6 A;  2R0G A;  3T37 A;  1YQZ A;  1O94 A;  3NK1 X;  4NWZ A;  1P2E A;  2B7R A;  1D5T A;  2TMD A;  1H6V A;  5CKU A;  2C64 A;  4K5R A;  4TM4 A;  2ARD A;  3S5W A;  4EMJ A;  3DJE A;  3UKF A;  2CVJ A;  4ADW A;  2YG6 A;  3UTG A;  2R9Z A;  1GER A;  1CC4 A;  2HQM A;  1GES A;  1EL7 A;  1PBD A;  1MOK A;  2B76 A;  1GXF A;  5IQ1 A;  2C3C A;  1L9E A;  3OZ2 A;  4H4W A;  2QA2 A;  3L1R A;  4U8K A;  2XVF A;  2JB1 A;  4GR1 A;  2DKI A;  4Z24 A;  3VQR A;  4D03 A;  3CNS A;  3L8K A;  1RSG A;  3GMB A;  4II3 A;  2YR6 A;  1E39 A;  1DOD A;  2YR4 A;  3NK2 X;  1GRG A;  4EQR A;  4EMI A;  2EQ8 A;  3PG6 A;  4UDR A;  1GTE A;  4J34 A;  4YXD A;  4EIQ A;  3GYX A;  3AEB A;  4EM4 A;  4JNA A;  3EAO A;  4FX9 A;  2YLX A;  3EF6 A;  1IUV A;  2R4E A;  2FJA A;  3RNM A;  1IUU A;  4H7U A;  3QSE A;  1GV4 A;  1ZY8 A;  4JQ9 A;  3DA1 A;  4RSL A;  3ICT A;  3NN6 X;  2C72 A;  3V3N A;  3P1W A;  4I58 A;  4H4Z A;  2R45 A;  3UKQ A;  2XFQ A;  1QO8 A;  3CNJ A;  1H7W A;  1DOC A;  2YVG A;  4GDP A;  1TDK A;  2C73 A;  1DJQ A;  1PN0 A;  3D1C A;  3AE6 A;  1DOB A;  1H86 A;  1LV0 A;  4HA6 A;  5C2T A;  1S7M A;  2APG A;  4C3Y A;  3BI4 A;  3DGZ A;  1LTX R;  2Z5X A;  3G5Q A;  4YSH A;  4JY2 A;  2GEW A;  1TDN A;  1B37 A;  4K22 A;  5EB4 A;  4J33 A;  2WHD A;  3DME A;  2VRM A;  3AYJ A;  2H88 A;  1K0L A;  4XWR A;  4OPL A;  4AOS A;  5BRT A;  3C96 A;  3QVR A;  1V59 A;  2GH5 A;  4BUR A;  3DJJ A;  1BGJ A;  2GMJ A;  4H4P A;  2Q0K A;  2WU2 A;  2WPC A;  3AD8 B;  2PYX A;  1VG0 A;  3ATR A;  4J31 A;  4Y4M A;  1N4V A;  2FJD A;  3II4 A;  1W4X A;  5GRT A;  3NK0 X;  1REO A;  2ZZB A;  3GD3 A;  5JCI A;  2YLR A;  3NNE A;  4U8N A;  4NTE A;  3S61 A;  4X4J A;  3KD9 A;  4FDC B;  2XFP A;  2Z5Y A;  3P4P A;  4ZCC A;  4DNA A;  2F5Z A;  1PBE A;  4RG3 A;  2GR0 A;  4G6H A;  2WOV A;  2JB2 A;  3D9X A;  1NEK A;  2B9W A;  1EBD A;  2OA1 A;  3PS9 A;  1KDG A;  1F3P A;  2BK4 A;  3ICS A;  1NDA A;  2W0H A;  3LB8 A;  1O95 A;  2FJE A;  3SFE A;  5KWF A;  4GUV A;  1XDI A;  4Y4L A;  1H84 A;  3EPT A;  3NLC A;  2CUL A;  3KU9 A;  4OPG A;  3BI2 A;  2R0P A;  1LPF A;  3AD7 B;  3K7Q X;  4K8D A;  4KX6 A;  4B65 A;  1GET A;  3SY4 A;  3T0K A;  1NEN A;  2BRA A;  2IVD A;  1OJC A;  3UP4 A;  3P4Q A;  1CC2 A;  2XLU A;  1JRX A;  5J7X A;  2R4J A;  4H4S A;  3FMW A;  1Q1R A;  4H2R A;  5U63 A;  2C3D A;  1PXB A;  1TDF A;  2FJB A;  3ZDN A;  1OJA A;  4C5O A;  3RP7 A;  2Q0L A;  1GND A;  3M13 A;  4JNQ A;  1D4E A;  5IPY A;  4C3X A;  1ZDL A;  4IA6 A;  4G74 A;  4U2S A;  2FBW A;  4TM1 A;  3K30 A;  1SEZ A;  1DXL A;  2C67 A;  2O9Z A;  1GRA A;  2A89 A;  1M6I A;  1GRE A;  3K7T A;  4OVI A;  2RGO A;  3M0O A;  4TLX A;  5U1O A;  3HYW A;  1F8R A;  3AE2 A;  3RED A;  2WBA A;  4IV9 A;  2RGJ A;  1E6E A;  4REK A;  5HHF A;  4A65 A;  2J3N A;  2XCG A;  1BZL A;  5KRQ A;  2BS4 A;  2V5Z A;  3NTD A;  3V3O A;  2WET A;  3FIM B;  2E1M A;  1FL2 A;  2YLT A;  3CIR A;  3NKS A;  3COX A;  4Z26 A;  4YKG A;  4TM3 A;  1DNC A;  1IUS A;  3RP8 A;  1OJ9 A;  3UP5 A;  4A6N A;  3AE7 A;  4U8P A;  4O5U A;  4BV6 A;  1BF3 A;  4TLZ A;  1GSN A;  1D7L A;  1CF3 A;  3P9U A;  2GQW A;  1Y56 A;  1Q9I A;  4H4Y A;  2TPR A;  1PS9 A;  2XFN A;  3QJ4 A;  1CC6 A;  3AEG A;  1IUT A;  1FEC A;  4KPR A;  4YT0 A;  1VG9 A;  1E7P A;  2WPF A;  3KPK A;  3NRN A;  5CQF A;  3CGC A;  1CJ4 A;  3ITJ A;  3AE9 A;  3URH A;  4LU6 A;  3UKK A;  1P2H A;  4FK1 C;  2OAL A;  3HYV A;  3SFD A;  4C77 A;  4I59 A;  2ZZC A;  5KMR A;  3CNT A;  4A5L A;  4J57 A;  4YWO A;  3QVP A;  4GAP A;  4IVO B;  1FEB A;  3SQP A;  4LII A;  5KOW A;  2V6O A;  2VZ2 A;  2OAM A;  2WOI A;  4TM0 A;  3NH3 X;  3DGH A;  2VVL A;  3GRT A;  1XHC A;  4ICY A;  2X8G A;  2BCP A;  4B69 A;  4IA5 A;  4U8L A;  1LVL A;  3SZF A;  3F8R A;  1ELI A;  3GWD A;  2PHH A;  1H83 A;  1YQ4 A;  4AT2 A;  3UCL A;  2UZZ A;  5U25 A;  1K4Q A;  2YLZ A;  2WDV A;  3SX6 A;  3LXD A;  2CFY A;  3KPF A;  5FMH A;  3V76 A;  4Y4N A;  2WP6 A;  3AE4 A;  5TR3 A;  1QLB A;  4G9K A;  4O5Q A;  4U2L A;  3ALJ A;  1OJD A;  3RP6 A;  4J2W A;  5L46 A;  1FCD A;  5KMP A;  1TYT A;  1NHQ A;  4NEV A;  2I0Z A;  3VRD B;  1NAA A;  3JSK A;  1H82 A;  2C66 A;  2BCG G;  3IF9 A;  3CN8 A;  4DSH A;  1B4V A;  3IC9 A;  4U8O A;  4OPD A;  4BK2 A;  2CDU A;  2QAE A;  1JU2 A;  2JAE A;  4JY3 A;  3ZYX A;  2IID A;  1LJ1 A;  2XVE A;  5EB5 A;  5KMS A;  2V61 A;  1GTH A;  1XPQ A;  5HY5 A;  1GEU A;  4H50 A;  1B8S A;  4Z43 A;  2JB3 A;  3GRS A;  1D4C A;  4CBQ A;  2X99 A;  1O5W A;  2Q6U A;  4YSY A;  2YWL A;  1KN0 A;  3B3R A;  1JOA A;  3CND A;  1DJN A;  1PJ5 A;  1GRH A;  4GDE A;  3ALL A;  3CNP A;  2XLT A;  1KNP A;  3M12 A;  2H89 A;  4GCM A;  1K0I A;  2VVM A;  1CBO A;  2WPE A;  3H4K A;  4NEW A;  1PBF A;  4HB9 A;  2BYB A;  4K5S A;  4CY6 A;  1NG4 A;  4BK3 A;  2JK6 A;  4H2N A;  2E4G A;  4H2Q A;  2A8X A;  3QFA A;  2WS3 A;  1RYI A;  2WEU A;  3NIX A;  5IQ4 A;  2YVJ A;  1PXC A;  2B9X A;  4OPC A;  3O0H A;  2GR1 A;  4CNJ A;  3UTF A;  4U8M A;  1OJT A;  1EL5 A;  2ZZ0 A;  4FK1 A;  1N4U A;  1KSU A;  3GYJ A;  2GVC A;  4PAB A;  2V60 A;  4USQ A;  3UKH A;  1YKJ A;  4C74 A;  5C3J A;  2BA9 A;  1VDC A;  3GYI A;  2YM1 A;  1KSS A;  2E5V A;  3SZ0 A;  1QJD A;  2BRY A;  3L5O A;  1EL9 A;  1Y0P A;  1GAL A;  3NG7 X;  3AEE A;  2A87 A;  4II2 A;  1ZX9 A;  4B1B A;  2GQF A;  4E0V A;  2GR2 A;  4M52 A;  2XLS A;  3G5S A;  1PJ6 A;  3QSM A;  4NTD A;  4YSX A;  4H4Q A;  4H4R A;  1IUW A;  4GF7 A;  2AAQ A;  2X8H A;  4OPT A;  3VR9 A;  3LAD A;  1L9C A;  3AEC A;  4UDQ A;  4YTP A;  3BNU A;  5EOW A;  1CJ3 A;  3SZW A;  4B66 A;  3KA7 A;  3NT6 A;  1ZP0 A;  4NTC A;  2C4C A;  4Z25 A;  3IHM A;  2IVE A;  3C4A A;  5KNL A;  2GV8 A;  1TDO A;  5FS6 A;  3UOX A;  3UOZ A;  2WP5 A;  5HYM A;  2C70 A;  3GDN A;  3LJP A;  1NPX A;  1PBC A;  4WX1 A;  4XWZ A;  1CJ2 A;  1E1K A;  3AWI A;  3P4R A;  2ZBW A;  4A79 A;  3UKP A;  3UTE A;  4K7Z A;  4U8J A;  3AEF A;  4YKF A;  2BS2 A;  2C65 A;  1F8S A;  2GB0 A;  4EMW A;  2B7S A;  2R0C A;  3AE3 A;  1LQT A;  4A6N B;  3AE5 A;  3CPH G;  3T2Y A;  1NG3 A;  2YQU A;  2X3N A;  4ZN0 A;  1M64 A;  3AYI A;  2V3A A;  1Z6L A;  4YTN A;  1ZK7 A;  1RP0 A;  3CGB A;  2YG4 A;  3P4S A;  2V3B A;  3NN0 X;  3Q6J A;  1N1P A;  2VOU A;  1MO9 A;  2QA1 A;  4K2X A;  5EBK A;  2BK5 A;  2BC1 A;  3CGD A;  4CNK A;  2WDR A;  2WP9 A;  3DH9 A;  2YLW A;  2XVJ A;  3VR8 A;  3GWF A;  1UKV G;  3QSS A;  1GRT A;  1B5Q A;  2OLN A;  1PJ7 A;  2R46 A;  4ZCD A;  5JCK A;  1GOS A;  3NYC A;  4H4V A;  3F8P A;  5M10 A;  1KNR A;  3AB1 A;  4DSG A;  2GAG B;  4UDP A;  5KMQ A;  5JCL A;  2VQB A;  2XFO A;  4B64 A;  1H81 A;  3I6D A;  4YSZ A;  4Z2T A;  4DGK A;  2XVI A;  5JRB A;  3CGE A;  4WCT A;  3FG2 P;  3GD4 A;  3AD9 B;  4X9M A;  4AOX A;  4J36 A;  4OCG A;  1E1M A;  4Z2U A;  3BNM A;  3R9U A;  3LZW A;  1S3B A;  4NZH A;  1NHP A;  5KVH A;  3T31 A;  4LA1 A;  4BJY A;  4UP3 A;  2WU5 A;  3F8D A;  4OPI A;  1NHS A;  2WQY A;  3PO7 A;  4CY8 A;  3IHG A;  3ISH A;  3T2Z A;  3NYF A;  2WDQ A;  4ECH A;  1ZOV A;  3DK8 A;  1EL8 A;  3ABV A;  2AQJ A;  3D8X A;  3UOY A;  4A99 A;  2WOW A;  3VRB A;  3AEA A;  4JDR A;  5DBJ A;  3HZL A;  2QCU A;  5JCN A;  3CPJ G;  4AT0 A;  5KOX A;  1ZMD A;  2RAB A;  1TYP A;  4EQS A;  4X9N A;  2JBV A;  3NYE A;  1H7X A;  2C76 A;  1ZKQ A;  1X31 B;  1GPE A;  3ICR A;  4U8I A;  1PBB A;  5JCM A;  4EIP A;  1D4D A;  3HYX A;  3IWA A;  1JNR A;  2BXS A;  3T2K A;  3AED A;  2GMH A;  2YG5 A;  1IJH A;  3UTH A;  3AE1 A;  4RG4 A;  3DJG X;  1E1N A;  1F6M A;  4NNJ A;  4PAA A;  5GSN A;  3Q9T A;  1FOH A;  3KLJ A;  3E1T A;  4D04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...