2V3AA

Crystal structure of rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN REDUCTASE
total genus 110
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3aA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA02
5JCKA 2H89A 1O95A 3F8DA 4OPCA 2BK4A 1GSNA 4JNQA 4Y4LA 2YAUA 3F8PA 1OJAA 4FDCB 4K7ZA 1CF3A 1F6MA 4KX6A 4APNA 2XLUA 4OPLA 4EMJA 3IHGA 4DNAA 4EIPA 3LB8A 4U8MA 3G5SA 2BS3A 3OZ2A 4M52A 4K2XA 2NVKX 4J56A 1L0VA 3KD9A 4YTNA 2GF3A 4AP1A 3FMWA 5KWFA 4H2QA 1CJ3A 1P2HA 1KSSA 5GRTA 3GD3A 5EB4A 5EB5A 4EM3A 4B69A 1PBDA 2WDVA 5FS7A 4H4ZA 2DKHA 2GR1A 3GSIA 2APGA 3NIXA 1DODA 1B8SA 1LTXR 4WX1A 1OJCA 3AE4A 1EL7A 3ATRA 3NYFA 5EBKA 3NT6A 3AD9B 2WU5A 4CCQA 3Q6JA 1FL2A 1H86A 5KRQA 4CY8A 1GXFA 3P4RA 4X9MA 2FJDA 5C2TA 4FK1C 1CBOA 2ZBWA 2ZZCA 4Z2TA 4ZCCA 2XVHA 1N4WA 3UP5A 3T37A 2ACZA 1F8RA 1D7LA 1MO9A 3CTYA 4OPUA 4C3YA 3I3LA 4H4PA 2IVDA 1JOAA 1GRFA 2BXSA 1DJQA 1OJ9A 1NG3A 2WDRA 1CC4A 5BUKA 5KVIA 3SFEA 1GV4A 4Z2RA 3FG2P 3QFBA 1PHHA 3UTEA 1NHRA 1N1PA 2BS4A 4H2RA 2H88A 1NDAA 4O5QA 2RGOA 1PJ5A 2YLZA 4Z26A 5J7XA 1D5TA 1BZLA 1K4QA 2VVMA 4E0VA 4RSLA 4C74A 3LJPA 2BK3A 3P4SA 4UDRA 4YKFA 2TPRA 4YTPA 3CGDA 3H4KA 3UTHA 1H84A 1RYIA 2C70A 2WEUA 3NGCX 2C66A 1L9EA 5JCMA 3NTAA 5BVAA 4NTEA 4X9NA 4GDEA 3RHAA 1V59A 3UOXA 1TDNA 2VRLA 2OALA 3SM8A 1IUWA 2XDOA 1D4CA 1E1LA 2WDQA 4J33A 3GRSA 3V3OA 4AT2A 3BNMA 2FJEA 2R0GA 3F8RA 4BURA 4CNJA 4A65A 5C3JA 2YLRA 5DBJA 1X31B 3AEFA 3ZDNA 1GESA 1H82A 1GERA 1YY5A 3KLJA 2CVJA 2WHDA 1YQ3A 2XLTA 2XVFA 1ELIA 3EAOA 5FMHA 3UKQA 1S3EA 3AE9A 1GOSA 3C96A 2XLSA 4TM0A 3UOYA 3ALJA 3D8XA 1EL5A 5JCNA 2R0CA 3AEBA 4A6NA 1O5WA 3K7MX 2C64A 3AE3A 3CNSA 2WQYA 1B4VA 1CJCA 1KNRA 4J31A 2DKIA 3G5RA 4Z43A 5L46A 2RABA 3AXBA 3QSMA 2WOIA 4U8PA 1M6IA 1LVLA 3GDNA 5CQFA 4B63A 4C3XA 5HY5A 3AECA 3DA1A 3B6DA 4LIIA 3AYIA 2ZZ0A 4B1BA 3AE8A 4IVOB 3OC4A 4GDPA 1K0JA 3AE1A 3IF9A 1PDHA 2Y6RA 2BYBA 1E1KA 4K5RA 2EQ9A 2FBWA 3QSSA 4RG4A 5EOWA 1K0LA 2CULA 3DJGX 1KFYA 2GMJA 1DJNA 2YLSA 4K22A 5FS6A 4H4YA 3DGHA 3HZLA 2OLNA 2C67A 1BKWA 4Z25A 2YWLA 5LV9A 1VRQB 3NRNA 3KPFA 2R4JA 5BULA 1PN0A 1IUVA 2QCUA 2GR2A 4H4QA 2V3AA 1M64A 2GVCA 4C5OA 2XFUA 4U8IA 2GEWA 4IA6A 3NKSA 2X8CA 1BGJA 1PJ7A 1GRTA 1XHCA 4OPTA 4H2PA 2WP6A 1JU2A 3NH3X 3LXDA 3DGZA 4YWOA 1F8WA 2V3BA 1GTHA 3P4PA 1N4UA 5FS8A 4OPDA 3NNEA 1GETA 1LQUA 1TDFA 4U2LA 3V76A 2FJAA 2R46A 2WOWA 4B65A 1Y56B 1E39A 1XANA 1DOBA 2RGHA 2GQFA 3QSEA 4BJYA 4Y4NA 1GALA 2I0ZA 3QVRA 2VQ7A 3GRTA 4J34A 3UOVA 2AQJA 4YSZA 1TDOA 1ONFA 3SGLA 5J60A 5KVHA 3NK1X 4U8NA 1NAAA 2AAQA 4IV9A 3ATQA 3VQRA 3PO7A 1DXLA 2YVGA 2CFYA 1IJHA 1JNRA 3Q9TA 4J36A 3ZYXA 2XFOA 2YVFA 3V3NA 3KVEA 2XLPA 3CNTA 4B64A 5U25A 4EMWA 3AYJA 3R9UA 4JQ9A 2QA1A 1RP0A 5FS9A 2XCGA 1Y56A 1PBBA 2EQ7A 2VOUA 1Y0PA 3VR9A 4NEVA 2NPXA 1W4XA 3AEGA 1D4DA 4OPIA 2UZZA 4BK3A 3EF6A 2WPCA 3D1CA 1ZOVA 2V6OA 3M0OA 3ISHA 1LPFA 3K7QX 1EL9A 1CC6A 1TRBA 3L1RA 1LJ1A 2BS2A 4TM3A 1FEAA 3IHMA 2YR4A 5ER0A 3H8IA 4X4JA 4DSHA 2A8XA 2BACA 1AOGA 2X8HA 3DK4A 3B3RA 3DJDA 3KKJA 2OAMA 4D04A 1EBDA 1NEKA 4EM4A 2PYXA 3UKKA 3RP6A 3O0HA 1NHPA 3UKHA 3VRAA 4JNAA 3C4NA 3FPZA 2EQ8A 1PXAA 4IVMB 4NZHA 1GPEA 3H8LA 4PAAA 4YSYA 3GWDA 3LZXA 1RSGA 1PBCA 3AWIA 5IQ1A 1NHQA 4AT0A 3ALLA 4TM1A 1H7WA 1ZK7A 3II4A 4H7UA 4GRTA 1IUUA 4WCTA 1QLBA 4CCRA 3IC9A 4EMIA 2BC0A 2C76A 1Q9IA 1OJTA 4U8LA 1UKVG 2WOVA 3CNPA 4H2NA 2X8GA 3CNDA 2TMDA 3DK8A 4OCGA 3UOZA 4REKA 2HQMA 4NTDA 3UTGA 5KOXA 4K8DA 4XXGA 1ZX9A 3GDPA 2V61A 1NG4A 2GR0A 3CGBA 4ZCDA 4YT0A 1XPQA 3BHFA 5HXIA 4EQWA 2WESA 2PHHA 3NYCA 4OPGA 4A9WA 1JRYA 3UKFA 2WU2A 1E1NA 1IUXA 2BK5A 2YG3A 4C77A 3S5WA 2BABA 3CPIG 2A87A 3ALMA 3VRBA 2JK6A 3SQPA 4DSGA 2XYOA 3ICSA 1S2YA 5CKUA 3RNMA 4GR1A 1COYA 2WBAA 4EIQA 2WPFA 2YR6A 2Q0KA 2Z5XA 2GAGB 2QAEA 2XFQA 3CN8A 4GF7A 3AEDA 4CBQA 1GNDA 2GMHA 4RG3A 3KU9A 2B9WA 1F3PA 1ZKQA 3SFDA 2WP5A 4JN9A 1FECA 2JB3A 1GRHA 2VVLG 2XVIA 1JRXA 3COXA 3URHA 2Z5YA 3CGEA 4ADWA 2WETA 3AB1A 2C3DA 3K7TA 2B7SA 3GWFA 1ZMDA 2R9ZA 1K0IA 1BF3A 4YSXA 3C4AA 2JB1A 3CIRA 3K30A 1IUSA 4NEWA 4DGKA 4H4XA 4BK2A 5IQ4A 3RP7A 1DOEA 1JNZA 4LA1A 4Y4MA 1VQWA 1XDIA 2W0HA 3BI2A 3M12A 3NN0X 1L9CA 2E4GA 2V5ZA 3S61A 4EQRA 4A5LA 1ZP0A 3LADA 1NHSA 4O5UA 4J57A 2Y6QA 1GRGA 4P9SA 3LZWA 2YQUA 3QVPA 4I58A 4N9XA 1IUTA 2R4EA 2VZ2A 3BHKA 4Z2UA 5M10A 2CDUA 3CNJA 1KDGA 3NK0X 4TLXA 1JEHA 3NYEA 4ICYA 5IPYA 3VRDB 4U8JA 3UKPA 3GYIA 2XVEA 1PJ6A 2YM2A 4JY2A 1S3BA 2IIDA 2YM1A 1QO8A 3NHOX 4UDPA 2GH5A 2C3CA 2E5VA 2YG6A 2C75A 3BI4A 2FJBA 2X99A 3M13A 5HHFA 2EQ6A 3DJEA 1S2QA 4JDRA 1H83A 4H4VA 4AOSA 4U2SA 2OLOA 4ZN0A 2Q6UA 2F5ZA 3RP8A 1NENA 4FK1A 1PXBA 2XVJA 4NTCA 4AOXA 4A7AA 4CRTA 4JY3A 4B66A 1CJ4A 2JAEA 2VRMA 4AP3A 1Q1WA 2JBVA 1PXCA 1ZOYA 3G5QA 1Q1RA 3WE0A 1TYPA 4ECHA 4KPRA 1EL8A 2YLTA 2C7GA 3AD8B 2Q0LA 2C72A 3CPHG 1JRZA 1KSUA 2YLWA 3BI5A 3NK2X 2ARDA 5BRTA 4BK1A 1D7YA 3ITJA 2QA2A 2JKCA 4TLZA 2B9XA 3NTDA 1O94A 1DOCA 2YLXA 2BXRA 2YG4A 5GSNA 2YG5A 2XFNA 3PS9A 1B37A 2A89A 2C73A 2YR5A 3NN6X 4K5SA 4CY6A 3GD4A 1FEBA 3GMBA 1TDEA 3AEAA 5U63A 3FBSA 1REOA 2OA1A 4H4SA 2B7RA 4LU6A 1GRBA 4B68A 1H81A 2B9YA 4IA5A 4USRA 2WPEA 4D03A 3VR8A 3NLCA 2GQWA 4HA6A 2AR8A 3JSKA 3P9UA 2R45A 3KA7A 4A99A 1QJDA 1D4EA 2GR3A 3UP4A 2J3NA 3UKLA 4BJZA 3FIMB 1N4VA 2GRTA 4U8OA 3REDA 5JCIA 1VG9A 1L9DA 1PBFA 4UP3A 4J2WA 3P1WA 4H4WA 1E6EA 3P4QA 1FCDA 2WS3A 4MJWA 1MXTA 2O9ZA 3DH9A 3UTFA 3EPTA 2BCGG 3E1TA 4A79A 1YKJA 2BA9A 3AE7A 4PABA 4YSHA 1E1MA 2E1MA 5TR3A 1E7PA 3EANA 4TM4A 3GYJA 1VDCA 4Z24A 1TDKA 4U8KA 2C65A 3PVCA 4EQSA 1CHUA 4B67A 1GEUA 2BCPA 1BGNA 4XWRA 2XLRA 2XFPA 3DMEA 3UCLA 3GMCA 1GT8A 4EQXA 5M0ZA 1CJ2A 4I59A 3CPJG 2BC1A 1YQ4A 2IVEA 1ZDLA 2GAHB 2Q7VA 2X50A 4U2TA 3ABVA 4Z44A 3QJ4A 4XWZA 2RGJA 3AEEA 2WP9A 3LOVA 3AE5A 3QFAA 3L8KA 4GCMA 1B5QA 1KF6A 1PS9A 2VVLA 1LV0A 5U1OA 4H4TA 4H50A 1H6VA 3CGCA 4H4UA 1GTEA 4A6NB 1KNPA 2YVJA 3UKAA 1OJDA 4CNKA 1ZMCA 1Z6LA 1SEZA 5HYMA 3I6DA 2ZZBA 4YTMA 1BWCA 2V60A 1VG0A 2X3NA 2GV8A 3NG7X 1HYUA 5KXJA 4BV6A 1YQZA 1DNCA 2GB0A 2R0PA 3AYLA 1MOKA 3ICTA 4FX9A 1GRAA 4YXDA 2JB2A 4USQA 1LQTA 1GREA 4YKGA 1ZY8A 4OVIA 3DK9A 3ICRA 1FOHA 1NPXA 2B76A 3ADAB 4H4RA 1CC2A 1P2EA 5KOWA 3AD7B 3DJJA 1H7XA 1CL0A 1F8SA 1PBEA 5JCLA 3IWAA 4GUVA 3AE2A 2VQBA 3AE6A 4HB9A 4UDQA 3BNUA 1TYTA 2YG7A
chains in the Genus database with same CATH superfamily
5JCKA 1T3QC 3N6HA 1GSNA 2XH0A 2W54A 1CF3A 3K1GA 4EMJA 4DNAA 4U8MA 1L0VA 4YTNA 4H4ZA 2APGA 3T2ZA 1EL7A 3HPFA 3ATRA 3AD9B 4CCQA 1H86A 2PU0A 3T37A 3I3LA 3NXLA 1DJQA 2P0IA 1GV4A 3FG2P 1PHHA 1N1PA 3QPEA 3H70A 3TCSA 4Z26A 4C74A 4YTPA 3UTHA 4GAVA 1RYIA 2PP0A 2C70A 1L9EA 1TE6A 1MUCA 4X9NA 4GDEA 2VRLA 1STZA 2WDQA 2GSHA 2FJEA 2R0GA 5C3JA 2P8CA 2WHDA 3UKQA 1S3EA 5BOFA 3C96A 3D8XA 3AE3A 4E4FA 4Z43A 3ENLA 3QSMA 3ZLGA 2WOIA 1M6IA 5CQFA 3R11A 3AYIA 4GYPC 4E4UA 3OC4A 3AE1A 2Y6RA 5KNLA 1E1KA 1KFYA 2YLSA 1N63C 4H4YA 3UJ2A 3FYYA 3NVVB 5BULA 1IUVA 5FJOA 2GVCA 3TTEA 4U8IA 3STPA 2GEWA 3NKSA 1XHCA 1JU2A 3LXDA 3KPKA 2PP1A 5FS8A 4OPDA 1GETA 1LQUA 4U2LA 2DW7A 4B65A 1E39A 1XANA 3V5CA 3QSEA 4Y4NA 2I0ZA 4YSZA 4HNCA 5KVHA 3NK1X 3ATQA 3VQRA 2OQHA 2YVGA 3S47A 4J36A 3AYJA 3DG3A 3R9UA 2RDXA 1RP0A 5FS9A 2PTZA 2VOUA 1Y0PA 3VR9A 4NEVA 1W4XA 1D4DA 4OPIA 3D1CA 1ZOVA 3ISHA 1LPFA 3L1RA 1CC6A 1FEAA 3CXOA 2YR4A 4DSHA 2A8XA 2BACA 4HCHA 3DK4A 3B3RA 4D04A 1NEKA 2PYXA 3C4NA 3FPZA 2AL2A 4NZHA 4YSYA 4Z17A 3JZUA 1PBCA 1ZK7A 3II4A 4H7UA 1IUUA 2BC0A 1BQGA 2C76A 3CNPA 3CNDA 4II2A 3DK8A 4ZCDA 3GDPA 3CGBA 5IDZA 1NG4A 3TQPA 4EQWA 4A9WA 4X2PA 3UKFA 2WU2A 1E1NA 4C77A 3ZLFA 1KN0A 3CPIG 3ALMA 3ZLHA 3ICSA 3PK7A 2QJJA 2WPFA 2Q0KA 2OVLA 3NRZB 2XFQA 3KU9A 1F3PA 3SFDA 2JB3A 2XVIA 3CGEA 2WETA 3AB1A 2B7SA 3ES8A 1P48A 2JB1A 3CIRA 4YSXA 1IUSA 4BK2A 2HXUA 1DOEA 4Y4MA 1VQWA 3BI2A 2E4GA 4A5LA 1ZP0A 4O5UA 4P9SA 4I58A 3QVPA 1R6WA 3BHKA 5M10A 2CDUA 3TW9A 1SJCA 3VRDB 1WYGA 2XVEA 2YM2A 2YM1A 3NHOX 4UDPA 2GH5A 3QTPA 5FJPA 1ZXIC 5HHFA 3N4FA 1H83A 4FK1A 4B66A 2VRMA 1PXCA 1ZOYA 3TJ4A 3AD8B 4K2SA 2C72A 3CPHG 3NVWB 1FHVA 1KSUA 3P3BA 1KKOA 1XPYA 3NO1A 3ITJA 4TLZA 1O94A 2YLXA 2YG4A 2YG5A 1B37A 3NN6X 4CY6A 3SZ0A 3R07C 3NVYB 3I6TA 4H4SA 4B68A 4TVYA 3VR8A 4A99A 1KD0A 3CYJA 1N4VA 4G74A 2GRTA 2QJNA 4DYEA 1L9DA 4UP3A 3P1WA 3P4QA 2WS3A 4MJWA 3UTFA 1MRAA 3R25A 4A79A 3VA8A 4PABA 5TR3A 1E1MA 1VDCA 2OO6A 1CHUA 1GEUA 4IP4A 4XWRA 3GMCA 5M0ZA 2X50A 2MNRA 3ABVA 3QJ4A 4XWZA 2WP9A 3LOVA 1PS9A 2VVLA 3RCYA 1GTEA 1ZMCA 4J3ZA 2OLAA 2V60A 3NG7X 1YQZA 2R0PA 3AYLA 2JB2A 4DX3A 4YKGA 4OVIA 1NPXA 4H4RA 1P2EA 3DJJA 1CL0A 1F8SA 4H19A 3BNUA 3F8DA 4OPCA 3GD6A 2AL1A 2OG9A 1F6MA 4APNA 4OPLA 3LB8A 4IP5A 4AP1A 4E5TA 1P2HA 3GD3A 5EB4A 4EM3A 1PBDA 3U9IA 2DKHA 1LTXR 1OJCA 3AE4A 3NYFA 3BOXA 3AMZA 5EBKA 2WU5A 3Q6JA 1FL2A 1CBOA 2ZZCA 4ZCCA 2XVHA 3UJSA 2ACZA 1F8RA 4TVWA 4IL2A 1JOAA 2BXSA 2WDRA 1MNSA 4Z2RA 3QFBA 3UTEA 2BS4A 1FFUC 3UXKA 4FI4A 4H2RA 3FV9A 2YLZA 1DTNA 5J7XA 1K4QA 1D5TA 4RSLA 3LJPA 2TPRA 3CGDA 3H4KA 3NGCX 3NTAA 2OALA 2XDOA 1D4CA 5KMRA 3BNMA 2YLRA 1X31B 3ZDNA 1GESA 4JN7A 1H82A 1YY5A 1YQ3A 3VC6A 3TJIA 2OFJA 3EAOA 3UGVA 3QLDA 3DFYA 3ZVIA 2XLSA 4TM0A 3R1ZA 3UOYA 3ALJA 3D9XA 1EL5A 2R0CA 3AEBA 1O5WA 3K7MX 2PTXA 1CJCA 3U4FA 3G5RA 2RABA 1JPMA 4U8PA 1LVLA 3GDNA 3CAWA 3AE8A 4IVOB 4GDPA 1K0JA 2I5QA 3IF9A 4RG4A 3QSSA 3Q4DA 7ENLA 2GMJA 5FS6A 3DGHA 1EC9A 2C67A 2YWLA 3NRNA 2PS2A 3KPFA 2O56A 2ONEA 4G6GA 1N60C 3VCNA 2WP6A 3SN0A 3NH3X 1F8WA 2V3BA 2HNEA 4ENLA 3DFHA 3NNEA 2FJAA 2R46A 2W3RA 3T2YA 1DOBA 2RGHA 3QVRA 4GISA 3GRTA 4J34A 3UOVA 4F4RA 2AAQA 1EC8A 1IJHA 1JNRA 3Q9TA 2XFOA 2YVFA 3V3NA 2OZTA 1WUEA 2FYMA 1FO4A 3CNTA 3RO6A 3UCDA 4EMWA 3RGTA 1PBBA 1Y56A 3AEGA 3OW1A 1ELSA 1VQZA 1LJ1A 2BS2A 4NNJA 4TM3A 3H8IA 2X8HA 3UKKA 1BKHA 1NHPA 2EQ8A 1PXAA 4A3RA 1GPEA 1RSGA 1NHQA 4WCTA 4CCRA 4EMIA 1OJTA 1UKVG 2X8GA 1JPDX 5KOXA 1JROA 2GR0A 3V3WA 5HXIA 4OPGA 1IUXA 4H83A 3S5WA 2BABA 2A87A 3VRBA 3CB3A 2XYOA 1S2YA 3B97A 5CKUA 5FJUA 4GGHA 4EIQA 2C4CA 2QAEA 4K1WA 2GAGB 4GF7A 4CBQA 2GMHA 2B9WA 1MDRA 1TZZA 1GRHA 3URHA 4ADWA 3UXLA 3GY1A 3GWFA 1ZMDA 3L5OA 3QN3A 1BF3A 3K30A 4NEWA 4DGKA 1S7MA 3RP7A 1JNZA 4G9KA 4J1OA 4KPLA 2XGZA 2V5ZA 1N5XA 4J57A 3A7RA 2YQUA 3SSZA 2R4EA 3CNJA 4TLXA 3T4WA 1JEHA 6ENLA 3GYIA 1PJ6A 3FJ4A 3SQSA 3SR6B 1L8PA 2YG6A 2X99A 2EQ6A 4E8GA 1S2QA 4H4VA 4ZN0A 2F5ZA 3RP8A 4AOXA 2XVJA 4NTCA 4JY3A 4MKSA 2JAEA 4AP3A 3SBFA 2JBVA 3OP2A 1Q1RA 4EWJA 1H2IA 4ECHA 1F9CA 4KPRA 2PODA 2YLTA 2C7GA 1JRZA 2QA2A 4ZOHB 2B9XA 2BXRA 2XH2A 2A89A 3NVZB 1FEBA 1TDEA 3UJEA 5U63A 2PA6A 2XH4A 1REOA 4LU6A 1KKRA 3NLCA 2AR8A 3P9UA 3SN1A 2BRAA 1NU5A 2R45A 3CXBA 2GR3A 2J3NA 2PTYA 3B9JB 4GFIA 3P0WA 1PBFA 1N5WC 1E6EA 2ZC8A 3SXIA 1MXTA 3RITA 2BCGG 3EPTA 3E1TA 3FXGA 4KT2A 1YKJA 2GGGA 3D47A 1E7PA 2OPJA 4TM4A 3DG7A 1TDKA 3PVCA 4B67A 3DDMA 3OZYA 1BGNA 3RR1A 2XFPA 1GT8A 2HXTA 1ZDLA 4K8GA 2GAHB 4M0XA 2OZ3A 4ROPA 3SZFA 4GCMA 4H4TA 3SJNA 4H4UA 2YVJA 3UKAA 1SEZA 5HYMA 3I6EA 2ZZBA 1BWCA 1VG0A 2X3NA 5KXJA 1HYUA 1DNCA 4YXDA 1ZY8A 3PFRA 5G5HB 1FOHA 3RRAA 1PBEA 3IWAA 4GUVA 4HB9A 3R0UA 5BVAA 3DESA 1O95A 3JW7A 2BK4A 3F8PA 1OJAA 4KX6A 2XLUA 3IHGA 2PGWA 3OZ2A 4M52A 3KD9A 3FMWA 5KWFA 3AM9A 2WDVA 5FS7A 3NIXA 1V97A 1DODA 4GYPA 4WX1A 1ONEA 3NT6A 1GXFA 3P4RA 4X9MA 5C2TA 2XSXA 4JHMA 4NWZA 1N4WA 3UP5A 3MY9A 1D7LA 1MO9A 4OPUA 4H4PA 2IVDA 4YWSA 1NG3A 5BUKA 5KVIA 3SFEA 2GGEA 1NDAA 1JCTA 1X2HA 1PJ5A 1BZLA 4UDRA 2WEUA 2C66A 5JCMA 1V59A 3UOXA 5EU9A 3VDGA 1X2GA 1E1LA 3GRSA 5G5GB 3BJSA 3AEFA 5FJRA 3KLJA 2XLTA 4E6MA 1ELIA 5FMHA 3AE9A 1GOSA 2PP3A 4G73A 5JCNA 4A6NA 3CNSA 4ZA0A 1KNRA 5L46A 3AXBA 1JDFA 2QQ6A 4A6GA 4B63A 3AECA 2ZZ0A 1SJDA 3IK4A 4IL0A 1PDHA 2EQ9A 2OKTA 2FBWA 3DJGX 3T8QA 2CULA 1DJNA 4K22A 2POZA 2OLNA 1VRQB 1EBHA 4H4QA 1M64A 3GYXA 4C5OA 2XFUA 2MUCA 3N6JA 3EKGA 4IA6A 1BGJA 1PJ7A 1GRTA 3HW2A 4HN8A 4H2PA 4KWSA 4HCLA 3DGZA 4YWOA 1N4UA 3OTRA 1TDFA 3V76A 2WOWA 3MKCA 4BJYA 2VQ7A 5J60A 1TDOA 3SGLA 1NAAA 4IV9A 3PO7A 1DXLA 2QDEA 3KVEA 2XLPA 3UJFA 4B64A 3SY4A 4JQ9A 2XCGA 2EQ7A 3EUB3 2NPXA 4BK3A 2UZZA 1IYXA 2WPCA 1EL9A 3VCCA 5ER0A 4X4JA 4EM4A 3DJDA 2OAMA 1EBDA 3AN1A 3UKHA 3VRAA 1RM6B 4PAAA 3GWDA 1OEPA 3SZWA 4AT0A 3ALLA 2PTWA 2OQYA 2WOVA 2PGEA 4OCGA 4REKA 2HQMA 5JRBA 4K8DA 4XXGA 1ZX9A 2V61A 4DN1A 5ENLA 3BHFA 2P3ZA 2PHHA 2YG3A 2JK6A 3SQPA 2OX4A 1EBGA 2GGJA 2E5AA 2Z5XA 2YR6A 2WP5A 4JN9A 1FECA 3A7AA 2VVLG 3COXA 3IJLA 4GMEA 1SJBA 1RVKA 1K0IA 3FVDA 3C4AA 1TKKA 2BRYA 3ES7A 1XDIA 3M12A 3MSYA 3JVAA 1L9CA 4G7FA 3T31A 4EQRA 3GO2A 3N4EA 3LADA 1NHSA 3T2KA 1ECQA 4N9XA 3R0KA 1IUTA 2VZ2A 4H1ZA 3NK0X 4GIRA 4ICYA 4U8JA 3UKPA 3KUMA 4JY2A 4MGGA 1YEYA 3PWGA 1W6TA 2FJBA 3M13A 4IT1A 4JDRA 4DXKA 4U2SA 2OLOA 2Q6UA 1PDYA 1NENA 1PXBA 4A7AA 1FFVC 1CJ4A 1Q1WA 3G5QA 2PCEA 3WE0A 1EL8A 2YLWA 3CMMA 2ARDA 5BRTA 4BK1A 4II3A 3DGBA 5GSNA 3BSMA 1JRPA 2C73A 2YR5A 4K5SA 3I4KA 3GD4A 3GMBA 1E9IA 4GAPA 3FBSA 5KMSA 2B7RA 1GRBA 1H81A 2B9YA 4IA5A 1WUFA 2WPEA 3H12A 2GQWA 5KMPA 3JSKA 3DIPA 3D46A 3KA7A 1D4EA 3UP4A 3UKLA 3FIMB 1VG9A 1MDLA 4J2WA 4H4WA 2QVHA 3S5SA 1FCDA 4YSHA 2E1MA 3EANA 3NZGA 4HNLA 4Z24A 4EQSA 4Z1YA 2XLRA 3DMEA 3UCLA 4EQXA 3TWBA 3UJRA 1CJ2A 4I59A 2BC1A 1YQ4A 3QFAA 3AEEA 1B5QA 1KF6A 1H6VA 3CGCA 3UCCA 4A6NB 1OJDA 4CNKA 1Z6LA 3I6DA 4YTMA 1KCZA 2GB0A 1GRAA 4USQA 3ICRA 2B76A 3ADAB 3SYIA 5KOWA 2QJMA 3A7UA 5JCLA 1R0MA 2W3SA 3AE6A 5BOEA 1TYTA 4GGBA 2H89A 3VC5A 4JNQA 4Y4LA 2YAUA 4FDCB 4K7ZA 2XH7A 4HPNA 4EIPA 4DHGA 3G5SA 2BS3A 4K2XA 2PSNA 2NVKX 4J56A 2GF3A 3MZNA 3HYXA 5GRTA 1CJ3A 4H2QA 1KSSA 5EB5A 3T0KA 4B69A 3GSIA 2GR1A 1B8SA 1SB3B 5KRQA 4G8TA 4CY8A 2FJDA 3DEQA 4FK1C 2ZBWA 2HZGA 4Z2TA 3CTYA 4C3YA 1GRFA 1N62C 1OJ9A 1CC4A 2P8BA 1NHRA 2H88A 4O5QA 2RGOA 4E0VA 2VVMA 2BK3A 3P4SA 4YKFA 1H84A 4HYRA 4NTEA 3RHAA 3IJIA 1TDNA 4IHCA 3SM8A 1IUWA 3V5FA 4J33A 4AT2A 3V3OA 3PWIA 4BURA 3F8RA 4CNJA 4A65A 5DBJA 2QDDA 1GERA 2CVJA 2XVFA 4G6HA 2PPGA 4A35A 3T14A 4HCDA 2C64A 2WQYA 1B4VA 3HYVA 4J31A 2DKIA 4C3XA 5HY5A 4LIIA 3B6DA 3DA1A 5FJTA 4B1BA 3VFCA 2BYBA 4K5RA 5EOWA 1K0LA 3HZLA 3PG6A 3V4BA 1BKWA 4Z25A 5LV9A 2R4JA 1PN0A 2QCUA 2GR2A 2V3AA 1PDZA 2X8CA 4OPTA 3P4PA 1GTHA 1NELA 1Y56B 2GQFA 1GALA 2NQLA 2AQJA 1ONFA 2PU1A 4U8NA 2CFYA 3ZYXA 3H8AA 5U25A 2QA1A 1VDVA 3EF6A 2V6OA 3M0OA 3K7QX 2AL2B 1TRBA 1XS2A 1AOGA 3IHMA 3KKJA 3RP6A 3O0HA 4JNAA 4IVMB 3H8LA 3LZXA 3AWIA 3T6CA 5IQ1A 4TM1A 1H7WA 4GRTA 3MUCA 1QLBA 2E3TA 3IC9A 1Q9IA 4U8LA 4H2NA 2TMDA 3DERA 3UOZA 3UTGA 4NTDA 2ZADA 2GDQA 3T9PA 4YT0A 1XPQA 2GGIA 2WESA 3NYCA 1JRYA 2BK5A 4MMWA 4DSGA 3ZVHB 3RNMA 4GR1A 1COYA 2WBAA 4H2HA 3CN8A 3AEDA 1GNDA 4RG3A 1ZKQA 2DW6A 3MWCA 1JRXA 2Z5YA 2C3DA 3CK5A 3TWAA 3K7TA 2GGHA 2R9ZA 3NS1B 3HRDC 4H4XA 5IQ4A 4LA1A 1P43A 3SZCA 2W0HA 2AKMA 3NN0X 3IJQA 3S61A 2Y6QA 1GRGA 3LZWA 4Z2UA 1KDGA 3NYEA 5IPYA 1S3BA 3MQTA 2IIDA 1QO8A 2C3CA 3R10A 2E5VA 2C75A 3BI4A 4IZGA 1EC7A 3DJEA 4AOSA 2P88A 4JN8A 4ZCWA 4CRTA 5J04A 1FIQB 1TYPA 3DG6A 2W55A 2Q0LA 3TOYA 3GC2A 4DWDA 1FHUA 3BI5A 3NK2X 1D7YA 2JKCA 3NTDA 1DOCA 2XFNA 3PS9A 2PMQA 2QGYA 3AEAA 1N61C 2OA1A 3ZVHA 3P93A 4USRA 4D03A 3Q45A 3OPSA 4HA6A 3NFUA 1QJDA 4BJZA 1SJAA 4U8OA 5JCIA 3REDA 3ETRB 3SN4A 3THUA 3DH9A 2O9ZA 2BA9A 3AE7A 3FCPA 2CHRA 3GYJA 4M6UA 4U8KA 2C65A 2BCPA 3SX6A 2FKPA 2GL5A 4KEMA 3CPJG 2AKZA 2IVEA 2Q7VA 4U2TA 5KMQA 4Z44A 4FP1A 2RGJA 3AE5A 3L8KA 5U1OA 1LV0A 3EEZA 4H50A 1KNPA 2OZ8A 2GV8A 3QKEA 4BV6A 3ICTA 1MOKA 4FX9A 1LQTA 1GREA 3DK9A 3H7VA 1CC2A 3AD7B 1H7XA 3AE2A 3HYWA 2VQBA 3CT2A 4UDQA 2YG7A 3OZMA
chains in the Genus database with same CATH topology
5JCKA 2H89A 1O95A 3F8DA 4OPCA 2BK4A 1GSNA 4JNQA 4Y4LA 2YAUA 3F8PA 4FDCB 1OJAA 4K7ZA 1CF3A 1F6MA 4KX6A 4APNA 2XLUA 4OPLA 4EMJA 4DNAA 3IHGA 4EIPA 3LB8A 4U8MA 3G5SA 2BS3A 3OZ2A 4M52A 4K2XA 2NVKX 4J56A 1L0VA 3KD9A 4YTNA 2GF3A 4AP1A 3FMWA 3HYXA 5KWFA 5GRTA 1CJ3A 1P2HA 1KSSA 4H2QA 3GD3A 5EB4A 5EB5A 4EM3A 3T0KA 1PBDA 4B69A 2WDVA 5FS7A 4H4ZA 2DKHA 2GR1A 3GSIA 2APGA 3NIXA 1DODA 1B8SA 1LTXR 4WX1A 1OJCA 3AE4A 3T2ZA 1EL7A 3ATRA 3NYFA 5EBKA 3NT6A 3AD9B 2WU5A 4CCQA 3Q6JA 1FL2A 1H86A 5KRQA 4CY8A 1GXFA 3P4RA 4X9MA 2FJDA 5C2TA 4FK1C 1CBOA 2ZZCA 2ZBWA 4Z2TA 4NWZA 2XVHA 4ZCCA 1N4WA 3UP5A 3T37A 2ACZA 1F8RA 1D7LA 1MO9A 3CTYA 4OPUA 4C3YA 3I3LA 4H4PA 2IVDA 1JOAA 1GRFA 2BXSA 1DJQA 1OJ9A 1NG3A 2WDRA 1CC4A 5BUKA 5KVIA 3SFEA 1GV4A 4Z2RA 3FG2P 3QFBA 1PHHA 3UTEA 1NHRA 1N1PA 2BS4A 4H2RA 2H88A 1NDAA 4O5QA 2RGOA 1PJ5A 2YLZA 4Z26A 5J7XA 1K4QA 1BZLA 1D5TA 2VVMA 4E0VA 4RSLA 4C74A 3LJPA 2BK3A 3P4SA 4UDRA 4YKFA 2TPRA 4YTPA 3CGDA 3H4KA 3UTHA 1H84A 4GAVA 1RYIA 2C70A 2WEUA 3NGCX 2C66A 1L9EA 5JCMA 3NTAA 5BVAA 4NTEA 4X9NA 4GDEA 3RHAA 1V59A 3UOXA 1TDNA 2VRLA 2OALA 3SM8A 1IUWA 2XDOA 1D4CA 1E1LA 2WDQA 4J33A 3GRSA 3V3OA 4AT2A 5KMRA 3BNMA 2FJEA 2R0GA 4BURA 3F8RA 4CNJA 4A65A 5C3JA 2YLRA 5DBJA 1X31B 3AEFA 3ZDNA 1GESA 1H82A 1GERA 1YY5A 3KLJA 2CVJA 2WHDA 1YQ3A 2XLTA 2XVFA 1ELIA 3EAOA 5FMHA 3UKQA 1S3EA 3AE9A 1GOSA 3C96A 2XLSA 4G6HA 4TM0A 3UOYA 3ALJA 3D8XA 3D9XA 4G73A 5JCNA 1EL5A 2R0CA 3AEBA 3T14A 4A6NA 1O5WA 3K7MX 2C64A 3AE3A 3CNSA 2WQYA 1B4VA 1CJCA 1KNRA 3HYVA 4J31A 2DKIA 3G5RA 4Z43A 5L46A 2RABA 3AXBA 3QSMA 2WOIA 4U8PA 1LVLA 1M6IA 3GDNA 5CQFA 4B63A 4C3XA 5HY5A 3AECA 4LIIA 3B6DA 3DA1A 3AYIA 2ZZ0A 4B1BA 3AE8A 4IVOB 3OC4A 4GDPA 1K0JA 3AE1A 3IF9A 1PDHA 2Y6RA 5KNLA 2BYBA 1E1KA 4K5RA 2EQ9A 2FBWA 3QSSA 4RG4A 5EOWA 3DJGX 1K0LA 2CULA 1KFYA 2GMJA 1DJNA 2YLSA 4K22A 5FS6A 4H4YA 3DGHA 3HZLA 3PG6A 2OLNA 2C67A 1BKWA 4Z25A 2YWLA 5LV9A 1VRQB 3NRNA 3KPFA 2R4JA 5BULA 1PN0A 1IUVA 2QCUA 2GR2A 4H4QA 2V3AA 1M64A 2GVCA 3GYXA 4C5OA 2XFUA 4U8IA 2GEWA 4IA6A 3NKSA 2X8CA 4G6GA 1BGJA 1PJ7A 1GRTA 1XHCA 4OPTA 4H2PA 2WP6A 1JU2A 3NH3X 3LXDA 3DGZA 4YWOA 1F8WA 2V3BA 1GTHA 3KPKA 1N4UA 3P4PA 5FS8A 4OPDA 3NNEA 1GETA 1LQUA 1TDFA 4U2LA 3V76A 2FJAA 2R46A 2WOWA 4B65A 1Y56B 3T2YA 1E39A 1XANA 1DOBA 2RGHA 2GQFA 3QSEA 4BJYA 4Y4NA 1GALA 2I0ZA 3QVRA 2VQ7A 3GRTA 4J34A 3UOVA 2AQJA 4YSZA 1TDOA 1ONFA 5KVHA 3SGLA 5J60A 3NK1X 4U8NA 1NAAA 2AAQA 4IV9A 3ATQA 3VQRA 3PO7A 1DXLA 2YVGA 2CFYA 1IJHA 1JNRA 3Q9TA 4J36A 3ZYXA 2XFOA 2YVFA 3V3NA 3KVEA 2XLPA 3CNTA 4B64A 5U25A 4EMWA 3AYJA 3R9UA 4JQ9A 2QA1A 1RP0A 5FS9A 2XCGA 3SY4A 1Y56A 1PBBA 2EQ7A 2VOUA 1Y0PA 3VR9A 4NEVA 2NPXA 1W4XA 3AEGA 1D4DA 4OPIA 2UZZA 4BK3A 3EF6A 2WPCA 3D1CA 1ZOVA 2V6OA 3M0OA 3ISHA 1LPFA 3K7QX 1EL9A 1CC6A 1TRBA 3L1RA 1LJ1A 2BS2A 4NNJA 1FEAA 1AOGA 2YR4A 5ER0A 3H8IA 3IHMA 4TM3A 2A8XA 2BACA 4X4JA 4DSHA 2X8HA 3DK4A 4EM4A 3B3RA 3DJDA 2OAMA 3KKJA 1EBDA 1NEKA 4D04A 2PYXA 3UKKA 3RP6A 3O0HA 1NHPA 3UKHA 3VRAA 4JNAA 3C4NA 3FPZA 2EQ8A 1PXAA 4IVMB 4NZHA 1GPEA 3H8LA 4PAAA 4YSYA 3GWDA 3LZXA 3SZWA 1RSGA 1PBCA 3AWIA 5IQ1A 1NHQA 4AT0A 3ALLA 4TM1A 1ZK7A 3II4A 1H7WA 4H7UA 4GRTA 1IUUA 4WCTA 1QLBA 4CCRA 3IC9A 4EMIA 2BC0A 1OJTA 1Q9IA 2C76A 4U8LA 1UKVG 2WOVA 3CNPA 4H2NA 2X8GA 3CNDA 2TMDA 4II2A 3DK8A 4OCGA 3UOZA 4REKA 2HQMA 4NTDA 3UTGA 5KOXA 5JRBA 4K8DA 4XXGA 1ZX9A 3GDPA 3CGBA 2GR0A 1NG4A 2V61A 4ZCDA 4YT0A 1XPQA 3BHFA 5HXIA 4EQWA 2WESA 2PHHA 3NYCA 4OPGA 4A9WA 1JRYA 3UKFA 2WU2A 1E1NA 1IUXA 2BK5A 2YG3A 4C77A 3S5WA 1KN0A 2BABA 2A87A 3ALMA 3CPIG 3VRBA 2JK6A 3SQPA 4DSGA 2XYOA 3ICSA 1S2YA 5CKUA 3RNMA 4GR1A 1COYA 2WBAA 4EIQA 2WPFA 2C4CA 2Q0KA 2YR6A 2Z5XA 2QAEA 2GAGB 2XFQA 3CN8A 4GF7A 3AEDA 4CBQA 1GNDA 2GMHA 4RG3A 3KU9A 2B9WA 1F3PA 1ZKQA 3SFDA 2WP5A 4JN9A 1FECA 2JB3A 1GRHA 2VVLG 2XVIA 3URHA 4ADWA 1JRXA 2Z5YA 3CGEA 3COXA 2WETA 3AB1A 2C3DA 3K7TA 2B7SA 3GWFA 1ZMDA 2R9ZA 3L5OA 1K0IA 1BF3A 4YSXA 3C4AA 2JB1A 3CIRA 3K30A 1IUSA 4NEWA 4DGKA 2BRYA 1S7MA 4H4XA 4BK2A 5IQ4A 3RP7A 1DOEA 1JNZA 4LA1A 4Y4MA 3SZCA 4G9KA 1VQWA 1XDIA 2W0HA 3BI2A 3M12A 3NN0X 1L9CA 3T31A 2E4GA 2V5ZA 4EQRA 3S61A 4A5LA 1ZP0A 3LADA 1NHSA 4O5UA 4J57A 2Y6QA 1GRGA 4P9SA 3LZWA 2YQUA 3QVPA 4I58A 4N9XA 1IUTA 2R4EA 2VZ2A 3BHKA 4Z2UA 5M10A 2CDUA 3CNJA 1KDGA 3NK0X 4TLXA 1JEHA 3NYEA 4ICYA 5IPYA 3VRDB 4U8JA 3UKPA 3GYIA 2XVEA 1PJ6A 2YM2A 4JY2A 1S3BA 2IIDA 2YM1A 1QO8A 3NHOX 3T2KA 4UDPA 2GH5A 2C3CA 2E5VA 2YG6A 2C75A 3BI4A 2FJBA 2X99A 3M13A 5HHFA 2EQ6A 3DJEA 4JDRA 1S2QA 4H4VA 1H83A 4AOSA 4U2SA 2OLOA 4ZN0A 2Q6UA 2F5ZA 3RP8A 1NENA 4FK1A 1PXBA 2XVJA 4NTCA 4AOXA 4A7AA 4CRTA 4JY3A 4B66A 1CJ4A 2JAEA 2VRMA 4AP3A 1Q1WA 2JBVA 1PXCA 1ZOYA 3G5QA 1Q1RA 3WE0A 1H2IA 1TYPA 4ECHA 4KPRA 1EL8A 2YLTA 2C7GA 3AD8B 2Q0LA 2C72A 3CPHG 1JRZA 1KSUA 2YLWA 3CMMA 3BI5A 3NK2X 2ARDA 5BRTA 4BK1A 1D7YA 3ITJA 2QA2A 2JKCA 4II3A 2B9XA 3NTDA 1O94A 4TLZA 1DOCA 2YLXA 2BXRA 2YG4A 5GSNA 2YG5A 2XFNA 3PS9A 1B37A 2A89A 2C73A 2YR5A 3NN6X 4K5SA 4CY6A 3GD4A 3SZ0A 1FEBA 3GMBA 1TDEA 3AEAA 5U63A 4GAPA 3FBSA 1REOA 2OA1A 4H4SA 5KMSA 2B7RA 4LU6A 1GRBA 4B68A 1H81A 2B9YA 4IA5A 4USRA 2WPEA 4D03A 3VR8A 3NLCA 2GQWA 5KMPA 4HA6A 2AR8A 3JSKA 3P9UA 2BRAA 2R45A 3KA7A 4A99A 1QJDA 2GR3A 1D4EA 3UP4A 2J3NA 3UKLA 4BJZA 3FIMB 4G74A 1N4VA 2GRTA 5JCIA 4U8OA 3REDA 1VG9A 1L9DA 1PBFA 4UP3A 4J2WA 3P1WA 4H4WA 1E6EA 3P4QA 1FCDA 2WS3A 3SXIA 4MJWA 1MXTA 2O9ZA 3DH9A 3UTFA 3EPTA 2BCGG 3E1TA 4A79A 1YKJA 2BA9A 3AE7A 4PABA 4YSHA 5TR3A 1E1MA 2E1MA 1E7PA 3EANA 4TM4A 3GYJA 1VDCA 4Z24A 1TDKA 4U8KA 4EQSA 2C65A 3PVCA 1CHUA 4B67A 1GEUA 2BCPA 3SX6A 1BGNA 4XWRA 2XLRA 2XFPA 3DMEA 3UCLA 3GMCA 4EQXA 1GT8A 5M0ZA 1CJ2A 4I59A 3CPJG 2BC1A 1YQ4A 2IVEA 1ZDLA 2GAHB 2Q7VA 2X50A 4U2TA 5KMQA 3ABVA 4Z44A 3QJ4A 4XWZA 2RGJA 3SZFA 3QFAA 2WP9A 3AEEA 3AE5A 3LOVA 3L8KA 4GCMA 1B5QA 1KF6A 1PS9A 2VVLA 5U1OA 1LV0A 4H4TA 4H50A 1H6VA 3CGCA 4H4UA 1GTEA 4A6NB 1KNPA 2YVJA 3UKAA 1OJDA 4CNKA 1ZMCA 1Z6LA 1SEZA 5HYMA 3I6DA 2ZZBA 4YTMA 1BWCA 2V60A 1VG0A 2X3NA 2GV8A 3NG7X 1HYUA 5KXJA 4BV6A 1YQZA 1DNCA 2GB0A 2R0PA 3AYLA 1MOKA 4FX9A 3ICTA 1GRAA 4YXDA 2JB2A 4USQA 1LQTA 1GREA 4YKGA 1ZY8A 4OVIA 3DK9A 3ICRA 1FOHA 1NPXA 2B76A 3ADAB 4H4RA 3SYIA 1CC2A 1P2EA 5KOWA 3AD7B 3DJJA 1H7XA 1CL0A 1F8SA 1PBEA 5JCLA 3IWAA 4GUVA 3AE2A 3HYWA 2VQBA 3AE6A 4HB9A 4UDQA 3BNUA 1TYTA 2YG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCK A;  2H89 A;  1O95 A;  3F8D A;  4OPC A;  2BK4 A;  1GSN A;  4JNQ A;  4Y4L A;  2YAU A;  3F8P A;  1OJA A;  4FDC B;  4K7Z A;  1CF3 A;  1F6M A;  4KX6 A;  4APN A;  2XLU A;  4OPL A;  4EMJ A;  3IHG A;  4DNA A;  4EIP A;  3LB8 A;  4U8M A;  3G5S A;  2BS3 A;  3OZ2 A;  4M52 A;  4K2X A;  2NVK X;  4J56 A;  1L0V A;  3KD9 A;  4YTN A;  2GF3 A;  4AP1 A;  3FMW A;  5KWF A;  4H2Q A;  1CJ3 A;  1P2H A;  1KSS A;  5GRT A;  3GD3 A;  5EB4 A;  5EB5 A;  4EM3 A;  4B69 A;  1PBD A;  2WDV A;  5FS7 A;  4H4Z A;  2DKH A;  2GR1 A;  3GSI A;  2APG A;  3NIX A;  1DOD A;  1B8S A;  1LTX R;  4WX1 A;  1OJC A;  3AE4 A;  1EL7 A;  3ATR A;  3NYF A;  5EBK A;  3NT6 A;  3AD9 B;  2WU5 A;  4CCQ A;  3Q6J A;  1FL2 A;  1H86 A;  5KRQ A;  4CY8 A;  1GXF A;  3P4R A;  4X9M A;  2FJD A;  5C2T A;  4FK1 C;  1CBO A;  2ZBW A;  2ZZC A;  4Z2T A;  4ZCC A;  2XVH A;  1N4W A;  3UP5 A;  3T37 A;  2ACZ A;  1F8R A;  1D7L A;  1MO9 A;  3CTY A;  4OPU A;  4C3Y A;  3I3L A;  4H4P A;  2IVD A;  1JOA A;  1GRF A;  2BXS A;  1DJQ A;  1OJ9 A;  1NG3 A;  2WDR A;  1CC4 A;  5BUK A;  5KVI A;  3SFE A;  1GV4 A;  4Z2R A;  3FG2 P;  3QFB A;  1PHH A;  3UTE A;  1NHR A;  1N1P A;  2BS4 A;  4H2R A;  2H88 A;  1NDA A;  4O5Q A;  2RGO A;  1PJ5 A;  2YLZ A;  4Z26 A;  5J7X A;  1D5T A;  1BZL A;  1K4Q A;  2VVM A;  4E0V A;  4RSL A;  4C74 A;  3LJP A;  2BK3 A;  3P4S A;  4UDR A;  4YKF A;  2TPR A;  4YTP A;  3CGD A;  3H4K A;  3UTH A;  1H84 A;  1RYI A;  2C70 A;  2WEU A;  3NGC X;  2C66 A;  1L9E A;  5JCM A;  3NTA A;  5BVA A;  4NTE A;  4X9N A;  4GDE A;  3RHA A;  1V59 A;  3UOX A;  1TDN A;  2VRL A;  2OAL A;  3SM8 A;  1IUW A;  2XDO A;  1D4C A;  1E1L A;  2WDQ A;  4J33 A;  3GRS A;  3V3O A;  4AT2 A;  3BNM A;  2FJE A;  2R0G A;  3F8R A;  4BUR A;  4CNJ A;  4A65 A;  5C3J A;  2YLR A;  5DBJ A;  1X31 B;  3AEF A;  3ZDN A;  1GES A;  1H82 A;  1GER A;  1YY5 A;  3KLJ A;  2CVJ A;  2WHD A;  1YQ3 A;  2XLT A;  2XVF A;  1ELI A;  3EAO A;  5FMH A;  3UKQ A;  1S3E A;  3AE9 A;  1GOS A;  3C96 A;  2XLS A;  4TM0 A;  3UOY A;  3ALJ A;  3D8X A;  1EL5 A;  5JCN A;  2R0C A;  3AEB A;  4A6N A;  1O5W A;  3K7M X;  2C64 A;  3AE3 A;  3CNS A;  2WQY A;  1B4V A;  1CJC A;  1KNR A;  4J31 A;  2DKI A;  3G5R A;  4Z43 A;  5L46 A;  2RAB A;  3AXB A;  3QSM A;  2WOI A;  4U8P A;  1M6I A;  1LVL A;  3GDN A;  5CQF A;  4B63 A;  4C3X A;  5HY5 A;  3AEC A;  3DA1 A;  3B6D A;  4LII A;  3AYI A;  2ZZ0 A;  4B1B A;  3AE8 A;  4IVO B;  3OC4 A;  4GDP A;  1K0J A;  3AE1 A;  3IF9 A;  1PDH A;  2Y6R A;  2BYB A;  1E1K A;  4K5R A;  2EQ9 A;  2FBW A;  3QSS A;  4RG4 A;  5EOW A;  1K0L A;  2CUL A;  3DJG X;  1KFY A;  2GMJ A;  1DJN A;  2YLS A;  4K22 A;  5FS6 A;  4H4Y A;  3DGH A;  3HZL A;  2OLN A;  2C67 A;  1BKW A;  4Z25 A;  2YWL A;  5LV9 A;  1VRQ B;  3NRN A;  3KPF A;  2R4J A;  5BUL A;  1PN0 A;  1IUV A;  2QCU A;  2GR2 A;  4H4Q A;  2V3A A;  1M64 A;  2GVC A;  4C5O A;  2XFU A;  4U8I A;  2GEW A;  4IA6 A;  3NKS A;  2X8C A;  1BGJ A;  1PJ7 A;  1GRT A;  1XHC A;  4OPT A;  4H2P A;  2WP6 A;  1JU2 A;  3NH3 X;  3LXD A;  3DGZ A;  4YWO A;  1F8W A;  2V3B A;  1GTH A;  3P4P A;  1N4U A;  5FS8 A;  4OPD A;  3NNE A;  1GET A;  1LQU A;  1TDF A;  4U2L A;  3V76 A;  2FJA A;  2R46 A;  2WOW A;  4B65 A;  1Y56 B;  1E39 A;  1XAN A;  1DOB A;  2RGH A;  2GQF A;  3QSE A;  4BJY A;  4Y4N A;  1GAL A;  2I0Z A;  3QVR A;  2VQ7 A;  3GRT A;  4J34 A;  3UOV A;  2AQJ A;  4YSZ A;  1TDO A;  1ONF A;  3SGL A;  5J60 A;  5KVH A;  3NK1 X;  4U8N A;  1NAA A;  2AAQ A;  4IV9 A;  3ATQ A;  3VQR A;  3PO7 A;  1DXL A;  2YVG A;  2CFY A;  1IJH A;  1JNR A;  3Q9T A;  4J36 A;  3ZYX A;  2XFO A;  2YVF A;  3V3N A;  3KVE A;  2XLP A;  3CNT A;  4B64 A;  5U25 A;  4EMW A;  3AYJ A;  3R9U A;  4JQ9 A;  2QA1 A;  1RP0 A;  5FS9 A;  2XCG A;  1Y56 A;  1PBB A;  2EQ7 A;  2VOU A;  1Y0P A;  3VR9 A;  4NEV A;  2NPX A;  1W4X A;  3AEG A;  1D4D A;  4OPI A;  2UZZ A;  4BK3 A;  3EF6 A;  2WPC A;  3D1C A;  1ZOV A;  2V6O A;  3M0O A;  3ISH A;  1LPF A;  3K7Q X;  1EL9 A;  1CC6 A;  1TRB A;  3L1R A;  1LJ1 A;  2BS2 A;  4TM3 A;  1FEA A;  3IHM A;  2YR4 A;  5ER0 A;  3H8I A;  4X4J A;  4DSH A;  2A8X A;  2BAC A;  1AOG A;  2X8H A;  3DK4 A;  3B3R A;  3DJD A;  3KKJ A;  2OAM A;  4D04 A;  1EBD A;  1NEK A;  4EM4 A;  2PYX A;  3UKK A;  3RP6 A;  3O0H A;  1NHP A;  3UKH A;  3VRA A;  4JNA A;  3C4N A;  3FPZ A;  2EQ8 A;  1PXA A;  4IVM B;  4NZH A;  1GPE A;  3H8L A;  4PAA A;  4YSY A;  3GWD A;  3LZX A;  1RSG A;  1PBC A;  3AWI A;  5IQ1 A;  1NHQ A;  4AT0 A;  3ALL A;  4TM1 A;  1H7W A;  1ZK7 A;  3II4 A;  4H7U A;  4GRT A;  1IUU A;  4WCT A;  1QLB A;  4CCR A;  3IC9 A;  4EMI A;  2BC0 A;  2C76 A;  1Q9I A;  1OJT A;  4U8L A;  1UKV G;  2WOV A;  3CNP A;  4H2N A;  2X8G A;  3CND A;  2TMD A;  3DK8 A;  4OCG A;  3UOZ A;  4REK A;  2HQM A;  4NTD A;  3UTG A;  5KOX A;  4K8D A;  4XXG A;  1ZX9 A;  3GDP A;  2V61 A;  1NG4 A;  2GR0 A;  3CGB A;  4ZCD A;  4YT0 A;  1XPQ A;  3BHF A;  5HXI A;  4EQW A;  2WES A;  2PHH A;  3NYC A;  4OPG A;  4A9W A;  1JRY A;  3UKF A;  2WU2 A;  1E1N A;  1IUX A;  2BK5 A;  2YG3 A;  4C77 A;  3S5W A;  2BAB A;  3CPI G;  2A87 A;  3ALM A;  3VRB A;  2JK6 A;  3SQP A;  4DSG A;  2XYO A;  3ICS A;  1S2Y A;  5CKU A;  3RNM A;  4GR1 A;  1COY A;  2WBA A;  4EIQ A;  2WPF A;  2YR6 A;  2Q0K A;  2Z5X A;  2GAG B;  2QAE A;  2XFQ A;  3CN8 A;  4GF7 A;  3AED A;  4CBQ A;  1GND A;  2GMH A;  4RG3 A;  3KU9 A;  2B9W A;  1F3P A;  1ZKQ A;  3SFD A;  2WP5 A;  4JN9 A;  1FEC A;  2JB3 A;  1GRH A;  2VVL G;  2XVI A;  1JRX A;  3COX A;  3URH A;  2Z5Y A;  3CGE A;  4ADW A;  2WET A;  3AB1 A;  2C3D A;  3K7T A;  2B7S A;  3GWF A;  1ZMD A;  2R9Z A;  1K0I A;  1BF3 A;  4YSX A;  3C4A A;  2JB1 A;  3CIR A;  3K30 A;  1IUS A;  4NEW A;  4DGK A;  4H4X A;  4BK2 A;  5IQ4 A;  3RP7 A;  1DOE A;  1JNZ A;  4LA1 A;  4Y4M A;  1VQW A;  1XDI A;  2W0H A;  3BI2 A;  3M12 A;  3NN0 X;  1L9C A;  2E4G A;  2V5Z A;  3S61 A;  4EQR A;  4A5L A;  1ZP0 A;  3LAD A;  1NHS A;  4O5U A;  4J57 A;  2Y6Q A;  1GRG A;  4P9S A;  3LZW A;  2YQU A;  3QVP A;  4I58 A;  4N9X A;  1IUT A;  2R4E A;  2VZ2 A;  3BHK A;  4Z2U A;  5M10 A;  2CDU A;  3CNJ A;  1KDG A;  3NK0 X;  4TLX A;  1JEH A;  3NYE A;  4ICY A;  5IPY A;  3VRD B;  4U8J A;  3UKP A;  3GYI A;  2XVE A;  1PJ6 A;  2YM2 A;  4JY2 A;  1S3B A;  2IID A;  2YM1 A;  1QO8 A;  3NHO X;  4UDP A;  2GH5 A;  2C3C A;  2E5V A;  2YG6 A;  2C75 A;  3BI4 A;  2FJB A;  2X99 A;  3M13 A;  5HHF A;  2EQ6 A;  3DJE A;  1S2Q A;  4JDR A;  1H83 A;  4H4V A;  4AOS A;  4U2S A;  2OLO A;  4ZN0 A;  2Q6U A;  2F5Z A;  3RP8 A;  1NEN A;  4FK1 A;  1PXB A;  2XVJ A;  4NTC A;  4AOX A;  4A7A A;  4CRT A;  4JY3 A;  4B66 A;  1CJ4 A;  2JAE A;  2VRM A;  4AP3 A;  1Q1W A;  2JBV A;  1PXC A;  1ZOY A;  3G5Q A;  1Q1R A;  3WE0 A;  1TYP A;  4ECH A;  4KPR A;  1EL8 A;  2YLT A;  2C7G A;  3AD8 B;  2Q0L A;  2C72 A;  3CPH G;  1JRZ A;  1KSU A;  2YLW A;  3BI5 A;  3NK2 X;  2ARD A;  5BRT A;  4BK1 A;  1D7Y A;  3ITJ A;  2QA2 A;  2JKC A;  4TLZ A;  2B9X A;  3NTD A;  1O94 A;  1DOC A;  2YLX A;  2BXR A;  2YG4 A;  5GSN A;  2YG5 A;  2XFN A;  3PS9 A;  1B37 A;  2A89 A;  2C73 A;  2YR5 A;  3NN6 X;  4K5S A;  4CY6 A;  3GD4 A;  1FEB A;  3GMB A;  1TDE A;  3AEA A;  5U63 A;  3FBS A;  1REO A;  2OA1 A;  4H4S A;  2B7R A;  4LU6 A;  1GRB A;  4B68 A;  1H81 A;  2B9Y A;  4IA5 A;  4USR A;  2WPE A;  4D03 A;  3VR8 A;  3NLC A;  2GQW A;  4HA6 A;  2AR8 A;  3JSK A;  3P9U A;  2R45 A;  3KA7 A;  4A99 A;  1QJD A;  1D4E A;  2GR3 A;  3UP4 A;  2J3N A;  3UKL A;  4BJZ A;  3FIM B;  1N4V A;  2GRT A;  4U8O A;  3RED A;  5JCI A;  1VG9 A;  1L9D A;  1PBF A;  4UP3 A;  4J2W A;  3P1W A;  4H4W A;  1E6E A;  3P4Q A;  1FCD A;  2WS3 A;  4MJW A;  1MXT A;  2O9Z A;  3DH9 A;  3UTF A;  3EPT A;  2BCG G;  3E1T A;  4A79 A;  1YKJ A;  2BA9 A;  3AE7 A;  4PAB A;  4YSH A;  1E1M A;  2E1M A;  5TR3 A;  1E7P A;  3EAN A;  4TM4 A;  3GYJ A;  1VDC A;  4Z24 A;  1TDK A;  4U8K A;  2C65 A;  3PVC A;  4EQS A;  1CHU A;  4B67 A;  1GEU A;  2BCP A;  1BGN A;  4XWR A;  2XLR A;  2XFP A;  3DME A;  3UCL A;  3GMC A;  1GT8 A;  4EQX A;  5M0Z A;  1CJ2 A;  4I59 A;  3CPJ G;  2BC1 A;  1YQ4 A;  2IVE A;  1ZDL A;  2GAH B;  2Q7V A;  2X50 A;  4U2T A;  3ABV A;  4Z44 A;  3QJ4 A;  4XWZ A;  2RGJ A;  3AEE A;  2WP9 A;  3LOV A;  3AE5 A;  3QFA A;  3L8K A;  4GCM A;  1B5Q A;  1KF6 A;  1PS9 A;  2VVL A;  1LV0 A;  5U1O A;  4H4T A;  4H50 A;  1H6V A;  3CGC A;  4H4U A;  1GTE A;  4A6N B;  1KNP A;  2YVJ A;  3UKA A;  1OJD A;  4CNK A;  1ZMC A;  1Z6L A;  1SEZ A;  5HYM A;  3I6D A;  2ZZB A;  4YTM A;  1BWC A;  2V60 A;  1VG0 A;  2X3N A;  2GV8 A;  3NG7 X;  1HYU A;  5KXJ A;  4BV6 A;  1YQZ A;  1DNC A;  2GB0 A;  2R0P A;  3AYL A;  1MOK A;  3ICT A;  4FX9 A;  1GRA A;  4YXD A;  2JB2 A;  4USQ A;  1LQT A;  1GRE A;  4YKG A;  1ZY8 A;  4OVI A;  3DK9 A;  3ICR A;  1FOH A;  1NPX A;  2B76 A;  3ADA B;  4H4R A;  1CC2 A;  1P2E A;  5KOW A;  3AD7 B;  3DJJ A;  1H7X A;  1CL0 A;  1F8S A;  1PBE A;  5JCL A;  3IWA A;  4GUV A;  3AE2 A;  2VQB A;  3AE6 A;  4HB9 A;  4UDQ A;  3BNU A;  1TYT A;  2YG7 A; 
#chains in the Genus database with same CATH topology
 5JCK A;  1T3Q C;  3N6H A;  1GSN A;  2XH0 A;  2W54 A;  1CF3 A;  3K1G A;  4EMJ A;  4DNA A;  4U8M A;  1L0V A;  4YTN A;  4H4Z A;  2APG A;  3T2Z A;  1EL7 A;  3HPF A;  3ATR A;  3AD9 B;  4CCQ A;  1H86 A;  2PU0 A;  3T37 A;  3I3L A;  3NXL A;  1DJQ A;  2P0I A;  1GV4 A;  3FG2 P;  1PHH A;  1N1P A;  3QPE A;  3H70 A;  3TCS A;  4Z26 A;  4C74 A;  4YTP A;  3UTH A;  4GAV A;  1RYI A;  2PP0 A;  2C70 A;  1L9E A;  1TE6 A;  1MUC A;  4X9N A;  4GDE A;  2VRL A;  1STZ A;  2WDQ A;  2GSH A;  2FJE A;  2R0G A;  5C3J A;  2P8C A;  2WHD A;  3UKQ A;  1S3E A;  5BOF A;  3C96 A;  3D8X A;  3AE3 A;  4E4F A;  4Z43 A;  3ENL A;  3QSM A;  3ZLG A;  2WOI A;  1M6I A;  5CQF A;  3R11 A;  3AYI A;  4GYP C;  4E4U A;  3OC4 A;  3AE1 A;  2Y6R A;  5KNL A;  1E1K A;  1KFY A;  2YLS A;  1N63 C;  4H4Y A;  3UJ2 A;  3FYY A;  3NVV B;  5BUL A;  1IUV A;  5FJO A;  2GVC A;  3TTE A;  4U8I A;  3STP A;  2GEW A;  3NKS A;  1XHC A;  1JU2 A;  3LXD A;  3KPK A;  2PP1 A;  5FS8 A;  4OPD A;  1GET A;  1LQU A;  4U2L A;  2DW7 A;  4B65 A;  1E39 A;  1XAN A;  3V5C A;  3QSE A;  4Y4N A;  2I0Z A;  4YSZ A;  4HNC A;  5KVH A;  3NK1 X;  3ATQ A;  3VQR A;  2OQH A;  2YVG A;  3S47 A;  4J36 A;  3AYJ A;  3DG3 A;  3R9U A;  2RDX A;  1RP0 A;  5FS9 A;  2PTZ A;  2VOU A;  1Y0P A;  3VR9 A;  4NEV A;  1W4X A;  1D4D A;  4OPI A;  3D1C A;  1ZOV A;  3ISH A;  1LPF A;  3L1R A;  1CC6 A;  1FEA A;  3CXO A;  2YR4 A;  4DSH A;  2A8X A;  2BAC A;  4HCH A;  3DK4 A;  3B3R A;  4D04 A;  1NEK A;  2PYX A;  3C4N A;  3FPZ A;  2AL2 A;  4NZH A;  4YSY A;  4Z17 A;  3JZU A;  1PBC A;  1ZK7 A;  3II4 A;  4H7U A;  1IUU A;  2BC0 A;  1BQG A;  2C76 A;  3CNP A;  3CND A;  4II2 A;  3DK8 A;  4ZCD A;  3GDP A;  3CGB A;  5IDZ A;  1NG4 A;  3TQP A;  4EQW A;  4A9W A;  4X2P A;  3UKF A;  2WU2 A;  1E1N A;  4C77 A;  3ZLF A;  1KN0 A;  3CPI G;  3ALM A;  3ZLH A;  3ICS A;  3PK7 A;  2QJJ A;  2WPF A;  2Q0K A;  2OVL A;  3NRZ B;  2XFQ A;  3KU9 A;  1F3P A;  3SFD A;  2JB3 A;  2XVI A;  3CGE A;  2WET A;  3AB1 A;  2B7S A;  3ES8 A;  1P48 A;  2JB1 A;  3CIR A;  4YSX A;  1IUS A;  4BK2 A;  2HXU A;  1DOE A;  4Y4M A;  1VQW A;  3BI2 A;  2E4G A;  4A5L A;  1ZP0 A;  4O5U A;  4P9S A;  4I58 A;  3QVP A;  1R6W A;  3BHK A;  5M10 A;  2CDU A;  3TW9 A;  1SJC A;  3VRD B;  1WYG A;  2XVE A;  2YM2 A;  2YM1 A;  3NHO X;  4UDP A;  2GH5 A;  3QTP A;  5FJP A;  1ZXI C;  5HHF A;  3N4F A;  1H83 A;  4FK1 A;  4B66 A;  2VRM A;  1PXC A;  1ZOY A;  3TJ4 A;  3AD8 B;  4K2S A;  2C72 A;  3CPH G;  3NVW B;  1FHV A;  1KSU A;  3P3B A;  1KKO A;  1XPY A;  3NO1 A;  3ITJ A;  4TLZ A;  1O94 A;  2YLX A;  2YG4 A;  2YG5 A;  1B37 A;  3NN6 X;  4CY6 A;  3SZ0 A;  3R07 C;  3NVY B;  3I6T A;  4H4S A;  4B68 A;  4TVY A;  3VR8 A;  4A99 A;  1KD0 A;  3CYJ A;  1N4V A;  4G74 A;  2GRT A;  2QJN A;  4DYE A;  1L9D A;  4UP3 A;  3P1W A;  3P4Q A;  2WS3 A;  4MJW A;  3UTF A;  1MRA A;  3R25 A;  4A79 A;  3VA8 A;  4PAB A;  5TR3 A;  1E1M A;  1VDC A;  2OO6 A;  1CHU A;  1GEU A;  4IP4 A;  4XWR A;  3GMC A;  5M0Z A;  2X50 A;  2MNR A;  3ABV A;  3QJ4 A;  4XWZ A;  2WP9 A;  3LOV A;  1PS9 A;  2VVL A;  3RCY A;  1GTE A;  1ZMC A;  4J3Z A;  2OLA A;  2V60 A;  3NG7 X;  1YQZ A;  2R0P A;  3AYL A;  2JB2 A;  4DX3 A;  4YKG A;  4OVI A;  1NPX A;  4H4R A;  1P2E A;  3DJJ A;  1CL0 A;  1F8S A;  4H19 A;  3BNU A;  3F8D A;  4OPC A;  3GD6 A;  2AL1 A;  2OG9 A;  1F6M A;  4APN A;  4OPL A;  3LB8 A;  4IP5 A;  4AP1 A;  4E5T A;  1P2H A;  3GD3 A;  5EB4 A;  4EM3 A;  1PBD A;  3U9I A;  2DKH A;  1LTX R;  1OJC A;  3AE4 A;  3NYF A;  3BOX A;  3AMZ A;  5EBK A;  2WU5 A;  3Q6J A;  1FL2 A;  1CBO A;  2ZZC A;  4ZCC A;  2XVH A;  3UJS A;  2ACZ A;  1F8R A;  4TVW A;  4IL2 A;  1JOA A;  2BXS A;  2WDR A;  1MNS A;  4Z2R A;  3QFB A;  3UTE A;  2BS4 A;  1FFU C;  3UXK A;  4FI4 A;  4H2R A;  3FV9 A;  2YLZ A;  1DTN A;  5J7X A;  1K4Q A;  1D5T A;  4RSL A;  3LJP A;  2TPR A;  3CGD A;  3H4K A;  3NGC X;  3NTA A;  2OAL A;  2XDO A;  1D4C A;  5KMR A;  3BNM A;  2YLR A;  1X31 B;  3ZDN A;  1GES A;  4JN7 A;  1H82 A;  1YY5 A;  1YQ3 A;  3VC6 A;  3TJI A;  2OFJ A;  3EAO A;  3UGV A;  3QLD A;  3DFY A;  3ZVI A;  2XLS A;  4TM0 A;  3R1Z A;  3UOY A;  3ALJ A;  3D9X A;  1EL5 A;  2R0C A;  3AEB A;  1O5W A;  3K7M X;  2PTX A;  1CJC A;  3U4F A;  3G5R A;  2RAB A;  1JPM A;  4U8P A;  1LVL A;  3GDN A;  3CAW A;  3AE8 A;  4IVO B;  4GDP A;  1K0J A;  2I5Q A;  3IF9 A;  4RG4 A;  3QSS A;  3Q4D A;  7ENL A;  2GMJ A;  5FS6 A;  3DGH A;  1EC9 A;  2C67 A;  2YWL A;  3NRN A;  2PS2 A;  3KPF A;  2O56 A;  2ONE A;  4G6G A;  1N60 C;  3VCN A;  2WP6 A;  3SN0 A;  3NH3 X;  1F8W A;  2V3B A;  2HNE A;  4ENL A;  3DFH A;  3NNE A;  2FJA A;  2R46 A;  2W3R A;  3T2Y A;  1DOB A;  2RGH A;  3QVR A;  4GIS A;  3GRT A;  4J34 A;  3UOV A;  4F4R A;  2AAQ A;  1EC8 A;  1IJH A;  1JNR A;  3Q9T A;  2XFO A;  2YVF A;  3V3N A;  2OZT A;  1WUE A;  2FYM A;  1FO4 A;  3CNT A;  3RO6 A;  3UCD A;  4EMW A;  3RGT A;  1PBB A;  1Y56 A;  3AEG A;  3OW1 A;  1ELS A;  1VQZ A;  1LJ1 A;  2BS2 A;  4NNJ A;  4TM3 A;  3H8I A;  2X8H A;  3UKK A;  1BKH A;  1NHP A;  2EQ8 A;  1PXA A;  4A3R A;  1GPE A;  1RSG A;  1NHQ A;  4WCT A;  4CCR A;  4EMI A;  1OJT A;  1UKV G;  2X8G A;  1JPD X;  5KOX A;  1JRO A;  2GR0 A;  3V3W A;  5HXI A;  4OPG A;  1IUX A;  4H83 A;  3S5W A;  2BAB A;  2A87 A;  3VRB A;  3CB3 A;  2XYO A;  1S2Y A;  3B97 A;  5CKU A;  5FJU A;  4GGH A;  4EIQ A;  2C4C A;  2QAE A;  4K1W A;  2GAG B;  4GF7 A;  4CBQ A;  2GMH A;  2B9W A;  1MDR A;  1TZZ A;  1GRH A;  3URH A;  4ADW A;  3UXL A;  3GY1 A;  3GWF A;  1ZMD A;  3L5O A;  3QN3 A;  1BF3 A;  3K30 A;  4NEW A;  4DGK A;  1S7M A;  3RP7 A;  1JNZ A;  4G9K A;  4J1O A;  4KPL A;  2XGZ A;  2V5Z A;  1N5X A;  4J57 A;  3A7R A;  2YQU A;  3SSZ A;  2R4E A;  3CNJ A;  4TLX A;  3T4W A;  1JEH A;  6ENL A;  3GYI A;  1PJ6 A;  3FJ4 A;  3SQS A;  3SR6 B;  1L8P A;  2YG6 A;  2X99 A;  2EQ6 A;  4E8G A;  1S2Q A;  4H4V A;  4ZN0 A;  2F5Z A;  3RP8 A;  4AOX A;  2XVJ A;  4NTC A;  4JY3 A;  4MKS A;  2JAE A;  4AP3 A;  3SBF A;  2JBV A;  3OP2 A;  1Q1R A;  4EWJ A;  1H2I A;  4ECH A;  1F9C A;  4KPR A;  2POD A;  2YLT A;  2C7G A;  1JRZ A;  2QA2 A;  4ZOH B;  2B9X A;  2BXR A;  2XH2 A;  2A89 A;  3NVZ B;  1FEB A;  1TDE A;  3UJE A;  5U63 A;  2PA6 A;  2XH4 A;  1REO A;  4LU6 A;  1KKR A;  3NLC A;  2AR8 A;  3P9U A;  3SN1 A;  2BRA A;  1NU5 A;  2R45 A;  3CXB A;  2GR3 A;  2J3N A;  2PTY A;  3B9J B;  4GFI A;  3P0W A;  1PBF A;  1N5W C;  1E6E A;  2ZC8 A;  3SXI A;  1MXT A;  3RIT A;  2BCG G;  3EPT A;  3E1T A;  3FXG A;  4KT2 A;  1YKJ A;  2GGG A;  3D47 A;  1E7P A;  2OPJ A;  4TM4 A;  3DG7 A;  1TDK A;  3PVC A;  4B67 A;  3DDM A;  3OZY A;  1BGN A;  3RR1 A;  2XFP A;  1GT8 A;  2HXT A;  1ZDL A;  4K8G A;  2GAH B;  4M0X A;  2OZ3 A;  4ROP A;  3SZF A;  4GCM A;  4H4T A;  3SJN A;  4H4U A;  2YVJ A;  3UKA A;  1SEZ A;  5HYM A;  3I6E A;  2ZZB A;  1BWC A;  1VG0 A;  2X3N A;  5KXJ A;  1HYU A;  1DNC A;  4YXD A;  1ZY8 A;  3PFR A;  5G5H B;  1FOH A;  3RRA A;  1PBE A;  3IWA A;  4GUV A;  4HB9 A;  3R0U A;  5BVA A;  3DES A;  1O95 A;  3JW7 A;  2BK4 A;  3F8P A;  1OJA A;  4KX6 A;  2XLU A;  3IHG A;  2PGW A;  3OZ2 A;  4M52 A;  3KD9 A;  3FMW A;  5KWF A;  3AM9 A;  2WDV A;  5FS7 A;  3NIX A;  1V97 A;  1DOD A;  4GYP A;  4WX1 A;  1ONE A;  3NT6 A;  1GXF A;  3P4R A;  4X9M A;  5C2T A;  2XSX A;  4JHM A;  4NWZ A;  1N4W A;  3UP5 A;  3MY9 A;  1D7L A;  1MO9 A;  4OPU A;  4H4P A;  2IVD A;  4YWS A;  1NG3 A;  5BUK A;  5KVI A;  3SFE A;  2GGE A;  1NDA A;  1JCT A;  1X2H A;  1PJ5 A;  1BZL A;  4UDR A;  2WEU A;  2C66 A;  5JCM A;  1V59 A;  3UOX A;  5EU9 A;  3VDG A;  1X2G A;  1E1L A;  3GRS A;  5G5G B;  3BJS A;  3AEF A;  5FJR A;  3KLJ A;  2XLT A;  4E6M A;  1ELI A;  5FMH A;  3AE9 A;  1GOS A;  2PP3 A;  4G73 A;  5JCN A;  4A6N A;  3CNS A;  4ZA0 A;  1KNR A;  5L46 A;  3AXB A;  1JDF A;  2QQ6 A;  4A6G A;  4B63 A;  3AEC A;  2ZZ0 A;  1SJD A;  3IK4 A;  4IL0 A;  1PDH A;  2EQ9 A;  2OKT A;  2FBW A;  3DJG X;  3T8Q A;  2CUL A;  1DJN A;  4K22 A;  2POZ A;  2OLN A;  1VRQ B;  1EBH A;  4H4Q A;  1M64 A;  3GYX A;  4C5O A;  2XFU A;  2MUC A;  3N6J A;  3EKG A;  4IA6 A;  1BGJ A;  1PJ7 A;  1GRT A;  3HW2 A;  4HN8 A;  4H2P A;  4KWS A;  4HCL A;  3DGZ A;  4YWO A;  1N4U A;  3OTR A;  1TDF A;  3V76 A;  2WOW A;  3MKC A;  4BJY A;  2VQ7 A;  5J60 A;  1TDO A;  3SGL A;  1NAA A;  4IV9 A;  3PO7 A;  1DXL A;  2QDE A;  3KVE A;  2XLP A;  3UJF A;  4B64 A;  3SY4 A;  4JQ9 A;  2XCG A;  2EQ7 A;  3EUB 3;  2NPX A;  4BK3 A;  2UZZ A;  1IYX A;  2WPC A;  1EL9 A;  3VCC A;  5ER0 A;  4X4J A;  4EM4 A;  3DJD A;  2OAM A;  1EBD A;  3AN1 A;  3UKH A;  3VRA A;  1RM6 B;  4PAA A;  3GWD A;  1OEP A;  3SZW A;  4AT0 A;  3ALL A;  2PTW A;  2OQY A;  2WOV A;  2PGE A;  4OCG A;  4REK A;  2HQM A;  5JRB A;  4K8D A;  4XXG A;  1ZX9 A;  2V61 A;  4DN1 A;  5ENL A;  3BHF A;  2P3Z A;  2PHH A;  2YG3 A;  2JK6 A;  3SQP A;  2OX4 A;  1EBG A;  2GGJ A;  2E5A A;  2Z5X A;  2YR6 A;  2WP5 A;  4JN9 A;  1FEC A;  3A7A A;  2VVL G;  3COX A;  3IJL A;  4GME A;  1SJB A;  1RVK A;  1K0I A;  3FVD A;  3C4A A;  1TKK A;  2BRY A;  3ES7 A;  1XDI A;  3M12 A;  3MSY A;  3JVA A;  1L9C A;  4G7F A;  3T31 A;  4EQR A;  3GO2 A;  3N4E A;  3LAD A;  1NHS A;  3T2K A;  1ECQ A;  4N9X A;  3R0K A;  1IUT A;  2VZ2 A;  4H1Z A;  3NK0 X;  4GIR A;  4ICY A;  4U8J A;  3UKP A;  3KUM A;  4JY2 A;  4MGG A;  1YEY A;  3PWG A;  1W6T A;  2FJB A;  3M13 A;  4IT1 A;  4JDR A;  4DXK A;  4U2S A;  2OLO A;  2Q6U A;  1PDY A;  1NEN A;  1PXB A;  4A7A A;  1FFV C;  1CJ4 A;  1Q1W A;  3G5Q A;  2PCE A;  3WE0 A;  1EL8 A;  2YLW A;  3CMM A;  2ARD A;  5BRT A;  4BK1 A;  4II3 A;  3DGB A;  5GSN A;  3BSM A;  1JRP A;  2C73 A;  2YR5 A;  4K5S A;  3I4K A;  3GD4 A;  3GMB A;  1E9I A;  4GAP A;  3FBS A;  5KMS A;  2B7R A;  1GRB A;  1H81 A;  2B9Y A;  4IA5 A;  1WUF A;  2WPE A;  3H12 A;  2GQW A;  5KMP A;  3JSK A;  3DIP A;  3D46 A;  3KA7 A;  1D4E A;  3UP4 A;  3UKL A;  3FIM B;  1VG9 A;  1MDL A;  4J2W A;  4H4W A;  2QVH A;  3S5S A;  1FCD A;  4YSH A;  2E1M A;  3EAN A;  3NZG A;  4HNL A;  4Z24 A;  4EQS A;  4Z1Y A;  2XLR A;  3DME A;  3UCL A;  4EQX A;  3TWB A;  3UJR A;  1CJ2 A;  4I59 A;  2BC1 A;  1YQ4 A;  3QFA A;  3AEE A;  1B5Q A;  1KF6 A;  1H6V A;  3CGC A;  3UCC A;  4A6N B;  1OJD A;  4CNK A;  1Z6L A;  3I6D A;  4YTM A;  1KCZ A;  2GB0 A;  1GRA A;  4USQ A;  3ICR A;  2B76 A;  3ADA B;  3SYI A;  5KOW A;  2QJM A;  3A7U A;  5JCL A;  1R0M A;  2W3S A;  3AE6 A;  5BOE A;  1TYT A;  4GGB A;  2H89 A;  3VC5 A;  4JNQ A;  4Y4L A;  2YAU A;  4FDC B;  4K7Z A;  2XH7 A;  4HPN A;  4EIP A;  4DHG A;  3G5S A;  2BS3 A;  4K2X A;  2PSN A;  2NVK X;  4J56 A;  2GF3 A;  3MZN A;  3HYX A;  5GRT A;  1CJ3 A;  4H2Q A;  1KSS A;  5EB5 A;  3T0K A;  4B69 A;  3GSI A;  2GR1 A;  1B8S A;  1SB3 B;  5KRQ A;  4G8T A;  4CY8 A;  2FJD A;  3DEQ A;  4FK1 C;  2ZBW A;  2HZG A;  4Z2T A;  3CTY A;  4C3Y A;  1GRF A;  1N62 C;  1OJ9 A;  1CC4 A;  2P8B A;  1NHR A;  2H88 A;  4O5Q A;  2RGO A;  4E0V A;  2VVM A;  2BK3 A;  3P4S A;  4YKF A;  1H84 A;  4HYR A;  4NTE A;  3RHA A;  3IJI A;  1TDN A;  4IHC A;  3SM8 A;  1IUW A;  3V5F A;  4J33 A;  4AT2 A;  3V3O A;  3PWI A;  4BUR A;  3F8R A;  4CNJ A;  4A65 A;  5DBJ A;  2QDD A;  1GER A;  2CVJ A;  2XVF A;  4G6H A;  2PPG A;  4A35 A;  3T14 A;  4HCD A;  2C64 A;  2WQY A;  1B4V A;  3HYV A;  4J31 A;  2DKI A;  4C3X A;  5HY5 A;  4LII A;  3B6D A;  3DA1 A;  5FJT A;  4B1B A;  3VFC A;  2BYB A;  4K5R A;  5EOW A;  1K0L A;  3HZL A;  3PG6 A;  3V4B A;  1BKW A;  4Z25 A;  5LV9 A;  2R4J A;  1PN0 A;  2QCU A;  2GR2 A;  2V3A A;  1PDZ A;  2X8C A;  4OPT A;  3P4P A;  1GTH A;  1NEL A;  1Y56 B;  2GQF A;  1GAL A;  2NQL A;  2AQJ A;  1ONF A;  2PU1 A;  4U8N A;  2CFY A;  3ZYX A;  3H8A A;  5U25 A;  2QA1 A;  1VDV A;  3EF6 A;  2V6O A;  3M0O A;  3K7Q X;  2AL2 B;  1TRB A;  1XS2 A;  1AOG A;  3IHM A;  3KKJ A;  3RP6 A;  3O0H A;  4JNA A;  4IVM B;  3H8L A;  3LZX A;  3AWI A;  3T6C A;  5IQ1 A;  4TM1 A;  1H7W A;  4GRT A;  3MUC A;  1QLB A;  2E3T A;  3IC9 A;  1Q9I A;  4U8L A;  4H2N A;  2TMD A;  3DER A;  3UOZ A;  3UTG A;  4NTD A;  2ZAD A;  2GDQ A;  3T9P A;  4YT0 A;  1XPQ A;  2GGI A;  2WES A;  3NYC A;  1JRY A;  2BK5 A;  4MMW A;  4DSG A;  3ZVH B;  3RNM A;  4GR1 A;  1COY A;  2WBA A;  4H2H A;  3CN8 A;  3AED A;  1GND A;  4RG3 A;  1ZKQ A;  2DW6 A;  3MWC A;  1JRX A;  2Z5Y A;  2C3D A;  3CK5 A;  3TWA A;  3K7T A;  2GGH A;  2R9Z A;  3NS1 B;  3HRD C;  4H4X A;  5IQ4 A;  4LA1 A;  1P43 A;  3SZC A;  2W0H A;  2AKM A;  3NN0 X;  3IJQ A;  3S61 A;  2Y6Q A;  1GRG A;  3LZW A;  4Z2U A;  1KDG A;  3NYE A;  5IPY A;  1S3B A;  3MQT A;  2IID A;  1QO8 A;  2C3C A;  3R10 A;  2E5V A;  2C75 A;  3BI4 A;  4IZG A;  1EC7 A;  3DJE A;  4AOS A;  2P88 A;  4JN8 A;  4ZCW A;  4CRT A;  5J04 A;  1FIQ B;  1TYP A;  3DG6 A;  2W55 A;  2Q0L A;  3TOY A;  3GC2 A;  4DWD A;  1FHU A;  3BI5 A;  3NK2 X;  1D7Y A;  2JKC A;  3NTD A;  1DOC A;  2XFN A;  3PS9 A;  2PMQ A;  2QGY A;  3AEA A;  1N61 C;  2OA1 A;  3ZVH A;  3P93 A;  4USR A;  4D03 A;  3Q45 A;  3OPS A;  4HA6 A;  3NFU A;  1QJD A;  4BJZ A;  1SJA A;  4U8O A;  5JCI A;  3RED A;  3ETR B;  3SN4 A;  3THU A;  3DH9 A;  2O9Z A;  2BA9 A;  3AE7 A;  3FCP A;  2CHR A;  3GYJ A;  4M6U A;  4U8K A;  2C65 A;  2BCP A;  3SX6 A;  2FKP A;  2GL5 A;  4KEM A;  3CPJ G;  2AKZ A;  2IVE A;  2Q7V A;  4U2T A;  5KMQ A;  4Z44 A;  4FP1 A;  2RGJ A;  3AE5 A;  3L8K A;  5U1O A;  1LV0 A;  3EEZ A;  4H50 A;  1KNP A;  2OZ8 A;  2GV8 A;  3QKE A;  4BV6 A;  3ICT A;  1MOK A;  4FX9 A;  1LQT A;  1GRE A;  3DK9 A;  3H7V A;  1CC2 A;  3AD7 B;  1H7X A;  3AE2 A;  3HYW A;  2VQB A;  3CT2 A;  4UDQ A;  2YG7 A;  3OZM A; 
#chains in the Genus database with same CATH homology
 5JCK A;  2H89 A;  1O95 A;  3F8D A;  4OPC A;  2BK4 A;  1GSN A;  4JNQ A;  4Y4L A;  2YAU A;  3F8P A;  4FDC B;  1OJA A;  4K7Z A;  1CF3 A;  1F6M A;  4KX6 A;  4APN A;  2XLU A;  4OPL A;  4EMJ A;  4DNA A;  3IHG A;  4EIP A;  3LB8 A;  4U8M A;  3G5S A;  2BS3 A;  3OZ2 A;  4M52 A;  4K2X A;  2NVK X;  4J56 A;  1L0V A;  3KD9 A;  4YTN A;  2GF3 A;  4AP1 A;  3FMW A;  3HYX A;  5KWF A;  5GRT A;  1CJ3 A;  1P2H A;  1KSS A;  4H2Q A;  3GD3 A;  5EB4 A;  5EB5 A;  4EM3 A;  3T0K A;  1PBD A;  4B69 A;  2WDV A;  5FS7 A;  4H4Z A;  2DKH A;  2GR1 A;  3GSI A;  2APG A;  3NIX A;  1DOD A;  1B8S A;  1LTX R;  4WX1 A;  1OJC A;  3AE4 A;  3T2Z A;  1EL7 A;  3ATR A;  3NYF A;  5EBK A;  3NT6 A;  3AD9 B;  2WU5 A;  4CCQ A;  3Q6J A;  1FL2 A;  1H86 A;  5KRQ A;  4CY8 A;  1GXF A;  3P4R A;  4X9M A;  2FJD A;  5C2T A;  4FK1 C;  1CBO A;  2ZZC A;  2ZBW A;  4Z2T A;  4NWZ A;  2XVH A;  4ZCC A;  1N4W A;  3UP5 A;  3T37 A;  2ACZ A;  1F8R A;  1D7L A;  1MO9 A;  3CTY A;  4OPU A;  4C3Y A;  3I3L A;  4H4P A;  2IVD A;  1JOA A;  1GRF A;  2BXS A;  1DJQ A;  1OJ9 A;  1NG3 A;  2WDR A;  1CC4 A;  5BUK A;  5KVI A;  3SFE A;  1GV4 A;  4Z2R A;  3FG2 P;  3QFB A;  1PHH A;  3UTE A;  1NHR A;  1N1P A;  2BS4 A;  4H2R A;  2H88 A;  1NDA A;  4O5Q A;  2RGO A;  1PJ5 A;  2YLZ A;  4Z26 A;  5J7X A;  1K4Q A;  1BZL A;  1D5T A;  2VVM A;  4E0V A;  4RSL A;  4C74 A;  3LJP A;  2BK3 A;  3P4S A;  4UDR A;  4YKF A;  2TPR A;  4YTP A;  3CGD A;  3H4K A;  3UTH A;  1H84 A;  4GAV A;  1RYI A;  2C70 A;  2WEU A;  3NGC X;  2C66 A;  1L9E A;  5JCM A;  3NTA A;  5BVA A;  4NTE A;  4X9N A;  4GDE A;  3RHA A;  1V59 A;  3UOX A;  1TDN A;  2VRL A;  2OAL A;  3SM8 A;  1IUW A;  2XDO A;  1D4C A;  1E1L A;  2WDQ A;  4J33 A;  3GRS A;  3V3O A;  4AT2 A;  5KMR A;  3BNM A;  2FJE A;  2R0G A;  4BUR A;  3F8R A;  4CNJ A;  4A65 A;  5C3J A;  2YLR A;  5DBJ A;  1X31 B;  3AEF A;  3ZDN A;  1GES A;  1H82 A;  1GER A;  1YY5 A;  3KLJ A;  2CVJ A;  2WHD A;  1YQ3 A;  2XLT A;  2XVF A;  1ELI A;  3EAO A;  5FMH A;  3UKQ A;  1S3E A;  3AE9 A;  1GOS A;  3C96 A;  2XLS A;  4G6H A;  4TM0 A;  3UOY A;  3ALJ A;  3D8X A;  3D9X A;  4G73 A;  5JCN A;  1EL5 A;  2R0C A;  3AEB A;  3T14 A;  4A6N A;  1O5W A;  3K7M X;  2C64 A;  3AE3 A;  3CNS A;  2WQY A;  1B4V A;  1CJC A;  1KNR A;  3HYV A;  4J31 A;  2DKI A;  3G5R A;  4Z43 A;  5L46 A;  2RAB A;  3AXB A;  3QSM A;  2WOI A;  4U8P A;  1LVL A;  1M6I A;  3GDN A;  5CQF A;  4B63 A;  4C3X A;  5HY5 A;  3AEC A;  4LII A;  3B6D A;  3DA1 A;  3AYI A;  2ZZ0 A;  4B1B A;  3AE8 A;  4IVO B;  3OC4 A;  4GDP A;  1K0J A;  3AE1 A;  3IF9 A;  1PDH A;  2Y6R A;  5KNL A;  2BYB A;  1E1K A;  4K5R A;  2EQ9 A;  2FBW A;  3QSS A;  4RG4 A;  5EOW A;  3DJG X;  1K0L A;  2CUL A;  1KFY A;  2GMJ A;  1DJN A;  2YLS A;  4K22 A;  5FS6 A;  4H4Y A;  3DGH A;  3HZL A;  3PG6 A;  2OLN A;  2C67 A;  1BKW A;  4Z25 A;  2YWL A;  5LV9 A;  1VRQ B;  3NRN A;  3KPF A;  2R4J A;  5BUL A;  1PN0 A;  1IUV A;  2QCU A;  2GR2 A;  4H4Q A;  2V3A A;  1M64 A;  2GVC A;  3GYX A;  4C5O A;  2XFU A;  4U8I A;  2GEW A;  4IA6 A;  3NKS A;  2X8C A;  4G6G A;  1BGJ A;  1PJ7 A;  1GRT A;  1XHC A;  4OPT A;  4H2P A;  2WP6 A;  1JU2 A;  3NH3 X;  3LXD A;  3DGZ A;  4YWO A;  1F8W A;  2V3B A;  1GTH A;  3KPK A;  1N4U A;  3P4P A;  5FS8 A;  4OPD A;  3NNE A;  1GET A;  1LQU A;  1TDF A;  4U2L A;  3V76 A;  2FJA A;  2R46 A;  2WOW A;  4B65 A;  1Y56 B;  3T2Y A;  1E39 A;  1XAN A;  1DOB A;  2RGH A;  2GQF A;  3QSE A;  4BJY A;  4Y4N A;  1GAL A;  2I0Z A;  3QVR A;  2VQ7 A;  3GRT A;  4J34 A;  3UOV A;  2AQJ A;  4YSZ A;  1TDO A;  1ONF A;  5KVH A;  3SGL A;  5J60 A;  3NK1 X;  4U8N A;  1NAA A;  2AAQ A;  4IV9 A;  3ATQ A;  3VQR A;  3PO7 A;  1DXL A;  2YVG A;  2CFY A;  1IJH A;  1JNR A;  3Q9T A;  4J36 A;  3ZYX A;  2XFO A;  2YVF A;  3V3N A;  3KVE A;  2XLP A;  3CNT A;  4B64 A;  5U25 A;  4EMW A;  3AYJ A;  3R9U A;  4JQ9 A;  2QA1 A;  1RP0 A;  5FS9 A;  2XCG A;  3SY4 A;  1Y56 A;  1PBB A;  2EQ7 A;  2VOU A;  1Y0P A;  3VR9 A;  4NEV A;  2NPX A;  1W4X A;  3AEG A;  1D4D A;  4OPI A;  2UZZ A;  4BK3 A;  3EF6 A;  2WPC A;  3D1C A;  1ZOV A;  2V6O A;  3M0O A;  3ISH A;  1LPF A;  3K7Q X;  1EL9 A;  1CC6 A;  1TRB A;  3L1R A;  1LJ1 A;  2BS2 A;  4NNJ A;  1FEA A;  1AOG A;  2YR4 A;  5ER0 A;  3H8I A;  3IHM A;  4TM3 A;  2A8X A;  2BAC A;  4X4J A;  4DSH A;  2X8H A;  3DK4 A;  4EM4 A;  3B3R A;  3DJD A;  2OAM A;  3KKJ A;  1EBD A;  1NEK A;  4D04 A;  2PYX A;  3UKK A;  3RP6 A;  3O0H A;  1NHP A;  3UKH A;  3VRA A;  4JNA A;  3C4N A;  3FPZ A;  2EQ8 A;  1PXA A;  4IVM B;  4NZH A;  1GPE A;  3H8L A;  4PAA A;  4YSY A;  3GWD A;  3LZX A;  3SZW A;  1RSG A;  1PBC A;  3AWI A;  5IQ1 A;  1NHQ A;  4AT0 A;  3ALL A;  4TM1 A;  1ZK7 A;  3II4 A;  1H7W A;  4H7U A;  4GRT A;  1IUU A;  4WCT A;  1QLB A;  4CCR A;  3IC9 A;  4EMI A;  2BC0 A;  1OJT A;  1Q9I A;  2C76 A;  4U8L A;  1UKV G;  2WOV A;  3CNP A;  4H2N A;  2X8G A;  3CND A;  2TMD A;  4II2 A;  3DK8 A;  4OCG A;  3UOZ A;  4REK A;  2HQM A;  4NTD A;  3UTG A;  5KOX A;  5JRB A;  4K8D A;  4XXG A;  1ZX9 A;  3GDP A;  3CGB A;  2GR0 A;  1NG4 A;  2V61 A;  4ZCD A;  4YT0 A;  1XPQ A;  3BHF A;  5HXI A;  4EQW A;  2WES A;  2PHH A;  3NYC A;  4OPG A;  4A9W A;  1JRY A;  3UKF A;  2WU2 A;  1E1N A;  1IUX A;  2BK5 A;  2YG3 A;  4C77 A;  3S5W A;  1KN0 A;  2BAB A;  2A87 A;  3ALM A;  3CPI G;  3VRB A;  2JK6 A;  3SQP A;  4DSG A;  2XYO A;  3ICS A;  1S2Y A;  5CKU A;  3RNM A;  4GR1 A;  1COY A;  2WBA A;  4EIQ A;  2WPF A;  2C4C A;  2Q0K A;  2YR6 A;  2Z5X A;  2QAE A;  2GAG B;  2XFQ A;  3CN8 A;  4GF7 A;  3AED A;  4CBQ A;  1GND A;  2GMH A;  4RG3 A;  3KU9 A;  2B9W A;  1F3P A;  1ZKQ A;  3SFD A;  2WP5 A;  4JN9 A;  1FEC A;  2JB3 A;  1GRH A;  2VVL G;  2XVI A;  3URH A;  4ADW A;  1JRX A;  2Z5Y A;  3CGE A;  3COX A;  2WET A;  3AB1 A;  2C3D A;  3K7T A;  2B7S A;  3GWF A;  1ZMD A;  2R9Z A;  3L5O A;  1K0I A;  1BF3 A;  4YSX A;  3C4A A;  2JB1 A;  3CIR A;  3K30 A;  1IUS A;  4NEW A;  4DGK A;  2BRY A;  1S7M A;  4H4X A;  4BK2 A;  5IQ4 A;  3RP7 A;  1DOE A;  1JNZ A;  4LA1 A;  4Y4M A;  3SZC A;  4G9K A;  1VQW A;  1XDI A;  2W0H A;  3BI2 A;  3M12 A;  3NN0 X;  1L9C A;  3T31 A;  2E4G A;  2V5Z A;  4EQR A;  3S61 A;  4A5L A;  1ZP0 A;  3LAD A;  1NHS A;  4O5U A;  4J57 A;  2Y6Q A;  1GRG A;  4P9S A;  3LZW A;  2YQU A;  3QVP A;  4I58 A;  4N9X A;  1IUT A;  2R4E A;  2VZ2 A;  3BHK A;  4Z2U A;  5M10 A;  2CDU A;  3CNJ A;  1KDG A;  3NK0 X;  4TLX A;  1JEH A;  3NYE A;  4ICY A;  5IPY A;  3VRD B;  4U8J A;  3UKP A;  3GYI A;  2XVE A;  1PJ6 A;  2YM2 A;  4JY2 A;  1S3B A;  2IID A;  2YM1 A;  1QO8 A;  3NHO X;  3T2K A;  4UDP A;  2GH5 A;  2C3C A;  2E5V A;  2YG6 A;  2C75 A;  3BI4 A;  2FJB A;  2X99 A;  3M13 A;  5HHF A;  2EQ6 A;  3DJE A;  4JDR A;  1S2Q A;  4H4V A;  1H83 A;  4AOS A;  4U2S A;  2OLO A;  4ZN0 A;  2Q6U A;  2F5Z A;  3RP8 A;  1NEN A;  4FK1 A;  1PXB A;  2XVJ A;  4NTC A;  4AOX A;  4A7A A;  4CRT A;  4JY3 A;  4B66 A;  1CJ4 A;  2JAE A;  2VRM A;  4AP3 A;  1Q1W A;  2JBV A;  1PXC A;  1ZOY A;  3G5Q A;  1Q1R A;  3WE0 A;  1H2I A;  1TYP A;  4ECH A;  4KPR A;  1EL8 A;  2YLT A;  2C7G A;  3AD8 B;  2Q0L A;  2C72 A;  3CPH G;  1JRZ A;  1KSU A;  2YLW A;  3CMM A;  3BI5 A;  3NK2 X;  2ARD A;  5BRT A;  4BK1 A;  1D7Y A;  3ITJ A;  2QA2 A;  2JKC A;  4II3 A;  2B9X A;  3NTD A;  1O94 A;  4TLZ A;  1DOC A;  2YLX A;  2BXR A;  2YG4 A;  5GSN A;  2YG5 A;  2XFN A;  3PS9 A;  1B37 A;  2A89 A;  2C73 A;  2YR5 A;  3NN6 X;  4K5S A;  4CY6 A;  3GD4 A;  3SZ0 A;  1FEB A;  3GMB A;  1TDE A;  3AEA A;  5U63 A;  4GAP A;  3FBS A;  1REO A;  2OA1 A;  4H4S A;  5KMS A;  2B7R A;  4LU6 A;  1GRB A;  4B68 A;  1H81 A;  2B9Y A;  4IA5 A;  4USR A;  2WPE A;  4D03 A;  3VR8 A;  3NLC A;  2GQW A;  5KMP A;  4HA6 A;  2AR8 A;  3JSK A;  3P9U A;  2BRA A;  2R45 A;  3KA7 A;  4A99 A;  1QJD A;  2GR3 A;  1D4E A;  3UP4 A;  2J3N A;  3UKL A;  4BJZ A;  3FIM B;  4G74 A;  1N4V A;  2GRT A;  5JCI A;  4U8O A;  3RED A;  1VG9 A;  1L9D A;  1PBF A;  4UP3 A;  4J2W A;  3P1W A;  4H4W A;  1E6E A;  3P4Q A;  1FCD A;  2WS3 A;  3SXI A;  4MJW A;  1MXT A;  2O9Z A;  3DH9 A;  3UTF A;  3EPT A;  2BCG G;  3E1T A;  4A79 A;  1YKJ A;  2BA9 A;  3AE7 A;  4PAB A;  4YSH A;  5TR3 A;  1E1M A;  2E1M A;  1E7P A;  3EAN A;  4TM4 A;  3GYJ A;  1VDC A;  4Z24 A;  1TDK A;  4U8K A;  4EQS A;  2C65 A;  3PVC A;  1CHU A;  4B67 A;  1GEU A;  2BCP A;  3SX6 A;  1BGN A;  4XWR A;  2XLR A;  2XFP A;  3DME A;  3UCL A;  3GMC A;  4EQX A;  1GT8 A;  5M0Z A;  1CJ2 A;  4I59 A;  3CPJ G;  2BC1 A;  1YQ4 A;  2IVE A;  1ZDL A;  2GAH B;  2Q7V A;  2X50 A;  4U2T A;  5KMQ A;  3ABV A;  4Z44 A;  3QJ4 A;  4XWZ A;  2RGJ A;  3SZF A;  3QFA A;  2WP9 A;  3AEE A;  3AE5 A;  3LOV A;  3L8K A;  4GCM A;  1B5Q A;  1KF6 A;  1PS9 A;  2VVL A;  5U1O A;  1LV0 A;  4H4T A;  4H50 A;  1H6V A;  3CGC A;  4H4U A;  1GTE A;  4A6N B;  1KNP A;  2YVJ A;  3UKA A;  1OJD A;  4CNK A;  1ZMC A;  1Z6L A;  1SEZ A;  5HYM A;  3I6D A;  2ZZB A;  4YTM A;  1BWC A;  2V60 A;  1VG0 A;  2X3N A;  2GV8 A;  3NG7 X;  1HYU A;  5KXJ A;  4BV6 A;  1YQZ A;  1DNC A;  2GB0 A;  2R0P A;  3AYL A;  1MOK A;  4FX9 A;  3ICT A;  1GRA A;  4YXD A;  2JB2 A;  4USQ A;  1LQT A;  1GRE A;  4YKG A;  1ZY8 A;  4OVI A;  3DK9 A;  3ICR A;  1FOH A;  1NPX A;  2B76 A;  3ADA B;  4H4R A;  3SYI A;  1CC2 A;  1P2E A;  5KOW A;  3AD7 B;  3DJJ A;  1H7X A;  1CL0 A;  1F8S A;  1PBE A;  5JCL A;  3IWA A;  4GUV A;  3AE2 A;  3HYW A;  2VQB A;  3AE6 A;  4HB9 A;  4UDQ A;  3BNU A;  1TYT A;  2YG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...