2V3AA

Crystal structure of rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN REDUCTASE
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 110
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3aA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3aA02
3IC9A 3CNTA 2ZZ0A 3P1WA 3K7MX 3F8DA 4UP3A 3CNDA 3AECA 4FDCB 3CGBA 4KPRA 2FBWA 5JCKA 3OC4A 4OPGA 3AE2A 3GSIA 2XLPA 4I58A 1LV0A 3ATQA 2YG6A 4H4TA 1KF6A 2Y6RA 4J33A 4H4UA 4REKA 2YVFA 1ZOYA 3NLCA 5C2TA 1CBOA 1CC2A 2NVKX 2XLTA 3CPJG 4CCQA 3REDA 1GESA 3URHA 1H7WA 1NAAA 3UKLA 1XDIA 1PS9A 1GTHA 3DJJA 3SQPA 1LQTA 3UKAA 4K22A 4EMWA 3Q6JA 4NTDA 1FECA 3CIRA 4BURA 4U2TA 3ALJA 3UTFA 1QLBA 5HHFA 1CJ3A 2ACZA 4FK1C 1BZLA 3UP4A 4OPIA 2B7RA 1NG3A 2OLOA 4YKFA 3BI2A 1NPXA 1REOA 1IUWA 3UKFA 4YTPA 2GF3A 2E1MA 1CC4A 3CNJA 3QSEA 4H4VA 2JB1A 4DNAA 1GERA 1GTEA 2C70A 2R4EA 1CC6A 1FCDA 2VRLA 2YQUA 2XLUA 4OCGA 4YSXA 1PJ5A 3SM8A 2WETA 3AEDA 1E7PA 5KWFA 4AOSA 2EQ6A 1V59A 1ZOVA 4OPCA 2YAUA 3NN6X 2B9XA 1OJCA 4U8MA 1UKVG 5BULA 1PDHA 2XCGA 3P4RA 1FL2A 4E0VA 2C72A 3SFDA 1S2QA 2FJDA 2GR0A 2YR6A 3OZ2A 5EB4A 1K0IA 3K7TA 3NTDA 2GMHA 3QFBA 2XYOA 3LOVA 4DSGA 1GALA 3UKKA 1KSUA 4U8IA 5BRTA 4BJYA 1FOHA 2XLRA 3QFAA 4B64A 2B7SA 3NRNA 2OALA 4UDQA 3S61A 1XHCA 1B5QA 3AE8A 4B68A 1GREA 3IWAA 3BHKA 2C3DA 5BVAA 2XVJA 1LQUA 2WU5A 1H82A 1TDOA 4B63A 1E39A 2R4JA 5KVHA 1GRGA 1GRTA 3RP6A 1VG9A 1QO8A 2WDRA 3FG2P 5EOWA 5KOXA 4AP1A 1XPQA 4X9NA 3ICTA 3FPZA 3CN8A 1GRHA 2B76A 3B3RA 4LU6A 1VQWA 1F6MA 4JN9A 1Y56A 2X3NA 5FS8A 3NNEA 4JNQA 4Z26A 3DJDA 4P9SA 2PYXA 2QCUA 4K2XA 1PBDA 3M12A 3ISHA 4JY3A 3CPIG 1CJ2A 2Q6UA 1AOGA 3CPHG 3S5WA 4A5LA 2WPFA 4U8OA 1GOSA 1VG0A 1EBDA 3FMWA 3BHFA 3AD7B 3AE4A 2EQ9A 2XFPA 2VQ7A 3D1CA 2H89A 3P4SA 2WP9A 3RP8A 4MJWA 4Y4MA 3P9UA 4KX6A 4JDRA 4EIPA 1XANA 3RP7A 4K8DA 4JNAA 3DMEA 2BXRA 2JBVA 2R0CA 2YG3A 3DGHA 3GYJA 3GD4A 4APNA 4CY8A 2AQJA 4A65A 1RSGA 2I0ZA 2A87A 2XVHA 2C75A 2WOVA 4LIIA 2E4GA 3PO7A 4TM4A 4A6NB 1IUVA 1JOAA 1NHRA 3DA1A 4X4JA 1Y0PA 2APGA 3II4A 4U2SA 1P2EA 4J56A 1N4UA 3NN0X 3LJPA 4YWOA 5LV9A 3CGCA 1KDGA 3ZDNA 4I59A 1OJDA 1TYTA 4EQSA 3ITJA 4BK3A 2JB3A 4CRTA 3KA7A 1DOCA 2JAEA 3ALLA 4J36A 2GRTA 1E1MA 2EQ7A 2WQYA 2GEWA 1EL8A 3DGZA 4EM3A 4IVMB 2BC1A 3I3LA 3KVEA 3Q9TA 4GF7A 5HXIA 2O9ZA 3P4QA 1BKWA 1ZDLA 4H4RA 1H81A 3GRSA 3NGCX 1NDAA 4H4QA 1PBBA 3M0OA 3ZYXA 4CNKA 3DK9A 5J60A 4C3XA 3AYIA 4ECHA 4EQXA 4YSZA 3GDNA 4RG3A 2C64A 4EQRA 2BCGG 2JK6A 4HA6A 2YG7A 3AEEA 5GRTA 2R9ZA 5C3JA 1GXFA 1CHUA 4XWRA 1VRQB 4Z2UA 1DJNA 2WEUA 2Y6QA 3EPTA 1GPEA 2FJBA 4OPLA 2VVLA 4IA5A 4ZCCA 1K4QA 3AEAA 4YTMA 2C7GA 4AT2A 2F5ZA 4IVOB 2YM1A 2JB2A 5U1OA 3DJGX 4BJZA 3C4NA 1BF3A 3JSKA 1ZP0A 5DBJA 1VDCA 2V3BA 2GAHB 4TM0A 4U8NA 4CNJA 2GB0A 3QJ4A 2RGJA 3NYFA 3UCLA 5JCIA 1L9EA 4TLXA 2BS2A 4WCTA 3VRDB 4U2LA 2GQFA 2WP5A 3AE7A 2DKHA 3KPFA 3UTGA 5M10A 1F8RA 2VVMA 3L1RA 4NTEA 1D4DA 1N4WA 3AE1A 2CDUA 3UP5A 3UOXA 2V61A 3UTEA 3I6DA 3V76A 5HY5A 2C76A 1CF3A 3LXDA 1BGNA 1GNDA 3GWFA 4AP3A 5KRQA 1TRBA 3FBSA 5KXJA 1NHQA 1IJHA 1YQZA 5ER0A 4BK2A 4EMIA 2AAQA 1CL0A 2WBAA 1YQ3A 4D04A 3KLJA 1BGJA 2VZ2A 2B9WA 2H88A 3NYEA 1JRXA 3V3NA 4AOXA 2WS3A 2A89A 1NHSA 3ADAB 3H8LA 2WPCA 1KSSA 1KFYA 2XFUA 2WDQA 1PXBA 3C4AA 4LA1A 2V5ZA 5U63A 4B67A 1HYUA 3F8RA 2YLTA 5FS6A 4C74A 2BC0A 1CJCA 1GRAA 4TLZA 1F8WA 4CBQA 4YTNA 1GETA 3NH3X 2QAEA 3L8KA 1PBEA 4K5SA 1LTXR 1E1LA 1NEKA 3KKJA 3T37A 4UDRA 1MO9A 1S3BA 3NKSA 2Q0LA 3VQRA 4C3YA 4YSHA 4OPTA 4FX9A 2XFNA 4CY6A 4J57A 3CNSA 2C66A 1ZK7A 2AR8A 5JCMA 3F8PA 5KVIA 1Q1WA 4N9XA 4Z2RA 2IIDA 2CULA 2VRMA 2XVIA 3LZWA 3NHOX 4C77A 3DK8A 2FJAA 1S3EA 2A8XA 3AB1A 3COXA 2B9YA 3VRBA 4OVIA 2R0PA 2WP6A 1X31B 2WHDA 1M6IA 2QA1A 1YQ4A 3QSMA 2WOIA 1E6EA 2YR5A 2GH5A 3SFEA 1ZX9A 1GRFA 3AE9A 5EBKA 1FEBA 3O0HA 1N4VA 4BK1A 3GYIA 1OJ9A 1YKJA 4UDPA 2JKCA 4K7ZA 4FK1A 4WX1A 1H83A 4Y4NA 2W0HA 3ICSA 4H4WA 4IA6A 4NTCA 1DJQA 1TDEA 3FIMB 3GDPA 3IHGA 2X99A 2QA2A 2C3CA 2BXSA 3VR9A 3C96A 4Z2TA 3GRTA 3QVPA 5CQFA 2ARDA 4H4PA 4ICYA 3GMCA 3SGLA 5IQ4A 2R0GA 4H4XA 1ZKQA 4A6NA 4XWZA 1PXCA 1IUUA 1IUTA 4M52A 1TYPA 2ZBWA 4H4ZA 2BABA 4J34A 4O5QA 1OJAA 3LB8A 1D5TA 2Z5YA 2BS4A 2C73A 3DJEA 4PABA 1ZMDA 4D03A 3AEFA 2GR1A 5FS7A 3K7QX 1NG4A 4IV9A 3EANA 3CGEA 3BNUA 2Q0KA 1LJ1A 2GQWA 4Y4LA 1DNCA 3H8IA 3CNPA 2VOUA 4EMJA 4O5UA 1JNRA 3P4PA 1DOBA 5U25A 2YLWA 3UTHA 2V6OA 3BI4A 3QSSA 3PVCA 5GSNA 4H4SA 3WE0A 2NPXA 4XXGA 4NZHA 3UKPA 4H2PA 4B69A 4Z25A 2X8GA 1K0LA 3IHMA 5BUKA 3AXBA 3PS9A 1B37A 1CJ4A 1Q9IA 2YVJA 1TDNA 1PN0A 4K5RA 3UOVA 1EL7A 4EIQA 1H84A 3GWDA 1GEUA 1F8SA 3HZLA 2X8HA 4H7UA 5TR3A 4USQA 2BK3A 2ZZBA 1DXLA 2C65A 2WU2A 4AT0A 4J2WA 2IVEA 2VVLG 4JY2A 3NYCA 1E1NA 3AD9B 2J3NA 1B8SA 1O95A 3VRAA 2XVFA 1TDFA 4A79A 4GRTA 1ELIA 1K0JA 5IQ1A 4TM1A 3H4KA 1COYA 2Z5XA 1PBFA 3E1TA 1EL9A 1PXAA 2PHHA 3AE3A 4GR1A 3UKQA 4YT0A 3K30A 2CFYA 3ICRA 1GV4A 1LPFA 2RABA 4A7AA 4X9MA 2YVGA 5HYMA 1QJDA 1ZY8A 2VQBA 1IUSA 2YWLA 1L0VA 4U8KA 2XFOA 1YY5A 2YLRA 1L9DA 5IPYA 2YG4A 3NK2X 4OPDA 4USRA 1H86A 2BACA 3LADA 1SEZA 3AD8B 4GUVA 2BK5A 1D7LA 3NIXA 2EQ8A 2WPEA 3AE6A 4YKGA 2R45A 3UKHA 3AYLA 1PJ6A 4B66A 1ZMCA 2GAGB 3NG7X 4H50A 2R46A 5KOWA 5EB5A 3V3OA 2ZZCA 2OA1A 1DOEA 2YR4A 4DGKA 2DKIA 4B1BA 1E1KA 3M13A 2BA9A 2TMDA 5FS9A 3LZXA 2X50A 4U8JA 3VR8A 1P2HA 1NHPA 4H4YA 4ZCDA 1O94A 2WDVA 2YLXA 3DK4A 5L46A 4H2NA 2OLNA 2YG5A 3EAOA 3UOYA 2RGHA 2YLZA 4RG4A 2CVJA 2GVCA 3DH9A 2HQMA 2GMJA 3KU9A 4H2RA 1KNPA 3UOZA 1LVLA 2Q7VA 3B6DA 3RHAA 5JCNA 3ALMA 3BI5A 4J31A 3AEBA 1D4EA 2YM2A 2IVDA 2GR3A 3GMBA 4TM3A 2FJEA 3G5RA 3NT6A 4Z24A 3KD9A 4BV6A 1S2YA 4JQ9A 5CKUA 1OJTA 4DSHA 2V3AA 4RSLA 3RNMA 2XVEA 3GD3A 4NEVA 3NK0X 2BS3A 4U8LA 5M0ZA 1JNZA 1JU2A 4ZN0A 1BWCA 1D7YA 1Q1RA 2GR2A 3ABVA 1H6VA 2C67A 4HB9A 1EL5A 2X8CA 3EF6A 1JRZA 1NENA 1Y56B 3AE5A 1F3PA 2YLSA 3AYJA 4U8PA 1B4VA 3CGDA 2GV8A 3IF9A 4EM4A 1Z6LA 3NTAA 4ADWA 2XFQA 1PJ7A 2WESA 5J7XA 4OPUA 4PAAA 1PHHA 1JRYA 1N1PA 3G5SA 5FMHA 2RGOA 4Z44A 1H7XA 1RP0A 2XLSA 4YSYA 4A9WA 1L9CA 1O5WA 4C5OA 4EQWA 4YXDA 1TDKA 2BK4A 1W4XA 3R9UA 1GSNA 4B65A 4GDEA 3CTYA 4NEWA 2V60A 1IUXA 1MXTA 2E5VA 4A99A 1M64A 1GT8A 1ONFA 1GRBA 3ATRA 1D4CA 1FEAA 4GDPA 4CCRA 2OAMA 2BYBA 1JEHA 5JCLA 2BCPA 3NK1X 1RYIA 3QVRA 3AWIA 2UZZA 1PBCA 2XDOA 4GCMA 3G5QA 4H2QA 2WOWA 1MOKA 1DODA 2TPRA 3D8XA 3BNMA 3AEGA 1KNRA 4Z43A
chains in the Genus database with same CATH superfamily
3CNTA 2ZZ0A 3ENLA 3F8DA 5KNLA 3CNDA 1WUEA 4FDCB 4KPRA 2AL2A 1RVKA 2YG6A 2Y6RA 4REKA 1CBOA 2P8BA 4A3RA 4CCQA 1GESA 1NAAA 3UKLA 4EMWA 1PS9A 3Q6JA 2PTYA 1N60C 5HHFA 1CJ3A 3UP4A 4OPIA 2ONEA 2OLOA 3BI2A 1NPXA 4M6UA 1IUWA 3EKGA 4YTPA 2GF3A 2E1MA 1XPYA 4DNAA 3A7AA 3FYYA 4Z17A 2ZC8A 1PJ5A 3NO1A 1E7PA 4E5TA 3V5CA 1OJCA 3N6HA 3OZ2A 5J04A 3VDGA 1K0IA 1DTNA 4ZOHB 2GMHA 3TCSA 4X2PA 4U8IA 1FOHA 5G5GB 1B5QA 2XVJA 1E39A 3RGTA 5KVHA 6ENLA 1VG9A 1QO8A 3VFCA 2WDRA 3ICTA 3FPZA 3CN8A 1GRHA 3B3RA 4Z26A 3DEQA 1PBDA 4NWZA 3PFRA 2Q6UA 4K2SA 1EBDA 3FMWA 3BHFA 2MUCA 2H89A 3P9UA 4EIPA 3GYJA 4CY8A 3MSYA 2C75A 2E4GA 4TM4A 3T14A 3GO2A 2APGA 4JN8A 3LJPA 1KDGA 3OW1A 5KMRA 2WQYA 3DGZA 4EM3A 2BC1A 2O9ZA 3P4QA 3AN1A 3NGCX 1NDAA 5J60A 2FKPA 3GDNA 4HA6A 3AEEA 2R9ZA 4GIRA 1GPEA 4YTMA 2F5ZA 4IVOB 2W3RA 1H2IA 4U8NA 4CNJA 2GB0A 2PS2A 2RGJA 3NVWB 2DKHA 2PODA 1F8RA 3L1RA 3AE1A 1N4WA 2CDUA 3UOXA 2V61A 3I6DA 3V76A 2C76A 3LXDA 5KRQA 4AP3A 1TRBA 3FBSA 1NHQA 5ER0A 4EMIA 2B9WA 1JDFA 3V3NA 1NHSA 4G6GA 3ADAB 2WPCA 2XFUA 1NELA 2GGEA 1F9CA 3STPA 1KFYA 1BQGA 5U63A 5FS6A 4C74A 3V3WA 4TLZA 4CBQA 3T0KA 1PBEA 1NEKA 1MO9A 4FX9A 2XFNA 3TJIA 1ZK7A 2AR8A 3TQPA 5KVIA 4N9XA 2VRMA 3IJQA 2B9YA 2WP6A 1M6IA 3QSMA 1YQ4A 3KPKA 3ZLHA 1GRFA 4DWDA 3Q4DA 1N4VA 3DFHA 4UDPA 4IL0A 2JKCA 4WX1A 3FIMB 2QA2A 4Z2TA 2BXSA 5FJRA 2ARDA 4ICYA 3GMCA 4A6NA 4XWZA 1IUTA 4H4ZA 3SYIA 1ECQA 3LB8A 2Z5YA 4DN1A 1ZMDA 2GR1A 3K7QX 2OQYA 2W3SA 1LJ1A 4F4RA 3P4PA 2YLWA 3UTHA 2GDQA 3UKPA 2PU0A 2X8GA 3AXBA 1B37A 1CJ4A 1TDNA 3SX6A 4G74A 2WU2A 3EUB3 3NYCA 3VRAA 2OLAA 4A79A 5IQ1A 1R0MA 3DIPA 3OZYA 4TM1A 4KPLA 3T8QA 3E1TA 3AE3A 2PHHA 3UKQA 2CFYA 3ICRA 5HYMA 1ZY8A 1QJDA 3DFYA 2YG4A 1OEPA 2MNRA 2BACA 1SEZA 1KD0A 4A6GA 4ZCWA 3UKHA 2GL5A 4B66A 1ZMCA 2GAGB 2R46A 2W55A 5EB5A 2ZZCA 1DOEA 2DKIA 3M13A 2BA9A 5FS9A 3VR8A 3LZXA 2X50A 4U8JA 1P2HA 2YLXA 2YG5A 4G73A 3UOYA 3IK4A 2YLZA 3DDMA 3BOXA 4RG4A 3VCNA 3DH9A 1FFUC 2GMJA 3KU9A 3UOZA 1LVLA 2Q7VA 3RHAA 4J1OA 4J31A 3AEBA 3QKEA 3NXLA 2YM2A 4HCDA 1S2YA 3RNMA 3GD3A 1JU2A 1BWCA 1D7YA 1Q1RA 2GR2A 3SN4A 2C67A 3EF6A 2X8CA 1V97A 3ES7A 2GV8A 4DHGA 4MKSA 3NTAA 2XFQA 2WESA 3G5SA 1JRYA 2PSNA 1RP0A 2P0IA 2BK4A 3R9UA 4B65A 4GDEA 4NEWA 3CTYA 1IUXA 1M64A 1FEAA 2UZZA 3BNMA 1TYPA 3UCCA 3P1WA 3AECA 3T4WA 4HPNA 3OC4A 3AE2A 3UJRA 4J33A 2YVFA 1CC2A 1GTHA 3OZMA 4K22A 1JPMA 1FECA 3HYWA 1QLBA 2PP1A 1BZLA 1REOA 3NFUA 3T9PA 1CC4A 1JROA 4H4VA 4IZGA 3UJSA 1GTEA 2VRLA 3ETRB 2WETA 3AEDA 3N4FA 1ZOVA 2YAUA 3QPEA 4U8MA 2HNEA 2XCGA 2AL1A 1S2QA 3TWBA 3K7TA 3NTDA 1VQZA 3QFBA 4GYPA 2XLRA 3QFAA 3ZLGA 4B64A 2BRAA 2B7SA 1WYGA 3NRNA 4UDQA 4B68A 3IWAA 5BVAA 3THUA 1LQUA 1H82A 3FG2P 1WUFA 5KOXA 1TZZA 4LU6A 1VQWA 1F6MA 4JN9A 1RM6B 1SJAA 3M12A 3CPIG 1CJ2A 3S5WA 3FVDA 1GOSA 2VQ7A 3RP8A 4MJWA 5KMPA 3V4BA 1XANA 2PPGA 4K8DA 4JNAA 3DMEA 2BXRA 2R0CA 4APNA 4A65A 2I0ZA 2A87A 3RR1A 5G5HB 2PTXA 1JOAA 1NHRA 1Y0PA 4U2SA 1P2EA 4J56A 1X2HA 4YWOA 2PGEA 3ZDNA 4I59A 1OJDA 1TYTA 1DOCA 3GD6A 2EQ7A 2GEWA 3PWIA 1EL8A 4IVMB 5HXIA 3T6CA 3DK9A 4ECHA 3AYIA 4HNLA 4EQXA 2PA6A 2YG7A 3AM9A 1GXFA 4XWRA 1DJNA 4II2A 2Y6QA 3EPTA 3RITA 4IA5A 1K4QA 3AEAA 3UGVA 3HRDC 1JPDX 2PP3A 3C4NA 2GAHB 4TM0A 3HW2A 3QJ4A 2P8CA 1L9EA 3GC2A 2WP5A 3AE7A 1D4DA 5HY5A 1BGNA 2E5AA 1NU5A 1YQZA 4BK2A 2AAQA 1CL0A 2WBAA 1YQ3A 3H70A 1P48A 3CB3A 1L8PA 3NVZB 2A89A 3UCDA 1TKKA 4IHCA 4LA1A 2V5ZA 4FP1A 2QJJA 4B67A 4YTNA 1GETA 4E8GA 2Q0LA 3VQRA 4OPTA 4CY6A 4TVYA 2C66A 5BOFA 3LZWA 1ONEA 2A8XA 2GGGA 4OVIA 1X31B 3FV9A 1E6EA 1MUCA 2GH5A 3SFEA 1ZX9A 3O0HA 3GYIA 1OJ9A 1H83A 1DJQA 3UXKA 3IHGA 2X99A 2PU1A 3C96A 3QVPA 3D46A 5CQFA 4K1WA 4M52A 2BABA 4GYPC 1D5TA 2BS4A 4PABA 4D03A 4IL2A 1NG4A 2GQWA 4Y4LA 1DNCA 4O5UA 5U25A 2V6OA 2GGHA 3WE0A 1FHUA 2AL2B 3S5SA 4B69A 1S7MA 1K0LA 1MRAA 2YVJA 1Q9IA 3D47A 1PN0A 4K5RA 1H84A 1XS2A 3GWDA 5EU9A 1GEUA 1F8SA 2X8HA 3NVVB 4USQA 2NQLA 2PCEA 3AD9B 1B8SA 4G9KA 1TDFA 1ELIA 2PMQA 1K0JA 2PP0A 3H4KA 1COYA 1PXAA 3IJIA 1GV4A 1LPFA 2RABA 3TW9A 3UJFA 2YLRA 3NK2X 4USRA 3I6TA 1H86A 3LADA 4GUVA 3ZVIA 3DGBA 2EQ8A 2XH7A 2R45A 1PJ6A 5KOWA 3V3OA 1VDVA 2BRYA 3FCPA 4B1BA 1KKRA 1NHPA 4H4YA 1O94A 2WDVA 3DK4A 5L46A 4H2NA 1MDRA 3OPSA 2HQMA 1KNPA 3B6DA 1D4EA 2GGJA 2GR3A 2GSHA 1OJTA 4DSHA 1R6WA 1X2GA 4NEVA 3PK7A 3NK0X 2BS3A 5M0ZA 1JNZA 4GMEA 3KUMA 3RO6A 3ABVA 1H6VA 3RRAA 1NENA 1F3PA 3CGDA 1FHVA 3N6JA 3T31A 3Q45A 4YSXA 5FMHA 2XLSA 3UJEA 3RCYA 1O5WA 1TDKA 4ENLA 2E5VA 1ONFA 1GRBA 1D4CA 2OAMA 3NK1X 3IJLA 3PWGA 3V5FA 2P88A 4H2QA 3AEGA 1KNRA 4GGHA 3VC5A 3CK5A 4UP3A 3CGBA 2FBWA 3SZWA 3HYVA 2XLPA 4H4TA 1KF6A 4H4UA 2OZTA 3CPJG 2NVKX 2OZ3A 3REDA 1H7WA 5BOEA 3DJJA 3SQPA 3UKAA 4NTDA 3PG6A 4DX3A 4BURA 1FO4A 3ALJA 2ACZA 2B7RA 4JHMA 4YKFA 5FJTA 2XGZA 1N5WC 2PTWA 3QSEA 1GERA 2C70A 3CT2A 3HPFA 2YQUA 3CAWA 3NS1B 4OCGA 4J3ZA 5KWFA 4AOSA 1V59A 3NN6X 2AKMA 1FL2A 3SN0A 4KWSA 3SFDA 2GR0A 2YR6A 5EB4A 4HYRA 3QN3A 1W6TA 3MWCA 1GALA 2P3ZA 3UKKA 1KSUA 4BJYA 1SB3B 3BHKA 2C3DA 4B63A 2R4JA 1GRTA 3CXOA 4AP1A 2B76A 3JVAA 3NRZB 5ENLA 1Y56A 3NNEA 4JNQA 2QCUA 4K2XA 4JY3A 3AE4A 1ELSA 2WP9A 4Y4MA 3U9IA 4KX6A 2PGWA 3RP7A 3DGHA 2YG3A 3GD4A 2WOVA 4A6NB 1IUVA 3DA1A 4X4JA 1ZXIC 3II4A 3NN0X 5LV9A 3ITJA 2JB3A 2JAEA 3ALLA 2OX4A 3N4EA 1E1MA 4G8TA 4H2HA 3KVEA 4GF7A 1BKWA 4H4RA 1PBBA 3M0OA 3ZYXA 4CNKA 4IP5A 4YSZA 2QGYA 2BCGG 1CHUA 3A7RA 5JRBA 1VRQB 4Z2UA 2WEUA 3B9JB 2DW7A 2CHRA 2FJBA 4OPLA 4ZCCA 5U1OA 3L5OA 4BJZA 1BF3A 1ZP0A 1YEYA 3NYFA 3OTRA 4WCTA 2BS2A 4H83A 4U2LA 2GQFA 4NTEA 4IT1A 3UP5A 3UTEA 4E4FA 5KXJA 3CXBA 1IJHA 3T2ZA 4GAVA 4AOXA 2POZA 2WS3A 4HCLA 5FJPA 1KSSA 3R1ZA 1HYUA 2YLTA 2BC0A 2OVLA 3NH3X 3MY9A 4K5SA 1LTXR 2OQHA 5IDZA 1S3BA 3NKSA 4J57A 3CNSA 5JCMA 3F8PA 4Z2RA 1Q1WA 2CULA 2XVIA 4C77A 3DK8A 1N5XA 2FJAA 1S3EA 3AB1A 3VRBA 2R0PA 2WHDA 3GY1A 5EBKA 3MZNA 1YKJA 4KT2A 4EWJA 4K7ZA 4FK1A 1EC8A 4NTCA 3GDPA 5KMQA 3GRTA 4HN8A 4KEMA 2ZBWA 3DJEA 2C73A 4ZA0A 3UXLA 3AEFA 3EANA 1EBHA 3CGEA 1BKHA 2Q0KA 3CNPA 2VOUA 4EMJA 3BI4A 3QSSA 5GSNA 4H4SA 3TOYA 4GGBA 4H2PA 3BSMA 3IHMA 3UOVA 4EIQA 1SJDA 4H1ZA 3SZCA 2BK3A 2ZZBA 4AT0A 2IVEA 4JY2A 3ZVHB 2OFJA 4DYEA 4GRTA 4YT0A 3K30A 4ROPA 4A7AA 4X9MA 3CYJA 1L0VA 4U8KA 5KMSA 1YY5A 4II3A 5IPYA 3T2YA 2I5QA 2BK5A 4YKGA 3AYLA 3NG7X 2OA1A 2YR4A 1E1KA 4NNJA 4ZCDA 2OG9A 3SZFA 2OLNA 3EAOA 2RGHA 2CVJA 4M0XA 4H2RA 5JCNA 1SJBA 3ALMA 3BI5A 1N62C 2IVDA 4BV6A 3NT6A 3H8AA 3G5RA 4Z24A 3KD9A 4JQ9A 3P3BA 5CKUA 1T3QC 4DXKA 2XVEA 3TTEA 2OKTA 1EL5A 1JRZA 3DG6A 2YLSA 3AYJA 1KKOA 4U8PA 4EM4A 1Z6LA 4OPUA 1PHHA 3R11A 2RGOA 4YSYA 1H7XA 4A9WA 3K1GA 1W4XA 2ZADA 4H19A 2V60A 1MXTA 3ATRA 4CCRA 2BYBA 1JEHA 5JCLA 2QDEA 1PBCA 3G5QA 1MOKA 3GYXA 1GSNA 3IC9A 3P93A 3MQTA 3K7MX 3R25A 3VC6A 1SJCA 3DG3A 5JCKA 3UJ2A 4OPGA 3GSIA 1EC9A 4I58A 1LV0A 2DW6A 3ATQA 4X9NA 5EOWA 3DG7A 1ZOYA 3I6EA 3NLCA 5C2TA 3NZGA 2XLTA 3U4FA 3URHA 2O56A 2XH2A 1XDIA 1LQTA 7ENLA 3FJ4A 3SQSA 3CIRA 4U2TA 4MMWA 3UTFA 2QDDA 4FK1C 1NG3A 3UKFA 3CNJA 2HXTA 2JB1A 2R4EA 1CC6A 1FCDA 3R0UA 2XLUA 2FYMA 3SM8A 2EQ6A 4OPCA 2B9XA 2W54A 1PDYA 1UKVG 5BULA 1PDHA 3P4RA 4E0VA 2HXUA 2C72A 2FJDA 4HNCA 2HZGA 3A7UA 2XYOA 3LOVA 4DSGA 5BRTA 4GAPA 2OALA 3S61A 1XHCA 3AE8A 1GREA 1JRPA 2WU5A 1MNSA 1TDOA 1GRGA 3RP6A 1XPQA 4TVWA 3TWAA 2PTZA 3JZUA 3AMZA 3SXIA 2X3NA 1EBGA 5FS8A 3DJDA 4P9SA 2PYXA 3ISHA 1AOGA 3CPHG 4A5LA 4GFIA 2WPFA 4U8OA 3BJSA 1VG0A 3AD7B 1STZA 2EQ9A 2XFPA 3D1CA 3P4SA 3JW7A 3NVYB 4JDRA 2JBVA 2AQJA 1RSGA 2XVHA 4LIIA 3PO7A 2QQ6A 1N63C 4MGGA 1N4UA 3CGCA 4EQSA 4BK3A 4CRTA 3KA7A 4J36A 2GRTA 4IP4A 3I3LA 3Q9TA 2QJNA 1ZDLA 1H81A 3GRSA 4H4QA 4C3XA 4RG3A 2C64A 4EQRA 2JK6A 5GRTA 1FIQB 5C3JA 2OZ8A 2VVLA 4JN7A 2C7GA 4AT2A 4E4UA 3ES8A 2JB2A 2YM1A 3DJGX 3JSKA 5DBJA 4G7FA 4GISA 2V3BA 1VDCA 4FI4A 5JCIA 3UCLA 3VRDB 4TLXA 3KPFA 3SJNA 3UTGA 5M10A 1TE6A 2VVMA 3SN1A 3EEZA 1CF3A 3VA8A 2RDXA 1GNDA 3GWFA 4G6HA 3R07C 4D04A 3KLJA 1BGJA 2VZ2A 2H88A 3NYEA 1JRXA 2E3TA 3H8LA 2WDQA 1PXBA 3C4AA 3F8RA 1CJCA 1GRAA 1F8WA 3MUCA 2QAEA 3DERA 3L8KA 1E1LA 3KKJA 3T37A 4UDRA 4C3YA 4YSHA 3SSZA 2IIDA 4YWSA 3NHOX 3COXA 2QA1A 2WOIA 2YR5A 3MKCA 3AE9A 1FEBA 4BK1A 3DESA 4Y4NA 2W0HA 3ICSA 4H4WA 4IA6A 1TDEA 2C3CA 3VR9A 4H4PA 1JCTA 3SGLA 5IQ4A 1IYXA 2R0GA 1KCZA 4H4XA 1ZKQA 1PXCA 1IUUA 4J34A 4O5QA 1OJAA 5FS7A 4IV9A 3BNUA 3H8IA 1JNRA 1FFVC 1DOBA 3PVCA 3S47A 2NPXA 4XXGA 3H12A 4NZHA 4Z25A 3HYXA 5BUKA 3PS9A 3SR6B 1EL7A 3OP2A 2QVHA 5TR3A 3HZLA 4H7UA 1DXLA 2C65A 4J2WA 3SZ0A 2QJMA 2VVLG 3R10A 1E1NA 2J3NA 1O95A 2XVFA 3ZVHA 2XSXA 2Z5XA 1PBFA 4GR1A 1EL9A 1P43A 2XH4A 2YVGA 2VQBA 2YWLA 1IUSA 2XFOA 5FJOA 1L9DA 4OPDA 3QLDA 3AD8B 3P0WA 1D7LA 3SBFA 2OO6A 1PDZA 3NIXA 2WPEA 3AE6A 5FJUA 4H50A 2XH0A 4DGKA 2C4CA 4A35A 2TMDA 3VCCA 2GVCA 1E9IA 3R0KA 2AKZA 3SY4A 4Z1YA 3ZLFA 3GMBA 4TM3A 2FJEA 1MDLA 4E6MA 3H7VA 2V3AA 4RSLA 4U8LA 1EC7A 1N61C 4ZN0A 4HB9A 1Y56B 3AE5A 1B4VA 3IF9A 2OPJA 4ADWA 3D9XA 3TJ4A 1PJ7A 3B97A 5J7XA 4PAAA 1N1PA 4Z44A 4HCHA 3QTPA 1L9CA 3T2KA 4C5OA 4EQWA 4YXDA 3CMMA 2GGIA 3FXGA 4A99A 1GT8A 4GDPA 4K8GA 3I4KA 2BCPA 1RYIA 3QVRA 3AWIA 2XDOA 4GCMA 1KN0A 2WOWA 2TPRA 1DODA 3D8XA 4Z43A
chains in the Genus database with same CATH topology
3IC9A 3CNTA 2ZZ0A 3P1WA 3K7MX 3F8DA 4UP3A 5KNLA 3CNDA 3AECA 4FDCB 3CGBA 4KPRA 2FBWA 3SZWA 5JCKA 3OC4A 3HYVA 4OPGA 3AE2A 3GSIA 2XLPA 4I58A 1LV0A 4H4TA 2YG6A 3ATQA 1KF6A 2Y6RA 4J33A 4H4UA 4REKA 2YVFA 1ZOYA 3NLCA 5C2TA 1CBOA 2NVKX 1CC2A 2XLTA 3CPJG 4CCQA 3URHA 1GESA 3REDA 1H7WA 1NAAA 3UKLA 1XDIA 3DJJA 4EMWA 1GTHA 3SQPA 1LQTA 1PS9A 4K22A 3UKAA 3Q6JA 4NTDA 3PG6A 1FECA 3CIRA 4BURA 4U2TA 3ALJA 3HYWA 3UTFA 1QLBA 5HHFA 1CJ3A 2ACZA 4FK1C 1BZLA 3UP4A 4OPIA 2B7RA 1NG3A 2OLOA 4YKFA 3BI2A 1NPXA 1REOA 1IUWA 3UKFA 4YTPA 2GF3A 2E1MA 1CC4A 3CNJA 4DNAA 4H4VA 2JB1A 3QSEA 1GERA 1GTEA 2C70A 2R4EA 1CC6A 1FCDA 2VRLA 2YQUA 2XLUA 4OCGA 4YSXA 1PJ5A 3SM8A 2WETA 3AEDA 1E7PA 5KWFA 4AOSA 2EQ6A 1V59A 1ZOVA 4OPCA 2YAUA 3NN6X 2B9XA 1OJCA 4U8MA 1UKVG 5BULA 1PDHA 2XCGA 3P4RA 1FL2A 4E0VA 2C72A 3SFDA 2GR0A 1S2QA 2FJDA 2YR6A 3OZ2A 5EB4A 1K0IA 3K7TA 3NTDA 2GMHA 3QFBA 2XYOA 3LOVA 4DSGA 1GALA 3UKKA 1KSUA 4U8IA 5BRTA 4BJYA 1FOHA 2XLRA 3QFAA 4GAPA 4B64A 2BRAA 2B7SA 3NRNA 2OALA 4UDQA 3S61A 1XHCA 1B5QA 3AE8A 4B68A 1GREA 3IWAA 3BHKA 2C3DA 5BVAA 2XVJA 1LQUA 2WU5A 1H82A 1TDOA 4B63A 1E39A 2R4JA 5KVHA 1GRGA 1GRTA 3RP6A 1VG9A 1QO8A 2WDRA 3FG2P 5EOWA 5KOXA 4AP1A 1XPQA 4X9NA 3ICTA 3FPZA 3CN8A 1GRHA 2B76A 3B3RA 3SXIA 4LU6A 1VQWA 1F6MA 4JN9A 1Y56A 2X3NA 5FS8A 3NNEA 4JNQA 4Z26A 3DJDA 4P9SA 2PYXA 2QCUA 4K2XA 1PBDA 3M12A 3ISHA 4NWZA 4JY3A 3CPIG 1CJ2A 1AOGA 2Q6UA 3CPHG 3S5WA 4A5LA 2WPFA 4U8OA 1GOSA 1VG0A 1EBDA 3FMWA 3BHFA 3AD7B 3AE4A 2EQ9A 2XFPA 2VQ7A 3D1CA 2H89A 3P4SA 2WP9A 3RP8A 4MJWA 5KMPA 4Y4MA 3P9UA 4KX6A 4JDRA 4EIPA 1XANA 3RP7A 4K8DA 4JNAA 3DMEA 2BXRA 2JBVA 3DGHA 4APNA 2R0CA 2YG3A 3GD4A 3GYJA 4CY8A 2AQJA 4A65A 1RSGA 2I0ZA 2A87A 2XVHA 2WOVA 2C75A 4LIIA 2E4GA 3PO7A 4TM4A 4A6NB 1IUVA 1JOAA 1NHRA 3T14A 3DA1A 4X4JA 1Y0PA 2APGA 3II4A 4U2SA 1P2EA 4J56A 1N4UA 4YWOA 3LJPA 3NN0X 5LV9A 3CGCA 1KDGA 3ZDNA 4I59A 1OJDA 1TYTA 4EQSA 3ITJA 4BK3A 2JB3A 4CRTA 3KA7A 1DOCA 2JAEA 5KMRA 3ALLA 4J36A 2GRTA 1E1MA 2EQ7A 2WQYA 3DGZA 1EL8A 2GEWA 4EM3A 4IVMB 2BC1A 3I3LA 3KVEA 3Q9TA 4GF7A 5HXIA 2O9ZA 3P4QA 1BKWA 1ZDLA 4H4RA 1H81A 3GRSA 3NGCX 1NDAA 4H4QA 1PBBA 3M0OA 3ZYXA 4CNKA 3DK9A 5J60A 4C3XA 3AYIA 4ECHA 4EQXA 4YSZA 3GDNA 4RG3A 2C64A 4EQRA 2BCGG 2JK6A 4HA6A 5GRTA 2YG7A 3AEEA 2R9ZA 5C3JA 1GXFA 1CHUA 4XWRA 5JRBA 1VRQB 4Z2UA 1DJNA 4II2A 2WEUA 2Y6QA 3EPTA 1GPEA 2FJBA 4OPLA 2VVLA 4IA5A 4ZCCA 1K4QA 3AEAA 4YTMA 2C7GA 3VR8A 2F5ZA 5U1OA 2YM1A 2JB2A 4IVOB 4AT2A 3DJGX 3L5OA 4BJZA 3C4NA 1BF3A 3JSKA 1ZP0A 5DBJA 1H2IA 1VDCA 2V3BA 2GAHB 4TM0A 4U8NA 4CNJA 2GB0A 3QJ4A 5JCIA 2RGJA 3NYFA 3UCLA 1L9EA 4TLXA 2BS2A 4WCTA 3VRDB 4U2LA 2WP5A 2GQFA 3AE7A 2DKHA 3KPFA 3UTGA 5M10A 1F8RA 2VVMA 3L1RA 4NTEA 1D4DA 1N4WA 3AE1A 2CDUA 3UP5A 3UOXA 2V61A 3UTEA 3I6DA 3V76A 5HY5A 1CF3A 3LXDA 2C76A 1BGNA 1GNDA 3GWFA 4G6HA 4AP3A 1TRBA 3FBSA 5KRQA 5KXJA 1NHQA 1IJHA 1YQZA 5ER0A 3T2ZA 4BK2A 4EMIA 4GAVA 2AAQA 1CL0A 2WBAA 1YQ3A 4D04A 3KLJA 1BGJA 2VZ2A 2B9WA 2H88A 3NYEA 1JRXA 3V3NA 4AOXA 2WS3A 2A89A 1NHSA 4G6GA 3ADAB 3H8LA 2WPCA 1KFYA 1KSSA 2XFUA 2WDQA 1PXBA 3C4AA 4LA1A 2V5ZA 5U63A 4B67A 5FS6A 1HYUA 2YLTA 3F8RA 4C74A 2BC0A 1CJCA 1GRAA 4TLZA 1F8WA 4CBQA 3T0KA 4YTNA 1GETA 3NH3X 2QAEA 3L8KA 1PBEA 4K5SA 1LTXR 1E1LA 1NEKA 3KKJA 3T37A 4UDRA 1MO9A 1S3BA 3NKSA 2Q0LA 3VQRA 4C3YA 4YSHA 4OPTA 4FX9A 2XFNA 4CY6A 4J57A 3CNSA 2C66A 1ZK7A 2AR8A 5JCMA 3F8PA 5KVIA 1Q1WA 4N9XA 4Z2RA 2IIDA 2CULA 2VRMA 2XVIA 3LZWA 3NHOX 4C77A 3DK8A 2FJAA 2A8XA 1S3EA 3AB1A 3COXA 2B9YA 3VRBA 4OVIA 2WP6A 2R0PA 1X31B 2WHDA 1M6IA 2QA1A 1YQ4A 3QSMA 2WOIA 1E6EA 2YR5A 3KPKA 2GH5A 3SFEA 1ZX9A 1GRFA 5EBKA 3AE9A 1FEBA 3O0HA 1N4VA 4BK1A 3GYIA 1OJ9A 1YKJA 4UDPA 2JKCA 4K7ZA 4FK1A 4WX1A 1H83A 4Y4NA 2W0HA 3ICSA 4H4WA 4IA6A 4NTCA 1DJQA 1TDEA 3FIMB 3GDPA 5KMQA 3IHGA 2X99A 2QA2A 2C3CA 2BXSA 3VR9A 3C96A 4Z2TA 3GRTA 3QVPA 5CQFA 4H4PA 2ARDA 4ICYA 3GMCA 3SGLA 5IQ4A 2R0GA 4H4XA 1ZKQA 4A6NA 4XWZA 1PXCA 1IUUA 4M52A 1IUTA 1TYPA 4H4ZA 2ZBWA 2BABA 4J34A 4O5QA 1OJAA 3SYIA 3LB8A 1D5TA 2Z5YA 2BS4A 2C73A 3DJEA 4PABA 1ZMDA 4D03A 3AEFA 2GR1A 5FS7A 3K7QX 1NG4A 4IV9A 3EANA 3CGEA 3BNUA 2Q0KA 1LJ1A 2GQWA 4Y4LA 1DNCA 3H8IA 3CNPA 2VOUA 4EMJA 4O5UA 1JNRA 3P4PA 5U25A 1DOBA 2YLWA 3UTHA 2V6OA 3BI4A 3QSSA 3PVCA 5GSNA 4H4SA 3WE0A 2NPXA 4XXGA 4NZHA 3UKPA 4H2PA 4B69A 3HYXA 4Z25A 2X8GA 1S7MA 1K0LA 3IHMA 5BUKA 3AXBA 3PS9A 1B37A 1CJ4A 2YVJA 1Q9IA 1TDNA 1PN0A 4K5RA 3UOVA 1EL7A 4EIQA 1H84A 3GWDA 3SX6A 1GEUA 5TR3A 1F8SA 2X8HA 3HZLA 4G74A 4H7UA 4USQA 2BK3A 3SZCA 2ZZBA 1DXLA 2C65A 2WU2A 4AT0A 4J2WA 2IVEA 3SZ0A 2VVLG 4JY2A 3NYCA 1E1NA 3AD9B 2J3NA 1B8SA 1O95A 4G9KA 3VRAA 2XVFA 1TDFA 4A79A 4GRTA 1ELIA 1K0JA 5IQ1A 4TM1A 3H4KA 1COYA 2Z5XA 1PBFA 3E1TA 4GR1A 1EL9A 1PXAA 2PHHA 3AE3A 3UKQA 4YT0A 3K30A 2CFYA 3ICRA 1GV4A 1LPFA 2RABA 4A7AA 4X9MA 2YVGA 5HYMA 1ZY8A 1QJDA 2VQBA 1IUSA 2YWLA 1L0VA 4U8KA 2XFOA 5KMSA 1YY5A 2YLRA 4II3A 1L9DA 5IPYA 2YG4A 3NK2X 4OPDA 4USRA 1H86A 3T2YA 2BACA 3LADA 1SEZA 3AD8B 4GUVA 2BK5A 1D7LA 3NIXA 2EQ8A 2WPEA 3AE6A 4YKGA 2R45A 3UKHA 3AYLA 1PJ6A 4B66A 1ZMCA 2GAGB 3NG7X 4H50A 2R46A 5KOWA 5EB5A 3V3OA 2ZZCA 2OA1A 1DOEA 2BRYA 2YR4A 4DGKA 2DKIA 4B1BA 2C4CA 1E1KA 3M13A 2BA9A 5FS9A 2TMDA 3LZXA 2X50A 4NNJA 4U8JA 1P2HA 1NHPA 4H4YA 4ZCDA 1O94A 2WDVA 3DK4A 2YLXA 3SZFA 5L46A 4H2NA 2OLNA 3EAOA 2YG5A 4G73A 3UOYA 2RGHA 2YLZA 4RG4A 2CVJA 2GVCA 3DH9A 2HQMA 2GMJA 3KU9A 4H2RA 1KNPA 5JCNA 1LVLA 2Q7VA 3B6DA 3RHAA 3UOZA 3ALMA 3BI5A 4J31A 3AEBA 1D4EA 3SY4A 2YM2A 2IVDA 2GR3A 4BV6A 3GMBA 2FJEA 3G5RA 3NT6A 4TM3A 3KD9A 4Z24A 1S2YA 4JQ9A 5CKUA 1OJTA 4DSHA 2V3AA 4RSLA 3RNMA 3GD3A 4NEVA 2XVEA 3NK0X 2BS3A 4U8LA 5M0ZA 1JNZA 1JU2A 4ZN0A 1D7YA 1BWCA 1Q1RA 2GR2A 3ABVA 1H6VA 2C67A 4HB9A 3EF6A 2X8CA 1EL5A 1JRZA 1NENA 1Y56B 3AE5A 1F3PA 2YLSA 3AYJA 4U8PA 3CGDA 1B4VA 2GV8A 3IF9A 4EM4A 1Z6LA 3NTAA 4ADWA 3D9XA 2XFQA 1PJ7A 3T31A 2WESA 5J7XA 4OPUA 4PAAA 1PHHA 1JRYA 1N1PA 5FMHA 3G5SA 2RGOA 4Z44A 1H7XA 1RP0A 2XLSA 4YSYA 4A9WA 1L9CA 1O5WA 3T2KA 4C5OA 4EQWA 4YXDA 1TDKA 2BK4A 1W4XA 3R9UA 1GSNA 4B65A 3CMMA 4GDEA 4NEWA 3CTYA 2V60A 1IUXA 1MXTA 2E5VA 4A99A 1M64A 1GT8A 1ONFA 1GRBA 3ATRA 1D4CA 1FEAA 4GDPA 4CCRA 2OAMA 2BYBA 1JEHA 5JCLA 2BCPA 3NK1X 1RYIA 3QVRA 3AWIA 2UZZA 1PBCA 2XDOA 4GCMA 1KN0A 3G5QA 4H2QA 2WOWA 1MOKA 2TPRA 1DODA 3D8XA 3GYXA 3BNMA 3AEGA 1KNRA 4Z43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC9 A;  3CNT A;  2ZZ0 A;  3P1W A;  3K7M X;  3F8D A;  4UP3 A;  3CND A;  3AEC A;  4FDC B;  3CGB A;  4KPR A;  2FBW A;  5JCK A;  3OC4 A;  4OPG A;  3AE2 A;  3GSI A;  2XLP A;  4I58 A;  1LV0 A;  3ATQ A;  2YG6 A;  4H4T A;  1KF6 A;  2Y6R A;  4J33 A;  4H4U A;  4REK A;  2YVF A;  1ZOY A;  3NLC A;  5C2T A;  1CBO A;  1CC2 A;  2NVK X;  2XLT A;  3CPJ G;  4CCQ A;  3RED A;  1GES A;  3URH A;  1H7W A;  1NAA A;  3UKL A;  1XDI A;  1PS9 A;  1GTH A;  3DJJ A;  3SQP A;  1LQT A;  3UKA A;  4K22 A;  4EMW A;  3Q6J A;  4NTD A;  1FEC A;  3CIR A;  4BUR A;  4U2T A;  3ALJ A;  3UTF A;  1QLB A;  5HHF A;  1CJ3 A;  2ACZ A;  4FK1 C;  1BZL A;  3UP4 A;  4OPI A;  2B7R A;  1NG3 A;  2OLO A;  4YKF A;  3BI2 A;  1NPX A;  1REO A;  1IUW A;  3UKF A;  4YTP A;  2GF3 A;  2E1M A;  1CC4 A;  3CNJ A;  3QSE A;  4H4V A;  2JB1 A;  4DNA A;  1GER A;  1GTE A;  2C70 A;  2R4E A;  1CC6 A;  1FCD A;  2VRL A;  2YQU A;  2XLU A;  4OCG A;  4YSX A;  1PJ5 A;  3SM8 A;  2WET A;  3AED A;  1E7P A;  5KWF A;  4AOS A;  2EQ6 A;  1V59 A;  1ZOV A;  4OPC A;  2YAU A;  3NN6 X;  2B9X A;  1OJC A;  4U8M A;  1UKV G;  5BUL A;  1PDH A;  2XCG A;  3P4R A;  1FL2 A;  4E0V A;  2C72 A;  3SFD A;  1S2Q A;  2FJD A;  2GR0 A;  2YR6 A;  3OZ2 A;  5EB4 A;  1K0I A;  3K7T A;  3NTD A;  2GMH A;  3QFB A;  2XYO A;  3LOV A;  4DSG A;  1GAL A;  3UKK A;  1KSU A;  4U8I A;  5BRT A;  4BJY A;  1FOH A;  2XLR A;  3QFA A;  4B64 A;  2B7S A;  3NRN A;  2OAL A;  4UDQ A;  3S61 A;  1XHC A;  1B5Q A;  3AE8 A;  4B68 A;  1GRE A;  3IWA A;  3BHK A;  2C3D A;  5BVA A;  2XVJ A;  1LQU A;  2WU5 A;  1H82 A;  1TDO A;  4B63 A;  1E39 A;  2R4J A;  5KVH A;  1GRG A;  1GRT A;  3RP6 A;  1VG9 A;  1QO8 A;  2WDR A;  3FG2 P;  5EOW A;  5KOX A;  4AP1 A;  1XPQ A;  4X9N A;  3ICT A;  3FPZ A;  3CN8 A;  1GRH A;  2B76 A;  3B3R A;  4LU6 A;  1VQW A;  1F6M A;  4JN9 A;  1Y56 A;  2X3N A;  5FS8 A;  3NNE A;  4JNQ A;  4Z26 A;  3DJD A;  4P9S A;  2PYX A;  2QCU A;  4K2X A;  1PBD A;  3M12 A;  3ISH A;  4JY3 A;  3CPI G;  1CJ2 A;  2Q6U A;  1AOG A;  3CPH G;  3S5W A;  4A5L A;  2WPF A;  4U8O A;  1GOS A;  1VG0 A;  1EBD A;  3FMW A;  3BHF A;  3AD7 B;  3AE4 A;  2EQ9 A;  2XFP A;  2VQ7 A;  3D1C A;  2H89 A;  3P4S A;  2WP9 A;  3RP8 A;  4MJW A;  4Y4M A;  3P9U A;  4KX6 A;  4JDR A;  4EIP A;  1XAN A;  3RP7 A;  4K8D A;  4JNA A;  3DME A;  2BXR A;  2JBV A;  2R0C A;  2YG3 A;  3DGH A;  3GYJ A;  3GD4 A;  4APN A;  4CY8 A;  2AQJ A;  4A65 A;  1RSG A;  2I0Z A;  2A87 A;  2XVH A;  2C75 A;  2WOV A;  4LII A;  2E4G A;  3PO7 A;  4TM4 A;  4A6N B;  1IUV A;  1JOA A;  1NHR A;  3DA1 A;  4X4J A;  1Y0P A;  2APG A;  3II4 A;  4U2S A;  1P2E A;  4J56 A;  1N4U A;  3NN0 X;  3LJP A;  4YWO A;  5LV9 A;  3CGC A;  1KDG A;  3ZDN A;  4I59 A;  1OJD A;  1TYT A;  4EQS A;  3ITJ A;  4BK3 A;  2JB3 A;  4CRT A;  3KA7 A;  1DOC A;  2JAE A;  3ALL A;  4J36 A;  2GRT A;  1E1M A;  2EQ7 A;  2WQY A;  2GEW A;  1EL8 A;  3DGZ A;  4EM3 A;  4IVM B;  2BC1 A;  3I3L A;  3KVE A;  3Q9T A;  4GF7 A;  5HXI A;  2O9Z A;  3P4Q A;  1BKW A;  1ZDL A;  4H4R A;  1H81 A;  3GRS A;  3NGC X;  1NDA A;  4H4Q A;  1PBB A;  3M0O A;  3ZYX A;  4CNK A;  3DK9 A;  5J60 A;  4C3X A;  3AYI A;  4ECH A;  4EQX A;  4YSZ A;  3GDN A;  4RG3 A;  2C64 A;  4EQR A;  2BCG G;  2JK6 A;  4HA6 A;  2YG7 A;  3AEE A;  5GRT A;  2R9Z A;  5C3J A;  1GXF A;  1CHU A;  4XWR A;  1VRQ B;  4Z2U A;  1DJN A;  2WEU A;  2Y6Q A;  3EPT A;  1GPE A;  2FJB A;  4OPL A;  2VVL A;  4IA5 A;  4ZCC A;  1K4Q A;  3AEA A;  4YTM A;  2C7G A;  4AT2 A;  2F5Z A;  4IVO B;  2YM1 A;  2JB2 A;  5U1O A;  3DJG X;  4BJZ A;  3C4N A;  1BF3 A;  3JSK A;  1ZP0 A;  5DBJ A;  1VDC A;  2V3B A;  2GAH B;  4TM0 A;  4U8N A;  4CNJ A;  2GB0 A;  3QJ4 A;  2RGJ A;  3NYF A;  3UCL A;  5JCI A;  1L9E A;  4TLX A;  2BS2 A;  4WCT A;  3VRD B;  4U2L A;  2GQF A;  2WP5 A;  3AE7 A;  2DKH A;  3KPF A;  3UTG A;  5M10 A;  1F8R A;  2VVM A;  3L1R A;  4NTE A;  1D4D A;  1N4W A;  3AE1 A;  2CDU A;  3UP5 A;  3UOX A;  2V61 A;  3UTE A;  3I6D A;  3V76 A;  5HY5 A;  2C76 A;  1CF3 A;  3LXD A;  1BGN A;  1GND A;  3GWF A;  4AP3 A;  5KRQ A;  1TRB A;  3FBS A;  5KXJ A;  1NHQ A;  1IJH A;  1YQZ A;  5ER0 A;  4BK2 A;  4EMI A;  2AAQ A;  1CL0 A;  2WBA A;  1YQ3 A;  4D04 A;  3KLJ A;  1BGJ A;  2VZ2 A;  2B9W A;  2H88 A;  3NYE A;  1JRX A;  3V3N A;  4AOX A;  2WS3 A;  2A89 A;  1NHS A;  3ADA B;  3H8L A;  2WPC A;  1KSS A;  1KFY A;  2XFU A;  2WDQ A;  1PXB A;  3C4A A;  4LA1 A;  2V5Z A;  5U63 A;  4B67 A;  1HYU A;  3F8R A;  2YLT A;  5FS6 A;  4C74 A;  2BC0 A;  1CJC A;  1GRA A;  4TLZ A;  1F8W A;  4CBQ A;  4YTN A;  1GET A;  3NH3 X;  2QAE A;  3L8K A;  1PBE A;  4K5S A;  1LTX R;  1E1L A;  1NEK A;  3KKJ A;  3T37 A;  4UDR A;  1MO9 A;  1S3B A;  3NKS A;  2Q0L A;  3VQR A;  4C3Y A;  4YSH A;  4OPT A;  4FX9 A;  2XFN A;  4CY6 A;  4J57 A;  3CNS A;  2C66 A;  1ZK7 A;  2AR8 A;  5JCM A;  3F8P A;  5KVI A;  1Q1W A;  4N9X A;  4Z2R A;  2IID A;  2CUL A;  2VRM A;  2XVI A;  3LZW A;  3NHO X;  4C77 A;  3DK8 A;  2FJA A;  1S3E A;  2A8X A;  3AB1 A;  3COX A;  2B9Y A;  3VRB A;  4OVI A;  2R0P A;  2WP6 A;  1X31 B;  2WHD A;  1M6I A;  2QA1 A;  1YQ4 A;  3QSM A;  2WOI A;  1E6E A;  2YR5 A;  2GH5 A;  3SFE A;  1ZX9 A;  1GRF A;  3AE9 A;  5EBK A;  1FEB A;  3O0H A;  1N4V A;  4BK1 A;  3GYI A;  1OJ9 A;  1YKJ A;  4UDP A;  2JKC A;  4K7Z A;  4FK1 A;  4WX1 A;  1H83 A;  4Y4N A;  2W0H A;  3ICS A;  4H4W A;  4IA6 A;  4NTC A;  1DJQ A;  1TDE A;  3FIM B;  3GDP A;  3IHG A;  2X99 A;  2QA2 A;  2C3C A;  2BXS A;  3VR9 A;  3C96 A;  4Z2T A;  3GRT A;  3QVP A;  5CQF A;  2ARD A;  4H4P A;  4ICY A;  3GMC A;  3SGL A;  5IQ4 A;  2R0G A;  4H4X A;  1ZKQ A;  4A6N A;  4XWZ A;  1PXC A;  1IUU A;  1IUT A;  4M52 A;  1TYP A;  2ZBW A;  4H4Z A;  2BAB A;  4J34 A;  4O5Q A;  1OJA A;  3LB8 A;  1D5T A;  2Z5Y A;  2BS4 A;  2C73 A;  3DJE A;  4PAB A;  1ZMD A;  4D03 A;  3AEF A;  2GR1 A;  5FS7 A;  3K7Q X;  1NG4 A;  4IV9 A;  3EAN A;  3CGE A;  3BNU A;  2Q0K A;  1LJ1 A;  2GQW A;  4Y4L A;  1DNC A;  3H8I A;  3CNP A;  2VOU A;  4EMJ A;  4O5U A;  1JNR A;  3P4P A;  1DOB A;  5U25 A;  2YLW A;  3UTH A;  2V6O A;  3BI4 A;  3QSS A;  3PVC A;  5GSN A;  4H4S A;  3WE0 A;  2NPX A;  4XXG A;  4NZH A;  3UKP A;  4H2P A;  4B69 A;  4Z25 A;  2X8G A;  1K0L A;  3IHM A;  5BUK A;  3AXB A;  3PS9 A;  1B37 A;  1CJ4 A;  1Q9I A;  2YVJ A;  1TDN A;  1PN0 A;  4K5R A;  3UOV A;  1EL7 A;  4EIQ A;  1H84 A;  3GWD A;  1GEU A;  1F8S A;  3HZL A;  2X8H A;  4H7U A;  5TR3 A;  4USQ A;  2BK3 A;  2ZZB A;  1DXL A;  2C65 A;  2WU2 A;  4AT0 A;  4J2W A;  2IVE A;  2VVL G;  4JY2 A;  3NYC A;  1E1N A;  3AD9 B;  2J3N A;  1B8S A;  1O95 A;  3VRA A;  2XVF A;  1TDF A;  4A79 A;  4GRT A;  1ELI A;  1K0J A;  5IQ1 A;  4TM1 A;  3H4K A;  1COY A;  2Z5X A;  1PBF A;  3E1T A;  1EL9 A;  1PXA A;  2PHH A;  3AE3 A;  4GR1 A;  3UKQ A;  4YT0 A;  3K30 A;  2CFY A;  3ICR A;  1GV4 A;  1LPF A;  2RAB A;  4A7A A;  4X9M A;  2YVG A;  5HYM A;  1QJD A;  1ZY8 A;  2VQB A;  1IUS A;  2YWL A;  1L0V A;  4U8K A;  2XFO A;  1YY5 A;  2YLR A;  1L9D A;  5IPY A;  2YG4 A;  3NK2 X;  4OPD A;  4USR A;  1H86 A;  2BAC A;  3LAD A;  1SEZ A;  3AD8 B;  4GUV A;  2BK5 A;  1D7L A;  3NIX A;  2EQ8 A;  2WPE A;  3AE6 A;  4YKG A;  2R45 A;  3UKH A;  3AYL A;  1PJ6 A;  4B66 A;  1ZMC A;  2GAG B;  3NG7 X;  4H50 A;  2R46 A;  5KOW A;  5EB5 A;  3V3O A;  2ZZC A;  2OA1 A;  1DOE A;  2YR4 A;  4DGK A;  2DKI A;  4B1B A;  1E1K A;  3M13 A;  2BA9 A;  2TMD A;  5FS9 A;  3LZX A;  2X50 A;  4U8J A;  3VR8 A;  1P2H A;  1NHP A;  4H4Y A;  4ZCD A;  1O94 A;  2WDV A;  2YLX A;  3DK4 A;  5L46 A;  4H2N A;  2OLN A;  2YG5 A;  3EAO A;  3UOY A;  2RGH A;  2YLZ A;  4RG4 A;  2CVJ A;  2GVC A;  3DH9 A;  2HQM A;  2GMJ A;  3KU9 A;  4H2R A;  1KNP A;  3UOZ A;  1LVL A;  2Q7V A;  3B6D A;  3RHA A;  5JCN A;  3ALM A;  3BI5 A;  4J31 A;  3AEB A;  1D4E A;  2YM2 A;  2IVD A;  2GR3 A;  3GMB A;  4TM3 A;  2FJE A;  3G5R A;  3NT6 A;  4Z24 A;  3KD9 A;  4BV6 A;  1S2Y A;  4JQ9 A;  5CKU A;  1OJT A;  4DSH A;  2V3A A;  4RSL A;  3RNM A;  2XVE A;  3GD3 A;  4NEV A;  3NK0 X;  2BS3 A;  4U8L A;  5M0Z A;  1JNZ A;  1JU2 A;  4ZN0 A;  1BWC A;  1D7Y A;  1Q1R A;  2GR2 A;  3ABV A;  1H6V A;  2C67 A;  4HB9 A;  1EL5 A;  2X8C A;  3EF6 A;  1JRZ A;  1NEN A;  1Y56 B;  3AE5 A;  1F3P A;  2YLS A;  3AYJ A;  4U8P A;  1B4V A;  3CGD A;  2GV8 A;  3IF9 A;  4EM4 A;  1Z6L A;  3NTA A;  4ADW A;  2XFQ A;  1PJ7 A;  2WES A;  5J7X A;  4OPU A;  4PAA A;  1PHH A;  1JRY A;  1N1P A;  3G5S A;  5FMH A;  2RGO A;  4Z44 A;  1H7X A;  1RP0 A;  2XLS A;  4YSY A;  4A9W A;  1L9C A;  1O5W A;  4C5O A;  4EQW A;  4YXD A;  1TDK A;  2BK4 A;  1W4X A;  3R9U A;  1GSN A;  4B65 A;  4GDE A;  3CTY A;  4NEW A;  2V60 A;  1IUX A;  1MXT A;  2E5V A;  4A99 A;  1M64 A;  1GT8 A;  1ONF A;  1GRB A;  3ATR A;  1D4C A;  1FEA A;  4GDP A;  4CCR A;  2OAM A;  2BYB A;  1JEH A;  5JCL A;  2BCP A;  3NK1 X;  1RYI A;  3QVR A;  3AWI A;  2UZZ A;  1PBC A;  2XDO A;  4GCM A;  3G5Q A;  4H2Q A;  2WOW A;  1MOK A;  1DOD A;  2TPR A;  3D8X A;  3BNM A;  3AEG A;  1KNR A;  4Z43 A; 
#chains in the Genus database with same CATH topology
 3CNT A;  2ZZ0 A;  3ENL A;  3F8D A;  5KNL A;  3CND A;  1WUE A;  4FDC B;  4KPR A;  2AL2 A;  1RVK A;  2YG6 A;  2Y6R A;  4REK A;  1CBO A;  2P8B A;  4A3R A;  4CCQ A;  1GES A;  1NAA A;  3UKL A;  4EMW A;  1PS9 A;  3Q6J A;  2PTY A;  1N60 C;  5HHF A;  1CJ3 A;  3UP4 A;  4OPI A;  2ONE A;  2OLO A;  3BI2 A;  1NPX A;  4M6U A;  1IUW A;  3EKG A;  4YTP A;  2GF3 A;  2E1M A;  1XPY A;  4DNA A;  3A7A A;  3FYY A;  4Z17 A;  2ZC8 A;  1PJ5 A;  3NO1 A;  1E7P A;  4E5T A;  3V5C A;  1OJC A;  3N6H A;  3OZ2 A;  5J04 A;  3VDG A;  1K0I A;  1DTN A;  4ZOH B;  2GMH A;  3TCS A;  4X2P A;  4U8I A;  1FOH A;  5G5G B;  1B5Q A;  2XVJ A;  1E39 A;  3RGT A;  5KVH A;  6ENL A;  1VG9 A;  1QO8 A;  3VFC A;  2WDR A;  3ICT A;  3FPZ A;  3CN8 A;  1GRH A;  3B3R A;  4Z26 A;  3DEQ A;  1PBD A;  4NWZ A;  3PFR A;  2Q6U A;  4K2S A;  1EBD A;  3FMW A;  3BHF A;  2MUC A;  2H89 A;  3P9U A;  4EIP A;  3GYJ A;  4CY8 A;  3MSY A;  2C75 A;  2E4G A;  4TM4 A;  3T14 A;  3GO2 A;  2APG A;  4JN8 A;  3LJP A;  1KDG A;  3OW1 A;  5KMR A;  2WQY A;  3DGZ A;  4EM3 A;  2BC1 A;  2O9Z A;  3P4Q A;  3AN1 A;  3NGC X;  1NDA A;  5J60 A;  2FKP A;  3GDN A;  4HA6 A;  3AEE A;  2R9Z A;  4GIR A;  1GPE A;  4YTM A;  2F5Z A;  4IVO B;  2W3R A;  1H2I A;  4U8N A;  4CNJ A;  2GB0 A;  2PS2 A;  2RGJ A;  3NVW B;  2DKH A;  2POD A;  1F8R A;  3L1R A;  3AE1 A;  1N4W A;  2CDU A;  3UOX A;  2V61 A;  3I6D A;  3V76 A;  2C76 A;  3LXD A;  5KRQ A;  4AP3 A;  1TRB A;  3FBS A;  1NHQ A;  5ER0 A;  4EMI A;  2B9W A;  1JDF A;  3V3N A;  1NHS A;  4G6G A;  3ADA B;  2WPC A;  2XFU A;  1NEL A;  2GGE A;  1F9C A;  3STP A;  1KFY A;  1BQG A;  5U63 A;  5FS6 A;  4C74 A;  3V3W A;  4TLZ A;  4CBQ A;  3T0K A;  1PBE A;  1NEK A;  1MO9 A;  4FX9 A;  2XFN A;  3TJI A;  1ZK7 A;  2AR8 A;  3TQP A;  5KVI A;  4N9X A;  2VRM A;  3IJQ A;  2B9Y A;  2WP6 A;  1M6I A;  3QSM A;  1YQ4 A;  3KPK A;  3ZLH A;  1GRF A;  4DWD A;  3Q4D A;  1N4V A;  3DFH A;  4UDP A;  4IL0 A;  2JKC A;  4WX1 A;  3FIM B;  2QA2 A;  4Z2T A;  2BXS A;  5FJR A;  2ARD A;  4ICY A;  3GMC A;  4A6N A;  4XWZ A;  1IUT A;  4H4Z A;  3SYI A;  1ECQ A;  3LB8 A;  2Z5Y A;  4DN1 A;  1ZMD A;  2GR1 A;  3K7Q X;  2OQY A;  2W3S A;  1LJ1 A;  4F4R A;  3P4P A;  2YLW A;  3UTH A;  2GDQ A;  3UKP A;  2PU0 A;  2X8G A;  3AXB A;  1B37 A;  1CJ4 A;  1TDN A;  3SX6 A;  4G74 A;  2WU2 A;  3EUB 3;  3NYC A;  3VRA A;  2OLA A;  4A79 A;  5IQ1 A;  1R0M A;  3DIP A;  3OZY A;  4TM1 A;  4KPL A;  3T8Q A;  3E1T A;  3AE3 A;  2PHH A;  3UKQ A;  2CFY A;  3ICR A;  5HYM A;  1ZY8 A;  1QJD A;  3DFY A;  2YG4 A;  1OEP A;  2MNR A;  2BAC A;  1SEZ A;  1KD0 A;  4A6G A;  4ZCW A;  3UKH A;  2GL5 A;  4B66 A;  1ZMC A;  2GAG B;  2R46 A;  2W55 A;  5EB5 A;  2ZZC A;  1DOE A;  2DKI A;  3M13 A;  2BA9 A;  5FS9 A;  3VR8 A;  3LZX A;  2X50 A;  4U8J A;  1P2H A;  2YLX A;  2YG5 A;  4G73 A;  3UOY A;  3IK4 A;  2YLZ A;  3DDM A;  3BOX A;  4RG4 A;  3VCN A;  3DH9 A;  1FFU C;  2GMJ A;  3KU9 A;  3UOZ A;  1LVL A;  2Q7V A;  3RHA A;  4J1O A;  4J31 A;  3AEB A;  3QKE A;  3NXL A;  2YM2 A;  4HCD A;  1S2Y A;  3RNM A;  3GD3 A;  1JU2 A;  1BWC A;  1D7Y A;  1Q1R A;  2GR2 A;  3SN4 A;  2C67 A;  3EF6 A;  2X8C A;  1V97 A;  3ES7 A;  2GV8 A;  4DHG A;  4MKS A;  3NTA A;  2XFQ A;  2WES A;  3G5S A;  1JRY A;  2PSN A;  1RP0 A;  2P0I A;  2BK4 A;  3R9U A;  4B65 A;  4GDE A;  4NEW A;  3CTY A;  1IUX A;  1M64 A;  1FEA A;  2UZZ A;  3BNM A;  1TYP A;  3UCC A;  3P1W A;  3AEC A;  3T4W A;  4HPN A;  3OC4 A;  3AE2 A;  3UJR A;  4J33 A;  2YVF A;  1CC2 A;  1GTH A;  3OZM A;  4K22 A;  1JPM A;  1FEC A;  3HYW A;  1QLB A;  2PP1 A;  1BZL A;  1REO A;  3NFU A;  3T9P A;  1CC4 A;  1JRO A;  4H4V A;  4IZG A;  3UJS A;  1GTE A;  2VRL A;  3ETR B;  2WET A;  3AED A;  3N4F A;  1ZOV A;  2YAU A;  3QPE A;  4U8M A;  2HNE A;  2XCG A;  2AL1 A;  1S2Q A;  3TWB A;  3K7T A;  3NTD A;  1VQZ A;  3QFB A;  4GYP A;  2XLR A;  3QFA A;  3ZLG A;  4B64 A;  2BRA A;  2B7S A;  1WYG A;  3NRN A;  4UDQ A;  4B68 A;  3IWA A;  5BVA A;  3THU A;  1LQU A;  1H82 A;  3FG2 P;  1WUF A;  5KOX A;  1TZZ A;  4LU6 A;  1VQW A;  1F6M A;  4JN9 A;  1RM6 B;  1SJA A;  3M12 A;  3CPI G;  1CJ2 A;  3S5W A;  3FVD A;  1GOS A;  2VQ7 A;  3RP8 A;  4MJW A;  5KMP A;  3V4B A;  1XAN A;  2PPG A;  4K8D A;  4JNA A;  3DME A;  2BXR A;  2R0C A;  4APN A;  4A65 A;  2I0Z A;  2A87 A;  3RR1 A;  5G5H B;  2PTX A;  1JOA A;  1NHR A;  1Y0P A;  4U2S A;  1P2E A;  4J56 A;  1X2H A;  4YWO A;  2PGE A;  3ZDN A;  4I59 A;  1OJD A;  1TYT A;  1DOC A;  3GD6 A;  2EQ7 A;  2GEW A;  3PWI A;  1EL8 A;  4IVM B;  5HXI A;  3T6C A;  3DK9 A;  4ECH A;  3AYI A;  4HNL A;  4EQX A;  2PA6 A;  2YG7 A;  3AM9 A;  1GXF A;  4XWR A;  1DJN A;  4II2 A;  2Y6Q A;  3EPT A;  3RIT A;  4IA5 A;  1K4Q A;  3AEA A;  3UGV A;  3HRD C;  1JPD X;  2PP3 A;  3C4N A;  2GAH B;  4TM0 A;  3HW2 A;  3QJ4 A;  2P8C A;  1L9E A;  3GC2 A;  2WP5 A;  3AE7 A;  1D4D A;  5HY5 A;  1BGN A;  2E5A A;  1NU5 A;  1YQZ A;  4BK2 A;  2AAQ A;  1CL0 A;  2WBA A;  1YQ3 A;  3H70 A;  1P48 A;  3CB3 A;  1L8P A;  3NVZ B;  2A89 A;  3UCD A;  1TKK A;  4IHC A;  4LA1 A;  2V5Z A;  4FP1 A;  2QJJ A;  4B67 A;  4YTN A;  1GET A;  4E8G A;  2Q0L A;  3VQR A;  4OPT A;  4CY6 A;  4TVY A;  2C66 A;  5BOF A;  3LZW A;  1ONE A;  2A8X A;  2GGG A;  4OVI A;  1X31 B;  3FV9 A;  1E6E A;  1MUC A;  2GH5 A;  3SFE A;  1ZX9 A;  3O0H A;  3GYI A;  1OJ9 A;  1H83 A;  1DJQ A;  3UXK A;  3IHG A;  2X99 A;  2PU1 A;  3C96 A;  3QVP A;  3D46 A;  5CQF A;  4K1W A;  4M52 A;  2BAB A;  4GYP C;  1D5T A;  2BS4 A;  4PAB A;  4D03 A;  4IL2 A;  1NG4 A;  2GQW A;  4Y4L A;  1DNC A;  4O5U A;  5U25 A;  2V6O A;  2GGH A;  3WE0 A;  1FHU A;  2AL2 B;  3S5S A;  4B69 A;  1S7M A;  1K0L A;  1MRA A;  2YVJ A;  1Q9I A;  3D47 A;  1PN0 A;  4K5R A;  1H84 A;  1XS2 A;  3GWD A;  5EU9 A;  1GEU A;  1F8S A;  2X8H A;  3NVV B;  4USQ A;  2NQL A;  2PCE A;  3AD9 B;  1B8S A;  4G9K A;  1TDF A;  1ELI A;  2PMQ A;  1K0J A;  2PP0 A;  3H4K A;  1COY A;  1PXA A;  3IJI A;  1GV4 A;  1LPF A;  2RAB A;  3TW9 A;  3UJF A;  2YLR A;  3NK2 X;  4USR A;  3I6T A;  1H86 A;  3LAD A;  4GUV A;  3ZVI A;  3DGB A;  2EQ8 A;  2XH7 A;  2R45 A;  1PJ6 A;  5KOW A;  3V3O A;  1VDV A;  2BRY A;  3FCP A;  4B1B A;  1KKR A;  1NHP A;  4H4Y A;  1O94 A;  2WDV A;  3DK4 A;  5L46 A;  4H2N A;  1MDR A;  3OPS A;  2HQM A;  1KNP A;  3B6D A;  1D4E A;  2GGJ A;  2GR3 A;  2GSH A;  1OJT A;  4DSH A;  1R6W A;  1X2G A;  4NEV A;  3PK7 A;  3NK0 X;  2BS3 A;  5M0Z A;  1JNZ A;  4GME A;  3KUM A;  3RO6 A;  3ABV A;  1H6V A;  3RRA A;  1NEN A;  1F3P A;  3CGD A;  1FHV A;  3N6J A;  3T31 A;  3Q45 A;  4YSX A;  5FMH A;  2XLS A;  3UJE A;  3RCY A;  1O5W A;  1TDK A;  4ENL A;  2E5V A;  1ONF A;  1GRB A;  1D4C A;  2OAM A;  3NK1 X;  3IJL A;  3PWG A;  3V5F A;  2P88 A;  4H2Q A;  3AEG A;  1KNR A;  4GGH A;  3VC5 A;  3CK5 A;  4UP3 A;  3CGB A;  2FBW A;  3SZW A;  3HYV A;  2XLP A;  4H4T A;  1KF6 A;  4H4U A;  2OZT A;  3CPJ G;  2NVK X;  2OZ3 A;  3RED A;  1H7W A;  5BOE A;  3DJJ A;  3SQP A;  3UKA A;  4NTD A;  3PG6 A;  4DX3 A;  4BUR A;  1FO4 A;  3ALJ A;  2ACZ A;  2B7R A;  4JHM A;  4YKF A;  5FJT A;  2XGZ A;  1N5W C;  2PTW A;  3QSE A;  1GER A;  2C70 A;  3CT2 A;  3HPF A;  2YQU A;  3CAW A;  3NS1 B;  4OCG A;  4J3Z A;  5KWF A;  4AOS A;  1V59 A;  3NN6 X;  2AKM A;  1FL2 A;  3SN0 A;  4KWS A;  3SFD A;  2GR0 A;  2YR6 A;  5EB4 A;  4HYR A;  3QN3 A;  1W6T A;  3MWC A;  1GAL A;  2P3Z A;  3UKK A;  1KSU A;  4BJY A;  1SB3 B;  3BHK A;  2C3D A;  4B63 A;  2R4J A;  1GRT A;  3CXO A;  4AP1 A;  2B76 A;  3JVA A;  3NRZ B;  5ENL A;  1Y56 A;  3NNE A;  4JNQ A;  2QCU A;  4K2X A;  4JY3 A;  3AE4 A;  1ELS A;  2WP9 A;  4Y4M A;  3U9I A;  4KX6 A;  2PGW A;  3RP7 A;  3DGH A;  2YG3 A;  3GD4 A;  2WOV A;  4A6N B;  1IUV A;  3DA1 A;  4X4J A;  1ZXI C;  3II4 A;  3NN0 X;  5LV9 A;  3ITJ A;  2JB3 A;  2JAE A;  3ALL A;  2OX4 A;  3N4E A;  1E1M A;  4G8T A;  4H2H A;  3KVE A;  4GF7 A;  1BKW A;  4H4R A;  1PBB A;  3M0O A;  3ZYX A;  4CNK A;  4IP5 A;  4YSZ A;  2QGY A;  2BCG G;  1CHU A;  3A7R A;  5JRB A;  1VRQ B;  4Z2U A;  2WEU A;  3B9J B;  2DW7 A;  2CHR A;  2FJB A;  4OPL A;  4ZCC A;  5U1O A;  3L5O A;  4BJZ A;  1BF3 A;  1ZP0 A;  1YEY A;  3NYF A;  3OTR A;  4WCT A;  2BS2 A;  4H83 A;  4U2L A;  2GQF A;  4NTE A;  4IT1 A;  3UP5 A;  3UTE A;  4E4F A;  5KXJ A;  3CXB A;  1IJH A;  3T2Z A;  4GAV A;  4AOX A;  2POZ A;  2WS3 A;  4HCL A;  5FJP A;  1KSS A;  3R1Z A;  1HYU A;  2YLT A;  2BC0 A;  2OVL A;  3NH3 X;  3MY9 A;  4K5S A;  1LTX R;  2OQH A;  5IDZ A;  1S3B A;  3NKS A;  4J57 A;  3CNS A;  5JCM A;  3F8P A;  4Z2R A;  1Q1W A;  2CUL A;  2XVI A;  4C77 A;  3DK8 A;  1N5X A;  2FJA A;  1S3E A;  3AB1 A;  3VRB A;  2R0P A;  2WHD A;  3GY1 A;  5EBK A;  3MZN A;  1YKJ A;  4KT2 A;  4EWJ A;  4K7Z A;  4FK1 A;  1EC8 A;  4NTC A;  3GDP A;  5KMQ A;  3GRT A;  4HN8 A;  4KEM A;  2ZBW A;  3DJE A;  2C73 A;  4ZA0 A;  3UXL A;  3AEF A;  3EAN A;  1EBH A;  3CGE A;  1BKH A;  2Q0K A;  3CNP A;  2VOU A;  4EMJ A;  3BI4 A;  3QSS A;  5GSN A;  4H4S A;  3TOY A;  4GGB A;  4H2P A;  3BSM A;  3IHM A;  3UOV A;  4EIQ A;  1SJD A;  4H1Z A;  3SZC A;  2BK3 A;  2ZZB A;  4AT0 A;  2IVE A;  4JY2 A;  3ZVH B;  2OFJ A;  4DYE A;  4GRT A;  4YT0 A;  3K30 A;  4ROP A;  4A7A A;  4X9M A;  3CYJ A;  1L0V A;  4U8K A;  5KMS A;  1YY5 A;  4II3 A;  5IPY A;  3T2Y A;  2I5Q A;  2BK5 A;  4YKG A;  3AYL A;  3NG7 X;  2OA1 A;  2YR4 A;  1E1K A;  4NNJ A;  4ZCD A;  2OG9 A;  3SZF A;  2OLN A;  3EAO A;  2RGH A;  2CVJ A;  4M0X A;  4H2R A;  5JCN A;  1SJB A;  3ALM A;  3BI5 A;  1N62 C;  2IVD A;  4BV6 A;  3NT6 A;  3H8A A;  3G5R A;  4Z24 A;  3KD9 A;  4JQ9 A;  3P3B A;  5CKU A;  1T3Q C;  4DXK A;  2XVE A;  3TTE A;  2OKT A;  1EL5 A;  1JRZ A;  3DG6 A;  2YLS A;  3AYJ A;  1KKO A;  4U8P A;  4EM4 A;  1Z6L A;  4OPU A;  1PHH A;  3R11 A;  2RGO A;  4YSY A;  1H7X A;  4A9W A;  3K1G A;  1W4X A;  2ZAD A;  4H19 A;  2V60 A;  1MXT A;  3ATR A;  4CCR A;  2BYB A;  1JEH A;  5JCL A;  2QDE A;  1PBC A;  3G5Q A;  1MOK A;  3GYX A;  1GSN A;  3IC9 A;  3P93 A;  3MQT A;  3K7M X;  3R25 A;  3VC6 A;  1SJC A;  3DG3 A;  5JCK A;  3UJ2 A;  4OPG A;  3GSI A;  1EC9 A;  4I58 A;  1LV0 A;  2DW6 A;  3ATQ A;  4X9N A;  5EOW A;  3DG7 A;  1ZOY A;  3I6E A;  3NLC A;  5C2T A;  3NZG A;  2XLT A;  3U4F A;  3URH A;  2O56 A;  2XH2 A;  1XDI A;  1LQT A;  7ENL A;  3FJ4 A;  3SQS A;  3CIR A;  4U2T A;  4MMW A;  3UTF A;  2QDD A;  4FK1 C;  1NG3 A;  3UKF A;  3CNJ A;  2HXT A;  2JB1 A;  2R4E A;  1CC6 A;  1FCD A;  3R0U A;  2XLU A;  2FYM A;  3SM8 A;  2EQ6 A;  4OPC A;  2B9X A;  2W54 A;  1PDY A;  1UKV G;  5BUL A;  1PDH A;  3P4R A;  4E0V A;  2HXU A;  2C72 A;  2FJD A;  4HNC A;  2HZG A;  3A7U A;  2XYO A;  3LOV A;  4DSG A;  5BRT A;  4GAP A;  2OAL A;  3S61 A;  1XHC A;  3AE8 A;  1GRE A;  1JRP A;  2WU5 A;  1MNS A;  1TDO A;  1GRG A;  3RP6 A;  1XPQ A;  4TVW A;  3TWA A;  2PTZ A;  3JZU A;  3AMZ A;  3SXI A;  2X3N A;  1EBG A;  5FS8 A;  3DJD A;  4P9S A;  2PYX A;  3ISH A;  1AOG A;  3CPH G;  4A5L A;  4GFI A;  2WPF A;  4U8O A;  3BJS A;  1VG0 A;  3AD7 B;  1STZ A;  2EQ9 A;  2XFP A;  3D1C A;  3P4S A;  3JW7 A;  3NVY B;  4JDR A;  2JBV A;  2AQJ A;  1RSG A;  2XVH A;  4LII A;  3PO7 A;  2QQ6 A;  1N63 C;  4MGG A;  1N4U A;  3CGC A;  4EQS A;  4BK3 A;  4CRT A;  3KA7 A;  4J36 A;  2GRT A;  4IP4 A;  3I3L A;  3Q9T A;  2QJN A;  1ZDL A;  1H81 A;  3GRS A;  4H4Q A;  4C3X A;  4RG3 A;  2C64 A;  4EQR A;  2JK6 A;  5GRT A;  1FIQ B;  5C3J A;  2OZ8 A;  2VVL A;  4JN7 A;  2C7G A;  4AT2 A;  4E4U A;  3ES8 A;  2JB2 A;  2YM1 A;  3DJG X;  3JSK A;  5DBJ A;  4G7F A;  4GIS A;  2V3B A;  1VDC A;  4FI4 A;  5JCI A;  3UCL A;  3VRD B;  4TLX A;  3KPF A;  3SJN A;  3UTG A;  5M10 A;  1TE6 A;  2VVM A;  3SN1 A;  3EEZ A;  1CF3 A;  3VA8 A;  2RDX A;  1GND A;  3GWF A;  4G6H A;  3R07 C;  4D04 A;  3KLJ A;  1BGJ A;  2VZ2 A;  2H88 A;  3NYE A;  1JRX A;  2E3T A;  3H8L A;  2WDQ A;  1PXB A;  3C4A A;  3F8R A;  1CJC A;  1GRA A;  1F8W A;  3MUC A;  2QAE A;  3DER A;  3L8K A;  1E1L A;  3KKJ A;  3T37 A;  4UDR A;  4C3Y A;  4YSH A;  3SSZ A;  2IID A;  4YWS A;  3NHO X;  3COX A;  2QA1 A;  2WOI A;  2YR5 A;  3MKC A;  3AE9 A;  1FEB A;  4BK1 A;  3DES A;  4Y4N A;  2W0H A;  3ICS A;  4H4W A;  4IA6 A;  1TDE A;  2C3C A;  3VR9 A;  4H4P A;  1JCT A;  3SGL A;  5IQ4 A;  1IYX A;  2R0G A;  1KCZ A;  4H4X A;  1ZKQ A;  1PXC A;  1IUU A;  4J34 A;  4O5Q A;  1OJA A;  5FS7 A;  4IV9 A;  3BNU A;  3H8I A;  1JNR A;  1FFV C;  1DOB A;  3PVC A;  3S47 A;  2NPX A;  4XXG A;  3H12 A;  4NZH A;  4Z25 A;  3HYX A;  5BUK A;  3PS9 A;  3SR6 B;  1EL7 A;  3OP2 A;  2QVH A;  5TR3 A;  3HZL A;  4H7U A;  1DXL A;  2C65 A;  4J2W A;  3SZ0 A;  2QJM A;  2VVL G;  3R10 A;  1E1N A;  2J3N A;  1O95 A;  2XVF A;  3ZVH A;  2XSX A;  2Z5X A;  1PBF A;  4GR1 A;  1EL9 A;  1P43 A;  2XH4 A;  2YVG A;  2VQB A;  2YWL A;  1IUS A;  2XFO A;  5FJO A;  1L9D A;  4OPD A;  3QLD A;  3AD8 B;  3P0W A;  1D7L A;  3SBF A;  2OO6 A;  1PDZ A;  3NIX A;  2WPE A;  3AE6 A;  5FJU A;  4H50 A;  2XH0 A;  4DGK A;  2C4C A;  4A35 A;  2TMD A;  3VCC A;  2GVC A;  1E9I A;  3R0K A;  2AKZ A;  3SY4 A;  4Z1Y A;  3ZLF A;  3GMB A;  4TM3 A;  2FJE A;  1MDL A;  4E6M A;  3H7V A;  2V3A A;  4RSL A;  4U8L A;  1EC7 A;  1N61 C;  4ZN0 A;  4HB9 A;  1Y56 B;  3AE5 A;  1B4V A;  3IF9 A;  2OPJ A;  4ADW A;  3D9X A;  3TJ4 A;  1PJ7 A;  3B97 A;  5J7X A;  4PAA A;  1N1P A;  4Z44 A;  4HCH A;  3QTP A;  1L9C A;  3T2K A;  4C5O A;  4EQW A;  4YXD A;  3CMM A;  2GGI A;  3FXG A;  4A99 A;  1GT8 A;  4GDP A;  4K8G A;  3I4K A;  2BCP A;  1RYI A;  3QVR A;  3AWI A;  2XDO A;  4GCM A;  1KN0 A;  2WOW A;  2TPR A;  1DOD A;  3D8X A;  4Z43 A; 
#chains in the Genus database with same CATH homology
 3IC9 A;  3CNT A;  2ZZ0 A;  3P1W A;  3K7M X;  3F8D A;  4UP3 A;  5KNL A;  3CND A;  3AEC A;  4FDC B;  3CGB A;  4KPR A;  2FBW A;  3SZW A;  5JCK A;  3OC4 A;  3HYV A;  4OPG A;  3AE2 A;  3GSI A;  2XLP A;  4I58 A;  1LV0 A;  4H4T A;  2YG6 A;  3ATQ A;  1KF6 A;  2Y6R A;  4J33 A;  4H4U A;  4REK A;  2YVF A;  1ZOY A;  3NLC A;  5C2T A;  1CBO A;  2NVK X;  1CC2 A;  2XLT A;  3CPJ G;  4CCQ A;  3URH A;  1GES A;  3RED A;  1H7W A;  1NAA A;  3UKL A;  1XDI A;  3DJJ A;  4EMW A;  1GTH A;  3SQP A;  1LQT A;  1PS9 A;  4K22 A;  3UKA A;  3Q6J A;  4NTD A;  3PG6 A;  1FEC A;  3CIR A;  4BUR A;  4U2T A;  3ALJ A;  3HYW A;  3UTF A;  1QLB A;  5HHF A;  1CJ3 A;  2ACZ A;  4FK1 C;  1BZL A;  3UP4 A;  4OPI A;  2B7R A;  1NG3 A;  2OLO A;  4YKF A;  3BI2 A;  1NPX A;  1REO A;  1IUW A;  3UKF A;  4YTP A;  2GF3 A;  2E1M A;  1CC4 A;  3CNJ A;  4DNA A;  4H4V A;  2JB1 A;  3QSE A;  1GER A;  1GTE A;  2C70 A;  2R4E A;  1CC6 A;  1FCD A;  2VRL A;  2YQU A;  2XLU A;  4OCG A;  4YSX A;  1PJ5 A;  3SM8 A;  2WET A;  3AED A;  1E7P A;  5KWF A;  4AOS A;  2EQ6 A;  1V59 A;  1ZOV A;  4OPC A;  2YAU A;  3NN6 X;  2B9X A;  1OJC A;  4U8M A;  1UKV G;  5BUL A;  1PDH A;  2XCG A;  3P4R A;  1FL2 A;  4E0V A;  2C72 A;  3SFD A;  2GR0 A;  1S2Q A;  2FJD A;  2YR6 A;  3OZ2 A;  5EB4 A;  1K0I A;  3K7T A;  3NTD A;  2GMH A;  3QFB A;  2XYO A;  3LOV A;  4DSG A;  1GAL A;  3UKK A;  1KSU A;  4U8I A;  5BRT A;  4BJY A;  1FOH A;  2XLR A;  3QFA A;  4GAP A;  4B64 A;  2BRA A;  2B7S A;  3NRN A;  2OAL A;  4UDQ A;  3S61 A;  1XHC A;  1B5Q A;  3AE8 A;  4B68 A;  1GRE A;  3IWA A;  3BHK A;  2C3D A;  5BVA A;  2XVJ A;  1LQU A;  2WU5 A;  1H82 A;  1TDO A;  4B63 A;  1E39 A;  2R4J A;  5KVH A;  1GRG A;  1GRT A;  3RP6 A;  1VG9 A;  1QO8 A;  2WDR A;  3FG2 P;  5EOW A;  5KOX A;  4AP1 A;  1XPQ A;  4X9N A;  3ICT A;  3FPZ A;  3CN8 A;  1GRH A;  2B76 A;  3B3R A;  3SXI A;  4LU6 A;  1VQW A;  1F6M A;  4JN9 A;  1Y56 A;  2X3N A;  5FS8 A;  3NNE A;  4JNQ A;  4Z26 A;  3DJD A;  4P9S A;  2PYX A;  2QCU A;  4K2X A;  1PBD A;  3M12 A;  3ISH A;  4NWZ A;  4JY3 A;  3CPI G;  1CJ2 A;  1AOG A;  2Q6U A;  3CPH G;  3S5W A;  4A5L A;  2WPF A;  4U8O A;  1GOS A;  1VG0 A;  1EBD A;  3FMW A;  3BHF A;  3AD7 B;  3AE4 A;  2EQ9 A;  2XFP A;  2VQ7 A;  3D1C A;  2H89 A;  3P4S A;  2WP9 A;  3RP8 A;  4MJW A;  5KMP A;  4Y4M A;  3P9U A;  4KX6 A;  4JDR A;  4EIP A;  1XAN A;  3RP7 A;  4K8D A;  4JNA A;  3DME A;  2BXR A;  2JBV A;  3DGH A;  4APN A;  2R0C A;  2YG3 A;  3GD4 A;  3GYJ A;  4CY8 A;  2AQJ A;  4A65 A;  1RSG A;  2I0Z A;  2A87 A;  2XVH A;  2WOV A;  2C75 A;  4LII A;  2E4G A;  3PO7 A;  4TM4 A;  4A6N B;  1IUV A;  1JOA A;  1NHR A;  3T14 A;  3DA1 A;  4X4J A;  1Y0P A;  2APG A;  3II4 A;  4U2S A;  1P2E A;  4J56 A;  1N4U A;  4YWO A;  3LJP A;  3NN0 X;  5LV9 A;  3CGC A;  1KDG A;  3ZDN A;  4I59 A;  1OJD A;  1TYT A;  4EQS A;  3ITJ A;  4BK3 A;  2JB3 A;  4CRT A;  3KA7 A;  1DOC A;  2JAE A;  5KMR A;  3ALL A;  4J36 A;  2GRT A;  1E1M A;  2EQ7 A;  2WQY A;  3DGZ A;  1EL8 A;  2GEW A;  4EM3 A;  4IVM B;  2BC1 A;  3I3L A;  3KVE A;  3Q9T A;  4GF7 A;  5HXI A;  2O9Z A;  3P4Q A;  1BKW A;  1ZDL A;  4H4R A;  1H81 A;  3GRS A;  3NGC X;  1NDA A;  4H4Q A;  1PBB A;  3M0O A;  3ZYX A;  4CNK A;  3DK9 A;  5J60 A;  4C3X A;  3AYI A;  4ECH A;  4EQX A;  4YSZ A;  3GDN A;  4RG3 A;  2C64 A;  4EQR A;  2BCG G;  2JK6 A;  4HA6 A;  5GRT A;  2YG7 A;  3AEE A;  2R9Z A;  5C3J A;  1GXF A;  1CHU A;  4XWR A;  5JRB A;  1VRQ B;  4Z2U A;  1DJN A;  4II2 A;  2WEU A;  2Y6Q A;  3EPT A;  1GPE A;  2FJB A;  4OPL A;  2VVL A;  4IA5 A;  4ZCC A;  1K4Q A;  3AEA A;  4YTM A;  2C7G A;  3VR8 A;  2F5Z A;  5U1O A;  2YM1 A;  2JB2 A;  4IVO B;  4AT2 A;  3DJG X;  3L5O A;  4BJZ A;  3C4N A;  1BF3 A;  3JSK A;  1ZP0 A;  5DBJ A;  1H2I A;  1VDC A;  2V3B A;  2GAH B;  4TM0 A;  4U8N A;  4CNJ A;  2GB0 A;  3QJ4 A;  5JCI A;  2RGJ A;  3NYF A;  3UCL A;  1L9E A;  4TLX A;  2BS2 A;  4WCT A;  3VRD B;  4U2L A;  2WP5 A;  2GQF A;  3AE7 A;  2DKH A;  3KPF A;  3UTG A;  5M10 A;  1F8R A;  2VVM A;  3L1R A;  4NTE A;  1D4D A;  1N4W A;  3AE1 A;  2CDU A;  3UP5 A;  3UOX A;  2V61 A;  3UTE A;  3I6D A;  3V76 A;  5HY5 A;  1CF3 A;  3LXD A;  2C76 A;  1BGN A;  1GND A;  3GWF A;  4G6H A;  4AP3 A;  1TRB A;  3FBS A;  5KRQ A;  5KXJ A;  1NHQ A;  1IJH A;  1YQZ A;  5ER0 A;  3T2Z A;  4BK2 A;  4EMI A;  4GAV A;  2AAQ A;  1CL0 A;  2WBA A;  1YQ3 A;  4D04 A;  3KLJ A;  1BGJ A;  2VZ2 A;  2B9W A;  2H88 A;  3NYE A;  1JRX A;  3V3N A;  4AOX A;  2WS3 A;  2A89 A;  1NHS A;  4G6G A;  3ADA B;  3H8L A;  2WPC A;  1KFY A;  1KSS A;  2XFU A;  2WDQ A;  1PXB A;  3C4A A;  4LA1 A;  2V5Z A;  5U63 A;  4B67 A;  5FS6 A;  1HYU A;  2YLT A;  3F8R A;  4C74 A;  2BC0 A;  1CJC A;  1GRA A;  4TLZ A;  1F8W A;  4CBQ A;  3T0K A;  4YTN A;  1GET A;  3NH3 X;  2QAE A;  3L8K A;  1PBE A;  4K5S A;  1LTX R;  1E1L A;  1NEK A;  3KKJ A;  3T37 A;  4UDR A;  1MO9 A;  1S3B A;  3NKS A;  2Q0L A;  3VQR A;  4C3Y A;  4YSH A;  4OPT A;  4FX9 A;  2XFN A;  4CY6 A;  4J57 A;  3CNS A;  2C66 A;  1ZK7 A;  2AR8 A;  5JCM A;  3F8P A;  5KVI A;  1Q1W A;  4N9X A;  4Z2R A;  2IID A;  2CUL A;  2VRM A;  2XVI A;  3LZW A;  3NHO X;  4C77 A;  3DK8 A;  2FJA A;  2A8X A;  1S3E A;  3AB1 A;  3COX A;  2B9Y A;  3VRB A;  4OVI A;  2WP6 A;  2R0P A;  1X31 B;  2WHD A;  1M6I A;  2QA1 A;  1YQ4 A;  3QSM A;  2WOI A;  1E6E A;  2YR5 A;  3KPK A;  2GH5 A;  3SFE A;  1ZX9 A;  1GRF A;  5EBK A;  3AE9 A;  1FEB A;  3O0H A;  1N4V A;  4BK1 A;  3GYI A;  1OJ9 A;  1YKJ A;  4UDP A;  2JKC A;  4K7Z A;  4FK1 A;  4WX1 A;  1H83 A;  4Y4N A;  2W0H A;  3ICS A;  4H4W A;  4IA6 A;  4NTC A;  1DJQ A;  1TDE A;  3FIM B;  3GDP A;  5KMQ A;  3IHG A;  2X99 A;  2QA2 A;  2C3C A;  2BXS A;  3VR9 A;  3C96 A;  4Z2T A;  3GRT A;  3QVP A;  5CQF A;  4H4P A;  2ARD A;  4ICY A;  3GMC A;  3SGL A;  5IQ4 A;  2R0G A;  4H4X A;  1ZKQ A;  4A6N A;  4XWZ A;  1PXC A;  1IUU A;  4M52 A;  1IUT A;  1TYP A;  4H4Z A;  2ZBW A;  2BAB A;  4J34 A;  4O5Q A;  1OJA A;  3SYI A;  3LB8 A;  1D5T A;  2Z5Y A;  2BS4 A;  2C73 A;  3DJE A;  4PAB A;  1ZMD A;  4D03 A;  3AEF A;  2GR1 A;  5FS7 A;  3K7Q X;  1NG4 A;  4IV9 A;  3EAN A;  3CGE A;  3BNU A;  2Q0K A;  1LJ1 A;  2GQW A;  4Y4L A;  1DNC A;  3H8I A;  3CNP A;  2VOU A;  4EMJ A;  4O5U A;  1JNR A;  3P4P A;  5U25 A;  1DOB A;  2YLW A;  3UTH A;  2V6O A;  3BI4 A;  3QSS A;  3PVC A;  5GSN A;  4H4S A;  3WE0 A;  2NPX A;  4XXG A;  4NZH A;  3UKP A;  4H2P A;  4B69 A;  3HYX A;  4Z25 A;  2X8G A;  1S7M A;  1K0L A;  3IHM A;  5BUK A;  3AXB A;  3PS9 A;  1B37 A;  1CJ4 A;  2YVJ A;  1Q9I A;  1TDN A;  1PN0 A;  4K5R A;  3UOV A;  1EL7 A;  4EIQ A;  1H84 A;  3GWD A;  3SX6 A;  1GEU A;  5TR3 A;  1F8S A;  2X8H A;  3HZL A;  4G74 A;  4H7U A;  4USQ A;  2BK3 A;  3SZC A;  2ZZB A;  1DXL A;  2C65 A;  2WU2 A;  4AT0 A;  4J2W A;  2IVE A;  3SZ0 A;  2VVL G;  4JY2 A;  3NYC A;  1E1N A;  3AD9 B;  2J3N A;  1B8S A;  1O95 A;  4G9K A;  3VRA A;  2XVF A;  1TDF A;  4A79 A;  4GRT A;  1ELI A;  1K0J A;  5IQ1 A;  4TM1 A;  3H4K A;  1COY A;  2Z5X A;  1PBF A;  3E1T A;  4GR1 A;  1EL9 A;  1PXA A;  2PHH A;  3AE3 A;  3UKQ A;  4YT0 A;  3K30 A;  2CFY A;  3ICR A;  1GV4 A;  1LPF A;  2RAB A;  4A7A A;  4X9M A;  2YVG A;  5HYM A;  1ZY8 A;  1QJD A;  2VQB A;  1IUS A;  2YWL A;  1L0V A;  4U8K A;  2XFO A;  5KMS A;  1YY5 A;  2YLR A;  4II3 A;  1L9D A;  5IPY A;  2YG4 A;  3NK2 X;  4OPD A;  4USR A;  1H86 A;  3T2Y A;  2BAC A;  3LAD A;  1SEZ A;  3AD8 B;  4GUV A;  2BK5 A;  1D7L A;  3NIX A;  2EQ8 A;  2WPE A;  3AE6 A;  4YKG A;  2R45 A;  3UKH A;  3AYL A;  1PJ6 A;  4B66 A;  1ZMC A;  2GAG B;  3NG7 X;  4H50 A;  2R46 A;  5KOW A;  5EB5 A;  3V3O A;  2ZZC A;  2OA1 A;  1DOE A;  2BRY A;  2YR4 A;  4DGK A;  2DKI A;  4B1B A;  2C4C A;  1E1K A;  3M13 A;  2BA9 A;  5FS9 A;  2TMD A;  3LZX A;  2X50 A;  4NNJ A;  4U8J A;  1P2H A;  1NHP A;  4H4Y A;  4ZCD A;  1O94 A;  2WDV A;  3DK4 A;  2YLX A;  3SZF A;  5L46 A;  4H2N A;  2OLN A;  3EAO A;  2YG5 A;  4G73 A;  3UOY A;  2RGH A;  2YLZ A;  4RG4 A;  2CVJ A;  2GVC A;  3DH9 A;  2HQM A;  2GMJ A;  3KU9 A;  4H2R A;  1KNP A;  5JCN A;  1LVL A;  2Q7V A;  3B6D A;  3RHA A;  3UOZ A;  3ALM A;  3BI5 A;  4J31 A;  3AEB A;  1D4E A;  3SY4 A;  2YM2 A;  2IVD A;  2GR3 A;  4BV6 A;  3GMB A;  2FJE A;  3G5R A;  3NT6 A;  4TM3 A;  3KD9 A;  4Z24 A;  1S2Y A;  4JQ9 A;  5CKU A;  1OJT A;  4DSH A;  2V3A A;  4RSL A;  3RNM A;  3GD3 A;  4NEV A;  2XVE A;  3NK0 X;  2BS3 A;  4U8L A;  5M0Z A;  1JNZ A;  1JU2 A;  4ZN0 A;  1D7Y A;  1BWC A;  1Q1R A;  2GR2 A;  3ABV A;  1H6V A;  2C67 A;  4HB9 A;  3EF6 A;  2X8C A;  1EL5 A;  1JRZ A;  1NEN A;  1Y56 B;  3AE5 A;  1F3P A;  2YLS A;  3AYJ A;  4U8P A;  3CGD A;  1B4V A;  2GV8 A;  3IF9 A;  4EM4 A;  1Z6L A;  3NTA A;  4ADW A;  3D9X A;  2XFQ A;  1PJ7 A;  3T31 A;  2WES A;  5J7X A;  4OPU A;  4PAA A;  1PHH A;  1JRY A;  1N1P A;  5FMH A;  3G5S A;  2RGO A;  4Z44 A;  1H7X A;  1RP0 A;  2XLS A;  4YSY A;  4A9W A;  1L9C A;  1O5W A;  3T2K A;  4C5O A;  4EQW A;  4YXD A;  1TDK A;  2BK4 A;  1W4X A;  3R9U A;  1GSN A;  4B65 A;  3CMM A;  4GDE A;  4NEW A;  3CTY A;  2V60 A;  1IUX A;  1MXT A;  2E5V A;  4A99 A;  1M64 A;  1GT8 A;  1ONF A;  1GRB A;  3ATR A;  1D4C A;  1FEA A;  4GDP A;  4CCR A;  2OAM A;  2BYB A;  1JEH A;  5JCL A;  2BCP A;  3NK1 X;  1RYI A;  3QVR A;  3AWI A;  2UZZ A;  1PBC A;  2XDO A;  4GCM A;  1KN0 A;  3G5Q A;  4H2Q A;  2WOW A;  1MOK A;  2TPR A;  1DOD A;  3D8X A;  3GYX A;  3BNM A;  3AEG A;  1KNR A;  4Z43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...