2V3SA

Structural insights into the recognition of substrates and activators by the osr1 kinase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE OSR1
publication title Structural Insights Into the Recognition of Substrates and Activators by the Osr1 Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2v3sA00
3T9LA 3PHWB 3RYTA 1TGZB 1WXAA 3O65B 2N9PC 2L00B 4MGKE 3R7QA 1ZW7A 3SDLC 3VHTC 1P3QU 2YVCA 4FJYA 4M0WB 1Z5SB 1WGRA 3EHVA 2DZJA 3CF6E 3M62B 3CMMB 4DHZB 1C3TA 3L17A 4W9LA 2G4DB 4I6PA 4KIKA 2CHWA 2CU1A 3QK0A 1EF1A 2KANA 3LDZE 4WWNA 4HPMB 3B0AA 4TUUA 3U7DA 4HK2A 2KXJA 2KFKA 2L05A 4EOYA 1SGHA 2M8SA 3IBEA 4MSMB 4ANVA 2K25A 4NNJB 1E7UA 3M3JA 1WJUA 2L76A 4GGQA 1M94A 4OVUA 3V61A 4G0NB 2LASA 3VH4B 5JH5C 2LXCA 3IHPC 1IYFA 4DHJB 2LUEA 5J18A 2KJHB 3APCA 2HE7A 4HWIB 4NPNA 2KTRB 3U8ZA 3RT3B 4IUMB 1WJ6A 4MM3A 4DDID 2NCNA 1WF9A 2KK8A 2BYFA 2BGFA 1Q1OA 2FCSA 3PPAA 4MGIE 3KYDD 4CO7A 1G6JA 2IBIB 2IZVB 1WMHA 1NI2A 2EMTA 2KFJA 1D3ZA 3QAQA 4PS3A 1KLVA 3PTFC 2WX1A 1YIWA 2MQJA 1TZ1A 2MWSB 4FN2A 2MBQA 3RUIB 3CSFA 5D2MB 2DX5B 3N32A 2MSED 4GDLA 3VH3B 4AUQC 2KKCA 4I6LB 4DK5A 4BKSA 4IW0A 4K7WA 4ZDVA 1WR1A 2WYQA 4IG7B 1OGWA 2IO2B 3UIPB 1ISNA 5C1ZA 5D6JB 3TIXA 1TBEA 3VUYA 4CHKA 4MGYE 3LJ3A 3TL5A 2J0JA 3BY4B 1CMXB 3ZDTA 4MEMA 4AJYB 4B9KA 3QX1A 3H7PB 4IC7B 3PT2B 1KM7A 2O6VD 4WJQA 2GOWA 4M8MA 2LJ5A 2MW5A 5FR6A 4E71A 4IM3A 2KO3A 2LWPA 1ZKHA 2REXA 3M63B 2KC2A 3ZUNA 1OEYA 3SHQA 4KSLC 5IA7A 3RULA 4JIOU 3A4SC 4MJSA 3ZW3A 5BO4B 3EC8A 2JVCA 3PREA 4W9GA 3V60A 2OOBB 4J6IA 4WQOB 1J8CA 3WAOA 3L54A 1R4MI 2M1MA 1P98A 3NHEB 4PS7A 2JWZA 4AWJA 3A33B 1LM8B 3W1SC 4DBGA 4DDGD 4JQWC 1XD3B 2M0XA 2BPSA 2KHWB 2L0FA 4XX5A 1BT0A 3RCZA 3W1SA 3UQBA 2CKHB 2MBHA 2NR2A 4GDKB 4WWPA 4MSQB 2LVOA 3WIMA 3ML9A 1H8CA 4DXAB 4KDLB 4FHKA 2DZMA 3VTWA 1GJZA 2GBMA 1WIAA 5L95C 4BBNC 3AXCA 3KH0A 3VTVA 4EZLA 5EDSA 3V6EB 3PGEA 4M8NA 4HVBA 3NOBA 3HM6X 1WX7A 1E5WA 2ZVOA 1JRUA 4JL9A 1UH6A 3A9KA 2M17A 2Y5BB 3KUDB 1GG3A 2KOXA 2KX3A 4KZ0A 2W9NA 4BFRA 3A9JA 2KVRA 5LXHA 4LCDE 4K7SA 2D3GA 3ZDMC 3ZKJC 3H1UA 1S1QB 1J19A 4TQ1A 3TBLD 3Q3JA 3WALA 2HJ8A 4NY0A 4MELA 3VUWA 1V9JA 2D07B 3QJZA 4WAAA 1YJ1A 1OEYJ 4GN1A 2K6QA 1EF5A 1WX9A 2MP2A 2PEAA 2NPTA 4BKGA 2JXXA 1UGMA 2Z59B 1XT9B 2J0MA 1WE6A 1KJTA 3ZRFA 3AU4A 3NY5A 3L16A 2DAFA 1I42A 2XK5B 1YX6B 1E8XA 4FULA 2GBRA 4IWQA 2KWUB 3P2BA 1UD7A 1WH3A 5AZGA 1WGHA 2G45B 2KLCA 1E8YA 4ANWA 3JW0X 2NBWB 5J17A 3R66C 2NBVB 2ZNVB 2FCQA 3QA8A 2LXAA 3QQ8B 1SIFA 2WDTB 2GBKA 3UINB 2ZVNA 2MRPA 4W9EA 4GOCA 1Z2MA 3IFWB 3MHSD 2N9XA 3DVNU 3PRMB 1V2YA 4OVVA 4E74A 4BKSD 3EFUA 4EKUA 5CX3A 4F7ZA 2K8CA 5JHAA 1LFDA 1RLFA 2KD0A 4IWPA 4KV2A 3TCAA 3VAWA 2MP2B 4II3B 2NPTB 3R7RA 3W1YA 4URKA 3PHXB 5J2RA 1GC7A 2I1KA 4RM8A 3KVFB 2B3AA 2AWTA 4W9JA 2C7NB 2RD0A 4FJVB 5CTRC 3BINA 2GBNA 2IY0B 2JT4B 2KQ7A 4GIVA 4E3CA 2AYOB 4KIKB 4YL8A 5KHQA 2RR9A 3RD2A 4CYEA 2JF5A 4NJ7A 2NVUI 3APDA 3R3MA 3N30A 2C7MB 1UZXB 3HK0A 2K1FA 2KFKB 4HDQA 2MCNB 2FCMA 5D94A 1GUAB 3APFA 3DVNV 1WY8A 3OJ3A 4FADA 3VFKA 2WX0A 1WI0A 3SD5A 2C5LC 2DYOA 2KTFA 3HIZA 4NQKE 5JZEB 2KDFB 4WJOA 2PJHA 2O2VA 1WZ3A 1WX8A 1WZ0A 1RAXA 2JRHA 5DPWA 4HLEA 4ANXA 2D11A 3KW5B 1WE7A 3VVWB 3NS8A 2N1VA 3EECA 1LXDA 3ZLZA 1EO6A 5E6NA 1WMHB 2MA9B 2LGYA 5DPRA 1H4RA 2N7DA 3GZNI 3NZSA 4ZRIA 3WAMA 4FA6A 4N9F4 2IYDB 2Z0DB 1EUVB 2KQSA 5AZHA 5C23A 1I35A 4GDLB 3HHMA 2FIFA 2RGFA 3OLMD 2DAJA 3QARA 4B6WA 1LQBA 3RZFA 4W9FA 1OTRB 3N3KB 3TJPA 4A3OA 3DBRI 2MX2A 2PE9A 3L13A 4GB9A 3ZRCA 4WWOA 2RSUA 2AEHA 3QIJA 2NS5A 2BF8B 4GMVA 3UIOB 3UQAA 2KDEB 2LGDA 2M4NA 3K9OB 2BKFA 2DYMA 3JSVA 2KMAA 2JZZA 2CHZA 5CHVC 3ENEA 1V5OA 4BBNF 5GMVA 3DVGY 2C7HA 4FJZA 2VRRB 4PYZA 2DZIA 3DVGX 2PPHA 4B95A 1S3SG 1WR6E 4K81A 3OAWA 4MJSB 2V1YA 2ASQA 3DBHI 2O6VA 4PS8A 2G3QB 3ZTCA 1IPGA 4X57B 1YD8U 3VUXA 3ML8A 3Q3FA 4FHJA 3GOEA 1WFYA 5IAAC 2IY1B 3KUZA 4WJNA 4WJPA 1WXMA 2UYZB 4IWOA 2FAZA 3ZTDA 3ZIMA 2R2QA 2LVPA 4MH0E 4HJKA 2DYBA 2MBOA 5AEKB 1F9JA 1YX5B 4HCPB 2K8BA 3L10B 3PV1A 4II2B 2ZZPB 3VDZA 3PLVA 4XZ4A 4K7UA 4GSWA 1GNUA 2D10A 3DBLI 2N4FA 3CSTA 3DBSA 3S2AA 3AULA 3K9PB 1WXSA 3IVFA 4EEWA 1YQBA 2BWES 2IO0B 3A9KB 2JPHA 4BKTA 3I3TB 2KTRA 3L08A 5LLIA 4AJWA 1UELA 3ZNZB 2K6DB 4ICUA 3A9JB 2KDIA 4HXDA 5DPSA 2DHZA 3AI5A 1XQQA 1E7VA 4HDOA 1WJNA 2LGXA 2LZ6A 2KLGA 3IG3A 2J0KA 5L83A 2FCNA 4MGZE 1VCBA 2KJRA 2KWVB 1NDDA 1WM3A 4PYUA 2V4LA 4LJOB 1R4NI 2XBBC 2ZJDA 2FNJB 3QWZB 2BWFA 4KDIC 3ALBA 1WXVA 1FXTB 4FLHA 3ZNHB 4EZJA 3B08A 2C9WB 4HCNB 4IM2A 2LVQA 1RRBA 1X1MA 1UBIA 3MTNB 3UGBB 2LI5A 1RFAA 1A5RA 1V80A 4NAWA 5E6PA 2GBJA 2KNBA 4TV3A 2HTHA 2JY6A 5E6OA 4W9CA 3TMPB 3V6CB 1V49A 3DDCB 3PZDA 3B1LX 1PQSA 2BYVE 3H7PA 4G11A 4FBJB 2A4ZA 2FUHB 5G55A 4ANUA 3M95A 2K39A 1V86A 4F8CB 4W9DA 3A1QA 3QC8B 4W9IA 5AZFA 5KHOA 3QCAA 1C1YB 2L3ZA 2AL3A 4HPLB 3VXWA 2JZ3B 2KWCA 1WRDB 2KX0A 4GU2A 3WAPA 4G50A 4KZCA 3PS6A 2KDBA 3PSEB 4JGHB 2DZKA 4ZRKA 4KSKC 2CR5A 4KVGB 3ZNID 2NBUA 1V5TA 4ICVA 4MDKE 2FIDA 2XEWA 4JLCA 5CHFA 4ZRJA 3ZNGC 1E8ZA 3DPDA 2K8HA 3PRPB 4GXBA 1WM2A 1AARA 2RPQA 5TR5A 4ASWC 3HM3A 3X0WA 1K8RB 3DCGA 2JRIB 4K1RB 1WGYA 4NAWB 2EMSA 5D7GA 3ECIA 3L0WB 4DHZE 1U4AA 3H9DA 4GDKA 4LDTB 4XC2A 1SE9A 1E8WA 5G2NA 3T8MA 4BOZB 3H6NA 2KMCA 1ZGUB 2ZPNA 1WYWB 1TTNA 2N9EB 2MBBB 2KZRA 2N1WA 5HKHA 5LXIB 2QHOA 3D32A 1T0YA 4A3PA 3A1QB 4F1SA 5JHBA 1QZEA 2HD5B 2J7QB 3ZO5B 3VQIA 5CHWA 2L7RA 1P1AA 3WA0A 1Y8RC 3JYUA 1P0RA 3QHTA 2JUOA 3NZUA 3U30A 2WWZA 1V81A 4NJ6A 4EFOA 2O2VB 4DWFA 4RMAA 1WGDA 1L7YA 1MG8A 4LJPB 4BVUC 4EUTA 1P9DU 2GMIC 2IO3B 4BOSC 2LRUA 2CHXA 2IO1B 3JVZX 3VTUA 2BYEA 3C0RB 5DCNA 2Z0EB 2MBEA 4AOFA 2PE6B 3X23A 2ZPYA 3AU5A 4IM0A 2V3SA 2ZCCA 4G3XB 4AP4C 4EZKA 3DOWA 4W9HA 3DQVA 4A20A 4TQ0A 2C60A 4NQLB 3H7SA 4DHJD 3WANA 2MLBA 3ZVVA 1Q5WB 3SU8X 2R2OA 4P7IA 1HE8A 3UF8A 1UBQA 2XK5A 3PLUA 2LRWA 2EKEC 2LD9A 1L2NA 3V62A 1V6EA 3MJWA 2KN5A 2OJRA 2ZNVC 1J0GA 1OQYA 3PVLA 3KUCB 1GC6A 2YLMA 3PRZA 5DPTA 1WGGA 1Q0WB 1WJ4A 2CS4A 1NBFC 3JSVB 4TKNA 2L8JA 4I6NB 2UWQA 1VD2A 2ZCBA 4RM9A 2I1JA 2KC1A 2A5UA 2AL6A 1E90A 4ZYNA 2ZEQA 3ONSA 2D2QA 2KJ6A 1KOTA 2G4SA 3A4RA 4LDTD 2N7EA 4W9KA 1IP9A 2BKRB 2DENB 3RZWC 2L0TA 2O6VB 3OJ4B 3KYCD
chains in the Genus database with same CATH superfamily
4MGKE 1P3QU 1T0SC 4XWWA 3CF6E 3VR8B 3M62B 3W2DA 3CMMB 3L17A 2G4DB 4I6PA 4RFBA 2CU1A 3QK0A 1JWBD 3FILA 4WWNA 3U7DA 2KFKA 4JX1C 3IBEA 1ZOYB 2L76A 1WRIA 1ET9A 3AE2B 4G0NB 3DBRB 3DHIC 3APCA 4HWIB 2M56B 1TS4A 2XNAC 4MM3A 4DDID 2KK8A 5E6JA 2BGFA 2FCSA 2BT6A 2PVGC 3KYDD 4CO7A 1G6JA 2IZVB 1WMHA 2EMTA 1MFWA 4DXGA 4S0RA 4FN2A 1JW9D 5D2MB 2H89B 3VH3B 3DBHB 1N6ZA 1NENB 5FKAC 4I6LB 2CJOA 2DBYA 2WYQA 4IG7B 2RPVA 3UIPB 1ISNA 5C1ZA 3TIXA 1TBEA 3GE3C 3LJ3A 2J0JA 1CMXB 4B9KA 1IUEA 1UGJA 3QX1A 4IC7B 4WJQA 3PT2B 2O6VD 2WXHA 4M8MA 2TSSA 4IM3A 1E6EB 1F2RI 3M63B 3ZUNA 2KDMA 1AW7A 5AUIA 4JIOU 1MHXA 3A4SC 1EM7A 3ZW3A 4OVZA 2JVCA 4ITKA 3V60A 3NHEB 3U4EG 1LM8B 3W1SC 4DDGD 2L0FA 1BT0A 3RCZA 2CKHB 4WWPA 1L4ZB 4DXAB 4KDLB 2LJIA 2GBMA 2IGGA 1WIAA 5L95C 1TS5A 2LGIA 3AV8A 2ZVOA 2OJWA 4JL9A 3MFGA 1UH6A 2M17A 2NMQA 2WU5B 4M02A 5G5HA 2D3GA 2J42A 3ZKJC 1J19A 2JQRB 3TBLD 1DYQA 4NY0A 1V9JA 3QJZA 2Y3AA 4GN1A 1AN8A 1EF5A 1WE6A 1DOXA 1KJTA 2DAFA 4IWQA 1C78A 2KWUB 1KTKA 4WAFA 3AMZA 2LXAA 2GBKA 2FBWB 3UINB 3BWUD 5FK9C 4F7ZA 2RDBC 3P4RB 2K8CA 1LFDA 2NPTB 5J2RA 3PHXB 1FMAD 1D6EC 4WWMA 1MG4A 3KVFB 1E9MA 2C7NB 3BINA 2GBNA 3TEYA 2KQ7A 4AS1A 4E3CA 2AYOB 1D5ZC 1QKZA 4NJ7A 3FILB 2X8XX 3RMKC 2FE8A 4KGRA 3HK0A 2KFKB 4HDQA 2MCNB 2FCMA 1GUAB 1YQ4B 3ZJUA 3VFKA 2C5LC 3HIZA 4NQKE 5EE0A 4O1NA 2KDFB 2HDEA 2O2VA 1C76A 1M4VA 1WX8A 1HZ6A 4HLEA 4RNAA 2D11A 1WE7A 3ZLZA 3RNCC 1WMHB 4ZYSA 5DPRA 4ZRIA 4N9F4 1SXTA 1EUVB 5AZHA 4RGMA 4US8A 1C4CA 4B6WA 3RZFA 1PFDA 3T3OA 1OTRB 4OZCA 2MX2A 4QAYA 1L6VA 2WXOA 2BF8B 1IGDA 3K9OB 2KN4A 2KMAA 1CJEA 3ENEA 1YQ3B 4YXDB 3KLSX 2Y5CA 2BQQA 3AH7A 5BYQA 2ASQA 4PS8A 4L1BA 1F2RC 3VUXA 4JE3B 1ZXIA 4M0WA 2UYZB 1XLOA 4IWOA 3P63A 1WYGA 2X38A 4B0MA 3MJ5A 1YX5B 4HCPB 2K8BA 1D5XC 2AX5A 4K7UA 1GNUA 3DBLI 2PW9A 3DBSA 1SIJA 2WXNA 2JX5A 4EEWA 4P1CC 1XCTL 2IO0B 2WDRB 4BKTA 1DOIA 2YEPF 3AN1A 4HXDA 5DPSA 5T8IA 3AI5A 1D4BA 1E7VA 3IG3A 2J0KA 5L83A 3GE8C 1ESFA 4MGZE 1VCBA 4PYUA 2V4LA 4LJOB 2BWFA 4IM2A 1RRBA 1X1MA 2I38A 1V80A 2KNBA 2HTHA 4W9CA 3BVGA 3PZDA 2BYVE 3H7PA 3N1YC 2BB6A 2KACA 4W9DA 3QC8B 1WGKA 4W9IA 5AZFA 3QCAA 4HPLB 3VXWA 1PUTA 2HTME 1WRDB 2INPE 1K50A 1V1PA 3WAPA 3PZ8A 1FXAA 1WWTA 2DZKA 4ZRKA 4ICVA 2QSDA 1E8ZA 2D3AA 3DPDA 2INCC 2RPQA 1AARA 3P4PB 3Q8FA 2GLSA 3HM3A 1WGYA 4NAWB 5D7GA 3ECIA 4ZRPA 4LLGM 1SF0A 3H6NA 4ZRQA 1TKGA 2K9XA 1MVKA 1WYWB 2N9EB 5LXIB 2KZRA 1C77A 1N5XA 3A1QB 3TEWA 2J7QB 2MEKA 1P1AA 3AEDB 1Y8RC 2L32A 2DLBA 1V81A 1JROA 2O2VB 4DWFA 4RMAA 4EUTA 2GMIC 3ZGZA 1TY0A 5DCNA 4AOFA 2GRIA 1XXGA 2V3SA 4DXFA 4A6QA 1FCCC 3DQVA 4A20A 5H92C 1BUIC 3MHZA 3AE3B 2JXTA 1GAQB 4OZBA 2BYTA 2OJRA 2R61A 2YLMA 3H8HA 1Q0WB 3BK1A 1NBFC 2L8JA 1VD2A 2LFIA 2A5UA 4ZYNA 2D2QA 2KJ6A 3A4RA 4KX6B 4HROA 2J53A 2D5GA 2DZJA 2LHDA 3PHWB 1CZPA 1J7AA 2WHIA 4M0WB 1Z5SB 1C3TA 4W9LA 1EF1A 3RNAC 4TUUA 3B0AA 4K3BA 4HK2A 5AUKA 1R4MB 2M8SA 4NNJB 3M3JA 1WJUA 2LASA 5JH5C 2LXCA 1WJ6A 4OHJA 3UI3A 4MGIE 2IBIB 1NI2A 3QAQA 4PS3A 2MQJA 3LYYA 1TZ1A 2ZW1A 2WXJA 3CSFA 1NI3A 3O13A 2DX5B 4GDLA 2MSED 4REZA 4C7ZA 4MACA 4IW0A 4K7WA 1E10A 3IT6B 3NVVA 2IO2B 3DWGC 4PT5A 2E6XA 3NJTA 4NJCA 3TL5A 3ZDTA 3R2IA 3MP9A 3H7PB 2GOWA 3LB8C 1KF6B 4E71A 3IT4B 3DBLB 2KO3A 2REXA 1AWDA 1V1PB 2N9LA 3RULA 3ZJTA 4MJSA 5BO4B 1VZ6A 4W9GA 3Q8BA 3WAOA 5FR3A 4JPSA 2QCZA 1VRAB 2M1MA 2LGSA 2EKIA 3Q6BA 4JQWC 2BPSA 2KHWB 4XX5A 3NG0A 3HRDD 1AYFA 4LNNA 3W1SA 4PK1A 3VRBB 2LVOA 3WIMA 1GJZA 3Q14C 1VDVA 4BBNC 1ZP0B 5D3DA 3AXCA 3VTVA 3AEAB 4A9AA 2WXMA 4HVBA 4M8NA 2WXPA 5GXGB 1E5WA 3A9KA 1DOYA 1GG3A 4YWGG 2KX3A 4KZ0A 1I4XA 1OQRA 3R8BA 4K7SA 4C00A 2PIAA 3Q3JA 2D07B 2MH7A 4WH4A 4M00A 1WX9A 2NPTA 2Z59B 1XT9B 3AU4A 3NY5A 3L16A 1I42A 4FULA 1EWYC 5HFYA 3OWEB 3P2BA 1WH3A 1VZ8A 3GZNB 1JWAD 1E8YA 3PO0A 2NBWB 2ZNVB 3BIID 2FCQA 4LK0M 2WDTB 3DVNU 4BKSD 4YTPB 1YOVB 1N62A 2LMCA 1RLFA 1WXQA 2MP2B 2VH2A 1C9FA 2I1KA 4RM8A 1VZ7A 1UWXA 2B3AA 2AWTA 2N7JA 5CTRC 1PGXA 5H8YE 3R2TA 3RI7C 4GIVA 1L0XB 5KHQA 3APDA 3Q3MC 1UZXB 2K1FA 1BXTA 3DVNV 1LGRA 3HVZA 2IDYA 4RGNA 3SD5A 2DYOA 1XO3A 4WJOA 1RAXA 2JRHA 2WQYB 3DWMA 5DPWA 4ARCA 1V97A 4ANXA 2M0AA 3NS8A 3BYTB 3P1MA 1LXDA 5E6NA 2MA9B 1H4RA 3WAMA 3EUB2 2KVZA 4FA6A 2K22A 4GDLB 3Q8EA 5G5GA 3OLMD 1SE4A 4YTMB 3AE1B 3N3KB 4TMAB 2KQ4X 3ZRCA 2RSUA 5BYSA 2MJDA 1KLGD 1KFYB 1R4NB 2LGDA 3JSVA 4HEA1 2JZZA 1JQ4A 1P7FA 2CHZA 4BBNF 4H2AA 5GMVA 2BS4B 3DVGY 4FJZA 2VRRB 2VH1A 3DVGX 2IJ0A 3E56A 2PPHA 4NZLB 1S3SG 1YJJA 3OAWA 1ENFA 4MJSB 2V1YA 2G3QB 4X57B 3V3XA 3IXSA 3ML8A 4P16A 1WXMA 1B9RA 2R2QA 2WXGA 2JWUA 2DYBA 5AEKB 3RNBC 1F9JA 3EA6A 1VR9A 1GPXA 3VDZA 3PLVA 2N4FA 1V1OA 3IVFA 1PYWD 2BWES 3A9KB 2JPHA 3I3TB 2KTRA 1FXIA 3CIRB 3ZNZB 2E3TA 5IOIA 1TKEA 2LZ6A 3BVMA 2KLGA 1FRDA 2UU7A 4M01A 1EU3A 4FXCA 3C19A 2FNJB 3ALBA 1QOFA 4FLHA 4EZJA 4HCNB 2C9WB 2CU3A 2LI5A 1I4HA 4NAWA 1B1ZA 4P6VF 2K3UA 2GI9A 3TMPB 1MI0A 1V49A 3DDCB 1PQSA 4FBJB 2A4ZA 2FUHB 5G55A 4F8CB 2K39A 1V86A 2KT7A 1T0RC 3A1QA 2DNFA 2YEPB 1C1YB 4Q2JA 1C4PA 1CK1A 2PKOA 4ZHPA 4G50A 4RF1A 3PZ7A 3N20C 4KSKC 4KVGB 3AEGB 3ZNID 3ZNGC 2FIDA 2XEWA 4EE2A 4OZAA 2K8HA 1XF5L 3B2FA 1JCKB 2EMSA 1U4AA 4GDKA 4LDTB 3T8MA 2KMCA 2RDGA 3I57A 1YN4A 5EE1A 4CQNA 3D32A 1T0YA 4IDIA 4A3PA 5JHBA 2HD5B 2VZKB 3ZO5B 3Q69A 5CHWA 1L5PA 1XEEA 2OHFA 3RN9C 1UUPA 1P0RA 3QHTA 3NZUA 3U30A 4NJ6A 1L7YA 4LJPB 4BVUC 1P9DU 4BOSC 2CHXA 3JVZX 3C0RB 4K3CA 1QF6A 3KWVA 1MPEA 2ZPYA 2ZCCA 3DOWA 1ZDXA 2C60A 3H7SA 4DHJD 2R2OA 2LD9A 5BYRA 1V6EA 3MJWA 2WNMA 1J0GA 3KUCB 1GC6A 2WU2B 3PRZA 5DPTA 2CS4A 1F52A 3JSVB 2Y5PA 2UWQA 2Z8LA 2ZCBA 2KC1A 1I4RA 2MJEA 2G4SA 4LDTD 2N7EA 3IAM1 2L0TA 1QOBA 3T9LA 3Q8CA 1WXAA 2N9PC 3SDLC 2NTTA 4NAMA 4RCOA 2VZKD 3V05A 5EE3A 1QOAA 4KIKA 2QC8A 2CHWA 1QLBB 1V8CA 3KQ4A 3B2GA 1I4GA 2KXJA 4LNFA 4EOYA 1XLPA 3GB1A 2G1EA 4MSMB 4XDDA 4ANVA 4JWUC 1FD6A 1GOZA 1M94A 5TSSA 3IHPC 1IYFA 2W54A 2LUEA 5J18A 2KJHB 1T0QC 2KTRB 1XLNA 3U8ZA 4IUMB 1A70A 4HRSA 2NCNA 1WF9A 2W82A 4YTNB 2BYFA 3BZDB 2KFJA 1D3ZA 3PTFC 2WX1A 2NTSA 2MWSB 2BS2B 2MBQA 1FEHA 1IGCA 4AUQC 3N32A 5HHDG 2KKCA 2QILA 4BKSA 2G9HD 1OGWA 4N58A 1HXYD 4CHKA 3VUYA 2L1AA 5BMIA 2BVCA 4AJYB 4MH8A 1ACCA 3W5VB 1YNTE 2LJ5A 2WXFA 5FR6A 2JZPA 1I4QA 1ZKHA 3ZYYX 2KC2A 5IA7A 3SHQA 3FC4A 4KSLC 3EC8A 2OOBB 4WQOB 3IAS1 1N61A 3OG5A 1SJHD 1P98A 4PS7A 4YSYB 1VJKA 2JWZA 4AWJA 3A33B 3HVDA 4KKIA 4DBGA 1KLUD 3P42A 4BAXA 1FPYA 2MBHA 2NR2A 4GDKB 4MSQB 3ML9A 4A55A 1H8CA 3NVYA 5I4DA 2DZMA 3VTWA 1TS2A 3ZXRA 4EZLA 5EDSA 3V6EB 4RGOS 1WX7A 2GB1A 1JRUA 4TSSA 3KUDB 3RPFC 3NS1A 1YN5A 2W9NA 3A9JA 2KVRA 1D5MC 3AE5B 2RMMA 3MC8A 3H1UA 4TQ1A 2SAKA 2HJ8A 4MELA 1T5XD 1YJ1A 1OEYJ 4WAAA 2K6QA 2MP2A 3ZQ4A 4BKGA 2JXXA 1UGMA 2J0MA 3Q8AA 3ZRFA 1YX6B 2MJ3A 3NZ3A 5AZGA 4ZHOA 1WGHA 2G45B 2KLCA 4ANWA 3VR9B 2NBVB 3QA8A 3QQ8B 4XE0A 1PGAA 2MRPA 4GOCA 3IFWB 2N9XA 3PRMB 4OVVA 4E74A 1Q10A 3EFUA 1UNSA 3DHHC 4IWPA 4LNKA 3EFCA 4KV2A 3ETRA 3W1YA 4URKA 1GC7A 1NVID 1ZPSA 3AM9A 4FJVB 4C56C 2IY0B 2JT4B 5C3JB 4KIKB 4YL8A 2PTLA 2IGHA 2NVUI 3AEFB 2C7MB 1FIQA 2BBCA 5D94A 1SBBB 2INDC 1WY8A 4FADA 2WX0A 1SJED 3P4SB 3DHGC 1WI0A 1YJIA 1L6UA 4HPPA 2K5PA 1WZ0A 1F0ZA 2QMTA 3KW5B 2WXKA 4RGTA 2N1VA 2WDVB 1EO6A 2KAJA 2H88B 3N9YC 4L2YA 3NZSA 2IYDB 1C79A 3HHMA 3T3NA 2FIFA 2RGFA 2DAJA 1K51A 2QEJC 1LQBA 2B76B 4W9FA 2IPKD 2PE9A 4GMVA 3UQAA 2IGDA 2KDEB 2BKFA 3J9CA 2WLBA 3ABVB 3Q3OC 1WR6E 1HTQA 3MC0B 3ZTCA 1IPGA 1YD8U 4FHJA 3GOEA 1WFYA 1T6BX 4WJNA 1RYJA 3E9SA 3ZIMA 3AEEB 4HJKA 2W3SA 2MBOA 2V4IB 3L10B 3PV1A 4II2B 4XZ4A 4GSWA 2WDQB 2QJLA 4BZAA 2WXQA 3CSTA 1N5WA 3AULA 1WXSA 2ACZB 1YQBA 2ONQA 1SE3A 2LEKA 4C4VA 4A90A 2FUG1 4AJWA 4ICUA 3A9JB 2KDIA 3MC9A 1XQQA 4MT5A 4HDOA 2LGXA 3TEZA 2KJRA 1NDDA 1WM3A 3N1ZC 1FCLA 4KDIC 3QWZB 1WXVA 1FXTB 3ZNHB 1FNVA 1E7PB 3UGBB 1UBIA 3MTNB 1BMLC 1RFAA 2W55A 2KMMA 5E6PA 2GBJA 4TV3A 1I7HA 2J4XA 2ZW0A 4B0EA 5E6OA 3SR6A 3V6CB 3B1LX 4R3DA 1NYRA 4ANUA 2CJNA 3EGRA 4UDUC 4GU2A 1EU4A 3PS6A 4JGHB 3TEXA 2CR5A 5BMGA 1V5TA 4MDKE 5CHFA 4JLCA 4ZRJA 5LNK1 4HJGE 1TJEA 3PRPB 4GXBA 3SFDB 4ASWC 5IKCM 2JRIB 4K1RB 3L0WB 4DHZE 5G2NA 4BOZB 1E8WA 4XDCA 2PVOD 2ZPNA 1TTNA 1KRHA 2MBBB 5HKHA 2N1WA 1E0ZA 3VQIA 4RF0A 3WA0A 4J3OD 3JYUA 1LO5D 1TYGB 1SSNA 4D2KA 4XWTA 2BS3B 1HZ5A 5IP4D 2IO1B 3VTUA 2BYEA 2Z0EB 2MBEA 3AU5A 2BB5A 3CWIA 1YMHE 4G3XB 4EZKA 3VRAB 4W9HA 1N63A 1Y56A 3ZVVA 3RNEC 2I2YA 3SU8X 4P7IA 4KKJA 3UF8A 3FKYA 2XK5A 3C8YA 2LRWA 3V62A 5C2TB 2KN5A 1OQYA 1K53A 3PVLA 3RFZB 1WGGA 1WJ4A 4WQMA 2RDHA 4GLSC 4TKNA 4I6NB 1UF0A 1UWMA 3TSSA 2JYTA 4RM9A 2AL6A 1E90A 4WURA 2ZEQA 3ONSA 4W9KA 1IP9A 2DENB 3RZWC 5IN7A 3OJ4B 3RYTA 1TGZB 3O65B 2L00B 3R7QA 1ZW7A 3VHTC 2YVCA 4FJYA 4YSZB 1WGRA 1HEZE 3EHVA 1GB1A 4DHZB 1TT5B 1K52A 1OFFA 3AE9B 2KANA 2N0SB 3LDZE 4HPMB 1MJDA 2WXIA 2L05A 1SGHA 3FAHA 2K25A 1E7UA 1F77A 4GGQA 4OVUA 3U7ZA 3V61A 3VH4B 4DQOC 3AE8B 4DHJB 4C80A 2HE7A 4NPNA 4C4VB 5JXVA 3RT3B 4YSXB 2M19A 1Q1OA 3PPAA 2BTEA 1KLVA 1YIWA 1JRPA 3RUIB 1IBXA 2WXRA 2ON8A 4DK5A 4N6EB 4ZDVA 1WR1A 5D6JB 2AQ1B 4MGYE 3BY4B 4MEMA 1KM7A 1RWSA 4KGTA 2MW5A 4MM3B 1FRRA 1DGJA 2LWPA 3BYYB 2ICIA 1ET6A 2QDFA 1OEYA 4ACFA 1TKYA 3PREA 1WSPA 1SEBD 4J6IA 1J8CA 2JU6X 3L54A 1R4MI 4LNOA 1PGBA 4OW0A 1J7CA 1XD3B 1QOGA 2M0XA 4YT0B 3UQBA 1JWMD 4FHKA 4AQ7A 2PMVA 3KH0A 4L23A 1KH0A 5HI1A 3PGEA 3NOBA 3HM6X 2L52A 1FFVA 2Y5BB 1ZUD2 2KOXA 4US9A 2LUMA 2LHEA 2D3BA 3TUOA 4BFRA 5LXHA 3SEBA 3I5JC 4LCDE 2V3NA 3ZDMC 1S1QB 3WALA 3VUWA 2HJ1A 2PEAA 2EELA 2K0PA 1STEA 2XK5B 3L4PA 1E8XA 1FNUA 2GBRA 1UD7A 3JW0X 5J17A 3R66C 4HKQA 1I4PA 1SIFA 4ZOHC 2ZVNA 4W9EA 2D3CA 1Z2MA 3MHSD 1V2YA 4EKUA 5CX3A 1J7BA 5JHAA 2KD0A 3AB5A 5EE9A 3TCAA 3VAWA 1JWUD 4II3B 3R7RA 3RNFC 3NRZA 2V3PA 3AEBB 3W5UB 4W9JA 2RD0A 3AE7B 1C4AA 2JYEA 1ROEA 2RR9A 3LXFA 3RD2A 4CYEA 2JF5A 3R3MA 4USAA 3N30A 1T3QA 3WCQA 3NVWA 1TIFA 3APFA 3OJ3A 1RFKA 4HKZE 2KTFA 5JZEB 2PJHA 1WZ3A 1XLQA 2KYWA 4KGSA 4C7YA 2AQ3B 4RH6A 1QQRA 3VVWB 2N9KA 2WXLA 3EECA 3ZJVA 2LGYA 4IKGA 3GZNI 2N7DA 1TZOA 3BVZA 3HUIA 1L4DB 3I9V1 2Z0DB 2KQSA 5C23A 1IBXB 1I35A 1GB4A 3QARA 3TJPA 4A3OA 4ARIA 3DBRI 1F1HA 3L13A 4GB9A 4WWOA 1XCQL 2AEHA 3NVZA 3QIJA 1SB3C 2INNE 2NS5A 5MPOA 3UIOB 1QILA 2QIEB 1HTOA 2M4NA 2DYMA 2SEBD 5CHVC 1V5OA 2C7HA 4PYZA 2DZIA 3RNGC 4B95A 4K81A 1JMLA 3DBHI 2O6VA 1FNWA 3SFEB 3Q3FA 3NUHB 3ZXVA 5IAAC 2IY1B 4LTUA 4WJPA 3ZTDA 3KWLA 2FAZA 1FM0D 2LVPA 4MH0E 1NYQA 3GP7A 2WGSA 3URYA 2ZZPB 4N59A 2D10A 3S2AA 3K9PB 1CQVA 4JWSC 1FO4A 1NEKB 3U2SC 2J52A 2AQ2B 1SE2A 3L08A 5LLIA 1L0VB 1UELA 2K6DB 4WIPA 2DHZA 1WJNA 3N1XC 1N60A 2FCNA 3AECB 4LNIA 2KWVB 1TS3A 4S17A 3AE4B 1R4NI 2XBBC 2WS3B 2ZJDA 3Q2AC 3U52E 3I63C 3B08A 2LVQA 2BW2A 1ZE3D 1TY2A 3AE6B 1EWCA 1A5RA 2JY6A 3Q3NC 1R7SA 4G11A 3M95A 2DWQA 1HA5A 5KHOA 3W9CB 4XYCA 2L3ZA 2AL3A 2JZ3B 2KWCA 3GS2A 1MHHE 2KX0A 1OQQA 1QT9A 4KZCA 2PLPA 2KDBA 3PSEB 2Q5WD 2XN9C 2NBUA 1VLBA 1WM2A 4XGAB 5TR5A 1ZXHA 3X0WA 1K8RB 3DCGA 1RM6C 3H9DA 4XC2A 1SE9A 3P4QB 1JWSD 4A8XC 1ZGUB 2QHOA 2L83A 4F1SA 1QZEA 3BK2A 2L7RA 1PDXA 2JUOA 2WWZA 4EFOA 1YN3A 1FFUA 2V9HA 1WGDA 1MG8A 2IO3B 5IO9A 2LRUA 5HG2A 2W3RA 2PE6B 3X23A 4IM0A 4P1BC 4AP4C 4TQ0A 4NQLB 3WANA 2MLBA 2V0GA 1Q5WB 1HE8A 1L0YB 1UBQA 3PLUA 4IOIE 2EKEC 1L2NA 1JALA 2OEDA 2ZNVC 5BMHA 3B9JA 2JSVX 1P7EA 2I1JA 2MHJA 1ZDVA 1HQRD 1KOTA 2KWDA 2WP9B 2BKRB 3KUZA 2O6VB 3KYCD 5D3IB
chains in the Genus database with same CATH topology
3T9LA 3PHWB 3RYTA 1TGZB 1WXAA 3O65B 2N9PC 2L00B 4MGKE 3R7QA 1ZW7A 3SDLC 3VHTC 1P3QU 2YVCA 4FJYA 4M0WB 1Z5SB 1WGRA 3EHVA 2DZJA 3CF6E 3M62B 3CMMB 4DHZB 1C3TA 3L17A 4W9LA 2G4DB 4I6PA 4KIKA 2CHWA 2CU1A 3QK0A 1EF1A 2KANA 3LDZE 4WWNA 4HPMB 3B0AA 4TUUA 3U7DA 4HK2A 2KXJA 2KFKA 2L05A 4EOYA 1SGHA 2M8SA 3IBEA 4MSMB 4ANVA 2K25A 4NNJB 1E7UA 3M3JA 1WJUA 2L76A 4GGQA 1M94A 4OVUA 3V61A 4G0NB 2LASA 3VH4B 5JH5C 2LXCA 3IHPC 1IYFA 4DHJB 2LUEA 5J18A 2KJHB 3APCA 2HE7A 4HWIB 4NPNA 2KTRB 3U8ZA 3RT3B 4IUMB 1WJ6A 4MM3A 4DDID 2NCNA 1WF9A 2KK8A 2BYFA 2BGFA 1Q1OA 2FCSA 3PPAA 4MGIE 3KYDD 4CO7A 1G6JA 2IBIB 2IZVB 1WMHA 1NI2A 2EMTA 2KFJA 1D3ZA 3QAQA 4PS3A 1KLVA 3PTFC 2WX1A 1YIWA 2MQJA 1TZ1A 2MWSB 4FN2A 2MBQA 3RUIB 3CSFA 5D2MB 2DX5B 3N32A 2MSED 4GDLA 3VH3B 4AUQC 2KKCA 4I6LB 4DK5A 4BKSA 4IW0A 4K7WA 4ZDVA 1WR1A 2WYQA 4IG7B 1OGWA 2IO2B 3UIPB 1ISNA 5C1ZA 5D6JB 3TIXA 1TBEA 3VUYA 4CHKA 4MGYE 3LJ3A 3TL5A 2J0JA 3BY4B 1CMXB 3ZDTA 4MEMA 4AJYB 4B9KA 3QX1A 3H7PB 4IC7B 3PT2B 1KM7A 2O6VD 4WJQA 2GOWA 4M8MA 2LJ5A 2MW5A 5FR6A 4E71A 4IM3A 2KO3A 2LWPA 1ZKHA 2REXA 3M63B 2KC2A 3ZUNA 1OEYA 3SHQA 4KSLC 5IA7A 3RULA 4JIOU 3A4SC 4MJSA 3ZW3A 5BO4B 3EC8A 2JVCA 3PREA 4W9GA 3V60A 2OOBB 4J6IA 4WQOB 1J8CA 3WAOA 3L54A 1R4MI 2M1MA 1P98A 3NHEB 4PS7A 2JWZA 4AWJA 3A33B 1LM8B 3W1SC 4DBGA 4DDGD 4JQWC 1XD3B 2M0XA 2BPSA 2KHWB 2L0FA 4XX5A 1BT0A 3RCZA 3W1SA 3UQBA 2CKHB 2MBHA 2NR2A 4GDKB 4WWPA 4MSQB 2LVOA 3WIMA 3ML9A 1H8CA 4DXAB 4KDLB 4FHKA 2DZMA 3VTWA 1GJZA 2GBMA 1WIAA 5L95C 4BBNC 3AXCA 3KH0A 3VTVA 4EZLA 5EDSA 3V6EB 3PGEA 4M8NA 4HVBA 3NOBA 3HM6X 1WX7A 1E5WA 2ZVOA 1JRUA 4JL9A 1UH6A 3A9KA 2M17A 2Y5BB 3KUDB 1GG3A 2KOXA 2KX3A 4KZ0A 2W9NA 4BFRA 3A9JA 2KVRA 5LXHA 4LCDE 4K7SA 2D3GA 3ZDMC 3ZKJC 3H1UA 1S1QB 1J19A 4TQ1A 3TBLD 3Q3JA 3WALA 2HJ8A 4NY0A 4MELA 3VUWA 1V9JA 2D07B 3QJZA 4WAAA 1YJ1A 1OEYJ 4GN1A 2K6QA 1EF5A 1WX9A 2MP2A 2PEAA 2NPTA 4BKGA 2JXXA 1UGMA 2Z59B 1XT9B 2J0MA 1WE6A 1KJTA 3ZRFA 3AU4A 3NY5A 3L16A 2DAFA 1I42A 2XK5B 1YX6B 1E8XA 4FULA 2GBRA 4IWQA 2KWUB 3P2BA 1UD7A 1WH3A 5AZGA 1WGHA 2G45B 2KLCA 1E8YA 4ANWA 3JW0X 2NBWB 5J17A 3R66C 2NBVB 2ZNVB 2FCQA 3QA8A 2LXAA 3QQ8B 1SIFA 2WDTB 2GBKA 3UINB 2ZVNA 2MRPA 4W9EA 4GOCA 1Z2MA 3IFWB 3MHSD 2N9XA 3DVNU 3PRMB 1V2YA 4OVVA 4E74A 4BKSD 3EFUA 4EKUA 5CX3A 4F7ZA 2K8CA 5JHAA 1LFDA 1RLFA 2KD0A 4IWPA 4KV2A 3TCAA 3VAWA 2MP2B 4II3B 2NPTB 3R7RA 3W1YA 4URKA 3PHXB 5J2RA 1GC7A 2I1KA 4RM8A 3KVFB 2B3AA 2AWTA 4W9JA 2C7NB 2RD0A 4FJVB 5CTRC 3BINA 2GBNA 2IY0B 2JT4B 2KQ7A 4GIVA 4E3CA 2AYOB 4KIKB 4YL8A 5KHQA 2RR9A 3RD2A 4CYEA 2JF5A 4NJ7A 2NVUI 3APDA 3R3MA 3N30A 2C7MB 1UZXB 3HK0A 2K1FA 2KFKB 4HDQA 2MCNB 2FCMA 5D94A 1GUAB 3APFA 3DVNV 1WY8A 3OJ3A 4FADA 3VFKA 2WX0A 1WI0A 3SD5A 2C5LC 2DYOA 2KTFA 3HIZA 4NQKE 5JZEB 2KDFB 4WJOA 2PJHA 2O2VA 1WZ3A 1WX8A 1WZ0A 1RAXA 2JRHA 5DPWA 4HLEA 4ANXA 2D11A 3KW5B 1WE7A 3VVWB 3NS8A 2N1VA 3EECA 1LXDA 3ZLZA 1EO6A 5E6NA 1WMHB 2MA9B 2LGYA 5DPRA 1H4RA 2N7DA 3GZNI 3NZSA 4ZRIA 3WAMA 4FA6A 4N9F4 2IYDB 2Z0DB 1EUVB 2KQSA 5AZHA 5C23A 1I35A 4GDLB 3HHMA 2FIFA 2RGFA 3OLMD 2DAJA 3QARA 4B6WA 1LQBA 3RZFA 4W9FA 1OTRB 3N3KB 3TJPA 4A3OA 3DBRI 2MX2A 2PE9A 3L13A 4GB9A 3ZRCA 4WWOA 2RSUA 2AEHA 3QIJA 2NS5A 2BF8B 4GMVA 3UIOB 3UQAA 2KDEB 2LGDA 2M4NA 3K9OB 2BKFA 2DYMA 3JSVA 2KMAA 2JZZA 2CHZA 5CHVC 3ENEA 1V5OA 4BBNF 5GMVA 3DVGY 2C7HA 4FJZA 2VRRB 4PYZA 2DZIA 3DVGX 2PPHA 4B95A 1S3SG 1WR6E 4K81A 3OAWA 4MJSB 2V1YA 2ASQA 3DBHI 2O6VA 4PS8A 2G3QB 3ZTCA 1IPGA 4X57B 1YD8U 3VUXA 3ML8A 3Q3FA 4FHJA 3GOEA 1WFYA 5IAAC 2IY1B 3KUZA 4WJNA 4WJPA 1WXMA 2UYZB 4IWOA 2FAZA 3ZTDA 3ZIMA 2R2QA 2LVPA 4MH0E 4HJKA 2DYBA 2MBOA 5AEKB 1F9JA 1YX5B 4HCPB 2K8BA 3L10B 3PV1A 4II2B 2ZZPB 3VDZA 3PLVA 4XZ4A 4K7UA 4GSWA 1GNUA 2D10A 3DBLI 2N4FA 3CSTA 3DBSA 3S2AA 3AULA 3K9PB 1WXSA 3IVFA 4EEWA 1YQBA 2BWES 2IO0B 3A9KB 2JPHA 4BKTA 3I3TB 2KTRA 3L08A 5LLIA 4AJWA 1UELA 3ZNZB 2K6DB 4ICUA 3A9JB 2KDIA 4HXDA 5DPSA 2DHZA 3AI5A 1XQQA 1E7VA 4HDOA 1WJNA 2LGXA 2LZ6A 2KLGA 3IG3A 2J0KA 5L83A 2FCNA 4MGZE 1VCBA 2KJRA 2KWVB 1NDDA 1WM3A 4PYUA 2V4LA 4LJOB 1R4NI 2XBBC 2ZJDA 2FNJB 3QWZB 2BWFA 4KDIC 3ALBA 1WXVA 1FXTB 4FLHA 3ZNHB 4EZJA 3B08A 2C9WB 4HCNB 4IM2A 2LVQA 1RRBA 1X1MA 1UBIA 3MTNB 3UGBB 2LI5A 1RFAA 1A5RA 1V80A 4NAWA 5E6PA 2GBJA 2KNBA 4TV3A 2HTHA 2JY6A 5E6OA 4W9CA 3TMPB 3V6CB 1V49A 3DDCB 3PZDA 3B1LX 1PQSA 2BYVE 3H7PA 4G11A 4FBJB 2A4ZA 2FUHB 5G55A 4ANUA 3M95A 2K39A 1V86A 4F8CB 4W9DA 3A1QA 3QC8B 4W9IA 5AZFA 5KHOA 3QCAA 1C1YB 2L3ZA 2AL3A 4HPLB 3VXWA 2JZ3B 2KWCA 1WRDB 2KX0A 4GU2A 3WAPA 4G50A 4KZCA 3PS6A 2KDBA 3PSEB 4JGHB 2DZKA 4ZRKA 4KSKC 2CR5A 4KVGB 3ZNID 2NBUA 1V5TA 4ICVA 4MDKE 2FIDA 2XEWA 4JLCA 5CHFA 4ZRJA 3ZNGC 1E8ZA 3DPDA 2K8HA 3PRPB 4GXBA 1WM2A 1AARA 2RPQA 5TR5A 4ASWC 3HM3A 3X0WA 1K8RB 3DCGA 2JRIB 4K1RB 1WGYA 4NAWB 2EMSA 5D7GA 3ECIA 3L0WB 4DHZE 1U4AA 3H9DA 4GDKA 4LDTB 4XC2A 1SE9A 1E8WA 5G2NA 3T8MA 4BOZB 3H6NA 2KMCA 1ZGUB 2ZPNA 1WYWB 1TTNA 2N9EB 2MBBB 2KZRA 2N1WA 5HKHA 5LXIB 2QHOA 3D32A 1T0YA 4A3PA 3A1QB 4F1SA 5JHBA 1QZEA 2HD5B 2J7QB 3ZO5B 3VQIA 5CHWA 2L7RA 1P1AA 3WA0A 1Y8RC 3JYUA 1P0RA 3QHTA 2JUOA 3NZUA 3U30A 2WWZA 1V81A 4NJ6A 4EFOA 2O2VB 4DWFA 4RMAA 1WGDA 1L7YA 1MG8A 4LJPB 4BVUC 4EUTA 1P9DU 2GMIC 2IO3B 4BOSC 2LRUA 2CHXA 2IO1B 3JVZX 3VTUA 2BYEA 3C0RB 5DCNA 2Z0EB 2MBEA 4AOFA 2PE6B 3X23A 2ZPYA 3AU5A 4IM0A 2V3SA 2ZCCA 4G3XB 4AP4C 4EZKA 3DOWA 4W9HA 3DQVA 4A20A 4TQ0A 2C60A 4NQLB 3H7SA 4DHJD 3WANA 2MLBA 3ZVVA 1Q5WB 3SU8X 2R2OA 4P7IA 1HE8A 3UF8A 1UBQA 2XK5A 3PLUA 2LRWA 2EKEC 2LD9A 1L2NA 3V62A 1V6EA 3MJWA 2KN5A 2OJRA 2ZNVC 1J0GA 1OQYA 3PVLA 3KUCB 1GC6A 2YLMA 3PRZA 5DPTA 1WGGA 1Q0WB 1WJ4A 2CS4A 1NBFC 3JSVB 4TKNA 2L8JA 4I6NB 2UWQA 1VD2A 2ZCBA 4RM9A 2I1JA 2KC1A 2A5UA 2AL6A 1E90A 4ZYNA 2ZEQA 3ONSA 2D2QA 2KJ6A 1KOTA 2G4SA 3A4RA 4LDTD 2N7EA 4W9KA 1IP9A 2BKRB 2DENB 3RZWC 2L0TA 2O6VB 3OJ4B 3KYCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9L A;  3PHW B;  3RYT A;  1TGZ B;  1WXA A;  3O65 B;  2N9P C;  2L00 B;  4MGK E;  3R7Q A;  1ZW7 A;  3SDL C;  3VHT C;  1P3Q U;  2YVC A;  4FJY A;  4M0W B;  1Z5S B;  1WGR A;  3EHV A;  2DZJ A;  3CF6 E;  3M62 B;  3CMM B;  4DHZ B;  1C3T A;  3L17 A;  4W9L A;  2G4D B;  4I6P A;  4KIK A;  2CHW A;  2CU1 A;  3QK0 A;  1EF1 A;  2KAN A;  3LDZ E;  4WWN A;  4HPM B;  3B0A A;  4TUU A;  3U7D A;  4HK2 A;  2KXJ A;  2KFK A;  2L05 A;  4EOY A;  1SGH A;  2M8S A;  3IBE A;  4MSM B;  4ANV A;  2K25 A;  4NNJ B;  1E7U A;  3M3J A;  1WJU A;  2L76 A;  4GGQ A;  1M94 A;  4OVU A;  3V61 A;  4G0N B;  2LAS A;  3VH4 B;  5JH5 C;  2LXC A;  3IHP C;  1IYF A;  4DHJ B;  2LUE A;  5J18 A;  2KJH B;  3APC A;  2HE7 A;  4HWI B;  4NPN A;  2KTR B;  3U8Z A;  3RT3 B;  4IUM B;  1WJ6 A;  4MM3 A;  4DDI D;  2NCN A;  1WF9 A;  2KK8 A;  2BYF A;  2BGF A;  1Q1O A;  2FCS A;  3PPA A;  4MGI E;  3KYD D;  4CO7 A;  1G6J A;  2IBI B;  2IZV B;  1WMH A;  1NI2 A;  2EMT A;  2KFJ A;  1D3Z A;  3QAQ A;  4PS3 A;  1KLV A;  3PTF C;  2WX1 A;  1YIW A;  2MQJ A;  1TZ1 A;  2MWS B;  4FN2 A;  2MBQ A;  3RUI B;  3CSF A;  5D2M B;  2DX5 B;  3N32 A;  2MSE D;  4GDL A;  3VH3 B;  4AUQ C;  2KKC A;  4I6L B;  4DK5 A;  4BKS A;  4IW0 A;  4K7W A;  4ZDV A;  1WR1 A;  2WYQ A;  4IG7 B;  1OGW A;  2IO2 B;  3UIP B;  1ISN A;  5C1Z A;  5D6J B;  3TIX A;  1TBE A;  3VUY A;  4CHK A;  4MGY E;  3LJ3 A;  3TL5 A;  2J0J A;  3BY4 B;  1CMX B;  3ZDT A;  4MEM A;  4AJY B;  4B9K A;  3QX1 A;  3H7P B;  4IC7 B;  3PT2 B;  1KM7 A;  2O6V D;  4WJQ A;  2GOW A;  4M8M A;  2LJ5 A;  2MW5 A;  5FR6 A;  4E71 A;  4IM3 A;  2KO3 A;  2LWP A;  1ZKH A;  2REX A;  3M63 B;  2KC2 A;  3ZUN A;  1OEY A;  3SHQ A;  4KSL C;  5IA7 A;  3RUL A;  4JIO U;  3A4S C;  4MJS A;  3ZW3 A;  5BO4 B;  3EC8 A;  2JVC A;  3PRE A;  4W9G A;  3V60 A;  2OOB B;  4J6I A;  4WQO B;  1J8C A;  3WAO A;  3L54 A;  1R4M I;  2M1M A;  1P98 A;  3NHE B;  4PS7 A;  2JWZ A;  4AWJ A;  3A33 B;  1LM8 B;  3W1S C;  4DBG A;  4DDG D;  4JQW C;  1XD3 B;  2M0X A;  2BPS A;  2KHW B;  2L0F A;  4XX5 A;  1BT0 A;  3RCZ A;  3W1S A;  3UQB A;  2CKH B;  2MBH A;  2NR2 A;  4GDK B;  4WWP A;  4MSQ B;  2LVO A;  3WIM A;  3ML9 A;  1H8C A;  4DXA B;  4KDL B;  4FHK A;  2DZM A;  3VTW A;  1GJZ A;  2GBM A;  1WIA A;  5L95 C;  4BBN C;  3AXC A;  3KH0 A;  3VTV A;  4EZL A;  5EDS A;  3V6E B;  3PGE A;  4M8N A;  4HVB A;  3NOB A;  3HM6 X;  1WX7 A;  1E5W A;  2ZVO A;  1JRU A;  4JL9 A;  1UH6 A;  3A9K A;  2M17 A;  2Y5B B;  3KUD B;  1GG3 A;  2KOX A;  2KX3 A;  4KZ0 A;  2W9N A;  4BFR A;  3A9J A;  2KVR A;  5LXH A;  4LCD E;  4K7S A;  2D3G A;  3ZDM C;  3ZKJ C;  3H1U A;  1S1Q B;  1J19 A;  4TQ1 A;  3TBL D;  3Q3J A;  3WAL A;  2HJ8 A;  4NY0 A;  4MEL A;  3VUW A;  1V9J A;  2D07 B;  3QJZ A;  4WAA A;  1YJ1 A;  1OEY J;  4GN1 A;  2K6Q A;  1EF5 A;  1WX9 A;  2MP2 A;  2PEA A;  2NPT A;  4BKG A;  2JXX A;  1UGM A;  2Z59 B;  1XT9 B;  2J0M A;  1WE6 A;  1KJT A;  3ZRF A;  3AU4 A;  3NY5 A;  3L16 A;  2DAF A;  1I42 A;  2XK5 B;  1YX6 B;  1E8X A;  4FUL A;  2GBR A;  4IWQ A;  2KWU B;  3P2B A;  1UD7 A;  1WH3 A;  5AZG A;  1WGH A;  2G45 B;  2KLC A;  1E8Y A;  4ANW A;  3JW0 X;  2NBW B;  5J17 A;  3R66 C;  2NBV B;  2ZNV B;  2FCQ A;  3QA8 A;  2LXA A;  3QQ8 B;  1SIF A;  2WDT B;  2GBK A;  3UIN B;  2ZVN A;  2MRP A;  4W9E A;  4GOC A;  1Z2M A;  3IFW B;  3MHS D;  2N9X A;  3DVN U;  3PRM B;  1V2Y A;  4OVV A;  4E74 A;  4BKS D;  3EFU A;  4EKU A;  5CX3 A;  4F7Z A;  2K8C A;  5JHA A;  1LFD A;  1RLF A;  2KD0 A;  4IWP A;  4KV2 A;  3TCA A;  3VAW A;  2MP2 B;  4II3 B;  2NPT B;  3R7R A;  3W1Y A;  4URK A;  3PHX B;  5J2R A;  1GC7 A;  2I1K A;  4RM8 A;  3KVF B;  2B3A A;  2AWT A;  4W9J A;  2C7N B;  2RD0 A;  4FJV B;  5CTR C;  3BIN A;  2GBN A;  2IY0 B;  2JT4 B;  2KQ7 A;  4GIV A;  4E3C A;  2AYO B;  4KIK B;  4YL8 A;  5KHQ A;  2RR9 A;  3RD2 A;  4CYE A;  2JF5 A;  4NJ7 A;  2NVU I;  3APD A;  3R3M A;  3N30 A;  2C7M B;  1UZX B;  3HK0 A;  2K1F A;  2KFK B;  4HDQ A;  2MCN B;  2FCM A;  5D94 A;  1GUA B;  3APF A;  3DVN V;  1WY8 A;  3OJ3 A;  4FAD A;  3VFK A;  2WX0 A;  1WI0 A;  3SD5 A;  2C5L C;  2DYO A;  2KTF A;  3HIZ A;  4NQK E;  5JZE B;  2KDF B;  4WJO A;  2PJH A;  2O2V A;  1WZ3 A;  1WX8 A;  1WZ0 A;  1RAX A;  2JRH A;  5DPW A;  4HLE A;  4ANX A;  2D11 A;  3KW5 B;  1WE7 A;  3VVW B;  3NS8 A;  2N1V A;  3EEC A;  1LXD A;  3ZLZ A;  1EO6 A;  5E6N A;  1WMH B;  2MA9 B;  2LGY A;  5DPR A;  1H4R A;  2N7D A;  3GZN I;  3NZS A;  4ZRI A;  3WAM A;  4FA6 A;  4N9F 4;  2IYD B;  2Z0D B;  1EUV B;  2KQS A;  5AZH A;  5C23 A;  1I35 A;  4GDL B;  3HHM A;  2FIF A;  2RGF A;  3OLM D;  2DAJ A;  3QAR A;  4B6W A;  1LQB A;  3RZF A;  4W9F A;  1OTR B;  3N3K B;  3TJP A;  4A3O A;  3DBR I;  2MX2 A;  2PE9 A;  3L13 A;  4GB9 A;  3ZRC A;  4WWO A;  2RSU A;  2AEH A;  3QIJ A;  2NS5 A;  2BF8 B;  4GMV A;  3UIO B;  3UQA A;  2KDE B;  2LGD A;  2M4N A;  3K9O B;  2BKF A;  2DYM A;  3JSV A;  2KMA A;  2JZZ A;  2CHZ A;  5CHV C;  3ENE A;  1V5O A;  4BBN F;  5GMV A;  3DVG Y;  2C7H A;  4FJZ A;  2VRR B;  4PYZ A;  2DZI A;  3DVG X;  2PPH A;  4B95 A;  1S3S G;  1WR6 E;  4K81 A;  3OAW A;  4MJS B;  2V1Y A;  2ASQ A;  3DBH I;  2O6V A;  4PS8 A;  2G3Q B;  3ZTC A;  1IPG A;  4X57 B;  1YD8 U;  3VUX A;  3ML8 A;  3Q3F A;  4FHJ A;  3GOE A;  1WFY A;  5IAA C;  2IY1 B;  3KUZ A;  4WJN A;  4WJP A;  1WXM A;  2UYZ B;  4IWO A;  2FAZ A;  3ZTD A;  3ZIM A;  2R2Q A;  2LVP A;  4MH0 E;  4HJK A;  2DYB A;  2MBO A;  5AEK B;  1F9J A;  1YX5 B;  4HCP B;  2K8B A;  3L10 B;  3PV1 A;  4II2 B;  2ZZP B;  3VDZ A;  3PLV A;  4XZ4 A;  4K7U A;  4GSW A;  1GNU A;  2D10 A;  3DBL I;  2N4F A;  3CST A;  3DBS A;  3S2A A;  3AUL A;  3K9P B;  1WXS A;  3IVF A;  4EEW A;  1YQB A;  2BWE S;  2IO0 B;  3A9K B;  2JPH A;  4BKT A;  3I3T B;  2KTR A;  3L08 A;  5LLI A;  4AJW A;  1UEL A;  3ZNZ B;  2K6D B;  4ICU A;  3A9J B;  2KDI A;  4HXD A;  5DPS A;  2DHZ A;  3AI5 A;  1XQQ A;  1E7V A;  4HDO A;  1WJN A;  2LGX A;  2LZ6 A;  2KLG A;  3IG3 A;  2J0K A;  5L83 A;  2FCN A;  4MGZ E;  1VCB A;  2KJR A;  2KWV B;  1NDD A;  1WM3 A;  4PYU A;  2V4L A;  4LJO B;  1R4N I;  2XBB C;  2ZJD A;  2FNJ B;  3QWZ B;  2BWF A;  4KDI C;  3ALB A;  1WXV A;  1FXT B;  4FLH A;  3ZNH B;  4EZJ A;  3B08 A;  2C9W B;  4HCN B;  4IM2 A;  2LVQ A;  1RRB A;  1X1M A;  1UBI A;  3MTN B;  3UGB B;  2LI5 A;  1RFA A;  1A5R A;  1V80 A;  4NAW A;  5E6P A;  2GBJ A;  2KNB A;  4TV3 A;  2HTH A;  2JY6 A;  5E6O A;  4W9C A;  3TMP B;  3V6C B;  1V49 A;  3DDC B;  3PZD A;  3B1L X;  1PQS A;  2BYV E;  3H7P A;  4G11 A;  4FBJ B;  2A4Z A;  2FUH B;  5G55 A;  4ANU A;  3M95 A;  2K39 A;  1V86 A;  4F8C B;  4W9D A;  3A1Q A;  3QC8 B;  4W9I A;  5AZF A;  5KHO A;  3QCA A;  1C1Y B;  2L3Z A;  2AL3 A;  4HPL B;  3VXW A;  2JZ3 B;  2KWC A;  1WRD B;  2KX0 A;  4GU2 A;  3WAP A;  4G50 A;  4KZC A;  3PS6 A;  2KDB A;  3PSE B;  4JGH B;  2DZK A;  4ZRK A;  4KSK C;  2CR5 A;  4KVG B;  3ZNI D;  2NBU A;  1V5T A;  4ICV A;  4MDK E;  2FID A;  2XEW A;  4JLC A;  5CHF A;  4ZRJ A;  3ZNG C;  1E8Z A;  3DPD A;  2K8H A;  3PRP B;  4GXB A;  1WM2 A;  1AAR A;  2RPQ A;  5TR5 A;  4ASW C;  3HM3 A;  3X0W A;  1K8R B;  3DCG A;  2JRI B;  4K1R B;  1WGY A;  4NAW B;  2EMS A;  5D7G A;  3ECI A;  3L0W B;  4DHZ E;  1U4A A;  3H9D A;  4GDK A;  4LDT B;  4XC2 A;  1SE9 A;  1E8W A;  5G2N A;  3T8M A;  4BOZ B;  3H6N A;  2KMC A;  1ZGU B;  2ZPN A;  1WYW B;  1TTN A;  2N9E B;  2MBB B;  2KZR A;  2N1W A;  5HKH A;  5LXI B;  2QHO A;  3D32 A;  1T0Y A;  4A3P A;  3A1Q B;  4F1S A;  5JHB A;  1QZE A;  2HD5 B;  2J7Q B;  3ZO5 B;  3VQI A;  5CHW A;  2L7R A;  1P1A A;  3WA0 A;  1Y8R C;  3JYU A;  1P0R A;  3QHT A;  2JUO A;  3NZU A;  3U30 A;  2WWZ A;  1V81 A;  4NJ6 A;  4EFO A;  2O2V B;  4DWF A;  4RMA A;  1WGD A;  1L7Y A;  1MG8 A;  4LJP B;  4BVU C;  4EUT A;  1P9D U;  2GMI C;  2IO3 B;  4BOS C;  2LRU A;  2CHX A;  2IO1 B;  3JVZ X;  3VTU A;  2BYE A;  3C0R B;  5DCN A;  2Z0E B;  2MBE A;  4AOF A;  2PE6 B;  3X23 A;  2ZPY A;  3AU5 A;  4IM0 A;  2V3S A;  2ZCC A;  4G3X B;  4AP4 C;  4EZK A;  3DOW A;  4W9H A;  3DQV A;  4A20 A;  4TQ0 A;  2C60 A;  4NQL B;  3H7S A;  4DHJ D;  3WAN A;  2MLB A;  3ZVV A;  1Q5W B;  3SU8 X;  2R2O A;  4P7I A;  1HE8 A;  3UF8 A;  1UBQ A;  2XK5 A;  3PLU A;  2LRW A;  2EKE C;  2LD9 A;  1L2N A;  3V62 A;  1V6E A;  3MJW A;  2KN5 A;  2OJR A;  2ZNV C;  1J0G A;  1OQY A;  3PVL A;  3KUC B;  1GC6 A;  2YLM A;  3PRZ A;  5DPT A;  1WGG A;  1Q0W B;  1WJ4 A;  2CS4 A;  1NBF C;  3JSV B;  4TKN A;  2L8J A;  4I6N B;  2UWQ A;  1VD2 A;  2ZCB A;  4RM9 A;  2I1J A;  2KC1 A;  2A5U A;  2AL6 A;  1E90 A;  4ZYN A;  2ZEQ A;  3ONS A;  2D2Q A;  2KJ6 A;  1KOT A;  2G4S A;  3A4R A;  4LDT D;  2N7E A;  4W9K A;  1IP9 A;  2BKR B;  2DEN B;  3RZW C;  2L0T A;  2O6V B;  3OJ4 B;  3KYC D; 
#chains in the Genus database with same CATH topology
 4MGK E;  1P3Q U;  1T0S C;  4XWW A;  3CF6 E;  3VR8 B;  3M62 B;  3W2D A;  3CMM B;  3L17 A;  2G4D B;  4I6P A;  4RFB A;  2CU1 A;  3QK0 A;  1JWB D;  3FIL A;  4WWN A;  3U7D A;  2KFK A;  4JX1 C;  3IBE A;  1ZOY B;  2L76 A;  1WRI A;  1ET9 A;  3AE2 B;  4G0N B;  3DBR B;  3DHI C;  3APC A;  4HWI B;  2M56 B;  1TS4 A;  2XNA C;  4MM3 A;  4DDI D;  2KK8 A;  5E6J A;  2BGF A;  2FCS A;  2BT6 A;  2PVG C;  3KYD D;  4CO7 A;  1G6J A;  2IZV B;  1WMH A;  2EMT A;  1MFW A;  4DXG A;  4S0R A;  4FN2 A;  1JW9 D;  5D2M B;  2H89 B;  3VH3 B;  3DBH B;  1N6Z A;  1NEN B;  5FKA C;  4I6L B;  2CJO A;  2DBY A;  2WYQ A;  4IG7 B;  2RPV A;  3UIP B;  1ISN A;  5C1Z A;  3TIX A;  1TBE A;  3GE3 C;  3LJ3 A;  2J0J A;  1CMX B;  4B9K A;  1IUE A;  1UGJ A;  3QX1 A;  4IC7 B;  4WJQ A;  3PT2 B;  2O6V D;  2WXH A;  4M8M A;  2TSS A;  4IM3 A;  1E6E B;  1F2R I;  3M63 B;  3ZUN A;  2KDM A;  1AW7 A;  5AUI A;  4JIO U;  1MHX A;  3A4S C;  1EM7 A;  3ZW3 A;  4OVZ A;  2JVC A;  4ITK A;  3V60 A;  3NHE B;  3U4E G;  1LM8 B;  3W1S C;  4DDG D;  2L0F A;  1BT0 A;  3RCZ A;  2CKH B;  4WWP A;  1L4Z B;  4DXA B;  4KDL B;  2LJI A;  2GBM A;  2IGG A;  1WIA A;  5L95 C;  1TS5 A;  2LGI A;  3AV8 A;  2ZVO A;  2OJW A;  4JL9 A;  3MFG A;  1UH6 A;  2M17 A;  2NMQ A;  2WU5 B;  4M02 A;  5G5H A;  2D3G A;  2J42 A;  3ZKJ C;  1J19 A;  2JQR B;  3TBL D;  1DYQ A;  4NY0 A;  1V9J A;  3QJZ A;  2Y3A A;  4GN1 A;  1AN8 A;  1EF5 A;  1WE6 A;  1DOX A;  1KJT A;  2DAF A;  4IWQ A;  1C78 A;  2KWU B;  1KTK A;  4WAF A;  3AMZ A;  2LXA A;  2GBK A;  2FBW B;  3UIN B;  3BWU D;  5FK9 C;  4F7Z A;  2RDB C;  3P4R B;  2K8C A;  1LFD A;  2NPT B;  5J2R A;  3PHX B;  1FMA D;  1D6E C;  4WWM A;  1MG4 A;  3KVF B;  1E9M A;  2C7N B;  3BIN A;  2GBN A;  3TEY A;  2KQ7 A;  4AS1 A;  4E3C A;  2AYO B;  1D5Z C;  1QKZ A;  4NJ7 A;  3FIL B;  2X8X X;  3RMK C;  2FE8 A;  4KGR A;  3HK0 A;  2KFK B;  4HDQ A;  2MCN B;  2FCM A;  1GUA B;  1YQ4 B;  3ZJU A;  3VFK A;  2C5L C;  3HIZ A;  4NQK E;  5EE0 A;  4O1N A;  2KDF B;  2HDE A;  2O2V A;  1C76 A;  1M4V A;  1WX8 A;  1HZ6 A;  4HLE A;  4RNA A;  2D11 A;  1WE7 A;  3ZLZ A;  3RNC C;  1WMH B;  4ZYS A;  5DPR A;  4ZRI A;  4N9F 4;  1SXT A;  1EUV B;  5AZH A;  4RGM A;  4US8 A;  1C4C A;  4B6W A;  3RZF A;  1PFD A;  3T3O A;  1OTR B;  4OZC A;  2MX2 A;  4QAY A;  1L6V A;  2WXO A;  2BF8 B;  1IGD A;  3K9O B;  2KN4 A;  2KMA A;  1CJE A;  3ENE A;  1YQ3 B;  4YXD B;  3KLS X;  2Y5C A;  2BQQ A;  3AH7 A;  5BYQ A;  2ASQ A;  4PS8 A;  4L1B A;  1F2R C;  3VUX A;  4JE3 B;  1ZXI A;  4M0W A;  2UYZ B;  1XLO A;  4IWO A;  3P63 A;  1WYG A;  2X38 A;  4B0M A;  3MJ5 A;  1YX5 B;  4HCP B;  2K8B A;  1D5X C;  2AX5 A;  4K7U A;  1GNU A;  3DBL I;  2PW9 A;  3DBS A;  1SIJ A;  2WXN A;  2JX5 A;  4EEW A;  4P1C C;  1XCT L;  2IO0 B;  2WDR B;  4BKT A;  1DOI A;  2YEP F;  3AN1 A;  4HXD A;  5DPS A;  5T8I A;  3AI5 A;  1D4B A;  1E7V A;  3IG3 A;  2J0K A;  5L83 A;  3GE8 C;  1ESF A;  4MGZ E;  1VCB A;  4PYU A;  2V4L A;  4LJO B;  2BWF A;  4IM2 A;  1RRB A;  1X1M A;  2I38 A;  1V80 A;  2KNB A;  2HTH A;  4W9C A;  3BVG A;  3PZD A;  2BYV E;  3H7P A;  3N1Y C;  2BB6 A;  2KAC A;  4W9D A;  3QC8 B;  1WGK A;  4W9I A;  5AZF A;  3QCA A;  4HPL B;  3VXW A;  1PUT A;  2HTM E;  1WRD B;  2INP E;  1K50 A;  1V1P A;  3WAP A;  3PZ8 A;  1FXA A;  1WWT A;  2DZK A;  4ZRK A;  4ICV A;  2QSD A;  1E8Z A;  2D3A A;  3DPD A;  2INC C;  2RPQ A;  1AAR A;  3P4P B;  3Q8F A;  2GLS A;  3HM3 A;  1WGY A;  4NAW B;  5D7G A;  3ECI A;  4ZRP A;  4LLG M;  1SF0 A;  3H6N A;  4ZRQ A;  1TKG A;  2K9X A;  1MVK A;  1WYW B;  2N9E B;  5LXI B;  2KZR A;  1C77 A;  1N5X A;  3A1Q B;  3TEW A;  2J7Q B;  2MEK A;  1P1A A;  3AED B;  1Y8R C;  2L32 A;  2DLB A;  1V81 A;  1JRO A;  2O2V B;  4DWF A;  4RMA A;  4EUT A;  2GMI C;  3ZGZ A;  1TY0 A;  5DCN A;  4AOF A;  2GRI A;  1XXG A;  2V3S A;  4DXF A;  4A6Q A;  1FCC C;  3DQV A;  4A20 A;  5H92 C;  1BUI C;  3MHZ A;  3AE3 B;  2JXT A;  1GAQ B;  4OZB A;  2BYT A;  2OJR A;  2R61 A;  2YLM A;  3H8H A;  1Q0W B;  3BK1 A;  1NBF C;  2L8J A;  1VD2 A;  2LFI A;  2A5U A;  4ZYN A;  2D2Q A;  2KJ6 A;  3A4R A;  4KX6 B;  4HRO A;  2J53 A;  2D5G A;  2DZJ A;  2LHD A;  3PHW B;  1CZP A;  1J7A A;  2WHI A;  4M0W B;  1Z5S B;  1C3T A;  4W9L A;  1EF1 A;  3RNA C;  4TUU A;  3B0A A;  4K3B A;  4HK2 A;  5AUK A;  1R4M B;  2M8S A;  4NNJ B;  3M3J A;  1WJU A;  2LAS A;  5JH5 C;  2LXC A;  1WJ6 A;  4OHJ A;  3UI3 A;  4MGI E;  2IBI B;  1NI2 A;  3QAQ A;  4PS3 A;  2MQJ A;  3LYY A;  1TZ1 A;  2ZW1 A;  2WXJ A;  3CSF A;  1NI3 A;  3O13 A;  2DX5 B;  4GDL A;  2MSE D;  4REZ A;  4C7Z A;  4MAC A;  4IW0 A;  4K7W A;  1E10 A;  3IT6 B;  3NVV A;  2IO2 B;  3DWG C;  4PT5 A;  2E6X A;  3NJT A;  4NJC A;  3TL5 A;  3ZDT A;  3R2I A;  3MP9 A;  3H7P B;  2GOW A;  3LB8 C;  1KF6 B;  4E71 A;  3IT4 B;  3DBL B;  2KO3 A;  2REX A;  1AWD A;  1V1P B;  2N9L A;  3RUL A;  3ZJT A;  4MJS A;  5BO4 B;  1VZ6 A;  4W9G A;  3Q8B A;  3WAO A;  5FR3 A;  4JPS A;  2QCZ A;  1VRA B;  2M1M A;  2LGS A;  2EKI A;  3Q6B A;  4JQW C;  2BPS A;  2KHW B;  4XX5 A;  3NG0 A;  3HRD D;  1AYF A;  4LNN A;  3W1S A;  4PK1 A;  3VRB B;  2LVO A;  3WIM A;  1GJZ A;  3Q14 C;  1VDV A;  4BBN C;  1ZP0 B;  5D3D A;  3AXC A;  3VTV A;  3AEA B;  4A9A A;  2WXM A;  4HVB A;  4M8N A;  2WXP A;  5GXG B;  1E5W A;  3A9K A;  1DOY A;  1GG3 A;  4YWG G;  2KX3 A;  4KZ0 A;  1I4X A;  1OQR A;  3R8B A;  4K7S A;  4C00 A;  2PIA A;  3Q3J A;  2D07 B;  2MH7 A;  4WH4 A;  4M00 A;  1WX9 A;  2NPT A;  2Z59 B;  1XT9 B;  3AU4 A;  3NY5 A;  3L16 A;  1I42 A;  4FUL A;  1EWY C;  5HFY A;  3OWE B;  3P2B A;  1WH3 A;  1VZ8 A;  3GZN B;  1JWA D;  1E8Y A;  3PO0 A;  2NBW B;  2ZNV B;  3BII D;  2FCQ A;  4LK0 M;  2WDT B;  3DVN U;  4BKS D;  4YTP B;  1YOV B;  1N62 A;  2LMC A;  1RLF A;  1WXQ A;  2MP2 B;  2VH2 A;  1C9F A;  2I1K A;  4RM8 A;  1VZ7 A;  1UWX A;  2B3A A;  2AWT A;  2N7J A;  5CTR C;  1PGX A;  5H8Y E;  3R2T A;  3RI7 C;  4GIV A;  1L0X B;  5KHQ A;  3APD A;  3Q3M C;  1UZX B;  2K1F A;  1BXT A;  3DVN V;  1LGR A;  3HVZ A;  2IDY A;  4RGN A;  3SD5 A;  2DYO A;  1XO3 A;  4WJO A;  1RAX A;  2JRH A;  2WQY B;  3DWM A;  5DPW A;  4ARC A;  1V97 A;  4ANX A;  2M0A A;  3NS8 A;  3BYT B;  3P1M A;  1LXD A;  5E6N A;  2MA9 B;  1H4R A;  3WAM A;  3EUB 2;  2KVZ A;  4FA6 A;  2K22 A;  4GDL B;  3Q8E A;  5G5G A;  3OLM D;  1SE4 A;  4YTM B;  3AE1 B;  3N3K B;  4TMA B;  2KQ4 X;  3ZRC A;  2RSU A;  5BYS A;  2MJD A;  1KLG D;  1KFY B;  1R4N B;  2LGD A;  3JSV A;  4HEA 1;  2JZZ A;  1JQ4 A;  1P7F A;  2CHZ A;  4BBN F;  4H2A A;  5GMV A;  2BS4 B;  3DVG Y;  4FJZ A;  2VRR B;  2VH1 A;  3DVG X;  2IJ0 A;  3E56 A;  2PPH A;  4NZL B;  1S3S G;  1YJJ A;  3OAW A;  1ENF A;  4MJS B;  2V1Y A;  2G3Q B;  4X57 B;  3V3X A;  3IXS A;  3ML8 A;  4P16 A;  1WXM A;  1B9R A;  2R2Q A;  2WXG A;  2JWU A;  2DYB A;  5AEK B;  3RNB C;  1F9J A;  3EA6 A;  1VR9 A;  1GPX A;  3VDZ A;  3PLV A;  2N4F A;  1V1O A;  3IVF A;  1PYW D;  2BWE S;  3A9K B;  2JPH A;  3I3T B;  2KTR A;  1FXI A;  3CIR B;  3ZNZ B;  2E3T A;  5IOI A;  1TKE A;  2LZ6 A;  3BVM A;  2KLG A;  1FRD A;  2UU7 A;  4M01 A;  1EU3 A;  4FXC A;  3C19 A;  2FNJ B;  3ALB A;  1QOF A;  4FLH A;  4EZJ A;  4HCN B;  2C9W B;  2CU3 A;  2LI5 A;  1I4H A;  4NAW A;  1B1Z A;  4P6V F;  2K3U A;  2GI9 A;  3TMP B;  1MI0 A;  1V49 A;  3DDC B;  1PQS A;  4FBJ B;  2A4Z A;  2FUH B;  5G55 A;  4F8C B;  2K39 A;  1V86 A;  2KT7 A;  1T0R C;  3A1Q A;  2DNF A;  2YEP B;  1C1Y B;  4Q2J A;  1C4P A;  1CK1 A;  2PKO A;  4ZHP A;  4G50 A;  4RF1 A;  3PZ7 A;  3N20 C;  4KSK C;  4KVG B;  3AEG B;  3ZNI D;  3ZNG C;  2FID A;  2XEW A;  4EE2 A;  4OZA A;  2K8H A;  1XF5 L;  3B2F A;  1JCK B;  2EMS A;  1U4A A;  4GDK A;  4LDT B;  3T8M A;  2KMC A;  2RDG A;  3I57 A;  1YN4 A;  5EE1 A;  4CQN A;  3D32 A;  1T0Y A;  4IDI A;  4A3P A;  5JHB A;  2HD5 B;  2VZK B;  3ZO5 B;  3Q69 A;  5CHW A;  1L5P A;  1XEE A;  2OHF A;  3RN9 C;  1UUP A;  1P0R A;  3QHT A;  3NZU A;  3U30 A;  4NJ6 A;  1L7Y A;  4LJP B;  4BVU C;  1P9D U;  4BOS C;  2CHX A;  3JVZ X;  3C0R B;  4K3C A;  1QF6 A;  3KWV A;  1MPE A;  2ZPY A;  2ZCC A;  3DOW A;  1ZDX A;  2C60 A;  3H7S A;  4DHJ D;  2R2O A;  2LD9 A;  5BYR A;  1V6E A;  3MJW A;  2WNM A;  1J0G A;  3KUC B;  1GC6 A;  2WU2 B;  3PRZ A;  5DPT A;  2CS4 A;  1F52 A;  3JSV B;  2Y5P A;  2UWQ A;  2Z8L A;  2ZCB A;  2KC1 A;  1I4R A;  2MJE A;  2G4S A;  4LDT D;  2N7E A;  3IAM 1;  2L0T A;  1QOB A;  3T9L A;  3Q8C A;  1WXA A;  2N9P C;  3SDL C;  2NTT A;  4NAM A;  4RCO A;  2VZK D;  3V05 A;  5EE3 A;  1QOA A;  4KIK A;  2QC8 A;  2CHW A;  1QLB B;  1V8C A;  3KQ4 A;  3B2G A;  1I4G A;  2KXJ A;  4LNF A;  4EOY A;  1XLP A;  3GB1 A;  2G1E A;  4MSM B;  4XDD A;  4ANV A;  4JWU C;  1FD6 A;  1GOZ A;  1M94 A;  5TSS A;  3IHP C;  1IYF A;  2W54 A;  2LUE A;  5J18 A;  2KJH B;  1T0Q C;  2KTR B;  1XLN A;  3U8Z A;  4IUM B;  1A70 A;  4HRS A;  2NCN A;  1WF9 A;  2W82 A;  4YTN B;  2BYF A;  3BZD B;  2KFJ A;  1D3Z A;  3PTF C;  2WX1 A;  2NTS A;  2MWS B;  2BS2 B;  2MBQ A;  1FEH A;  1IGC A;  4AUQ C;  3N32 A;  5HHD G;  2KKC A;  2QIL A;  4BKS A;  2G9H D;  1OGW A;  4N58 A;  1HXY D;  4CHK A;  3VUY A;  2L1A A;  5BMI A;  2BVC A;  4AJY B;  4MH8 A;  1ACC A;  3W5V B;  1YNT E;  2LJ5 A;  2WXF A;  5FR6 A;  2JZP A;  1I4Q A;  1ZKH A;  3ZYY X;  2KC2 A;  5IA7 A;  3SHQ A;  3FC4 A;  4KSL C;  3EC8 A;  2OOB B;  4WQO B;  3IAS 1;  1N61 A;  3OG5 A;  1SJH D;  1P98 A;  4PS7 A;  4YSY B;  1VJK A;  2JWZ A;  4AWJ A;  3A33 B;  3HVD A;  4KKI A;  4DBG A;  1KLU D;  3P42 A;  4BAX A;  1FPY A;  2MBH A;  2NR2 A;  4GDK B;  4MSQ B;  3ML9 A;  4A55 A;  1H8C A;  3NVY A;  5I4D A;  2DZM A;  3VTW A;  1TS2 A;  3ZXR A;  4EZL A;  5EDS A;  3V6E B;  4RGO S;  1WX7 A;  2GB1 A;  1JRU A;  4TSS A;  3KUD B;  3RPF C;  3NS1 A;  1YN5 A;  2W9N A;  3A9J A;  2KVR A;  1D5M C;  3AE5 B;  2RMM A;  3MC8 A;  3H1U A;  4TQ1 A;  2SAK A;  2HJ8 A;  4MEL A;  1T5X D;  1YJ1 A;  1OEY J;  4WAA A;  2K6Q A;  2MP2 A;  3ZQ4 A;  4BKG A;  2JXX A;  1UGM A;  2J0M A;  3Q8A A;  3ZRF A;  1YX6 B;  2MJ3 A;  3NZ3 A;  5AZG A;  4ZHO A;  1WGH A;  2G45 B;  2KLC A;  4ANW A;  3VR9 B;  2NBV B;  3QA8 A;  3QQ8 B;  4XE0 A;  1PGA A;  2MRP A;  4GOC A;  3IFW B;  2N9X A;  3PRM B;  4OVV A;  4E74 A;  1Q10 A;  3EFU A;  1UNS A;  3DHH C;  4IWP A;  4LNK A;  3EFC A;  4KV2 A;  3ETR A;  3W1Y A;  4URK A;  1GC7 A;  1NVI D;  1ZPS A;  3AM9 A;  4FJV B;  4C56 C;  2IY0 B;  2JT4 B;  5C3J B;  4KIK B;  4YL8 A;  2PTL A;  2IGH A;  2NVU I;  3AEF B;  2C7M B;  1FIQ A;  2BBC A;  5D94 A;  1SBB B;  2IND C;  1WY8 A;  4FAD A;  2WX0 A;  1SJE D;  3P4S B;  3DHG C;  1WI0 A;  1YJI A;  1L6U A;  4HPP A;  2K5P A;  1WZ0 A;  1F0Z A;  2QMT A;  3KW5 B;  2WXK A;  4RGT A;  2N1V A;  2WDV B;  1EO6 A;  2KAJ A;  2H88 B;  3N9Y C;  4L2Y A;  3NZS A;  2IYD B;  1C79 A;  3HHM A;  3T3N A;  2FIF A;  2RGF A;  2DAJ A;  1K51 A;  2QEJ C;  1LQB A;  2B76 B;  4W9F A;  2IPK D;  2PE9 A;  4GMV A;  3UQA A;  2IGD A;  2KDE B;  2BKF A;  3J9C A;  2WLB A;  3ABV B;  3Q3O C;  1WR6 E;  1HTQ A;  3MC0 B;  3ZTC A;  1IPG A;  1YD8 U;  4FHJ A;  3GOE A;  1WFY A;  1T6B X;  4WJN A;  1RYJ A;  3E9S A;  3ZIM A;  3AEE B;  4HJK A;  2W3S A;  2MBO A;  2V4I B;  3L10 B;  3PV1 A;  4II2 B;  4XZ4 A;  4GSW A;  2WDQ B;  2QJL A;  4BZA A;  2WXQ A;  3CST A;  1N5W A;  3AUL A;  1WXS A;  2ACZ B;  1YQB A;  2ONQ A;  1SE3 A;  2LEK A;  4C4V A;  4A90 A;  2FUG 1;  4AJW A;  4ICU A;  3A9J B;  2KDI A;  3MC9 A;  1XQQ A;  4MT5 A;  4HDO A;  2LGX A;  3TEZ A;  2KJR A;  1NDD A;  1WM3 A;  3N1Z C;  1FCL A;  4KDI C;  3QWZ B;  1WXV A;  1FXT B;  3ZNH B;  1FNV A;  1E7P B;  3UGB B;  1UBI A;  3MTN B;  1BML C;  1RFA A;  2W55 A;  2KMM A;  5E6P A;  2GBJ A;  4TV3 A;  1I7H A;  2J4X A;  2ZW0 A;  4B0E A;  5E6O A;  3SR6 A;  3V6C B;  3B1L X;  4R3D A;  1NYR A;  4ANU A;  2CJN A;  3EGR A;  4UDU C;  4GU2 A;  1EU4 A;  3PS6 A;  4JGH B;  3TEX A;  2CR5 A;  5BMG A;  1V5T A;  4MDK E;  5CHF A;  4JLC A;  4ZRJ A;  5LNK 1;  4HJG E;  1TJE A;  3PRP B;  4GXB A;  3SFD B;  4ASW C;  5IKC M;  2JRI B;  4K1R B;  3L0W B;  4DHZ E;  5G2N A;  4BOZ B;  1E8W A;  4XDC A;  2PVO D;  2ZPN A;  1TTN A;  1KRH A;  2MBB B;  5HKH A;  2N1W A;  1E0Z A;  3VQI A;  4RF0 A;  3WA0 A;  4J3O D;  3JYU A;  1LO5 D;  1TYG B;  1SSN A;  4D2K A;  4XWT A;  2BS3 B;  1HZ5 A;  5IP4 D;  2IO1 B;  3VTU A;  2BYE A;  2Z0E B;  2MBE A;  3AU5 A;  2BB5 A;  3CWI A;  1YMH E;  4G3X B;  4EZK A;  3VRA B;  4W9H A;  1N63 A;  1Y56 A;  3ZVV A;  3RNE C;  2I2Y A;  3SU8 X;  4P7I A;  4KKJ A;  3UF8 A;  3FKY A;  2XK5 A;  3C8Y A;  2LRW A;  3V62 A;  5C2T B;  2KN5 A;  1OQY A;  1K53 A;  3PVL A;  3RFZ B;  1WGG A;  1WJ4 A;  4WQM A;  2RDH A;  4GLS C;  4TKN A;  4I6N B;  1UF0 A;  1UWM A;  3TSS A;  2JYT A;  4RM9 A;  2AL6 A;  1E90 A;  4WUR A;  2ZEQ A;  3ONS A;  4W9K A;  1IP9 A;  2DEN B;  3RZW C;  5IN7 A;  3OJ4 B;  3RYT A;  1TGZ B;  3O65 B;  2L00 B;  3R7Q A;  1ZW7 A;  3VHT C;  2YVC A;  4FJY A;  4YSZ B;  1WGR A;  1HEZ E;  3EHV A;  1GB1 A;  4DHZ B;  1TT5 B;  1K52 A;  1OFF A;  3AE9 B;  2KAN A;  2N0S B;  3LDZ E;  4HPM B;  1MJD A;  2WXI A;  2L05 A;  1SGH A;  3FAH A;  2K25 A;  1E7U A;  1F77 A;  4GGQ A;  4OVU A;  3U7Z A;  3V61 A;  3VH4 B;  4DQO C;  3AE8 B;  4DHJ B;  4C80 A;  2HE7 A;  4NPN A;  4C4V B;  5JXV A;  3RT3 B;  4YSX B;  2M19 A;  1Q1O A;  3PPA A;  2BTE A;  1KLV A;  1YIW A;  1JRP A;  3RUI B;  1IBX A;  2WXR A;  2ON8 A;  4DK5 A;  4N6E B;  4ZDV A;  1WR1 A;  5D6J B;  2AQ1 B;  4MGY E;  3BY4 B;  4MEM A;  1KM7 A;  1RWS A;  4KGT A;  2MW5 A;  4MM3 B;  1FRR A;  1DGJ A;  2LWP A;  3BYY B;  2ICI A;  1ET6 A;  2QDF A;  1OEY A;  4ACF A;  1TKY A;  3PRE A;  1WSP A;  1SEB D;  4J6I A;  1J8C A;  2JU6 X;  3L54 A;  1R4M I;  4LNO A;  1PGB A;  4OW0 A;  1J7C A;  1XD3 B;  1QOG A;  2M0X A;  4YT0 B;  3UQB A;  1JWM D;  4FHK A;  4AQ7 A;  2PMV A;  3KH0 A;  4L23 A;  1KH0 A;  5HI1 A;  3PGE A;  3NOB A;  3HM6 X;  2L52 A;  1FFV A;  2Y5B B;  1ZUD 2;  2KOX A;  4US9 A;  2LUM A;  2LHE A;  2D3B A;  3TUO A;  4BFR A;  5LXH A;  3SEB A;  3I5J C;  4LCD E;  2V3N A;  3ZDM C;  1S1Q B;  3WAL A;  3VUW A;  2HJ1 A;  2PEA A;  2EEL A;  2K0P A;  1STE A;  2XK5 B;  3L4P A;  1E8X A;  1FNU A;  2GBR A;  1UD7 A;  3JW0 X;  5J17 A;  3R66 C;  4HKQ A;  1I4P A;  1SIF A;  4ZOH C;  2ZVN A;  4W9E A;  2D3C A;  1Z2M A;  3MHS D;  1V2Y A;  4EKU A;  5CX3 A;  1J7B A;  5JHA A;  2KD0 A;  3AB5 A;  5EE9 A;  3TCA A;  3VAW A;  1JWU D;  4II3 B;  3R7R A;  3RNF C;  3NRZ A;  2V3P A;  3AEB B;  3W5U B;  4W9J A;  2RD0 A;  3AE7 B;  1C4A A;  2JYE A;  1ROE A;  2RR9 A;  3LXF A;  3RD2 A;  4CYE A;  2JF5 A;  3R3M A;  4USA A;  3N30 A;  1T3Q A;  3WCQ A;  3NVW A;  1TIF A;  3APF A;  3OJ3 A;  1RFK A;  4HKZ E;  2KTF A;  5JZE B;  2PJH A;  1WZ3 A;  1XLQ A;  2KYW A;  4KGS A;  4C7Y A;  2AQ3 B;  4RH6 A;  1QQR A;  3VVW B;  2N9K A;  2WXL A;  3EEC A;  3ZJV A;  2LGY A;  4IKG A;  3GZN I;  2N7D A;  1TZO A;  3BVZ A;  3HUI A;  1L4D B;  3I9V 1;  2Z0D B;  2KQS A;  5C23 A;  1IBX B;  1I35 A;  1GB4 A;  3QAR A;  3TJP A;  4A3O A;  4ARI A;  3DBR I;  1F1H A;  3L13 A;  4GB9 A;  4WWO A;  1XCQ L;  2AEH A;  3NVZ A;  3QIJ A;  1SB3 C;  2INN E;  2NS5 A;  5MPO A;  3UIO B;  1QIL A;  2QIE B;  1HTO A;  2M4N A;  2DYM A;  2SEB D;  5CHV C;  1V5O A;  2C7H A;  4PYZ A;  2DZI A;  3RNG C;  4B95 A;  4K81 A;  1JML A;  3DBH I;  2O6V A;  1FNW A;  3SFE B;  3Q3F A;  3NUH B;  3ZXV A;  5IAA C;  2IY1 B;  4LTU A;  4WJP A;  3ZTD A;  3KWL A;  2FAZ A;  1FM0 D;  2LVP A;  4MH0 E;  1NYQ A;  3GP7 A;  2WGS A;  3URY A;  2ZZP B;  4N59 A;  2D10 A;  3S2A A;  3K9P B;  1CQV A;  4JWS C;  1FO4 A;  1NEK B;  3U2S C;  2J52 A;  2AQ2 B;  1SE2 A;  3L08 A;  5LLI A;  1L0V B;  1UEL A;  2K6D B;  4WIP A;  2DHZ A;  1WJN A;  3N1X C;  1N60 A;  2FCN A;  3AEC B;  4LNI A;  2KWV B;  1TS3 A;  4S17 A;  3AE4 B;  1R4N I;  2XBB C;  2WS3 B;  2ZJD A;  3Q2A C;  3U52 E;  3I63 C;  3B08 A;  2LVQ A;  2BW2 A;  1ZE3 D;  1TY2 A;  3AE6 B;  1EWC A;  1A5R A;  2JY6 A;  3Q3N C;  1R7S A;  4G11 A;  3M95 A;  2DWQ A;  1HA5 A;  5KHO A;  3W9C B;  4XYC A;  2L3Z A;  2AL3 A;  2JZ3 B;  2KWC A;  3GS2 A;  1MHH E;  2KX0 A;  1OQQ A;  1QT9 A;  4KZC A;  2PLP A;  2KDB A;  3PSE B;  2Q5W D;  2XN9 C;  2NBU A;  1VLB A;  1WM2 A;  4XGA B;  5TR5 A;  1ZXH A;  3X0W A;  1K8R B;  3DCG A;  1RM6 C;  3H9D A;  4XC2 A;  1SE9 A;  3P4Q B;  1JWS D;  4A8X C;  1ZGU B;  2QHO A;  2L83 A;  4F1S A;  1QZE A;  3BK2 A;  2L7R A;  1PDX A;  2JUO A;  2WWZ A;  4EFO A;  1YN3 A;  1FFU A;  2V9H A;  1WGD A;  1MG8 A;  2IO3 B;  5IO9 A;  2LRU A;  5HG2 A;  2W3R A;  2PE6 B;  3X23 A;  4IM0 A;  4P1B C;  4AP4 C;  4TQ0 A;  4NQL B;  3WAN A;  2MLB A;  2V0G A;  1Q5W B;  1HE8 A;  1L0Y B;  1UBQ A;  3PLU A;  4IOI E;  2EKE C;  1L2N A;  1JAL A;  2OED A;  2ZNV C;  5BMH A;  3B9J A;  2JSV X;  1P7E A;  2I1J A;  2MHJ A;  1ZDV A;  1HQR D;  1KOT A;  2KWD A;  2WP9 B;  2BKR B;  3KUZ A;  2O6V B;  3KYC D;  5D3I B; 
#chains in the Genus database with same CATH homology
 3T9L A;  3PHW B;  3RYT A;  1TGZ B;  1WXA A;  3O65 B;  2N9P C;  2L00 B;  4MGK E;  3R7Q A;  1ZW7 A;  3SDL C;  3VHT C;  1P3Q U;  2YVC A;  4FJY A;  4M0W B;  1Z5S B;  1WGR A;  3EHV A;  2DZJ A;  3CF6 E;  3M62 B;  3CMM B;  4DHZ B;  1C3T A;  3L17 A;  4W9L A;  2G4D B;  4I6P A;  4KIK A;  2CHW A;  2CU1 A;  3QK0 A;  1EF1 A;  2KAN A;  3LDZ E;  4WWN A;  4HPM B;  3B0A A;  4TUU A;  3U7D A;  4HK2 A;  2KXJ A;  2KFK A;  2L05 A;  4EOY A;  1SGH A;  2M8S A;  3IBE A;  4MSM B;  4ANV A;  2K25 A;  4NNJ B;  1E7U A;  3M3J A;  1WJU A;  2L76 A;  4GGQ A;  1M94 A;  4OVU A;  3V61 A;  4G0N B;  2LAS A;  3VH4 B;  5JH5 C;  2LXC A;  3IHP C;  1IYF A;  4DHJ B;  2LUE A;  5J18 A;  2KJH B;  3APC A;  2HE7 A;  4HWI B;  4NPN A;  2KTR B;  3U8Z A;  3RT3 B;  4IUM B;  1WJ6 A;  4MM3 A;  4DDI D;  2NCN A;  1WF9 A;  2KK8 A;  2BYF A;  2BGF A;  1Q1O A;  2FCS A;  3PPA A;  4MGI E;  3KYD D;  4CO7 A;  1G6J A;  2IBI B;  2IZV B;  1WMH A;  1NI2 A;  2EMT A;  2KFJ A;  1D3Z A;  3QAQ A;  4PS3 A;  1KLV A;  3PTF C;  2WX1 A;  1YIW A;  2MQJ A;  1TZ1 A;  2MWS B;  4FN2 A;  2MBQ A;  3RUI B;  3CSF A;  5D2M B;  2DX5 B;  3N32 A;  2MSE D;  4GDL A;  3VH3 B;  4AUQ C;  2KKC A;  4I6L B;  4DK5 A;  4BKS A;  4IW0 A;  4K7W A;  4ZDV A;  1WR1 A;  2WYQ A;  4IG7 B;  1OGW A;  2IO2 B;  3UIP B;  1ISN A;  5C1Z A;  5D6J B;  3TIX A;  1TBE A;  3VUY A;  4CHK A;  4MGY E;  3LJ3 A;  3TL5 A;  2J0J A;  3BY4 B;  1CMX B;  3ZDT A;  4MEM A;  4AJY B;  4B9K A;  3QX1 A;  3H7P B;  4IC7 B;  3PT2 B;  1KM7 A;  2O6V D;  4WJQ A;  2GOW A;  4M8M A;  2LJ5 A;  2MW5 A;  5FR6 A;  4E71 A;  4IM3 A;  2KO3 A;  2LWP A;  1ZKH A;  2REX A;  3M63 B;  2KC2 A;  3ZUN A;  1OEY A;  3SHQ A;  4KSL C;  5IA7 A;  3RUL A;  4JIO U;  3A4S C;  4MJS A;  3ZW3 A;  5BO4 B;  3EC8 A;  2JVC A;  3PRE A;  4W9G A;  3V60 A;  2OOB B;  4J6I A;  4WQO B;  1J8C A;  3WAO A;  3L54 A;  1R4M I;  2M1M A;  1P98 A;  3NHE B;  4PS7 A;  2JWZ A;  4AWJ A;  3A33 B;  1LM8 B;  3W1S C;  4DBG A;  4DDG D;  4JQW C;  1XD3 B;  2M0X A;  2BPS A;  2KHW B;  2L0F A;  4XX5 A;  1BT0 A;  3RCZ A;  3W1S A;  3UQB A;  2CKH B;  2MBH A;  2NR2 A;  4GDK B;  4WWP A;  4MSQ B;  2LVO A;  3WIM A;  3ML9 A;  1H8C A;  4DXA B;  4KDL B;  4FHK A;  2DZM A;  3VTW A;  1GJZ A;  2GBM A;  1WIA A;  5L95 C;  4BBN C;  3AXC A;  3KH0 A;  3VTV A;  4EZL A;  5EDS A;  3V6E B;  3PGE A;  4M8N A;  4HVB A;  3NOB A;  3HM6 X;  1WX7 A;  1E5W A;  2ZVO A;  1JRU A;  4JL9 A;  1UH6 A;  3A9K A;  2M17 A;  2Y5B B;  3KUD B;  1GG3 A;  2KOX A;  2KX3 A;  4KZ0 A;  2W9N A;  4BFR A;  3A9J A;  2KVR A;  5LXH A;  4LCD E;  4K7S A;  2D3G A;  3ZDM C;  3ZKJ C;  3H1U A;  1S1Q B;  1J19 A;  4TQ1 A;  3TBL D;  3Q3J A;  3WAL A;  2HJ8 A;  4NY0 A;  4MEL A;  3VUW A;  1V9J A;  2D07 B;  3QJZ A;  4WAA A;  1YJ1 A;  1OEY J;  4GN1 A;  2K6Q A;  1EF5 A;  1WX9 A;  2MP2 A;  2PEA A;  2NPT A;  4BKG A;  2JXX A;  1UGM A;  2Z59 B;  1XT9 B;  2J0M A;  1WE6 A;  1KJT A;  3ZRF A;  3AU4 A;  3NY5 A;  3L16 A;  2DAF A;  1I42 A;  2XK5 B;  1YX6 B;  1E8X A;  4FUL A;  2GBR A;  4IWQ A;  2KWU B;  3P2B A;  1UD7 A;  1WH3 A;  5AZG A;  1WGH A;  2G45 B;  2KLC A;  1E8Y A;  4ANW A;  3JW0 X;  2NBW B;  5J17 A;  3R66 C;  2NBV B;  2ZNV B;  2FCQ A;  3QA8 A;  2LXA A;  3QQ8 B;  1SIF A;  2WDT B;  2GBK A;  3UIN B;  2ZVN A;  2MRP A;  4W9E A;  4GOC A;  1Z2M A;  3IFW B;  3MHS D;  2N9X A;  3DVN U;  3PRM B;  1V2Y A;  4OVV A;  4E74 A;  4BKS D;  3EFU A;  4EKU A;  5CX3 A;  4F7Z A;  2K8C A;  5JHA A;  1LFD A;  1RLF A;  2KD0 A;  4IWP A;  4KV2 A;  3TCA A;  3VAW A;  2MP2 B;  4II3 B;  2NPT B;  3R7R A;  3W1Y A;  4URK A;  3PHX B;  5J2R A;  1GC7 A;  2I1K A;  4RM8 A;  3KVF B;  2B3A A;  2AWT A;  4W9J A;  2C7N B;  2RD0 A;  4FJV B;  5CTR C;  3BIN A;  2GBN A;  2IY0 B;  2JT4 B;  2KQ7 A;  4GIV A;  4E3C A;  2AYO B;  4KIK B;  4YL8 A;  5KHQ A;  2RR9 A;  3RD2 A;  4CYE A;  2JF5 A;  4NJ7 A;  2NVU I;  3APD A;  3R3M A;  3N30 A;  2C7M B;  1UZX B;  3HK0 A;  2K1F A;  2KFK B;  4HDQ A;  2MCN B;  2FCM A;  5D94 A;  1GUA B;  3APF A;  3DVN V;  1WY8 A;  3OJ3 A;  4FAD A;  3VFK A;  2WX0 A;  1WI0 A;  3SD5 A;  2C5L C;  2DYO A;  2KTF A;  3HIZ A;  4NQK E;  5JZE B;  2KDF B;  4WJO A;  2PJH A;  2O2V A;  1WZ3 A;  1WX8 A;  1WZ0 A;  1RAX A;  2JRH A;  5DPW A;  4HLE A;  4ANX A;  2D11 A;  3KW5 B;  1WE7 A;  3VVW B;  3NS8 A;  2N1V A;  3EEC A;  1LXD A;  3ZLZ A;  1EO6 A;  5E6N A;  1WMH B;  2MA9 B;  2LGY A;  5DPR A;  1H4R A;  2N7D A;  3GZN I;  3NZS A;  4ZRI A;  3WAM A;  4FA6 A;  4N9F 4;  2IYD B;  2Z0D B;  1EUV B;  2KQS A;  5AZH A;  5C23 A;  1I35 A;  4GDL B;  3HHM A;  2FIF A;  2RGF A;  3OLM D;  2DAJ A;  3QAR A;  4B6W A;  1LQB A;  3RZF A;  4W9F A;  1OTR B;  3N3K B;  3TJP A;  4A3O A;  3DBR I;  2MX2 A;  2PE9 A;  3L13 A;  4GB9 A;  3ZRC A;  4WWO A;  2RSU A;  2AEH A;  3QIJ A;  2NS5 A;  2BF8 B;  4GMV A;  3UIO B;  3UQA A;  2KDE B;  2LGD A;  2M4N A;  3K9O B;  2BKF A;  2DYM A;  3JSV A;  2KMA A;  2JZZ A;  2CHZ A;  5CHV C;  3ENE A;  1V5O A;  4BBN F;  5GMV A;  3DVG Y;  2C7H A;  4FJZ A;  2VRR B;  4PYZ A;  2DZI A;  3DVG X;  2PPH A;  4B95 A;  1S3S G;  1WR6 E;  4K81 A;  3OAW A;  4MJS B;  2V1Y A;  2ASQ A;  3DBH I;  2O6V A;  4PS8 A;  2G3Q B;  3ZTC A;  1IPG A;  4X57 B;  1YD8 U;  3VUX A;  3ML8 A;  3Q3F A;  4FHJ A;  3GOE A;  1WFY A;  5IAA C;  2IY1 B;  3KUZ A;  4WJN A;  4WJP A;  1WXM A;  2UYZ B;  4IWO A;  2FAZ A;  3ZTD A;  3ZIM A;  2R2Q A;  2LVP A;  4MH0 E;  4HJK A;  2DYB A;  2MBO A;  5AEK B;  1F9J A;  1YX5 B;  4HCP B;  2K8B A;  3L10 B;  3PV1 A;  4II2 B;  2ZZP B;  3VDZ A;  3PLV A;  4XZ4 A;  4K7U A;  4GSW A;  1GNU A;  2D10 A;  3DBL I;  2N4F A;  3CST A;  3DBS A;  3S2A A;  3AUL A;  3K9P B;  1WXS A;  3IVF A;  4EEW A;  1YQB A;  2BWE S;  2IO0 B;  3A9K B;  2JPH A;  4BKT A;  3I3T B;  2KTR A;  3L08 A;  5LLI A;  4AJW A;  1UEL A;  3ZNZ B;  2K6D B;  4ICU A;  3A9J B;  2KDI A;  4HXD A;  5DPS A;  2DHZ A;  3AI5 A;  1XQQ A;  1E7V A;  4HDO A;  1WJN A;  2LGX A;  2LZ6 A;  2KLG A;  3IG3 A;  2J0K A;  5L83 A;  2FCN A;  4MGZ E;  1VCB A;  2KJR A;  2KWV B;  1NDD A;  1WM3 A;  4PYU A;  2V4L A;  4LJO B;  1R4N I;  2XBB C;  2ZJD A;  2FNJ B;  3QWZ B;  2BWF A;  4KDI C;  3ALB A;  1WXV A;  1FXT B;  4FLH A;  3ZNH B;  4EZJ A;  3B08 A;  2C9W B;  4HCN B;  4IM2 A;  2LVQ A;  1RRB A;  1X1M A;  1UBI A;  3MTN B;  3UGB B;  2LI5 A;  1RFA A;  1A5R A;  1V80 A;  4NAW A;  5E6P A;  2GBJ A;  2KNB A;  4TV3 A;  2HTH A;  2JY6 A;  5E6O A;  4W9C A;  3TMP B;  3V6C B;  1V49 A;  3DDC B;  3PZD A;  3B1L X;  1PQS A;  2BYV E;  3H7P A;  4G11 A;  4FBJ B;  2A4Z A;  2FUH B;  5G55 A;  4ANU A;  3M95 A;  2K39 A;  1V86 A;  4F8C B;  4W9D A;  3A1Q A;  3QC8 B;  4W9I A;  5AZF A;  5KHO A;  3QCA A;  1C1Y B;  2L3Z A;  2AL3 A;  4HPL B;  3VXW A;  2JZ3 B;  2KWC A;  1WRD B;  2KX0 A;  4GU2 A;  3WAP A;  4G50 A;  4KZC A;  3PS6 A;  2KDB A;  3PSE B;  4JGH B;  2DZK A;  4ZRK A;  4KSK C;  2CR5 A;  4KVG B;  3ZNI D;  2NBU A;  1V5T A;  4ICV A;  4MDK E;  2FID A;  2XEW A;  4JLC A;  5CHF A;  4ZRJ A;  3ZNG C;  1E8Z A;  3DPD A;  2K8H A;  3PRP B;  4GXB A;  1WM2 A;  1AAR A;  2RPQ A;  5TR5 A;  4ASW C;  3HM3 A;  3X0W A;  1K8R B;  3DCG A;  2JRI B;  4K1R B;  1WGY A;  4NAW B;  2EMS A;  5D7G A;  3ECI A;  3L0W B;  4DHZ E;  1U4A A;  3H9D A;  4GDK A;  4LDT B;  4XC2 A;  1SE9 A;  1E8W A;  5G2N A;  3T8M A;  4BOZ B;  3H6N A;  2KMC A;  1ZGU B;  2ZPN A;  1WYW B;  1TTN A;  2N9E B;  2MBB B;  2KZR A;  2N1W A;  5HKH A;  5LXI B;  2QHO A;  3D32 A;  1T0Y A;  4A3P A;  3A1Q B;  4F1S A;  5JHB A;  1QZE A;  2HD5 B;  2J7Q B;  3ZO5 B;  3VQI A;  5CHW A;  2L7R A;  1P1A A;  3WA0 A;  1Y8R C;  3JYU A;  1P0R A;  3QHT A;  2JUO A;  3NZU A;  3U30 A;  2WWZ A;  1V81 A;  4NJ6 A;  4EFO A;  2O2V B;  4DWF A;  4RMA A;  1WGD A;  1L7Y A;  1MG8 A;  4LJP B;  4BVU C;  4EUT A;  1P9D U;  2GMI C;  2IO3 B;  4BOS C;  2LRU A;  2CHX A;  2IO1 B;  3JVZ X;  3VTU A;  2BYE A;  3C0R B;  5DCN A;  2Z0E B;  2MBE A;  4AOF A;  2PE6 B;  3X23 A;  2ZPY A;  3AU5 A;  4IM0 A;  2V3S A;  2ZCC A;  4G3X B;  4AP4 C;  4EZK A;  3DOW A;  4W9H A;  3DQV A;  4A20 A;  4TQ0 A;  2C60 A;  4NQL B;  3H7S A;  4DHJ D;  3WAN A;  2MLB A;  3ZVV A;  1Q5W B;  3SU8 X;  2R2O A;  4P7I A;  1HE8 A;  3UF8 A;  1UBQ A;  2XK5 A;  3PLU A;  2LRW A;  2EKE C;  2LD9 A;  1L2N A;  3V62 A;  1V6E A;  3MJW A;  2KN5 A;  2OJR A;  2ZNV C;  1J0G A;  1OQY A;  3PVL A;  3KUC B;  1GC6 A;  2YLM A;  3PRZ A;  5DPT A;  1WGG A;  1Q0W B;  1WJ4 A;  2CS4 A;  1NBF C;  3JSV B;  4TKN A;  2L8J A;  4I6N B;  2UWQ A;  1VD2 A;  2ZCB A;  4RM9 A;  2I1J A;  2KC1 A;  2A5U A;  2AL6 A;  1E90 A;  4ZYN A;  2ZEQ A;  3ONS A;  2D2Q A;  2KJ6 A;  1KOT A;  2G4S A;  3A4R A;  4LDT D;  2N7E A;  4W9K A;  1IP9 A;  2BKR B;  2DEN B;  3RZW C;  2L0T A;  2O6V B;  3OJ4 B;  3KYC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...