2V3SA

Structural insights into the recognition of substrates and activators by the osr1 kinase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
b'GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE OSR1
publication title Structural Insights Into the Recognition of Substrates and Activators by the Osr1 Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2v3sA00
4KIKB 4HJKA 1F9JA 3PS6A 3TIXA 3ZNID 3LDZE 2MLBA 4GN1A 5IA7A 5JHAA 4HPMB 1LFDA 4GXBA 4MGKE 1Q0WB 2FIFA 2G4DB 4AWJA 3B0AA 3SHQA 1UBQA 3APDA 1P0RA 3JSVA 1G6JA 3DBHI 1WE6A 1RAXA 3TBLD 3T9LA 2BYFA 4K81A 4MJSB 1Y8RC 3TJPA 3UINB 4K1RB 2DAJA 1YJ1A 2KWCA 2R2OA 2XK5B 2NBWB 3OJ4B 3QWZB 4GDKB 2FCNA 3ZDTA 3L10B 3ZNGC 3M3JA 1MG8A 1OGWA 4ANWA 4E71A 1X1MA 3ZDMC 4FJYA 2ZZPB 4I6LB 2LGXA 3NZSA 2WX0A 4MGZE 5AZGA 1TZ1A 3VUWA 2KC1A 3QA8A 2FCSA 1J8CA 2NCNA 1VCBA 3ZLZA 2I1JA 2C7MB 4HLEA 2XBBC 5G55A 4CHKA 4ZRKA 3QK0A 5D94A 3IG3A 4BBNF 2JPHA 1WRDB 2LASA 2GBRA 4PS8A 3WAPA 2M4NA 2KO3A 3ALBA 3VUYA 2BPSA 3H1UA 4WQOB 5CX3A 3KUZA 3ML9A 3PZDA 4IM3A 3KYCD 3B08A 3C0RB 3A9JA 3V62A 2BWFA 2DZKA 3DBRI 4I6NB 1WJUA 4NQLB 1T0YA 2G45B 1WZ3A 4AJYB 1GJZA 1YX5B 2KJHB 2JWZA 3CMMB 3L0WB 2V4LA 2J0MA 4P7IA 3PRMB 2WWZA 1UD7A 2KD0A 3BY4B 2RGFA 4AOFA 4JGHB 4W9LA 2KMCA 3CSTA 2N1WA 5GMVA 2NR2A 1WGHA 2BYVE 2KHWB 4GB9A 4II2B 1GG3A 5DCNA 4FN2A 4IM2A 1IP9A 4GDLA 1Z2MA 1UGMA 1LM8B 2L0FA 5KHOA 2D11A 2MBOA 1E7VA 3L16A 4NAWA 1I42A 3W1SC 4MELA 5AZFA 4AUQC 3N32A 2C9WB 3VQIA 2K8HA 3U7DA 3I3TB 1WX8A 4W9JA 3UF8A 3PGEA 4G50A 3UIOB 1OTRB 3RUIB 2D07B 3KUDB 1LXDA 2MBBB 1M94A 2PJHA 3VDZA 3AU4A 2GBKA 2CHWA 3VXWA 3APCA 2FCQA 2M8SA 3JSVB 4F8CB 3VTVA 1EUVB 4BOZB 2YVCA 2ASQA 4MSMB 4MDKE 5AZHA 2J0JA 2LGYA 2ZEQA 3DOWA 4DDID 4F7ZA 4BFRA 3PPAA 1J0GA 1WZ0A 4K7WA 2ZVNA 3RYTA 3PREA 3WIMA 4TUUA 1V6EA 2IY0B 1OEYA 2GOWA 2MBQA 3AU5A 3QAQA 3KYDD 2WDTB 3DCGA 3UQBA 3R7RA 3V60A 3A33B 4LJPB 2KX3A 3ECIA 4M0WB 4IC7B 1C3TA 3Q3FA 4HPLB 5E6OA 2REXA 5JH5C 3T8MA 3L08A 2O2VB 3IFWB 2HD5B 4MM3A 3ZNHB 1ZW7A 2KLCA 5E6NA 3QCAA 1EF1A 1E7UA 1WY8A 1WFYA 2M0XA 4KZCA 5D7GA 2JF5A 1YX6B 4RM9A 2C5LC 4F1SA 2OJRA 2NBUA 2UYZB 1YD8U 4I6PA 3EECA 1P1AA 4DXAB 2W9NA 4A3PA 1YIWA 2HE7A 4LDTB 3ZRCA 3V6EB 4EUTA 2RSUA 2ZNVC 2IYDB 2JUOA 3KUCB 1RRBA 2NPTB 2LD9A 4WJQA 2RPQA 1KM7A 3HIZA 4GDLB 2KKCA 3VTUA 3VUXA 1D3ZA 1E90A 4ZYNA 4DBGA 2DZMA 4PS7A 4DDGD 4NAWB 4AP4C 1K8RB 4FA6A 2DZJA 4DWFA 1V5TA 4GMVA 4GGQA 3M62B 1WGGA 5TR5A 4ASWC 4CO7A 3OJ3A 3CF6E 4HWIB 4EOYA 2KNBA 1SGHA 4NQKE 1V86A 1NI2A 1XD3B 1R4NI 4KVGB 3WANA 2Z59B 2GBMA 4FADA 1BT0A 3HM6X 2DENB 3H6NA 4WJNA 4EKUA 3U8ZA 3GZNI 2J7QB 2JRIB 4J6IA 4W9IA 2ZCBA 1V81A 2LUEA 2K8CA 1GC7A 4ICUA 4LJOB 2K6QA 2L7RA 4NJ6A 3H9DA 4ICVA 4RMAA 4B95A 1Q5WB 3IBEA 5KHQA 1L7YA 2A4ZA 2ZPNA 4W9KA 4EZKA 3QX1A 4II3B 4EZLA 5EDSA 4EEWA 1ZKHA 1Q1OA 1QZEA 1Z5SB 5BO4B 2L76A 4WWNA 4MGYE 3S2AA 2DHZA 2ZPYA 4HK2A 4ANUA 2KDBA 3PRZA 3R7QA 2KFJA 4PS3A 4A20A 4BKTA 3DBLI 3A1QB 3PLUA 2N1VA 3HK0A 4XX5A 1V49A 4G11A 2LGDA 2EMSA 2PE6B 3BINA 1FXTB 2MCNB 4E3CA 4JIOU 4HCNB 4WJOA 3MHSD 3NHEB 2MWSB 1I35A 2BWES 1WM2A 5LXIB 3WA0A 1E5WA 2MP2A 3DDCB 4GIVA 4KDIC 4A3OA 4ANVA 2FCMA 1J19A 2KTRA 4ZDVA 5D2MB 2KVRA 1E8WA 4K7SA 1LQBA 3JVZX 3ZTCA 4G3XB 2EKEC 5J18A 2BKRB 3VH4B 3P2BA 1E8ZA 2L05A 3QJZA 2KQSA 1E8YA 2K1FA 5CHWA 3PHXB 4W9HA 2GBJA 3PT2B 3PVLA 2L0TA 3ZO5B 1C1YB 1YQBA 2NS5A 3D32A 3HHMA 4HDOA 1EO6A 3H7PB 4EFOA 4MEMA 1E8XA 3ONSA 2JT4B 2DZIA 2AL6A 1V2YA 2Y5BB 3AULA 2FNJB 3VVWB 2BKFA 4KIKA 4ANXA 1XQQA 2JY6A 5FR6A 3L54A 3PHWB 3X0WA 1TTNA 3DVNV 3ML8A 2KWVB 4XZ4A 3VTWA 4EZJA 2CHXA 2LVPA 3UIPB 1V9JA 1XT9B 4FJZA 2KLGA 3QHTA 2MBEA 3WAMA 1WR1A 2LVOA 2LVQA 2V3SA 4MJSA 4IG7B 4WWOA 3ZKJC 4HVBA 2DX5B 1UBIA 2IZVB 2D3GA 2RR9A 4CYEA 2K25A 4NJ7A 4JLCA 4GU2A 2KWUB 4URKA 1OQYA 3W1SA 5L95C 2CR5A 5LXHA 3ZIMA 3UGBB 4MH0E 2KDEB 4MSQB 2KQ7A 2K39A 2XEWA 3RT3B 1WMHA 1S3SG 3RZWC 2KJRA 4ZRJA 3A9JB 4WAAA 3ZTDA 2L00B 1JRUA 3A9KA 2IO2B 4W9EA 4B9KA 3QARA 5G2NA 2I1KA 4M8MA 3LJ3A 2O6VA 1GNUA 2PPHA 4M8NA 2MP2B 3ZW3A 5CTRC 2FAZA 1A5RA 1PQSA 3V61A 4KSLC 2KTRB 4FBJB 2VRRB 2PE9A 3DQVA 1KJTA 4HXDA 3TL5A 2C7HA 3NZUA 4AJWA 2M17A 1U4AA 4TQ0A 4K7UA 3IHPC 4JQWC 2BYEA 2B3AA 1WXAA 2GBNA 4BVUC 4GOCA 3WALA 2MA9B 3H7SA 1RFAA 1VD2A 1WGRA 4TV3A 1WR6E 2IO1B 3X23A 1KLVA 1P3QU 3N30A 2R2QA 2CS4A 2N9PC 2FIDA 5IAAC 2KK8A 2KZRA 1CMXB 2Z0DB 4GSWA 2AL3A 5HKHA 1SE9A 2IY1B 1WH3A 2OOBB 2BGFA 2K8BA 1TBEA 1WI0A 2MQJA 5JHBA 2KXJA 4N9F4 3DVGY 2HJ8A 2C7NB 3SU8X 2YLMA 1H8CA 2KOXA 5CHVC 2D2QA 3L17A 3K9OB 3PRPB 2O6VD 3AI5A 3JW0X 4FHJA 2AEHA 2KFKA 1V80A 3ZNZB 3NS8A 1WXSA 5CHFA 4JL9A 2KJ6A 2MSED 1WJNA 2N9XA 4KDLB 2IO3B 1WJ6A 4FHKA 3A4RA 4E74A 1UELA 1HE8A 2KDFB 3RCZA 2A5UA 2WX1A 3N3KB 3RULA 2BF8B 3DBSA 2LXCA 4PYUA 5DPTA 3MTNB 1WMHB 1S1QB 1WIAA 2DAFA 3NY5A 4KZ0A 4DHZB 1SIFA 4KSKC 1IYFA 2RD0A 2LI5A 4NNJB 2HTHA 3A9KB 3ZRFA 4BOSC 3ZUNA 2MW5A 1P98A 4IWQA 1WF9A 2O2VA 3VH3B 4BKSA 2JZ3B 2EMTA 2JVCA 2O6VB 3IVFA 3JYUA 5DPWA 4WJPA 2N7DA 2KX0A 3VAWA 4DK5A 2C60A 1WM3A 3A4SC 3TCAA 2LRUA 2LRWA 2N7EA 3SD5A 4OVVA 4IUMB 1L2NA 2K6DB 1R4MI 5D6JB 3V6CB 5DPSA 1NDDA 5DPRA 1EF5A 2JRHA 2KTFA 2WYQA 4PYZA 4IM0A 3KVFB 4W9GA 2MX2A 3DPDA 2NPTA 3EC8A 2ZVOA 3B1LX 4NPNA 3TMPB 2IO0B 4KV2A 4YL8A 4WWPA 5JZEB 4TQ1A 3RD2A 3ZVVA 2MRPA 1UZXB 3MJWA 5C23A 3QC8B 3SDLC 4DHZE 2KANA 3DVGX 4MGIE 1KOTA 1NBFC 3ENEA 1WJ4A 3QQ8B 1GUAB 4BBNC 2N9EB 2N4FA 4IWPA 5C1ZA 2DYBA 2M1MA 3HM3A 1ZGUB 2LJ5A 2MBHA 4OVUA 2FUHB 2XK5A 4GDKA 2AYOB 3Q3JA 3GOEA 4G0NB 4FJVB 4XC2A 1WX7A 3PLVA 2CU1A 3VHTC 2ZJDA 4BKSD 1WXMA 4FLHA 3U30A 1P9DU 2V1YA 1WYWB 2IBIB 4W9CA 2KFKB 2LZ6A 3PSEB 3EFUA 4DHJD 1OEYJ 3OLMD 2Z0EB 1RLFA 2ZNVB 4W9DA 3CSFA 4BKGA 4IWOA 3L13A 3O65B 4HDQA 5AEKB 1V5OA 3VFKA 3PV1A 4LDTD 2KC2A 3APFA 1H4RA 4LCDE 3RZFA 2DYOA 1WGDA 2UWQA 3A1QA 3R3MA 1ISNA 2CHZA 2JZZA 3QIJA 4TKNA 2D10A 5E6PA 3M63B 2AWTA 3KH0A 2JXXA 3OAWA 2KMAA 2L8JA 2G3QB 3DVNU 4X57B 4B6WA 4RM8A 3PTFC 4NY0A 1TGZB 4HCPB 5L83A 3W1YA 3WAOA 2ZCCA 2NVUI 1GC6A 5LLIA 3AXCA 4IW0A 3M95A 3R66C 3EHVA 4DHJB 5J17A 4ZRIA 1AARA 5J2RA 4W9FA 2NBVB 2PEAA 3UQAA 2KN5A 1WXVA 2GMIC 2DYMA 2QHOA 1WE7A 2KDIA 2LXAA 2J0KA 3K9PB 2L3ZA 1WX9A 2LWPA 2CKHB 1IPGA 4FULA 3KW5B 1WGYA 3NOBA 2G4SA 3H7PA 1UH6A
chains in the Genus database with same CATH superfamily
3P4PB 3MC9A 1VJKA 4IOIE 5IA7A 5JHAA 3JSVA 1WE6A 1RAXA 1I4XA 2BYFA 2AQ3B 4MJSB 1Y8RC 3UINB 3NRZA 2R2OA 3QWZB 4GDKB 1IGDA 1OGWA 3V05A 1X1MA 4JX1C 2WX0A 4LNFA 1M4VA 2NCNA 3MC0B 5HG2A 1N5WA 1J8CA 5I4DA 1QKZA 3VRAB 1WRDB 4M0WA 4PS8A 3WAPA 3ALBA 1JWUD 1YQ4B 4WQOB 1DOXA 1PUTA 3U2SC 1HTQA 3HVZA 2K0PA 3PZDA 2N0SB 3KYCD 2LEKA 3C0RB 1NVID 1D6EC 3A9JA 2G9HD 2DZKA 5EE0A 4NQLB 4AJYB 1GJZA 3EFCA 4YXDB 2J0MA 2LGSA 4JGHB 1SJED 1C78A 1E9MA 3CSTA 5GMVA 1C77A 2KHWB 1VR9A 1Z2MA 3CWIA 3DHGC 2MHJA 3L16A 2IGDA 4NAWA 2D5GA 4C80A 3NJTA 2J4XA 2ON8A 2V9HA 2JZPA 2IPKD 1GPXA 2RPVA 5BYRA 5BYQA 3KUDB 1KFYB 4OZCA 3ZQ4A 2FCQA 3JSVB 3VTVA 4BOZB 1QLBB 1XLQA 1OQQA 3AB5A 4DDID 4F7ZA 1UF0A 3PPAA 2IGHA 1N61A 3RYTA 3PREA 2MBQA 3MHZA 3B2FA 4M0WB 1TT5B 1C3TA 3Q3FA 5JH5C 3T8MA 1OQRA 4HEA1 1PFDA 2N7JA 4LNOA 4MM3A 4XWWA 1ZW7A 1LO5D 1EF1A 4RGNA 1E7UA 4KZCA 2EELA 2UYZB 1YJIA 4I6PA 3C8YA 3N9YC 3ZRCA 4EUTA 2LHEA 2HTME 2W3RA 4OVZA 3VUXA 1ZPSA 1F77A 3LXFA 4NAWB 4AP4C 4FA6A 2DZJA 5TR5A 1UNSA 3CF6E 4KX6B 1XD3B 2JQRB 2GBMA 2Z59B 5BMGA 2JRIB 2ZCBA 3AMZA 4ICUA 3Q8BA 2K5PA 4LJOB 4B95A 3IBEA 2ZPNA 4EZKA 3QX1A 1GAQB 1PYWD 4A6QA 4EZLA 5EDSA 4EEWA 1QZEA 5BO4B 3UGBB 2L76A 3N1XC 4ANUA 4HK2A 2KDBA 3PRZA 4IDIA 3R7QA 4A20A 4BKTA 1TS2A 1AN8A 5IKCM 1FEHA 2J42A 3ETRA 2WHIA 1C4CA 1K53A 1CJEA 1I35A 2BWES 3DBHB 3BYTB 1E5WA 3DDCB 3SEBA 4ZDVA 3IAM1 1C4PA 1LQBA 1VZ7A 2KVZA 3RFZB 3ZTCA 4G3XB 1E8ZA 3QJZA 2KQSA 4W9HA 1K52A 2L0TA 1YQBA 3NVVA 1TS3A 1CK1A 3ONSA 3AULA 2W54A 3VVWB 4KIKA 2GLSA 1XQQA 1TTNA 1J7CA 3Q8EA 2MBEA 1JALA 4MACA 2V3SA 1KLUD 3N1YC 2KACA 3RNFC 1BMLC 4GU2A 2KWUB 4HJGE 1OQYA 3W1SA 3ZIMA 2K39A 1WMHA 3IT4B 3ZTDA 3VR8B 1IGCA 1UGJA 4M8MA 1PDXA 4HKZE 2PPHA 4M8NA 2RDGA 3RNAC 2JX5A 3DWMA 2VRRB 2PE9A 1KJTA 4S0RA 3NZUA 2OEDA 4RNAA 5JXVA 4K7UA 2B3AA 4MH8A 3GE8C 3WALA 2PVOD 1JWSD 1TY0A 1YN3A 3N30A 4YTPB 2R2QA 2Z8LA 1T5XD 2KK8A 4GSWA 2IY1B 3L4PA 1WH3A 1IUEA 2BGFA 4ZHOA 1WI0A 2WXOA 2ZW1A 2KXJA 4N9F4 1H8CA 2D2QA 4EE2A 3K9OB 4REZA 1J7AA 4C7ZA 2KFKA 3ZNZB 1WXSA 1DYQA 5CHFA 2WXGA 1CQVA 2IO3B 3O13A 3RCZA 3N3KB 2LXCA 1NI3A 4PYUA 1WMHB 2DAFA 4KZ0A 4DHZB 3P63A 1I4PA 2Y3AA 1R4NB 4RGOS 1TKEA 1AW7A 2JVCA 3NG0A 3JYUA 4WJPA 2N7DA 3U7ZA 2LRUA 3SD5A 4OVVA 4IUMB 1L2NA 4N6EB 2CU3A 5DPSA 5DPRA 1JROA 3ZXVA 2IJ0A 2WYQA 4IM0A 1GB4A 3KVFB 1E7PB 3DPDA 3EC8A 2ZVOA 1V1PA 4NPNA 3VRBB 1ENFA 2IO0B 4YL8A 2WS3B 3MJWA 3SDLC 1SEBD 2KANA 4MGIE 2N4FA 4IWPA 2LJ5A 3I9V1 2XK5A 4G0NB 1WX7A 3PLVA 3U30A 2V1YA 4W9CA 1VZ8A 2KFKB 4L1BA 1ZDVA 3OLMD 2Z0EB 2ZNVB 2AQ1B 4BKGA 2SEBD 2JWUA 4XE0A 4HDQA 4LDTD 3APFA 1H4RA 4LCDE 3P1MA 2UWQA 3A1QA 3R3MA 1JWMD 3QIJA 5E6PA 3M63B 3OAWA 1SJHD 5HFYA 2KMAA 2L8JA 2G3QB 3ZXRA 1TIFA 3AEFB 4HCPB 3W1YA 5LLIA 5J17A 3ZJTA 3NVYA 4W9FA 2NBVB 3B2GA 2GMIC 2DYMA 2QHOA 2KDIA 2V0GA 2LXAA 1WX9A 1FRRA 2H88B 3SFDB 4B0MA 1IPGA 5IOIA 3R2IA 3NVWA 2FE8A 1V1PB 4A90A 1F9JA 2INNE 3ZNID 3Q8FA 2MLBA 2J52A 1UBQA 3APDA 1G6JA 3DBHI 2MH7A 3AE5B 4K81A 1RFKA 1JQ4A 4K1RB 2XK5B 2NBWB 5J2RA 3L10B 3ZDMC 4I6LB 2ZZPB 3DHHC 3VUWA 1PGAA 4MGZE 1TZ1A 2WP9B 3QA8A 1SE4A 1VCBA 4ZRKA 3QK0A 3IG3A 4PK1A 2JPHA 2OHFA 4GLSC 4HKQA 5EE9A 3BVZA 2KDMA 2WXNA 3E56A 2KWDA 3BYYB 1T0YA 1RM6C 1E10A 3U4EG 3URYA 3L0WB 3OWEB 3PRMB 2RGFA 4AOFA 1V97A 1C9FA 1WGHA 4II2B 5DCNA 4FN2A 4IM2A 4UDUC 1UGMA 2L0FA 2I2YA 3W1SC 5AZFA 4C4VA 3Q2AC 3I3TB 5D3DA 2BYTA 1OTRB 4A8XC 1FD6A 1LXDA 2PJHA 3MFGA 3VXWA 1VDVA 1EUVB 2YVCA 4AS1A 3FAHA 4MSMB 2K3UA 1UWXA 4BFRA 4YSYB 1J0GA 1ET6A 2KQ4X 2INCC 3QAQA 1DGJA 3NUHB 3UI3A 3UQBA 3R7RA 3V60A 2BVCA 3ECIA 2X38A 4HPLB 2LHDA 3U52E 2REXA 1TZOA 2O2VB 3ZNHB 4LNIA 5E6NA 1T0QC 3IXSA 3GP7A 1WFYA 2JF5A 3AECB 4F1SA 1EWCA 1YD8U 2QIEB 3EECA 1V8CA 4LDTB 3V6EB 1Q10A 2ZNVC 2JUOA 1HA5A 3P4QB 4RH6A 2NPTB 3HIZA 2WXPA 4DXGA 4PS7A 4DDGD 3IT6B 2W3SA 2Q5WD 1RYJA 4DWFA 4C4VB 2YEPF 3M62B 2J53A 4LTUA 4EOYA 2KNBA 1NI2A 1R4NI 2WU2B 3WANA 1KLGD 3HM6X 3H6NA 3U8ZA 2J7QB 4J6IA 4ZRQA 2K8CA 2K6QA 1YOVB 2GB1A 1AWDA 5KHQA 1L7YA 2A4ZA 1Y56A 3Q3MC 4MGYE 2ZPYA 2QCZA 2KFJA 1FNVA 1QT9A 2WXKA 2PKOA 4XX5A 4G11A 4QAYA 2VH1A 1WXQA 4US8A 2L32A 2MWSB 4C7YA 1FM0D 1WM2A 2MP2A 4A3OA 1J19A 1ROEA 1QOBA 1ZXIA 2GBJA 3KWLA 3ZO5B 3HHMA 2NS5A 4LK0M 3HUIA 3H7PB 4EFOA 2DNFA 1V2YA 2AL6A 2FNJB 1HQRD 4NAMA 3P4SB 4ANXA 3GB1A 3DBRB 3AEEB 4J3OD 2JY6A 3L54A 3PHWB 2KWVB 1N63A 5G5GA 4EZJA 2CHXA 4M02A 2KLGA 3QHTA 3PO0A 3WAMA 1WR1A 2LVQA 2WXIA 4IG7B 4HVBA 2DX5B 2IZVB 2D3GA 2QDFA 4CYEA 4NJ7A 3DHIC 5L95C 2CR5A 3W5VB 5LXHA 4MSQB 2KQ7A 1L0VB 3RT3B 2LFIA 1FIQA 3RZWC 2KJRA 4WIPA 3A9JB 4WAAA 4ZRJA 2L00B 1JRUA 4YSZB 4KGRA 3QARA 2I1KA 4ITKA 2GRIA 3AN1A 1UWMA 2MP2B 4KGTA 1A5RA 2PIAA 2H89B 2KT7A 4KSLC 4FBJB 1GB1A 3DQVA 3TL5A 5C3JB 3IHPC 3N20C 2GBNA 1JMLA 4GOCA 4B0EA 3TEZA 1PGXA 1VD2A 4CQNA 1ACCA 2IO1B 1P3QU 2N9PC 2V3NA 2FIDA 4RGMA 2LMCA 1L5PA 5HKHA 1SE9A 2W55A 3RN9C 2G1EA 2OOBB 2DLBA 1MVKA 5JHBA 4RF0A 4OZAA 2HJ8A 3T3NA 1MG4A 2ACZB 5CHVC 2EKIA 4FHJA 3RPFC 4C00A 3RNCC 1XCTL 4JL9A 2MSED 1WJNA 3WCQA 4FHKA 3A4RA 4NJCA 4YTNB 2KDFB 2VH2A 5AUKA 3TUOA 5DPTA 3MTNB 3FILA 1S1QB 1WIAA 3NY5A 4MM3B 1SIFA 4KSKC 4O1NA 2WGSA 2XNAC 1P98A 3Q8CA 1WF9A 4IWQA 3VH3B 4TMAB 2JZ3B 3GZNB 4BKSA 2EMTA 1I4GA 4DK5A 1WM3A 1NDDA 1IBXA 2JRHA 1XEEA 1EWYC 2MX2A 3TMPB 3AE6B 2BW2A 3KWVA 2LGIA 3DVGX 4DHZE 3ENEA 5MPOA 2Y5CA 4BBNC 5C1ZA 2QJLA 2M1MA 3HM3A 4OVUA 3GOEA 3VHTC 4TSSA 3PSEB 4WH4A 3CSFA 3L13A 4ACFA 3PV1A 2KC2A 1ESFA 2RDBC 3RZFA 2JZZA 3FILB 4X57B 4RM8A 3PTFC 3TEWA 4KKIA 4NY0A 1TGZB 5L83A 3AE9B 1XO3A 1MHHE 5EE1A 3ZYYX 4XGAB 3W2DA 5BMHA 3SFEB 1F1HA 1I4RA 1WYGA 2KN5A 4ZRPA 1XLOA 1IBXB 4LNKA 1WE7A 5IO9A 2J0KA 3K9PB 2LWPA 2CKHB 3AV8A 1AYFA 2G4SA 3DVGY 1UH6A 3Q6BA 4KIKB 3PS6A 3ZJUA 4GN1A 3Q14C 3H8HA 4HPMB 4GXBA 3HRDD 2FIFA 4BZAA 3SHQA 1FNUA 2JXTA 1SSNA 3T9LA 3TJPA 2DAJA 2KWCA 2JYTA 4ANWA 3ZNGC 1MG8A 4E71A 1YMHE 3NZSA 5AZGA 2KC1A 1JCKB 2FCSA 4AQ7A 3ZLZA 5HHDG 4HLEA 2XBBC 2M56B 5D94A 2L1AA 4KGSA 2LASA 3MP9A 1OFFA 3LB8C 2BPSA 3H1UA 5CX3A 4XYCA 4IM3A 3MC8A 1NYQA 3V62A 2BWFA 3DBRI 4I6NB 1WJUA 2E3TA 2W82A 3BK1A 1YX5B 3SR6A 2KJHB 4P7IA 2WDVB 1UD7A 3BY4B 4ZHPA 5H92C 2KMCA 4DQOC 2N1WA 2N9KA 2BYVE 4GB9A 1GG3A 1IP9A 5KHOA 2D11A 1E7VA 1WRIA 1I42A 4MELA 1NEKB 1QOFA 4ARIA 3VQIA 2K8HA 3U7DA 3BIID 1WX8A 4W9JA 3UF8A 3PGEA 4G50A 1JWBD 2D07B 3VDZA 1T0RC 3AU4A 1QF6A 2CHWA 2M8SA 1FFVA 2ASQA 1SF0A 5AZHA 4MDKE 2J0JA 3AEAB 2LGYA 2ZEQA 5G5HA 3DOWA 2X8XX 1SIJA 2ZVNA 3NS1A 2DWQA 4TUUA 1V6EA 2IY0B 1OEYA 2GOWA 3AU5A 3KYDD 2WDTB 2KX3A 4IC7B 3EA6A 3L08A 1E6EB 2BBCA 1WGKA 4OZBA 3GE3C 2KLCA 2BS2B 1T0SC 1N5XA 1WY8A 1K50A 2M0XA 5D7GA 1YX6B 2C5LC 1L6UA 2NBUA 4DXAB 2W9NA 4A3PA 2DBYA 2RSUA 3BVGA 2QSDA 3RNGC 4BAXA 1RRBA 4WJQA 1SB3C 2RPQA 4XDDA 5TSSA 1HZ6A 3VTUA 2BTEA 1MFWA 4ZYNA 4DBGA 3P42A 2BB5A 1HTOA 1V5TA 4GMVA 4GGQA 1WGGA 4ASWC 3GS2A 4YT0B 4MT5A 3OJ3A 2WLBA 2WXFA 4NZLB 1V86A 2M0AA 4FADA 1BT0A 2DENB 3RNBC 2NTTA 3GZNI 1V81A 4TV3A 1TYGB 4NJ6A 3LYYA 4ICVA 3J9CA 1Q5WB 2K9XA 4W9KA 2WXLA 2YEPB 1ZKHA 1Q1OA 2UU7A 1Z5SB 4N59A 3S2AA 1IYFA 1XCQL 3A1QB 2N1VA 4XDCA 1QOGA 2LGDA 2EMSA 3AH7A 1FXTB 2MCNB 4E3CA 4HCNB 3MHSD 3WA0A 4K3CA 1WSPA 2KTRA 2PLPA 1ET9A 1DOYA 2MJ3A 1QQRA 1E8WA 2KVRA 4K7SA 2ZW0A 5J18A 2BKRB 1YQ3B 3FC4A 1LGRA 2NTSA 3PT2B 1MI0A 1C1YB 2N9LA 1EO6A 4MEMA 2DZIA 2JT4B 1FFUA 2Y5BB 4LLGM 3T3OA 1WWTA 4RF1A 1T3QA 1C4AA 5FR6A 1FCLA 3X0WA 3DVNV 3ML8A 3VTWA 4RGTA 2XN9C 4FJZA 2SAKA 2FUG1 1TKGA 4MJSA 3ZKJC 1UBIA 3KQ4A 2RR9A 2K25A 3N1ZC 4JLCA 5AUIA 4URKA 2L52A 1JWAD 1FXIA 2BQQA 2KDEB 3C19A 4K3BA 1S3SG 2QMTA 4B9KA 5IP4D 5FKAC 3BVMA 4A9AA 1L0YB 3LJ3A 2O6VA 2K22A 1GNUA 3ZW3A 5CTRC 1A70A 3V61A 2KTRB 2WXHA 4HXDA 2IDYA 2RMMA 3ABVB 2C7HA 2WNMA 4AJWA 2M17A 2PVGC 1GOZA 2MJEA 2BYEA 1WXAA 4BVUC 1STEA 1QOAA 2MA9B 3Q3NC 1WGRA 5HI1A 3X23A 2WXJA 1YN4A 4HPPA 2LUMA 2KZRA 1CMXB 2Z0DB 3Q8AA 4L2YA 2K8BA 2ONQA 1TBEA 4WURA 4US9A 3SU8X 1F0ZA 5IN7A 3AI5A 4YWGG 1NYRA 1K51A 1V80A 2HJ1A 3RMKC 2GI9A 4LNNA 4KDLB 1FPYA 1WJ6A 5BYSA 1D4BA 4E74A 1HE8A 4Q2JA 5FR3A 2A5UA 3RULA 2BF8B 1YNTE 3DBSA 3RNEC 2BT6A 1TY2A 1TS5A 2R61A 1JRPA 2D3AA 2RD0A 4BOSC 2HTHA 3ZRFA 3ZUNA 2MW5A 3FKYA 2TSSA 3VR9B 2O6VB 3IVFA 1VRAB 5GXGB 3VAWA 2KX0A 3TCAA 2LRWA 2N7EA 2WXRA 2K6DB 5D6JB 3V6CB 2FBWB 3DBLB 2KTFA 4PYZA 5BMIA 1J7BA 3B1LX 5JZEB 3RD2A 3ZVVA 5T8IA 1UZXB 3QC8B 1KOTA 4JPSA 1GUAB 1VZ6A 3NZ3A 1ZGUB 2MBHA 1R7SA 4BKSD 4XC2A 2CU1A 2ZJDA 1WXMA 1WYWB 2IBIB 2LZ6A 3EFUA 1RLFA 3Q3OC 4IWOA 4WAFA 3O65B 5AEKB 1V5OA 3HVDA 3VFKA 1D5ZC 1XLPA 3V3XA 3EUB2 1HEZE 2CHZA 2AWTA 2JXXA 3DVNU 1VLBA 4B6WA 2CJNA 1FRDA 1ZDXA 1CZPA 3WAOA 1GC6A 2WQYB 4IW0A 3M95A 3R66C 3EHVA 4DHJB 2PMVA 2NMQA 4ZRIA 2PEAA 3UQAA 1WXVA 1N6ZA 3MJ5A 4FULA 3KW5B 3NOBA 1XF5L 1B9RA 4M01A 3PZ7A 2BB6A 4HJKA 3TIXA 3LDZE 1LFDA 4MGKE 2PW9A 1Q0WB 2G4DB 4AWJA 3B0AA 5E6JA 1P0RA 1ZP0B 3TBLD 1TS4A 1YJ1A 3OJ4B 2FCNA 3R2TA 3ZDTA 3M3JA 4FJYA 2VZKB 2LGXA 1FXAA 3AM9A 2I1JA 2C7MB 1MJDA 5G55A 4CHKA 4S17A 2MEKA 4BBNF 2GBRA 2RDHA 2M4NA 2KO3A 3VUYA 2WXQA 3KUZA 3ML9A 3B08A 2HDEA 4DXFA 2G45B 1WZ3A 2PTLA 2JWZA 2CJOA 2IGGA 2V4LA 1C79A 3CMMB 3AEGB 2WWZA 4WQMA 2KD0A 4W9LA 3P4RB 2NR2A 2MJDA 4GDLA 2ICIA 1LM8B 2MBOA 4AUQC 3N32A 2C9WB 3UIOB 4N58A 3RUIB 1L6VA 2MBBB 1M94A 2Y5PA 2GBKA 2INPE 3APCA 2JYEA 4JWSC 5D3IB 4F8CB 4ZOHC 4A55A 1R4MB 1L0XB 1WZ0A 4K7WA 1EU3A 4OHJA 3WIMA 1D5MC 3W5UB 1I4QA 3DCGA 3W9CB 3A33B 4LJPB 4USAA 5E6OA 3KLSX 3IFWB 2HD5B 3TEXA 1SBBB 3QCAA 1I4HA 2KMMA 4RM9A 3RI7C 2OJRA 3ZJVA 4OW0A 1P1AA 3CIRB 1YIWA 2HE7A 3ZGZA 4C56C 2IYDB 3KUCB 2LD9A 1KM7A 1YN5A 4GDLB 2KKCA 1D3ZA 1BXTA 1E90A 2DZMA 1NENB 1K8RB 4CO7A 3AEBB 1QILA 4HWIB 4P1CC 1SGHA 4NQKE 1UUPA 4KVGB 3Q69A 4EKUA 4WJNA 2L83A 4W9IA 2LUEA 2D3BA 1GC7A 2L7RA 4RMAA 3H9DA 2AQ2B 1DOIA 3BK2A 1EU4A 4II3B 4D2KA 4WWNA 1KTKA 2DHZA 1L4ZB 4PS3A 3DBLI 3PLUA 3HK0A 1FNWA 1V49A 2PE6B 4JWUC 2QEJC 3BINA 4JIOU 4WJOA 3AE1B 3I5JC 3NHEB 5LNK1 5EE3A 5LXIB 3AE8B 4GIVA 4KDIC 2JU6X 4ANVA 2FCMA 4JE3B 5D2MB 3JVZX 3AE3B 4YTMB 3NVZA 2EKEC 3VH4B 3P2BA 2WDQB 2L05A 1KH0A 4YSXB 1E8YA 3OG5A 2K1FA 5CHWA 3PHXB 3B9JA 1N60A 2QC8A 3PVLA 4HDOA 3D32A 1ZXHA 3E9SA 1B1ZA 1E8XA 4FXCA 1YJJA 1ZOYB 4P6VF 2BKFA 3AE7B 4ARCA 1P7FA 4XZ4A 3UIPB 2LVPA 1V9JA 1XT9B 1C76A 2LVOA 1F52A 4WWOA 3IAS1 4RFBA 3BWUD 4MH0E 2XEWA 4L23A 1HZ5A 2WDRB 2OJWA 3A9KA 2IO2B 4W9EA 2QILA 5G2NA 1F2RC 1E0ZA 2BS4B 2KYWA 2FAZA 1P7EA 1PQSA 1BUIC 2V4IB 4IKGA 2M19A 3AE2B 3PZ8A 4HROA 1U4AA 4XWTA 4TQ0A 3BZDB 4JQWC 1PGBA 3H7SA 1RFAA 1WR6E 1KLVA 2CS4A 4RCOA 5IAAC 2AL3A 5C2TB 1D5XC 2MQJA 1ZE3D 2C7NB 1TJEA 2YLMA 2KOXA 3L17A 4P16A 3PRPB 2O6VD 3JW0X 2AEHA 3NS8A 2KJ6A 2N9XA 1L4DB 3AE4B 2LJIA 5H8YE 1UELA 1KRHA 4KKJA 2WX1A 2AX5A 2LI5A 4NNJB 3A9KB 3I57A 2WU5B 2O2VA 1F2RI 1XXGA 5DPWA 4P1BC 2C60A 2KAJA 1JW9D 3R8BA 3A4SC 4M00A 5FK9C 1R4MI 2JSVX 1EF5A 1RWSA 3TEYA 1ZUD2 1FMAD 4W9GA 3EGRA 2BS3B 2NPTA 4HRSA 4KV2A 4WWPA 4TQ1A 2MRPA 1TKYA 5C23A 2WXMA 1NBFC 1WJ4A 3QQ8B 2N9EB 2DYBA 1MPEA 1T6BX 2FUHB 2E6XA 4GDKA 2AYOB 3Q3JA 4FJVB 4FLHA 1P9DU 3AEDB 4H2AA 4R3DA 2KN4A 4DHJD 1OEYJ 1FCCC 2B76B 4ZYSA 4W9DA 3I63C 1N62A 1FO4A 2DYOA 1WGDA 1ISNA 4TKNA 2D3CA 2D10A 3KH0A 1MHXA 1V1OA 1I7HA 4WWMA 2ZCCA 2NVUI 3DWGC 3AXCA 2V3PA 1SE3A 2I38A 4PT5A 1AARA 1KF6B 1EM7A 2VZKD 1SE2A 3TSSA 1HXYD 1SXTA 1XLNA 2L3ZA 2INDC 1WGYA 3H7PA
chains in the Genus database with same CATH topology
4KIKB 4HJKA 1F9JA 3PS6A 3TIXA 3ZNID 3LDZE 2MLBA 4GN1A 5IA7A 5JHAA 4HPMB 1LFDA 4GXBA 4MGKE 1Q0WB 2FIFA 2G4DB 4AWJA 3B0AA 3SHQA 1UBQA 3APDA 1P0RA 3JSVA 1G6JA 3DBHI 1WE6A 1RAXA 3TBLD 3T9LA 2BYFA 4K81A 4MJSB 1Y8RC 3TJPA 3UINB 4K1RB 2DAJA 1YJ1A 2KWCA 2R2OA 2XK5B 2NBWB 3OJ4B 3QWZB 4GDKB 2FCNA 3ZDTA 3L10B 3ZNGC 3M3JA 1MG8A 1OGWA 4ANWA 4E71A 1X1MA 3ZDMC 4FJYA 2ZZPB 4I6LB 2LGXA 3NZSA 2WX0A 4MGZE 5AZGA 1TZ1A 3VUWA 2KC1A 3QA8A 2FCSA 1J8CA 2NCNA 1VCBA 3ZLZA 2I1JA 2C7MB 4HLEA 2XBBC 5G55A 4CHKA 4ZRKA 3QK0A 5D94A 3IG3A 4BBNF 2JPHA 1WRDB 2LASA 2GBRA 4PS8A 3WAPA 2M4NA 2KO3A 3ALBA 3VUYA 2BPSA 3H1UA 4WQOB 5CX3A 3KUZA 3ML9A 3PZDA 4IM3A 3KYCD 3B08A 3C0RB 3A9JA 3V62A 2BWFA 2DZKA 3DBRI 4I6NB 1WJUA 4NQLB 1T0YA 2G45B 1WZ3A 4AJYB 1GJZA 1YX5B 2KJHB 2JWZA 3CMMB 3L0WB 2V4LA 2J0MA 4P7IA 3PRMB 2WWZA 1UD7A 2KD0A 3BY4B 2RGFA 4AOFA 4JGHB 4W9LA 2KMCA 3CSTA 2N1WA 5GMVA 2NR2A 1WGHA 2BYVE 2KHWB 4GB9A 4II2B 1GG3A 5DCNA 4FN2A 4IM2A 1IP9A 4GDLA 1Z2MA 1UGMA 1LM8B 2L0FA 5KHOA 2D11A 2MBOA 1E7VA 3L16A 4NAWA 1I42A 3W1SC 4MELA 5AZFA 4AUQC 3N32A 2C9WB 3VQIA 2K8HA 3U7DA 3I3TB 1WX8A 4W9JA 3UF8A 3PGEA 4G50A 3UIOB 1OTRB 3RUIB 2D07B 3KUDB 1LXDA 2MBBB 1M94A 2PJHA 3VDZA 3AU4A 2GBKA 2CHWA 3VXWA 3APCA 2FCQA 2M8SA 3JSVB 4F8CB 3VTVA 1EUVB 4BOZB 2YVCA 2ASQA 4MSMB 4MDKE 5AZHA 2J0JA 2LGYA 2ZEQA 3DOWA 4DDID 4F7ZA 4BFRA 3PPAA 1J0GA 1WZ0A 4K7WA 2ZVNA 3RYTA 3PREA 3WIMA 4TUUA 1V6EA 2IY0B 1OEYA 2GOWA 2MBQA 3AU5A 3QAQA 3KYDD 2WDTB 3DCGA 3UQBA 3R7RA 3V60A 3A33B 4LJPB 2KX3A 3ECIA 4M0WB 4IC7B 1C3TA 3Q3FA 4HPLB 5E6OA 2REXA 5JH5C 3T8MA 3L08A 2O2VB 3IFWB 2HD5B 4MM3A 3ZNHB 1ZW7A 2KLCA 5E6NA 3QCAA 1EF1A 1E7UA 1WY8A 1WFYA 2M0XA 4KZCA 5D7GA 2JF5A 1YX6B 4RM9A 2C5LC 4F1SA 2OJRA 2NBUA 2UYZB 1YD8U 4I6PA 3EECA 1P1AA 4DXAB 2W9NA 4A3PA 1YIWA 2HE7A 4LDTB 3ZRCA 3V6EB 4EUTA 2RSUA 2ZNVC 2IYDB 2JUOA 3KUCB 1RRBA 2NPTB 2LD9A 4WJQA 2RPQA 1KM7A 3HIZA 4GDLB 2KKCA 3VTUA 3VUXA 1D3ZA 1E90A 4ZYNA 4DBGA 2DZMA 4PS7A 4DDGD 4NAWB 4AP4C 1K8RB 4FA6A 2DZJA 4DWFA 1V5TA 4GMVA 4GGQA 3M62B 1WGGA 5TR5A 4ASWC 4CO7A 3OJ3A 3CF6E 4HWIB 4EOYA 2KNBA 1SGHA 4NQKE 1V86A 1NI2A 1XD3B 1R4NI 4KVGB 3WANA 2Z59B 2GBMA 4FADA 1BT0A 3HM6X 2DENB 3H6NA 4WJNA 4EKUA 3U8ZA 3GZNI 2J7QB 2JRIB 4J6IA 4W9IA 2ZCBA 1V81A 2LUEA 2K8CA 1GC7A 4ICUA 4LJOB 2K6QA 2L7RA 4NJ6A 3H9DA 4ICVA 4RMAA 4B95A 1Q5WB 3IBEA 5KHQA 1L7YA 2A4ZA 2ZPNA 4W9KA 4EZKA 3QX1A 4II3B 4EZLA 5EDSA 4EEWA 1ZKHA 1Q1OA 1QZEA 1Z5SB 5BO4B 2L76A 4WWNA 4MGYE 3S2AA 2DHZA 2ZPYA 4HK2A 4ANUA 2KDBA 3PRZA 3R7QA 2KFJA 4PS3A 4A20A 4BKTA 3DBLI 3A1QB 3PLUA 2N1VA 3HK0A 4XX5A 1V49A 4G11A 2LGDA 2EMSA 2PE6B 3BINA 1FXTB 2MCNB 4E3CA 4JIOU 4HCNB 4WJOA 3MHSD 3NHEB 2MWSB 1I35A 2BWES 1WM2A 5LXIB 3WA0A 1E5WA 2MP2A 3DDCB 4GIVA 4KDIC 4A3OA 4ANVA 2FCMA 1J19A 2KTRA 4ZDVA 5D2MB 2KVRA 1E8WA 4K7SA 1LQBA 3JVZX 3ZTCA 4G3XB 2EKEC 5J18A 2BKRB 3VH4B 3P2BA 1E8ZA 2L05A 3QJZA 2KQSA 1E8YA 2K1FA 5CHWA 3PHXB 4W9HA 2GBJA 3PT2B 3PVLA 2L0TA 3ZO5B 1C1YB 1YQBA 2NS5A 3D32A 3HHMA 4HDOA 1EO6A 3H7PB 4EFOA 4MEMA 1E8XA 3ONSA 2JT4B 2DZIA 2AL6A 1V2YA 2Y5BB 3AULA 2FNJB 3VVWB 2BKFA 4KIKA 4ANXA 1XQQA 2JY6A 5FR6A 3L54A 3PHWB 3X0WA 1TTNA 3DVNV 3ML8A 2KWVB 4XZ4A 3VTWA 4EZJA 2CHXA 2LVPA 3UIPB 1V9JA 1XT9B 4FJZA 2KLGA 3QHTA 2MBEA 3WAMA 1WR1A 2LVOA 2LVQA 2V3SA 4MJSA 4IG7B 4WWOA 3ZKJC 4HVBA 2DX5B 1UBIA 2IZVB 2D3GA 2RR9A 4CYEA 2K25A 4NJ7A 4JLCA 4GU2A 2KWUB 4URKA 1OQYA 3W1SA 5L95C 2CR5A 5LXHA 3ZIMA 3UGBB 4MH0E 2KDEB 4MSQB 2KQ7A 2K39A 2XEWA 3RT3B 1WMHA 1S3SG 3RZWC 2KJRA 4ZRJA 3A9JB 4WAAA 3ZTDA 2L00B 1JRUA 3A9KA 2IO2B 4W9EA 4B9KA 3QARA 5G2NA 2I1KA 4M8MA 3LJ3A 2O6VA 1GNUA 2PPHA 4M8NA 2MP2B 3ZW3A 5CTRC 2FAZA 1A5RA 1PQSA 3V61A 4KSLC 2KTRB 4FBJB 2VRRB 2PE9A 3DQVA 1KJTA 4HXDA 3TL5A 2C7HA 3NZUA 4AJWA 2M17A 1U4AA 4TQ0A 4K7UA 3IHPC 4JQWC 2BYEA 2B3AA 1WXAA 2GBNA 4BVUC 4GOCA 3WALA 2MA9B 3H7SA 1RFAA 1VD2A 1WGRA 4TV3A 1WR6E 2IO1B 3X23A 1KLVA 1P3QU 3N30A 2R2QA 2CS4A 2N9PC 2FIDA 5IAAC 2KK8A 2KZRA 1CMXB 2Z0DB 4GSWA 2AL3A 5HKHA 1SE9A 2IY1B 1WH3A 2OOBB 2BGFA 2K8BA 1TBEA 1WI0A 2MQJA 5JHBA 2KXJA 4N9F4 3DVGY 2HJ8A 2C7NB 3SU8X 2YLMA 1H8CA 2KOXA 5CHVC 2D2QA 3L17A 3K9OB 3PRPB 2O6VD 3AI5A 3JW0X 4FHJA 2AEHA 2KFKA 1V80A 3ZNZB 3NS8A 1WXSA 5CHFA 4JL9A 2KJ6A 2MSED 1WJNA 2N9XA 4KDLB 2IO3B 1WJ6A 4FHKA 3A4RA 4E74A 1UELA 1HE8A 2KDFB 3RCZA 2A5UA 2WX1A 3N3KB 3RULA 2BF8B 3DBSA 2LXCA 4PYUA 5DPTA 3MTNB 1WMHB 1S1QB 1WIAA 2DAFA 3NY5A 4KZ0A 4DHZB 1SIFA 4KSKC 1IYFA 2RD0A 2LI5A 4NNJB 2HTHA 3A9KB 3ZRFA 4BOSC 3ZUNA 2MW5A 1P98A 4IWQA 1WF9A 2O2VA 3VH3B 4BKSA 2JZ3B 2EMTA 2JVCA 2O6VB 3IVFA 3JYUA 5DPWA 4WJPA 2N7DA 2KX0A 3VAWA 4DK5A 2C60A 1WM3A 3A4SC 3TCAA 2LRUA 2LRWA 2N7EA 3SD5A 4OVVA 4IUMB 1L2NA 2K6DB 1R4MI 5D6JB 3V6CB 5DPSA 1NDDA 5DPRA 1EF5A 2JRHA 2KTFA 2WYQA 4PYZA 4IM0A 3KVFB 4W9GA 2MX2A 3DPDA 2NPTA 3EC8A 2ZVOA 3B1LX 4NPNA 3TMPB 2IO0B 4KV2A 4YL8A 4WWPA 5JZEB 4TQ1A 3RD2A 3ZVVA 2MRPA 1UZXB 3MJWA 5C23A 3QC8B 3SDLC 4DHZE 2KANA 3DVGX 4MGIE 1KOTA 1NBFC 3ENEA 1WJ4A 3QQ8B 1GUAB 4BBNC 2N9EB 2N4FA 4IWPA 5C1ZA 2DYBA 2M1MA 3HM3A 1ZGUB 2LJ5A 2MBHA 4OVUA 2FUHB 2XK5A 4GDKA 2AYOB 3Q3JA 3GOEA 4G0NB 4FJVB 4XC2A 1WX7A 3PLVA 2CU1A 3VHTC 2ZJDA 4BKSD 1WXMA 4FLHA 3U30A 1P9DU 2V1YA 1WYWB 2IBIB 4W9CA 2KFKB 2LZ6A 3PSEB 3EFUA 4DHJD 1OEYJ 3OLMD 2Z0EB 1RLFA 2ZNVB 4W9DA 3CSFA 4BKGA 4IWOA 3L13A 3O65B 4HDQA 5AEKB 1V5OA 3VFKA 3PV1A 4LDTD 2KC2A 3APFA 1H4RA 4LCDE 3RZFA 2DYOA 1WGDA 2UWQA 3A1QA 3R3MA 1ISNA 2CHZA 2JZZA 3QIJA 4TKNA 2D10A 5E6PA 3M63B 2AWTA 3KH0A 2JXXA 3OAWA 2KMAA 2L8JA 2G3QB 3DVNU 4X57B 4B6WA 4RM8A 3PTFC 4NY0A 1TGZB 4HCPB 5L83A 3W1YA 3WAOA 2ZCCA 2NVUI 1GC6A 5LLIA 3AXCA 4IW0A 3M95A 3R66C 3EHVA 4DHJB 5J17A 4ZRIA 1AARA 5J2RA 4W9FA 2NBVB 2PEAA 3UQAA 2KN5A 1WXVA 2GMIC 2DYMA 2QHOA 1WE7A 2KDIA 2LXAA 2J0KA 3K9PB 2L3ZA 1WX9A 2LWPA 2CKHB 1IPGA 4FULA 3KW5B 1WGYA 3NOBA 2G4SA 3H7PA 1UH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIK B;  4HJK A;  1F9J A;  3PS6 A;  3TIX A;  3ZNI D;  3LDZ E;  2MLB A;  4GN1 A;  5IA7 A;  5JHA A;  4HPM B;  1LFD A;  4GXB A;  4MGK E;  1Q0W B;  2FIF A;  2G4D B;  4AWJ A;  3B0A A;  3SHQ A;  1UBQ A;  3APD A;  1P0R A;  3JSV A;  1G6J A;  3DBH I;  1WE6 A;  1RAX A;  3TBL D;  3T9L A;  2BYF A;  4K81 A;  4MJS B;  1Y8R C;  3TJP A;  3UIN B;  4K1R B;  2DAJ A;  1YJ1 A;  2KWC A;  2R2O A;  2XK5 B;  2NBW B;  3OJ4 B;  3QWZ B;  4GDK B;  2FCN A;  3ZDT A;  3L10 B;  3ZNG C;  3M3J A;  1MG8 A;  1OGW A;  4ANW A;  4E71 A;  1X1M A;  3ZDM C;  4FJY A;  2ZZP B;  4I6L B;  2LGX A;  3NZS A;  2WX0 A;  4MGZ E;  5AZG A;  1TZ1 A;  3VUW A;  2KC1 A;  3QA8 A;  2FCS A;  1J8C A;  2NCN A;  1VCB A;  3ZLZ A;  2I1J A;  2C7M B;  4HLE A;  2XBB C;  5G55 A;  4CHK A;  4ZRK A;  3QK0 A;  5D94 A;  3IG3 A;  4BBN F;  2JPH A;  1WRD B;  2LAS A;  2GBR A;  4PS8 A;  3WAP A;  2M4N A;  2KO3 A;  3ALB A;  3VUY A;  2BPS A;  3H1U A;  4WQO B;  5CX3 A;  3KUZ A;  3ML9 A;  3PZD A;  4IM3 A;  3KYC D;  3B08 A;  3C0R B;  3A9J A;  3V62 A;  2BWF A;  2DZK A;  3DBR I;  4I6N B;  1WJU A;  4NQL B;  1T0Y A;  2G45 B;  1WZ3 A;  4AJY B;  1GJZ A;  1YX5 B;  2KJH B;  2JWZ A;  3CMM B;  3L0W B;  2V4L A;  2J0M A;  4P7I A;  3PRM B;  2WWZ A;  1UD7 A;  2KD0 A;  3BY4 B;  2RGF A;  4AOF A;  4JGH B;  4W9L A;  2KMC A;  3CST A;  2N1W A;  5GMV A;  2NR2 A;  1WGH A;  2BYV E;  2KHW B;  4GB9 A;  4II2 B;  1GG3 A;  5DCN A;  4FN2 A;  4IM2 A;  1IP9 A;  4GDL A;  1Z2M A;  1UGM A;  1LM8 B;  2L0F A;  5KHO A;  2D11 A;  2MBO A;  1E7V A;  3L16 A;  4NAW A;  1I42 A;  3W1S C;  4MEL A;  5AZF A;  4AUQ C;  3N32 A;  2C9W B;  3VQI A;  2K8H A;  3U7D A;  3I3T B;  1WX8 A;  4W9J A;  3UF8 A;  3PGE A;  4G50 A;  3UIO B;  1OTR B;  3RUI B;  2D07 B;  3KUD B;  1LXD A;  2MBB B;  1M94 A;  2PJH A;  3VDZ A;  3AU4 A;  2GBK A;  2CHW A;  3VXW A;  3APC A;  2FCQ A;  2M8S A;  3JSV B;  4F8C B;  3VTV A;  1EUV B;  4BOZ B;  2YVC A;  2ASQ A;  4MSM B;  4MDK E;  5AZH A;  2J0J A;  2LGY A;  2ZEQ A;  3DOW A;  4DDI D;  4F7Z A;  4BFR A;  3PPA A;  1J0G A;  1WZ0 A;  4K7W A;  2ZVN A;  3RYT A;  3PRE A;  3WIM A;  4TUU A;  1V6E A;  2IY0 B;  1OEY A;  2GOW A;  2MBQ A;  3AU5 A;  3QAQ A;  3KYD D;  2WDT B;  3DCG A;  3UQB A;  3R7R A;  3V60 A;  3A33 B;  4LJP B;  2KX3 A;  3ECI A;  4M0W B;  4IC7 B;  1C3T A;  3Q3F A;  4HPL B;  5E6O A;  2REX A;  5JH5 C;  3T8M A;  3L08 A;  2O2V B;  3IFW B;  2HD5 B;  4MM3 A;  3ZNH B;  1ZW7 A;  2KLC A;  5E6N A;  3QCA A;  1EF1 A;  1E7U A;  1WY8 A;  1WFY A;  2M0X A;  4KZC A;  5D7G A;  2JF5 A;  1YX6 B;  4RM9 A;  2C5L C;  4F1S A;  2OJR A;  2NBU A;  2UYZ B;  1YD8 U;  4I6P A;  3EEC A;  1P1A A;  4DXA B;  2W9N A;  4A3P A;  1YIW A;  2HE7 A;  4LDT B;  3ZRC A;  3V6E B;  4EUT A;  2RSU A;  2ZNV C;  2IYD B;  2JUO A;  3KUC B;  1RRB A;  2NPT B;  2LD9 A;  4WJQ A;  2RPQ A;  1KM7 A;  3HIZ A;  4GDL B;  2KKC A;  3VTU A;  3VUX A;  1D3Z A;  1E90 A;  4ZYN A;  4DBG A;  2DZM A;  4PS7 A;  4DDG D;  4NAW B;  4AP4 C;  1K8R B;  4FA6 A;  2DZJ A;  4DWF A;  1V5T A;  4GMV A;  4GGQ A;  3M62 B;  1WGG A;  5TR5 A;  4ASW C;  4CO7 A;  3OJ3 A;  3CF6 E;  4HWI B;  4EOY A;  2KNB A;  1SGH A;  4NQK E;  1V86 A;  1NI2 A;  1XD3 B;  1R4N I;  4KVG B;  3WAN A;  2Z59 B;  2GBM A;  4FAD A;  1BT0 A;  3HM6 X;  2DEN B;  3H6N A;  4WJN A;  4EKU A;  3U8Z A;  3GZN I;  2J7Q B;  2JRI B;  4J6I A;  4W9I A;  2ZCB A;  1V81 A;  2LUE A;  2K8C A;  1GC7 A;  4ICU A;  4LJO B;  2K6Q A;  2L7R A;  4NJ6 A;  3H9D A;  4ICV A;  4RMA A;  4B95 A;  1Q5W B;  3IBE A;  5KHQ A;  1L7Y A;  2A4Z A;  2ZPN A;  4W9K A;  4EZK A;  3QX1 A;  4II3 B;  4EZL A;  5EDS A;  4EEW A;  1ZKH A;  1Q1O A;  1QZE A;  1Z5S B;  5BO4 B;  2L76 A;  4WWN A;  4MGY E;  3S2A A;  2DHZ A;  2ZPY A;  4HK2 A;  4ANU A;  2KDB A;  3PRZ A;  3R7Q A;  2KFJ A;  4PS3 A;  4A20 A;  4BKT A;  3DBL I;  3A1Q B;  3PLU A;  2N1V A;  3HK0 A;  4XX5 A;  1V49 A;  4G11 A;  2LGD A;  2EMS A;  2PE6 B;  3BIN A;  1FXT B;  2MCN B;  4E3C A;  4JIO U;  4HCN B;  4WJO A;  3MHS D;  3NHE B;  2MWS B;  1I35 A;  2BWE S;  1WM2 A;  5LXI B;  3WA0 A;  1E5W A;  2MP2 A;  3DDC B;  4GIV A;  4KDI C;  4A3O A;  4ANV A;  2FCM A;  1J19 A;  2KTR A;  4ZDV A;  5D2M B;  2KVR A;  1E8W A;  4K7S A;  1LQB A;  3JVZ X;  3ZTC A;  4G3X B;  2EKE C;  5J18 A;  2BKR B;  3VH4 B;  3P2B A;  1E8Z A;  2L05 A;  3QJZ A;  2KQS A;  1E8Y A;  2K1F A;  5CHW A;  3PHX B;  4W9H A;  2GBJ A;  3PT2 B;  3PVL A;  2L0T A;  3ZO5 B;  1C1Y B;  1YQB A;  2NS5 A;  3D32 A;  3HHM A;  4HDO A;  1EO6 A;  3H7P B;  4EFO A;  4MEM A;  1E8X A;  3ONS A;  2JT4 B;  2DZI A;  2AL6 A;  1V2Y A;  2Y5B B;  3AUL A;  2FNJ B;  3VVW B;  2BKF A;  4KIK A;  4ANX A;  1XQQ A;  2JY6 A;  5FR6 A;  3L54 A;  3PHW B;  3X0W A;  1TTN A;  3DVN V;  3ML8 A;  2KWV B;  4XZ4 A;  3VTW A;  4EZJ A;  2CHX A;  2LVP A;  3UIP B;  1V9J A;  1XT9 B;  4FJZ A;  2KLG A;  3QHT A;  2MBE A;  3WAM A;  1WR1 A;  2LVO A;  2LVQ A;  2V3S A;  4MJS A;  4IG7 B;  4WWO A;  3ZKJ C;  4HVB A;  2DX5 B;  1UBI A;  2IZV B;  2D3G A;  2RR9 A;  4CYE A;  2K25 A;  4NJ7 A;  4JLC A;  4GU2 A;  2KWU B;  4URK A;  1OQY A;  3W1S A;  5L95 C;  2CR5 A;  5LXH A;  3ZIM A;  3UGB B;  4MH0 E;  2KDE B;  4MSQ B;  2KQ7 A;  2K39 A;  2XEW A;  3RT3 B;  1WMH A;  1S3S G;  3RZW C;  2KJR A;  4ZRJ A;  3A9J B;  4WAA A;  3ZTD A;  2L00 B;  1JRU A;  3A9K A;  2IO2 B;  4W9E A;  4B9K A;  3QAR A;  5G2N A;  2I1K A;  4M8M A;  3LJ3 A;  2O6V A;  1GNU A;  2PPH A;  4M8N A;  2MP2 B;  3ZW3 A;  5CTR C;  2FAZ A;  1A5R A;  1PQS A;  3V61 A;  4KSL C;  2KTR B;  4FBJ B;  2VRR B;  2PE9 A;  3DQV A;  1KJT A;  4HXD A;  3TL5 A;  2C7H A;  3NZU A;  4AJW A;  2M17 A;  1U4A A;  4TQ0 A;  4K7U A;  3IHP C;  4JQW C;  2BYE A;  2B3A A;  1WXA A;  2GBN A;  4BVU C;  4GOC A;  3WAL A;  2MA9 B;  3H7S A;  1RFA A;  1VD2 A;  1WGR A;  4TV3 A;  1WR6 E;  2IO1 B;  3X23 A;  1KLV A;  1P3Q U;  3N30 A;  2R2Q A;  2CS4 A;  2N9P C;  2FID A;  5IAA C;  2KK8 A;  2KZR A;  1CMX B;  2Z0D B;  4GSW A;  2AL3 A;  5HKH A;  1SE9 A;  2IY1 B;  1WH3 A;  2OOB B;  2BGF A;  2K8B A;  1TBE A;  1WI0 A;  2MQJ A;  5JHB A;  2KXJ A;  4N9F 4;  3DVG Y;  2HJ8 A;  2C7N B;  3SU8 X;  2YLM A;  1H8C A;  2KOX A;  5CHV C;  2D2Q A;  3L17 A;  3K9O B;  3PRP B;  2O6V D;  3AI5 A;  3JW0 X;  4FHJ A;  2AEH A;  2KFK A;  1V80 A;  3ZNZ B;  3NS8 A;  1WXS A;  5CHF A;  4JL9 A;  2KJ6 A;  2MSE D;  1WJN A;  2N9X A;  4KDL B;  2IO3 B;  1WJ6 A;  4FHK A;  3A4R A;  4E74 A;  1UEL A;  1HE8 A;  2KDF B;  3RCZ A;  2A5U A;  2WX1 A;  3N3K B;  3RUL A;  2BF8 B;  3DBS A;  2LXC A;  4PYU A;  5DPT A;  3MTN B;  1WMH B;  1S1Q B;  1WIA A;  2DAF A;  3NY5 A;  4KZ0 A;  4DHZ B;  1SIF A;  4KSK C;  1IYF A;  2RD0 A;  2LI5 A;  4NNJ B;  2HTH A;  3A9K B;  3ZRF A;  4BOS C;  3ZUN A;  2MW5 A;  1P98 A;  4IWQ A;  1WF9 A;  2O2V A;  3VH3 B;  4BKS A;  2JZ3 B;  2EMT A;  2JVC A;  2O6V B;  3IVF A;  3JYU A;  5DPW A;  4WJP A;  2N7D A;  2KX0 A;  3VAW A;  4DK5 A;  2C60 A;  1WM3 A;  3A4S C;  3TCA A;  2LRU A;  2LRW A;  2N7E A;  3SD5 A;  4OVV A;  4IUM B;  1L2N A;  2K6D B;  1R4M I;  5D6J B;  3V6C B;  5DPS A;  1NDD A;  5DPR A;  1EF5 A;  2JRH A;  2KTF A;  2WYQ A;  4PYZ A;  4IM0 A;  3KVF B;  4W9G A;  2MX2 A;  3DPD A;  2NPT A;  3EC8 A;  2ZVO A;  3B1L X;  4NPN A;  3TMP B;  2IO0 B;  4KV2 A;  4YL8 A;  4WWP A;  5JZE B;  4TQ1 A;  3RD2 A;  3ZVV A;  2MRP A;  1UZX B;  3MJW A;  5C23 A;  3QC8 B;  3SDL C;  4DHZ E;  2KAN A;  3DVG X;  4MGI E;  1KOT A;  1NBF C;  3ENE A;  1WJ4 A;  3QQ8 B;  1GUA B;  4BBN C;  2N9E B;  2N4F A;  4IWP A;  5C1Z A;  2DYB A;  2M1M A;  3HM3 A;  1ZGU B;  2LJ5 A;  2MBH A;  4OVU A;  2FUH B;  2XK5 A;  4GDK A;  2AYO B;  3Q3J A;  3GOE A;  4G0N B;  4FJV B;  4XC2 A;  1WX7 A;  3PLV A;  2CU1 A;  3VHT C;  2ZJD A;  4BKS D;  1WXM A;  4FLH A;  3U30 A;  1P9D U;  2V1Y A;  1WYW B;  2IBI B;  4W9C A;  2KFK B;  2LZ6 A;  3PSE B;  3EFU A;  4DHJ D;  1OEY J;  3OLM D;  2Z0E B;  1RLF A;  2ZNV B;  4W9D A;  3CSF A;  4BKG A;  4IWO A;  3L13 A;  3O65 B;  4HDQ A;  5AEK B;  1V5O A;  3VFK A;  3PV1 A;  4LDT D;  2KC2 A;  3APF A;  1H4R A;  4LCD E;  3RZF A;  2DYO A;  1WGD A;  2UWQ A;  3A1Q A;  3R3M A;  1ISN A;  2CHZ A;  2JZZ A;  3QIJ A;  4TKN A;  2D10 A;  5E6P A;  3M63 B;  2AWT A;  3KH0 A;  2JXX A;  3OAW A;  2KMA A;  2L8J A;  2G3Q B;  3DVN U;  4X57 B;  4B6W A;  4RM8 A;  3PTF C;  4NY0 A;  1TGZ B;  4HCP B;  5L83 A;  3W1Y A;  3WAO A;  2ZCC A;  2NVU I;  1GC6 A;  5LLI A;  3AXC A;  4IW0 A;  3M95 A;  3R66 C;  3EHV A;  4DHJ B;  5J17 A;  4ZRI A;  1AAR A;  5J2R A;  4W9F A;  2NBV B;  2PEA A;  3UQA A;  2KN5 A;  1WXV A;  2GMI C;  2DYM A;  2QHO A;  1WE7 A;  2KDI A;  2LXA A;  2J0K A;  3K9P B;  2L3Z A;  1WX9 A;  2LWP A;  2CKH B;  1IPG A;  4FUL A;  3KW5 B;  1WGY A;  3NOB A;  2G4S A;  3H7P A;  1UH6 A; 
#chains in the Genus database with same CATH topology
 3P4P B;  3MC9 A;  1VJK A;  4IOI E;  5IA7 A;  5JHA A;  3JSV A;  1WE6 A;  1RAX A;  1I4X A;  2BYF A;  2AQ3 B;  4MJS B;  1Y8R C;  3UIN B;  3NRZ A;  2R2O A;  3QWZ B;  4GDK B;  1IGD A;  1OGW A;  3V05 A;  1X1M A;  4JX1 C;  2WX0 A;  4LNF A;  1M4V A;  2NCN A;  3MC0 B;  5HG2 A;  1N5W A;  1J8C A;  5I4D A;  1QKZ A;  3VRA B;  1WRD B;  4M0W A;  4PS8 A;  3WAP A;  3ALB A;  1JWU D;  1YQ4 B;  4WQO B;  1DOX A;  1PUT A;  3U2S C;  1HTQ A;  3HVZ A;  2K0P A;  3PZD A;  2N0S B;  3KYC D;  2LEK A;  3C0R B;  1NVI D;  1D6E C;  3A9J A;  2G9H D;  2DZK A;  5EE0 A;  4NQL B;  4AJY B;  1GJZ A;  3EFC A;  4YXD B;  2J0M A;  2LGS A;  4JGH B;  1SJE D;  1C78 A;  1E9M A;  3CST A;  5GMV A;  1C77 A;  2KHW B;  1VR9 A;  1Z2M A;  3CWI A;  3DHG C;  2MHJ A;  3L16 A;  2IGD A;  4NAW A;  2D5G A;  4C80 A;  3NJT A;  2J4X A;  2ON8 A;  2V9H A;  2JZP A;  2IPK D;  1GPX A;  2RPV A;  5BYR A;  5BYQ A;  3KUD B;  1KFY B;  4OZC A;  3ZQ4 A;  2FCQ A;  3JSV B;  3VTV A;  4BOZ B;  1QLB B;  1XLQ A;  1OQQ A;  3AB5 A;  4DDI D;  4F7Z A;  1UF0 A;  3PPA A;  2IGH A;  1N61 A;  3RYT A;  3PRE A;  2MBQ A;  3MHZ A;  3B2F A;  4M0W B;  1TT5 B;  1C3T A;  3Q3F A;  5JH5 C;  3T8M A;  1OQR A;  4HEA 1;  1PFD A;  2N7J A;  4LNO A;  4MM3 A;  4XWW A;  1ZW7 A;  1LO5 D;  1EF1 A;  4RGN A;  1E7U A;  4KZC A;  2EEL A;  2UYZ B;  1YJI A;  4I6P A;  3C8Y A;  3N9Y C;  3ZRC A;  4EUT A;  2LHE A;  2HTM E;  2W3R A;  4OVZ A;  3VUX A;  1ZPS A;  1F77 A;  3LXF A;  4NAW B;  4AP4 C;  4FA6 A;  2DZJ A;  5TR5 A;  1UNS A;  3CF6 E;  4KX6 B;  1XD3 B;  2JQR B;  2GBM A;  2Z59 B;  5BMG A;  2JRI B;  2ZCB A;  3AMZ A;  4ICU A;  3Q8B A;  2K5P A;  4LJO B;  4B95 A;  3IBE A;  2ZPN A;  4EZK A;  3QX1 A;  1GAQ B;  1PYW D;  4A6Q A;  4EZL A;  5EDS A;  4EEW A;  1QZE A;  5BO4 B;  3UGB B;  2L76 A;  3N1X C;  4ANU A;  4HK2 A;  2KDB A;  3PRZ A;  4IDI A;  3R7Q A;  4A20 A;  4BKT A;  1TS2 A;  1AN8 A;  5IKC M;  1FEH A;  2J42 A;  3ETR A;  2WHI A;  1C4C A;  1K53 A;  1CJE A;  1I35 A;  2BWE S;  3DBH B;  3BYT B;  1E5W A;  3DDC B;  3SEB A;  4ZDV A;  3IAM 1;  1C4P A;  1LQB A;  1VZ7 A;  2KVZ A;  3RFZ B;  3ZTC A;  4G3X B;  1E8Z A;  3QJZ A;  2KQS A;  4W9H A;  1K52 A;  2L0T A;  1YQB A;  3NVV A;  1TS3 A;  1CK1 A;  3ONS A;  3AUL A;  2W54 A;  3VVW B;  4KIK A;  2GLS A;  1XQQ A;  1TTN A;  1J7C A;  3Q8E A;  2MBE A;  1JAL A;  4MAC A;  2V3S A;  1KLU D;  3N1Y C;  2KAC A;  3RNF C;  1BML C;  4GU2 A;  2KWU B;  4HJG E;  1OQY A;  3W1S A;  3ZIM A;  2K39 A;  1WMH A;  3IT4 B;  3ZTD A;  3VR8 B;  1IGC A;  1UGJ A;  4M8M A;  1PDX A;  4HKZ E;  2PPH A;  4M8N A;  2RDG A;  3RNA C;  2JX5 A;  3DWM A;  2VRR B;  2PE9 A;  1KJT A;  4S0R A;  3NZU A;  2OED A;  4RNA A;  5JXV A;  4K7U A;  2B3A A;  4MH8 A;  3GE8 C;  3WAL A;  2PVO D;  1JWS D;  1TY0 A;  1YN3 A;  3N30 A;  4YTP B;  2R2Q A;  2Z8L A;  1T5X D;  2KK8 A;  4GSW A;  2IY1 B;  3L4P A;  1WH3 A;  1IUE A;  2BGF A;  4ZHO A;  1WI0 A;  2WXO A;  2ZW1 A;  2KXJ A;  4N9F 4;  1H8C A;  2D2Q A;  4EE2 A;  3K9O B;  4REZ A;  1J7A A;  4C7Z A;  2KFK A;  3ZNZ B;  1WXS A;  1DYQ A;  5CHF A;  2WXG A;  1CQV A;  2IO3 B;  3O13 A;  3RCZ A;  3N3K B;  2LXC A;  1NI3 A;  4PYU A;  1WMH B;  2DAF A;  4KZ0 A;  4DHZ B;  3P63 A;  1I4P A;  2Y3A A;  1R4N B;  4RGO S;  1TKE A;  1AW7 A;  2JVC A;  3NG0 A;  3JYU A;  4WJP A;  2N7D A;  3U7Z A;  2LRU A;  3SD5 A;  4OVV A;  4IUM B;  1L2N A;  4N6E B;  2CU3 A;  5DPS A;  5DPR A;  1JRO A;  3ZXV A;  2IJ0 A;  2WYQ A;  4IM0 A;  1GB4 A;  3KVF B;  1E7P B;  3DPD A;  3EC8 A;  2ZVO A;  1V1P A;  4NPN A;  3VRB B;  1ENF A;  2IO0 B;  4YL8 A;  2WS3 B;  3MJW A;  3SDL C;  1SEB D;  2KAN A;  4MGI E;  2N4F A;  4IWP A;  2LJ5 A;  3I9V 1;  2XK5 A;  4G0N B;  1WX7 A;  3PLV A;  3U30 A;  2V1Y A;  4W9C A;  1VZ8 A;  2KFK B;  4L1B A;  1ZDV A;  3OLM D;  2Z0E B;  2ZNV B;  2AQ1 B;  4BKG A;  2SEB D;  2JWU A;  4XE0 A;  4HDQ A;  4LDT D;  3APF A;  1H4R A;  4LCD E;  3P1M A;  2UWQ A;  3A1Q A;  3R3M A;  1JWM D;  3QIJ A;  5E6P A;  3M63 B;  3OAW A;  1SJH D;  5HFY A;  2KMA A;  2L8J A;  2G3Q B;  3ZXR A;  1TIF A;  3AEF B;  4HCP B;  3W1Y A;  5LLI A;  5J17 A;  3ZJT A;  3NVY A;  4W9F A;  2NBV B;  3B2G A;  2GMI C;  2DYM A;  2QHO A;  2KDI A;  2V0G A;  2LXA A;  1WX9 A;  1FRR A;  2H88 B;  3SFD B;  4B0M A;  1IPG A;  5IOI A;  3R2I A;  3NVW A;  2FE8 A;  1V1P B;  4A90 A;  1F9J A;  2INN E;  3ZNI D;  3Q8F A;  2MLB A;  2J52 A;  1UBQ A;  3APD A;  1G6J A;  3DBH I;  2MH7 A;  3AE5 B;  4K81 A;  1RFK A;  1JQ4 A;  4K1R B;  2XK5 B;  2NBW B;  5J2R A;  3L10 B;  3ZDM C;  4I6L B;  2ZZP B;  3DHH C;  3VUW A;  1PGA A;  4MGZ E;  1TZ1 A;  2WP9 B;  3QA8 A;  1SE4 A;  1VCB A;  4ZRK A;  3QK0 A;  3IG3 A;  4PK1 A;  2JPH A;  2OHF A;  4GLS C;  4HKQ A;  5EE9 A;  3BVZ A;  2KDM A;  2WXN A;  3E56 A;  2KWD A;  3BYY B;  1T0Y A;  1RM6 C;  1E10 A;  3U4E G;  3URY A;  3L0W B;  3OWE B;  3PRM B;  2RGF A;  4AOF A;  1V97 A;  1C9F A;  1WGH A;  4II2 B;  5DCN A;  4FN2 A;  4IM2 A;  4UDU C;  1UGM A;  2L0F A;  2I2Y A;  3W1S C;  5AZF A;  4C4V A;  3Q2A C;  3I3T B;  5D3D A;  2BYT A;  1OTR B;  4A8X C;  1FD6 A;  1LXD A;  2PJH A;  3MFG A;  3VXW A;  1VDV A;  1EUV B;  2YVC A;  4AS1 A;  3FAH A;  4MSM B;  2K3U A;  1UWX A;  4BFR A;  4YSY B;  1J0G A;  1ET6 A;  2KQ4 X;  2INC C;  3QAQ A;  1DGJ A;  3NUH B;  3UI3 A;  3UQB A;  3R7R A;  3V60 A;  2BVC A;  3ECI A;  2X38 A;  4HPL B;  2LHD A;  3U52 E;  2REX A;  1TZO A;  2O2V B;  3ZNH B;  4LNI A;  5E6N A;  1T0Q C;  3IXS A;  3GP7 A;  1WFY A;  2JF5 A;  3AEC B;  4F1S A;  1EWC A;  1YD8 U;  2QIE B;  3EEC A;  1V8C A;  4LDT B;  3V6E B;  1Q10 A;  2ZNV C;  2JUO A;  1HA5 A;  3P4Q B;  4RH6 A;  2NPT B;  3HIZ A;  2WXP A;  4DXG A;  4PS7 A;  4DDG D;  3IT6 B;  2W3S A;  2Q5W D;  1RYJ A;  4DWF A;  4C4V B;  2YEP F;  3M62 B;  2J53 A;  4LTU A;  4EOY A;  2KNB A;  1NI2 A;  1R4N I;  2WU2 B;  3WAN A;  1KLG D;  3HM6 X;  3H6N A;  3U8Z A;  2J7Q B;  4J6I A;  4ZRQ A;  2K8C A;  2K6Q A;  1YOV B;  2GB1 A;  1AWD A;  5KHQ A;  1L7Y A;  2A4Z A;  1Y56 A;  3Q3M C;  4MGY E;  2ZPY A;  2QCZ A;  2KFJ A;  1FNV A;  1QT9 A;  2WXK A;  2PKO A;  4XX5 A;  4G11 A;  4QAY A;  2VH1 A;  1WXQ A;  4US8 A;  2L32 A;  2MWS B;  4C7Y A;  1FM0 D;  1WM2 A;  2MP2 A;  4A3O A;  1J19 A;  1ROE A;  1QOB A;  1ZXI A;  2GBJ A;  3KWL A;  3ZO5 B;  3HHM A;  2NS5 A;  4LK0 M;  3HUI A;  3H7P B;  4EFO A;  2DNF A;  1V2Y A;  2AL6 A;  2FNJ B;  1HQR D;  4NAM A;  3P4S B;  4ANX A;  3GB1 A;  3DBR B;  3AEE B;  4J3O D;  2JY6 A;  3L54 A;  3PHW B;  2KWV B;  1N63 A;  5G5G A;  4EZJ A;  2CHX A;  4M02 A;  2KLG A;  3QHT A;  3PO0 A;  3WAM A;  1WR1 A;  2LVQ A;  2WXI A;  4IG7 B;  4HVB A;  2DX5 B;  2IZV B;  2D3G A;  2QDF A;  4CYE A;  4NJ7 A;  3DHI C;  5L95 C;  2CR5 A;  3W5V B;  5LXH A;  4MSQ B;  2KQ7 A;  1L0V B;  3RT3 B;  2LFI A;  1FIQ A;  3RZW C;  2KJR A;  4WIP A;  3A9J B;  4WAA A;  4ZRJ A;  2L00 B;  1JRU A;  4YSZ B;  4KGR A;  3QAR A;  2I1K A;  4ITK A;  2GRI A;  3AN1 A;  1UWM A;  2MP2 B;  4KGT A;  1A5R A;  2PIA A;  2H89 B;  2KT7 A;  4KSL C;  4FBJ B;  1GB1 A;  3DQV A;  3TL5 A;  5C3J B;  3IHP C;  3N20 C;  2GBN A;  1JML A;  4GOC A;  4B0E A;  3TEZ A;  1PGX A;  1VD2 A;  4CQN A;  1ACC A;  2IO1 B;  1P3Q U;  2N9P C;  2V3N A;  2FID A;  4RGM A;  2LMC A;  1L5P A;  5HKH A;  1SE9 A;  2W55 A;  3RN9 C;  2G1E A;  2OOB B;  2DLB A;  1MVK A;  5JHB A;  4RF0 A;  4OZA A;  2HJ8 A;  3T3N A;  1MG4 A;  2ACZ B;  5CHV C;  2EKI A;  4FHJ A;  3RPF C;  4C00 A;  3RNC C;  1XCT L;  4JL9 A;  2MSE D;  1WJN A;  3WCQ A;  4FHK A;  3A4R A;  4NJC A;  4YTN B;  2KDF B;  2VH2 A;  5AUK A;  3TUO A;  5DPT A;  3MTN B;  3FIL A;  1S1Q B;  1WIA A;  3NY5 A;  4MM3 B;  1SIF A;  4KSK C;  4O1N A;  2WGS A;  2XNA C;  1P98 A;  3Q8C A;  1WF9 A;  4IWQ A;  3VH3 B;  4TMA B;  2JZ3 B;  3GZN B;  4BKS A;  2EMT A;  1I4G A;  4DK5 A;  1WM3 A;  1NDD A;  1IBX A;  2JRH A;  1XEE A;  1EWY C;  2MX2 A;  3TMP B;  3AE6 B;  2BW2 A;  3KWV A;  2LGI A;  3DVG X;  4DHZ E;  3ENE A;  5MPO A;  2Y5C A;  4BBN C;  5C1Z A;  2QJL A;  2M1M A;  3HM3 A;  4OVU A;  3GOE A;  3VHT C;  4TSS A;  3PSE B;  4WH4 A;  3CSF A;  3L13 A;  4ACF A;  3PV1 A;  2KC2 A;  1ESF A;  2RDB C;  3RZF A;  2JZZ A;  3FIL B;  4X57 B;  4RM8 A;  3PTF C;  3TEW A;  4KKI A;  4NY0 A;  1TGZ B;  5L83 A;  3AE9 B;  1XO3 A;  1MHH E;  5EE1 A;  3ZYY X;  4XGA B;  3W2D A;  5BMH A;  3SFE B;  1F1H A;  1I4R A;  1WYG A;  2KN5 A;  4ZRP A;  1XLO A;  1IBX B;  4LNK A;  1WE7 A;  5IO9 A;  2J0K A;  3K9P B;  2LWP A;  2CKH B;  3AV8 A;  1AYF A;  2G4S A;  3DVG Y;  1UH6 A;  3Q6B A;  4KIK B;  3PS6 A;  3ZJU A;  4GN1 A;  3Q14 C;  3H8H A;  4HPM B;  4GXB A;  3HRD D;  2FIF A;  4BZA A;  3SHQ A;  1FNU A;  2JXT A;  1SSN A;  3T9L A;  3TJP A;  2DAJ A;  2KWC A;  2JYT A;  4ANW A;  3ZNG C;  1MG8 A;  4E71 A;  1YMH E;  3NZS A;  5AZG A;  2KC1 A;  1JCK B;  2FCS A;  4AQ7 A;  3ZLZ A;  5HHD G;  4HLE A;  2XBB C;  2M56 B;  5D94 A;  2L1A A;  4KGS A;  2LAS A;  3MP9 A;  1OFF A;  3LB8 C;  2BPS A;  3H1U A;  5CX3 A;  4XYC A;  4IM3 A;  3MC8 A;  1NYQ A;  3V62 A;  2BWF A;  3DBR I;  4I6N B;  1WJU A;  2E3T A;  2W82 A;  3BK1 A;  1YX5 B;  3SR6 A;  2KJH B;  4P7I A;  2WDV B;  1UD7 A;  3BY4 B;  4ZHP A;  5H92 C;  2KMC A;  4DQO C;  2N1W A;  2N9K A;  2BYV E;  4GB9 A;  1GG3 A;  1IP9 A;  5KHO A;  2D11 A;  1E7V A;  1WRI A;  1I42 A;  4MEL A;  1NEK B;  1QOF A;  4ARI A;  3VQI A;  2K8H A;  3U7D A;  3BII D;  1WX8 A;  4W9J A;  3UF8 A;  3PGE A;  4G50 A;  1JWB D;  2D07 B;  3VDZ A;  1T0R C;  3AU4 A;  1QF6 A;  2CHW A;  2M8S A;  1FFV A;  2ASQ A;  1SF0 A;  5AZH A;  4MDK E;  2J0J A;  3AEA B;  2LGY A;  2ZEQ A;  5G5H A;  3DOW A;  2X8X X;  1SIJ A;  2ZVN A;  3NS1 A;  2DWQ A;  4TUU A;  1V6E A;  2IY0 B;  1OEY A;  2GOW A;  3AU5 A;  3KYD D;  2WDT B;  2KX3 A;  4IC7 B;  3EA6 A;  3L08 A;  1E6E B;  2BBC A;  1WGK A;  4OZB A;  3GE3 C;  2KLC A;  2BS2 B;  1T0S C;  1N5X A;  1WY8 A;  1K50 A;  2M0X A;  5D7G A;  1YX6 B;  2C5L C;  1L6U A;  2NBU A;  4DXA B;  2W9N A;  4A3P A;  2DBY A;  2RSU A;  3BVG A;  2QSD A;  3RNG C;  4BAX A;  1RRB A;  4WJQ A;  1SB3 C;  2RPQ A;  4XDD A;  5TSS A;  1HZ6 A;  3VTU A;  2BTE A;  1MFW A;  4ZYN A;  4DBG A;  3P42 A;  2BB5 A;  1HTO A;  1V5T A;  4GMV A;  4GGQ A;  1WGG A;  4ASW C;  3GS2 A;  4YT0 B;  4MT5 A;  3OJ3 A;  2WLB A;  2WXF A;  4NZL B;  1V86 A;  2M0A A;  4FAD A;  1BT0 A;  2DEN B;  3RNB C;  2NTT A;  3GZN I;  1V81 A;  4TV3 A;  1TYG B;  4NJ6 A;  3LYY A;  4ICV A;  3J9C A;  1Q5W B;  2K9X A;  4W9K A;  2WXL A;  2YEP B;  1ZKH A;  1Q1O A;  2UU7 A;  1Z5S B;  4N59 A;  3S2A A;  1IYF A;  1XCQ L;  3A1Q B;  2N1V A;  4XDC A;  1QOG A;  2LGD A;  2EMS A;  3AH7 A;  1FXT B;  2MCN B;  4E3C A;  4HCN B;  3MHS D;  3WA0 A;  4K3C A;  1WSP A;  2KTR A;  2PLP A;  1ET9 A;  1DOY A;  2MJ3 A;  1QQR A;  1E8W A;  2KVR A;  4K7S A;  2ZW0 A;  5J18 A;  2BKR B;  1YQ3 B;  3FC4 A;  1LGR A;  2NTS A;  3PT2 B;  1MI0 A;  1C1Y B;  2N9L A;  1EO6 A;  4MEM A;  2DZI A;  2JT4 B;  1FFU A;  2Y5B B;  4LLG M;  3T3O A;  1WWT A;  4RF1 A;  1T3Q A;  1C4A A;  5FR6 A;  1FCL A;  3X0W A;  3DVN V;  3ML8 A;  3VTW A;  4RGT A;  2XN9 C;  4FJZ A;  2SAK A;  2FUG 1;  1TKG A;  4MJS A;  3ZKJ C;  1UBI A;  3KQ4 A;  2RR9 A;  2K25 A;  3N1Z C;  4JLC A;  5AUI A;  4URK A;  2L52 A;  1JWA D;  1FXI A;  2BQQ A;  2KDE B;  3C19 A;  4K3B A;  1S3S G;  2QMT A;  4B9K A;  5IP4 D;  5FKA C;  3BVM A;  4A9A A;  1L0Y B;  3LJ3 A;  2O6V A;  2K22 A;  1GNU A;  3ZW3 A;  5CTR C;  1A70 A;  3V61 A;  2KTR B;  2WXH A;  4HXD A;  2IDY A;  2RMM A;  3ABV B;  2C7H A;  2WNM A;  4AJW A;  2M17 A;  2PVG C;  1GOZ A;  2MJE A;  2BYE A;  1WXA A;  4BVU C;  1STE A;  1QOA A;  2MA9 B;  3Q3N C;  1WGR A;  5HI1 A;  3X23 A;  2WXJ A;  1YN4 A;  4HPP A;  2LUM A;  2KZR A;  1CMX B;  2Z0D B;  3Q8A A;  4L2Y A;  2K8B A;  2ONQ A;  1TBE A;  4WUR A;  4US9 A;  3SU8 X;  1F0Z A;  5IN7 A;  3AI5 A;  4YWG G;  1NYR A;  1K51 A;  1V80 A;  2HJ1 A;  3RMK C;  2GI9 A;  4LNN A;  4KDL B;  1FPY A;  1WJ6 A;  5BYS A;  1D4B A;  4E74 A;  1HE8 A;  4Q2J A;  5FR3 A;  2A5U A;  3RUL A;  2BF8 B;  1YNT E;  3DBS A;  3RNE C;  2BT6 A;  1TY2 A;  1TS5 A;  2R61 A;  1JRP A;  2D3A A;  2RD0 A;  4BOS C;  2HTH A;  3ZRF A;  3ZUN A;  2MW5 A;  3FKY A;  2TSS A;  3VR9 B;  2O6V B;  3IVF A;  1VRA B;  5GXG B;  3VAW A;  2KX0 A;  3TCA A;  2LRW A;  2N7E A;  2WXR A;  2K6D B;  5D6J B;  3V6C B;  2FBW B;  3DBL B;  2KTF A;  4PYZ A;  5BMI A;  1J7B A;  3B1L X;  5JZE B;  3RD2 A;  3ZVV A;  5T8I A;  1UZX B;  3QC8 B;  1KOT A;  4JPS A;  1GUA B;  1VZ6 A;  3NZ3 A;  1ZGU B;  2MBH A;  1R7S A;  4BKS D;  4XC2 A;  2CU1 A;  2ZJD A;  1WXM A;  1WYW B;  2IBI B;  2LZ6 A;  3EFU A;  1RLF A;  3Q3O C;  4IWO A;  4WAF A;  3O65 B;  5AEK B;  1V5O A;  3HVD A;  3VFK A;  1D5Z C;  1XLP A;  3V3X A;  3EUB 2;  1HEZ E;  2CHZ A;  2AWT A;  2JXX A;  3DVN U;  1VLB A;  4B6W A;  2CJN A;  1FRD A;  1ZDX A;  1CZP A;  3WAO A;  1GC6 A;  2WQY B;  4IW0 A;  3M95 A;  3R66 C;  3EHV A;  4DHJ B;  2PMV A;  2NMQ A;  4ZRI A;  2PEA A;  3UQA A;  1WXV A;  1N6Z A;  3MJ5 A;  4FUL A;  3KW5 B;  3NOB A;  1XF5 L;  1B9R A;  4M01 A;  3PZ7 A;  2BB6 A;  4HJK A;  3TIX A;  3LDZ E;  1LFD A;  4MGK E;  2PW9 A;  1Q0W B;  2G4D B;  4AWJ A;  3B0A A;  5E6J A;  1P0R A;  1ZP0 B;  3TBL D;  1TS4 A;  1YJ1 A;  3OJ4 B;  2FCN A;  3R2T A;  3ZDT A;  3M3J A;  4FJY A;  2VZK B;  2LGX A;  1FXA A;  3AM9 A;  2I1J A;  2C7M B;  1MJD A;  5G55 A;  4CHK A;  4S17 A;  2MEK A;  4BBN F;  2GBR A;  2RDH A;  2M4N A;  2KO3 A;  3VUY A;  2WXQ A;  3KUZ A;  3ML9 A;  3B08 A;  2HDE A;  4DXF A;  2G45 B;  1WZ3 A;  2PTL A;  2JWZ A;  2CJO A;  2IGG A;  2V4L A;  1C79 A;  3CMM B;  3AEG B;  2WWZ A;  4WQM A;  2KD0 A;  4W9L A;  3P4R B;  2NR2 A;  2MJD A;  4GDL A;  2ICI A;  1LM8 B;  2MBO A;  4AUQ C;  3N32 A;  2C9W B;  3UIO B;  4N58 A;  3RUI B;  1L6V A;  2MBB B;  1M94 A;  2Y5P A;  2GBK A;  2INP E;  3APC A;  2JYE A;  4JWS C;  5D3I B;  4F8C B;  4ZOH C;  4A55 A;  1R4M B;  1L0X B;  1WZ0 A;  4K7W A;  1EU3 A;  4OHJ A;  3WIM A;  1D5M C;  3W5U B;  1I4Q A;  3DCG A;  3W9C B;  3A33 B;  4LJP B;  4USA A;  5E6O A;  3KLS X;  3IFW B;  2HD5 B;  3TEX A;  1SBB B;  3QCA A;  1I4H A;  2KMM A;  4RM9 A;  3RI7 C;  2OJR A;  3ZJV A;  4OW0 A;  1P1A A;  3CIR B;  1YIW A;  2HE7 A;  3ZGZ A;  4C56 C;  2IYD B;  3KUC B;  2LD9 A;  1KM7 A;  1YN5 A;  4GDL B;  2KKC A;  1D3Z A;  1BXT A;  1E90 A;  2DZM A;  1NEN B;  1K8R B;  4CO7 A;  3AEB B;  1QIL A;  4HWI B;  4P1C C;  1SGH A;  4NQK E;  1UUP A;  4KVG B;  3Q69 A;  4EKU A;  4WJN A;  2L83 A;  4W9I A;  2LUE A;  2D3B A;  1GC7 A;  2L7R A;  4RMA A;  3H9D A;  2AQ2 B;  1DOI A;  3BK2 A;  1EU4 A;  4II3 B;  4D2K A;  4WWN A;  1KTK A;  2DHZ A;  1L4Z B;  4PS3 A;  3DBL I;  3PLU A;  3HK0 A;  1FNW A;  1V49 A;  2PE6 B;  4JWU C;  2QEJ C;  3BIN A;  4JIO U;  4WJO A;  3AE1 B;  3I5J C;  3NHE B;  5LNK 1;  5EE3 A;  5LXI B;  3AE8 B;  4GIV A;  4KDI C;  2JU6 X;  4ANV A;  2FCM A;  4JE3 B;  5D2M B;  3JVZ X;  3AE3 B;  4YTM B;  3NVZ A;  2EKE C;  3VH4 B;  3P2B A;  2WDQ B;  2L05 A;  1KH0 A;  4YSX B;  1E8Y A;  3OG5 A;  2K1F A;  5CHW A;  3PHX B;  3B9J A;  1N60 A;  2QC8 A;  3PVL A;  4HDO A;  3D32 A;  1ZXH A;  3E9S A;  1B1Z A;  1E8X A;  4FXC A;  1YJJ A;  1ZOY B;  4P6V F;  2BKF A;  3AE7 B;  4ARC A;  1P7F A;  4XZ4 A;  3UIP B;  2LVP A;  1V9J A;  1XT9 B;  1C76 A;  2LVO A;  1F52 A;  4WWO A;  3IAS 1;  4RFB A;  3BWU D;  4MH0 E;  2XEW A;  4L23 A;  1HZ5 A;  2WDR B;  2OJW A;  3A9K A;  2IO2 B;  4W9E A;  2QIL A;  5G2N A;  1F2R C;  1E0Z A;  2BS4 B;  2KYW A;  2FAZ A;  1P7E A;  1PQS A;  1BUI C;  2V4I B;  4IKG A;  2M19 A;  3AE2 B;  3PZ8 A;  4HRO A;  1U4A A;  4XWT A;  4TQ0 A;  3BZD B;  4JQW C;  1PGB A;  3H7S A;  1RFA A;  1WR6 E;  1KLV A;  2CS4 A;  4RCO A;  5IAA C;  2AL3 A;  5C2T B;  1D5X C;  2MQJ A;  1ZE3 D;  2C7N B;  1TJE A;  2YLM A;  2KOX A;  3L17 A;  4P16 A;  3PRP B;  2O6V D;  3JW0 X;  2AEH A;  3NS8 A;  2KJ6 A;  2N9X A;  1L4D B;  3AE4 B;  2LJI A;  5H8Y E;  1UEL A;  1KRH A;  4KKJ A;  2WX1 A;  2AX5 A;  2LI5 A;  4NNJ B;  3A9K B;  3I57 A;  2WU5 B;  2O2V A;  1F2R I;  1XXG A;  5DPW A;  4P1B C;  2C60 A;  2KAJ A;  1JW9 D;  3R8B A;  3A4S C;  4M00 A;  5FK9 C;  1R4M I;  2JSV X;  1EF5 A;  1RWS A;  3TEY A;  1ZUD 2;  1FMA D;  4W9G A;  3EGR A;  2BS3 B;  2NPT A;  4HRS A;  4KV2 A;  4WWP A;  4TQ1 A;  2MRP A;  1TKY A;  5C23 A;  2WXM A;  1NBF C;  1WJ4 A;  3QQ8 B;  2N9E B;  2DYB A;  1MPE A;  1T6B X;  2FUH B;  2E6X A;  4GDK A;  2AYO B;  3Q3J A;  4FJV B;  4FLH A;  1P9D U;  3AED B;  4H2A A;  4R3D A;  2KN4 A;  4DHJ D;  1OEY J;  1FCC C;  2B76 B;  4ZYS A;  4W9D A;  3I63 C;  1N62 A;  1FO4 A;  2DYO A;  1WGD A;  1ISN A;  4TKN A;  2D3C A;  2D10 A;  3KH0 A;  1MHX A;  1V1O A;  1I7H A;  4WWM A;  2ZCC A;  2NVU I;  3DWG C;  3AXC A;  2V3P A;  1SE3 A;  2I38 A;  4PT5 A;  1AAR A;  1KF6 B;  1EM7 A;  2VZK D;  1SE2 A;  3TSS A;  1HXY D;  1SXT A;  1XLN A;  2L3Z A;  2IND C;  1WGY A;  3H7P A; 
#chains in the Genus database with same CATH homology
 4KIK B;  4HJK A;  1F9J A;  3PS6 A;  3TIX A;  3ZNI D;  3LDZ E;  2MLB A;  4GN1 A;  5IA7 A;  5JHA A;  4HPM B;  1LFD A;  4GXB A;  4MGK E;  1Q0W B;  2FIF A;  2G4D B;  4AWJ A;  3B0A A;  3SHQ A;  1UBQ A;  3APD A;  1P0R A;  3JSV A;  1G6J A;  3DBH I;  1WE6 A;  1RAX A;  3TBL D;  3T9L A;  2BYF A;  4K81 A;  4MJS B;  1Y8R C;  3TJP A;  3UIN B;  4K1R B;  2DAJ A;  1YJ1 A;  2KWC A;  2R2O A;  2XK5 B;  2NBW B;  3OJ4 B;  3QWZ B;  4GDK B;  2FCN A;  3ZDT A;  3L10 B;  3ZNG C;  3M3J A;  1MG8 A;  1OGW A;  4ANW A;  4E71 A;  1X1M A;  3ZDM C;  4FJY A;  2ZZP B;  4I6L B;  2LGX A;  3NZS A;  2WX0 A;  4MGZ E;  5AZG A;  1TZ1 A;  3VUW A;  2KC1 A;  3QA8 A;  2FCS A;  1J8C A;  2NCN A;  1VCB A;  3ZLZ A;  2I1J A;  2C7M B;  4HLE A;  2XBB C;  5G55 A;  4CHK A;  4ZRK A;  3QK0 A;  5D94 A;  3IG3 A;  4BBN F;  2JPH A;  1WRD B;  2LAS A;  2GBR A;  4PS8 A;  3WAP A;  2M4N A;  2KO3 A;  3ALB A;  3VUY A;  2BPS A;  3H1U A;  4WQO B;  5CX3 A;  3KUZ A;  3ML9 A;  3PZD A;  4IM3 A;  3KYC D;  3B08 A;  3C0R B;  3A9J A;  3V62 A;  2BWF A;  2DZK A;  3DBR I;  4I6N B;  1WJU A;  4NQL B;  1T0Y A;  2G45 B;  1WZ3 A;  4AJY B;  1GJZ A;  1YX5 B;  2KJH B;  2JWZ A;  3CMM B;  3L0W B;  2V4L A;  2J0M A;  4P7I A;  3PRM B;  2WWZ A;  1UD7 A;  2KD0 A;  3BY4 B;  2RGF A;  4AOF A;  4JGH B;  4W9L A;  2KMC A;  3CST A;  2N1W A;  5GMV A;  2NR2 A;  1WGH A;  2BYV E;  2KHW B;  4GB9 A;  4II2 B;  1GG3 A;  5DCN A;  4FN2 A;  4IM2 A;  1IP9 A;  4GDL A;  1Z2M A;  1UGM A;  1LM8 B;  2L0F A;  5KHO A;  2D11 A;  2MBO A;  1E7V A;  3L16 A;  4NAW A;  1I42 A;  3W1S C;  4MEL A;  5AZF A;  4AUQ C;  3N32 A;  2C9W B;  3VQI A;  2K8H A;  3U7D A;  3I3T B;  1WX8 A;  4W9J A;  3UF8 A;  3PGE A;  4G50 A;  3UIO B;  1OTR B;  3RUI B;  2D07 B;  3KUD B;  1LXD A;  2MBB B;  1M94 A;  2PJH A;  3VDZ A;  3AU4 A;  2GBK A;  2CHW A;  3VXW A;  3APC A;  2FCQ A;  2M8S A;  3JSV B;  4F8C B;  3VTV A;  1EUV B;  4BOZ B;  2YVC A;  2ASQ A;  4MSM B;  4MDK E;  5AZH A;  2J0J A;  2LGY A;  2ZEQ A;  3DOW A;  4DDI D;  4F7Z A;  4BFR A;  3PPA A;  1J0G A;  1WZ0 A;  4K7W A;  2ZVN A;  3RYT A;  3PRE A;  3WIM A;  4TUU A;  1V6E A;  2IY0 B;  1OEY A;  2GOW A;  2MBQ A;  3AU5 A;  3QAQ A;  3KYD D;  2WDT B;  3DCG A;  3UQB A;  3R7R A;  3V60 A;  3A33 B;  4LJP B;  2KX3 A;  3ECI A;  4M0W B;  4IC7 B;  1C3T A;  3Q3F A;  4HPL B;  5E6O A;  2REX A;  5JH5 C;  3T8M A;  3L08 A;  2O2V B;  3IFW B;  2HD5 B;  4MM3 A;  3ZNH B;  1ZW7 A;  2KLC A;  5E6N A;  3QCA A;  1EF1 A;  1E7U A;  1WY8 A;  1WFY A;  2M0X A;  4KZC A;  5D7G A;  2JF5 A;  1YX6 B;  4RM9 A;  2C5L C;  4F1S A;  2OJR A;  2NBU A;  2UYZ B;  1YD8 U;  4I6P A;  3EEC A;  1P1A A;  4DXA B;  2W9N A;  4A3P A;  1YIW A;  2HE7 A;  4LDT B;  3ZRC A;  3V6E B;  4EUT A;  2RSU A;  2ZNV C;  2IYD B;  2JUO A;  3KUC B;  1RRB A;  2NPT B;  2LD9 A;  4WJQ A;  2RPQ A;  1KM7 A;  3HIZ A;  4GDL B;  2KKC A;  3VTU A;  3VUX A;  1D3Z A;  1E90 A;  4ZYN A;  4DBG A;  2DZM A;  4PS7 A;  4DDG D;  4NAW B;  4AP4 C;  1K8R B;  4FA6 A;  2DZJ A;  4DWF A;  1V5T A;  4GMV A;  4GGQ A;  3M62 B;  1WGG A;  5TR5 A;  4ASW C;  4CO7 A;  3OJ3 A;  3CF6 E;  4HWI B;  4EOY A;  2KNB A;  1SGH A;  4NQK E;  1V86 A;  1NI2 A;  1XD3 B;  1R4N I;  4KVG B;  3WAN A;  2Z59 B;  2GBM A;  4FAD A;  1BT0 A;  3HM6 X;  2DEN B;  3H6N A;  4WJN A;  4EKU A;  3U8Z A;  3GZN I;  2J7Q B;  2JRI B;  4J6I A;  4W9I A;  2ZCB A;  1V81 A;  2LUE A;  2K8C A;  1GC7 A;  4ICU A;  4LJO B;  2K6Q A;  2L7R A;  4NJ6 A;  3H9D A;  4ICV A;  4RMA A;  4B95 A;  1Q5W B;  3IBE A;  5KHQ A;  1L7Y A;  2A4Z A;  2ZPN A;  4W9K A;  4EZK A;  3QX1 A;  4II3 B;  4EZL A;  5EDS A;  4EEW A;  1ZKH A;  1Q1O A;  1QZE A;  1Z5S B;  5BO4 B;  2L76 A;  4WWN A;  4MGY E;  3S2A A;  2DHZ A;  2ZPY A;  4HK2 A;  4ANU A;  2KDB A;  3PRZ A;  3R7Q A;  2KFJ A;  4PS3 A;  4A20 A;  4BKT A;  3DBL I;  3A1Q B;  3PLU A;  2N1V A;  3HK0 A;  4XX5 A;  1V49 A;  4G11 A;  2LGD A;  2EMS A;  2PE6 B;  3BIN A;  1FXT B;  2MCN B;  4E3C A;  4JIO U;  4HCN B;  4WJO A;  3MHS D;  3NHE B;  2MWS B;  1I35 A;  2BWE S;  1WM2 A;  5LXI B;  3WA0 A;  1E5W A;  2MP2 A;  3DDC B;  4GIV A;  4KDI C;  4A3O A;  4ANV A;  2FCM A;  1J19 A;  2KTR A;  4ZDV A;  5D2M B;  2KVR A;  1E8W A;  4K7S A;  1LQB A;  3JVZ X;  3ZTC A;  4G3X B;  2EKE C;  5J18 A;  2BKR B;  3VH4 B;  3P2B A;  1E8Z A;  2L05 A;  3QJZ A;  2KQS A;  1E8Y A;  2K1F A;  5CHW A;  3PHX B;  4W9H A;  2GBJ A;  3PT2 B;  3PVL A;  2L0T A;  3ZO5 B;  1C1Y B;  1YQB A;  2NS5 A;  3D32 A;  3HHM A;  4HDO A;  1EO6 A;  3H7P B;  4EFO A;  4MEM A;  1E8X A;  3ONS A;  2JT4 B;  2DZI A;  2AL6 A;  1V2Y A;  2Y5B B;  3AUL A;  2FNJ B;  3VVW B;  2BKF A;  4KIK A;  4ANX A;  1XQQ A;  2JY6 A;  5FR6 A;  3L54 A;  3PHW B;  3X0W A;  1TTN A;  3DVN V;  3ML8 A;  2KWV B;  4XZ4 A;  3VTW A;  4EZJ A;  2CHX A;  2LVP A;  3UIP B;  1V9J A;  1XT9 B;  4FJZ A;  2KLG A;  3QHT A;  2MBE A;  3WAM A;  1WR1 A;  2LVO A;  2LVQ A;  2V3S A;  4MJS A;  4IG7 B;  4WWO A;  3ZKJ C;  4HVB A;  2DX5 B;  1UBI A;  2IZV B;  2D3G A;  2RR9 A;  4CYE A;  2K25 A;  4NJ7 A;  4JLC A;  4GU2 A;  2KWU B;  4URK A;  1OQY A;  3W1S A;  5L95 C;  2CR5 A;  5LXH A;  3ZIM A;  3UGB B;  4MH0 E;  2KDE B;  4MSQ B;  2KQ7 A;  2K39 A;  2XEW A;  3RT3 B;  1WMH A;  1S3S G;  3RZW C;  2KJR A;  4ZRJ A;  3A9J B;  4WAA A;  3ZTD A;  2L00 B;  1JRU A;  3A9K A;  2IO2 B;  4W9E A;  4B9K A;  3QAR A;  5G2N A;  2I1K A;  4M8M A;  3LJ3 A;  2O6V A;  1GNU A;  2PPH A;  4M8N A;  2MP2 B;  3ZW3 A;  5CTR C;  2FAZ A;  1A5R A;  1PQS A;  3V61 A;  4KSL C;  2KTR B;  4FBJ B;  2VRR B;  2PE9 A;  3DQV A;  1KJT A;  4HXD A;  3TL5 A;  2C7H A;  3NZU A;  4AJW A;  2M17 A;  1U4A A;  4TQ0 A;  4K7U A;  3IHP C;  4JQW C;  2BYE A;  2B3A A;  1WXA A;  2GBN A;  4BVU C;  4GOC A;  3WAL A;  2MA9 B;  3H7S A;  1RFA A;  1VD2 A;  1WGR A;  4TV3 A;  1WR6 E;  2IO1 B;  3X23 A;  1KLV A;  1P3Q U;  3N30 A;  2R2Q A;  2CS4 A;  2N9P C;  2FID A;  5IAA C;  2KK8 A;  2KZR A;  1CMX B;  2Z0D B;  4GSW A;  2AL3 A;  5HKH A;  1SE9 A;  2IY1 B;  1WH3 A;  2OOB B;  2BGF A;  2K8B A;  1TBE A;  1WI0 A;  2MQJ A;  5JHB A;  2KXJ A;  4N9F 4;  3DVG Y;  2HJ8 A;  2C7N B;  3SU8 X;  2YLM A;  1H8C A;  2KOX A;  5CHV C;  2D2Q A;  3L17 A;  3K9O B;  3PRP B;  2O6V D;  3AI5 A;  3JW0 X;  4FHJ A;  2AEH A;  2KFK A;  1V80 A;  3ZNZ B;  3NS8 A;  1WXS A;  5CHF A;  4JL9 A;  2KJ6 A;  2MSE D;  1WJN A;  2N9X A;  4KDL B;  2IO3 B;  1WJ6 A;  4FHK A;  3A4R A;  4E74 A;  1UEL A;  1HE8 A;  2KDF B;  3RCZ A;  2A5U A;  2WX1 A;  3N3K B;  3RUL A;  2BF8 B;  3DBS A;  2LXC A;  4PYU A;  5DPT A;  3MTN B;  1WMH B;  1S1Q B;  1WIA A;  2DAF A;  3NY5 A;  4KZ0 A;  4DHZ B;  1SIF A;  4KSK C;  1IYF A;  2RD0 A;  2LI5 A;  4NNJ B;  2HTH A;  3A9K B;  3ZRF A;  4BOS C;  3ZUN A;  2MW5 A;  1P98 A;  4IWQ A;  1WF9 A;  2O2V A;  3VH3 B;  4BKS A;  2JZ3 B;  2EMT A;  2JVC A;  2O6V B;  3IVF A;  3JYU A;  5DPW A;  4WJP A;  2N7D A;  2KX0 A;  3VAW A;  4DK5 A;  2C60 A;  1WM3 A;  3A4S C;  3TCA A;  2LRU A;  2LRW A;  2N7E A;  3SD5 A;  4OVV A;  4IUM B;  1L2N A;  2K6D B;  1R4M I;  5D6J B;  3V6C B;  5DPS A;  1NDD A;  5DPR A;  1EF5 A;  2JRH A;  2KTF A;  2WYQ A;  4PYZ A;  4IM0 A;  3KVF B;  4W9G A;  2MX2 A;  3DPD A;  2NPT A;  3EC8 A;  2ZVO A;  3B1L X;  4NPN A;  3TMP B;  2IO0 B;  4KV2 A;  4YL8 A;  4WWP A;  5JZE B;  4TQ1 A;  3RD2 A;  3ZVV A;  2MRP A;  1UZX B;  3MJW A;  5C23 A;  3QC8 B;  3SDL C;  4DHZ E;  2KAN A;  3DVG X;  4MGI E;  1KOT A;  1NBF C;  3ENE A;  1WJ4 A;  3QQ8 B;  1GUA B;  4BBN C;  2N9E B;  2N4F A;  4IWP A;  5C1Z A;  2DYB A;  2M1M A;  3HM3 A;  1ZGU B;  2LJ5 A;  2MBH A;  4OVU A;  2FUH B;  2XK5 A;  4GDK A;  2AYO B;  3Q3J A;  3GOE A;  4G0N B;  4FJV B;  4XC2 A;  1WX7 A;  3PLV A;  2CU1 A;  3VHT C;  2ZJD A;  4BKS D;  1WXM A;  4FLH A;  3U30 A;  1P9D U;  2V1Y A;  1WYW B;  2IBI B;  4W9C A;  2KFK B;  2LZ6 A;  3PSE B;  3EFU A;  4DHJ D;  1OEY J;  3OLM D;  2Z0E B;  1RLF A;  2ZNV B;  4W9D A;  3CSF A;  4BKG A;  4IWO A;  3L13 A;  3O65 B;  4HDQ A;  5AEK B;  1V5O A;  3VFK A;  3PV1 A;  4LDT D;  2KC2 A;  3APF A;  1H4R A;  4LCD E;  3RZF A;  2DYO A;  1WGD A;  2UWQ A;  3A1Q A;  3R3M A;  1ISN A;  2CHZ A;  2JZZ A;  3QIJ A;  4TKN A;  2D10 A;  5E6P A;  3M63 B;  2AWT A;  3KH0 A;  2JXX A;  3OAW A;  2KMA A;  2L8J A;  2G3Q B;  3DVN U;  4X57 B;  4B6W A;  4RM8 A;  3PTF C;  4NY0 A;  1TGZ B;  4HCP B;  5L83 A;  3W1Y A;  3WAO A;  2ZCC A;  2NVU I;  1GC6 A;  5LLI A;  3AXC A;  4IW0 A;  3M95 A;  3R66 C;  3EHV A;  4DHJ B;  5J17 A;  4ZRI A;  1AAR A;  5J2R A;  4W9F A;  2NBV B;  2PEA A;  3UQA A;  2KN5 A;  1WXV A;  2GMI C;  2DYM A;  2QHO A;  1WE7 A;  2KDI A;  2LXA A;  2J0K A;  3K9P B;  2L3Z A;  1WX9 A;  2LWP A;  2CKH B;  1IPG A;  4FUL A;  3KW5 B;  1WGY A;  3NOB A;  2G4S A;  3H7P A;  1UH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...