2V3SA

Structural insights into the recognition of substrates and activators by the osr1 kinase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Recognition of Substrates and Activators by the Osr1 Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE OSR1
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2v3sA00
3DBHI 2LASA 2LGDA 2R2OA 1WXVA 2K25A 4NAWB 3WANA 4ZDVA 4AJWA 5TR5A 4WJQA 3TBLD 4W9JA 3QX1A 3ZDTA 3ONSA 3ZRFA 2LVQA 2MBEA 4GGQA 1GG3A 3KUZA 2C7NB 3CSTA 4HPLB 4NJ7A 2XK5B 5G2NA 4GOCA 1PQSA 1V81A 2K8CA 4PS8A 3CMMB 4DBGA 3A1QB 2VRRB 4PS7A 1IP9A 4LDTD 2N9PC 3ZDMC 2FNJB 3CSFA 3L0WB 4KIKB 3W1SC 2IO3B 1VCBA 2NVUI 1KM7A 2KDIA 5C1ZA 2REXA 3ALBA 3OJ3A 4I6PA 3ZRCA 2JZZA 3H7SA 5LLIA 2N1WA 3JSVA 5JHAA 2KLCA 5D94A 2BYVE 2AEHA 1GUAB 4BVUC 3EHVA 3RYTA 5FR6A 3DCGA 4PYZA 3BY4B 3N3KB 2KVRA 2ASQA 3AI5A 4URKA 3WIMA 3PTFC 5D6JB 3H6NA 1E8WA 2KQSA 1YIWA 1ZW7A 3B08A 3NS8A 4CYEA 2GMIC 2B3AA 3KW5B 1WMHA 4RMAA 4BBNF 4E71A 4TV3A 1WY8A 2N9XA 3VXWA 4HLEA 2WX1A 1V9JA 3ZNGC 3AU4A 4HWIB 4YL8A 4LDTB 2MBOA 3NY5A 3VH4B 4GDKB 4NJ6A 2BWES 3AULA 3MJWA 3VTUA 1OGWA 2GBNA 2IO2B 3M95A 3KVFB 3ML8A 1WXSA 3UQAA 2C60A 1F9JA 3QWZB 3V62A 1E7VA 1WX8A 3HK0A 3NHEB 3ML9A 1FXTB 2Y5BB 3H1UA 2KANA 3DPDA 2DHZA 2NPTA 3PREA 2D2QA 2JY6A 2OJRA 3QIJA 3WALA 1I42A 1M94A 3PV1A 2JRIB 1XD3B 2XEWA 1WE7A 4HXDA 3L17A 1YJ1A 4FN2A 2MWSB 4IM3A 3MHSD 2ZCBA 3GOEA 3ZIMA 4G50A 3H7PB 4HVBA 4NPNA 3ECIA 4K7WA 1YX6B 2DZIA 4EUTA 2KZRA 3VH3B 3ZNZB 2RR9A 4B95A 3DOWA 4JL9A 2RSUA 1V5OA 2YVCA 2JXXA 2ZNVB 4ASWC 2JRHA 2NR2A 3VHTC 4W9DA 2N4FA 4A20A 2KXJA 1E7UA 1WRDB 4GIVA 3ZKJC 3DBRI 3S2AA 4F8CB 5KHQA 3VDZA 4GN1A 4TQ0A 1P3QU 4W9LA 1T0YA 4MJSA 4BOSC 3QJZA 4DHZB 3L54A 2KD0A 3ZW3A 5JH5C 5AZFA 2FAZA 4KZCA 2L76A 1YD8U 1TZ1A 2YLMA 1GJZA 2PPHA 2MX2A 4M0WB 4P7IA 2AL6A 4HPMB 3VUXA 2ZPYA 2L05A 1WGYA 2DZKA 1LM8B 2HTHA 2LVOA 3C0RB 4GDLB 3ZTCA 1LQBA 4HJKA 5KHOA 2KFKA 2LRUA 4IWPA 5E6OA 4W9KA 1G6JA 4NQKE 2MLBA 4EOYA 3JW0X 2IBIB 3QARA 5L83A 2MBHA 4BFRA 4EFOA 1MG8A 3PVLA 3L16A 2KX3A 1NDDA 3R66C 4KDLB 4BOZB 3DQVA 3PRZA 4DHZE 2K6QA 2M0XA 1ZKHA 2JZ3B 2KTRB 5AEKB 1J8CA 3BINA 2FCMA 4FBJB 2LXAA 1E8XA 2NBUA 2A5UA 1XQQA 1EF5A 4FULA 2KC1A 4MM3A 5CTRC 1WF9A 1WX9A 2ZZPB 4AWJA 2C7HA 3JYUA 5GMVA 3EFUA 2I1KA 1Z2MA 2M17A 2V1YA 2Z0EB 1WM2A 2K8HA 5CX3A 2O6VD 4GMVA 4LCDE 4M8NA 4DK5A 4IG7B 3U7DA 1TGZB 3TL5A 3V6EB 2GBMA 2MW5A 2M8SA 4GU2A 4I6NB 2FIFA 1OTRB 2M4NA 3DVNV 4DXAB 3X0WA 5L95C 3Q3JA 1WYWB 5EDSA 3R7RA 2K6DB 4MELA 1RLFA 1UGMA 4HCPB 4JIOU 3ZLZA 1V86A 3AU5A 4II3B 4TQ1A 4IWOA 2GBJA 2CKHB 4IUMB 3IFWB 4W9GA 5DPTA 2KFJA 2A4ZA 2XBBC 3SHQA 2WDTB 4B6WA 3ZNHB 1WXMA 1V49A 2MP2A 1ISNA 3D32A 4ZRKA 4ZYNA 3PZDA 2KWCA 4J6IA 3PSEB 4DWFA 1AARA 4AOFA 1P9DU 2V4LA 5CHFA 1WX7A 3APFA 5C23A 3UF8A 2KMCA 2NBWB 3JSVB 1YX5B 3QAQA 4G0NB 5D2MB 3VUYA 2RPQA 3A9JA 4MEMA 1OEYA 4G11A 4A3PA 2FUHB 3OLMD 3UQBA 2J0MA 2O6VA 4MGIE 2JWZA 2BYFA 3EC8A 3A9KA 3RCZA 5BO4B 1V6EA 3ZTDA 4EZLA 5JHBA 1UD7A 1E8ZA 4EZKA 3DVGX 1WMHB 4K7SA 3NZSA 5HKHA 1SIFA 2CHWA 2KMAA 2WX0A 3K9OB 2KLGA 3VUWA 4FJZA 4BKGA 3EECA 2L0FA 2KDFB 2LD9A 1S3SG 2D11A 2Z0DB 3KYDD 4IWQA 2C7MB 5DPSA 2G45B 4RM9A 3L08A 3DVGY 3APCA 4AUQC 1C3TA 1JRUA 4DDID 5E6NA 3B0AA 4MGZE 1WE6A 4DDGD 3PRMB 2ZPNA 4K1RB 4B9KA 5J17A 3M63B 3R7QA 3O65B 2N7EA 2LXCA 3IVFA 3PLVA 4KIKA 4N9F4 4MSQB 5AZGA 1E90A 2KKCA 1H4RA 3WA0A 2NCNA 1TTNA 3HM6X 4F7ZA 3U30A 3DBLI 2PE6B 2KC2A 4MH0E 4KDIC 3GZNI 2KNBA 2AWTA 2DZJA 3ZO5B 2G3QB 3IG3A 3PHXB 3WAMA 4HDQA 1C1YB 4HK2A 2EMSA 2IZVB 1GNUA 3RD2A 2L8JA 3PRPB 2RD0A 1H8CA 1YQBA 2CHZA 5CHVC 4WJOA 4HCNB 1K8RB 2DYMA 3LJ3A 3SU8X 3ZVVA 2DYBA 4A3OA 4ZRIA 5DPWA 3ZUNA 2MA9B 1UH6A 2LRWA 3W1YA 4OVUA 2M1MA 3OJ4B 3OAWA 2V3SA 1GC7A 4OVVA 5LXHA 1U4AA 1E5WA 2LWPA 2LVPA 2LI5A 4MSMB 1EO6A 4JLCA 1BT0A 4EKUA 5LXIB 3IBEA 2KJRA 2KK8A 4AP4C 2EMTA 2GOWA 3M62B 4KZ0A 2IO1B 5DCNA 3UGBB 2CS4A 4W9FA 3V61A 4NAWA 1KOTA 1J0GA 3QCAA 4W9CA 2KX0A 4FJYA 2KFKB 4FA6A 2QHOA 4IW0A 2D10A 4ANVA 3QK0A 1D3ZA 3ENEA 2G4DB 1SGHA 2XK5A 4NY0A 5IAAC 3SDLC 4CO7A 4GSWA 2DYOA 1Q1OA 2PJHA 3VTVA 2MBBB 4WQOB 4FLHA 1S1QB 2LZ6A 2RGFA 4BKTA 3A1QA 3A4RA 5J18A 2UWQA 2L0TA 3N30A 2N1VA 3W1SA 3ZNID 2MCNB 2MQJA 2IYDB 4KV2A 3NZUA 1A5RA 2BPSA 2KDBA 2MBQA 3QQ8B 4MGYE 3DDCB 2HJ8A 4GB9A 4WAAA 2O2VB 4EZJA 1P0RA 3NOBA 1WR6E 2I1JA 4NNJB 5IA7A 1RAXA 3KH0A 2KJHB 4X57B 3QHTA 4XZ4A 1P98A 4RM8A 1CMXB 4XX5A 1HE8A 2KN5A 2IY1B 2ZVNA 1WJ6A 3UIOB 4ICUA 4ANWA 2R2QA 2BWFA 1IPGA 4IC7B 3RZWC 1WI0A 4JQWC 4GDLA 2DAFA 3QC8B 3JVZX 4FJVB 3I3TB 4LJOB 4ICVA 3QA8A 2Z59B 3VVWB 2BKRB 3PGEA 4DHJD 3RZFA 2FCSA 2MP2B 2LUEA 3UINB 2DENB 2WWZA 4M8MA 2KJ6A 3X23A 3RUIB 2KTRA 2G4SA 3AXCA 1I35A 2HE7A 1OQYA 3APDA 4FADA 2MRPA 2AL3A 2D3GA 1SE9A 1OEYJ 1ZGUB 2DX5B 3PS6A 4JGHB 2FIDA 5D7GA 2ZNVC 4E74A 2D07B 3VQIA 1WM3A 2LGYA 4W9HA 5J2RA 3A9KB 1WH3A 1UELA 3R3MA 4PYUA 5DPRA 3TJPA 2JT4B 1KLVA 3H7PA 4FHKA 1GC6A 2DAJA 2GBKA 4IM2A 1EF1A 1WR1A 1WGHA 2K39A 3MTNB 3PLUA 3KUDB 5JZEB 2J0JA 4WJNA 3WAOA 2WYQA 4TUUA 3KUCB 1TBEA 4GDKA 3TIXA 2C5LC 4FHJA 1WIAA 3VTWA 2CU1A 4W9EA 2ZJDA 4KVGB 3K9PB 4HDOA 4KSLC 1UZXB 3H9DA 1Y8RC 3LDZE 4W9IA 3TCAA 2C9WB 2KWVB 2HD5B 4EEWA 4WJPA 2MSED 1P1AA 1WGDA 1QZEA 3B1LX 2KWUB 2IY0B 2NPTB 3A33B 3M3JA 4ZRJA 2FCQA 2NS5A 2W9NA 3CF6E 2J0KA 2O6VB 3L10B 2KTFA 3VAWA 3PT2B 4WWPA 2IO0B 1WGGA 2PE9A 2UYZB 5AZHA 2ZVOA 1WJ4A 1R4MI 1EUVB 3N32A 2JUOA 1WZ3A 1RRBA 2K1FA 1R4NI 4LJPB 3HM3A 4DHJB 1KJTA 2KDEB 2LGXA 4ANXA 2KQ7A 2BYEA 2DZMA 2EKEC 1V5TA 1V80A 3IHPC 4WWNA 1Z5SB 2PEAA 1V2YA 3DBSA 4II2B 2OOBB 1LXDA 2L3ZA 3VFKA 1L2NA 4WWOA 1UBQA 2BGFA 4MDKE 5CHWA 3UIPB 3A4SC 3SD5A 4BBNC 1NBFC 1XT9B 2L7RA 1X1MA 3PHWB 3KYCD 2BF8B 3T9LA 4MGKE 4F1SA 4MJSB 2N9EB 4PS3A 2LJ5A 4IM0A 3V60A 1LFDA 3HIZA 4CHKA 2GBRA 4GXBA 4KSKC 2ZCCA 4NQLB 3U8ZA 1WFYA 2AYOB 2CR5A 4E3CA 2JVCA 1NI2A 3RULA 4BKSA 2J7QB 3Q3FA 4I6LB 4ANUA 1WGRA 1Q5WB 2L00B 1WXAA 1WJUA 4K7UA 3WAPA 3L13A 3V6CB 4BKSD 1J19A 2N7DA 4G3XB 3P2BA 2CHXA 1IYFA 3HHMA 2FCNA 2O2VA 1E8YA 2BKFA 2KHWB 4AJYB 1WZ0A 4K81A 2KOXA 1Q0WB 2ZEQA 4TKNA 5E6PA 3DVNU 1VD2A 4XC2A 3A9JB 2KO3A 2JPHA 1UBIA 3PPAA 2NBVB 3T8MA 2JF5A 2K8BA 5G55A 3RT3B 1RFAA 1L7YA 3TMPB 1WJNA
chains in the Genus database with same CATH superfamily
5I4DA 2K25A 4NAWB 4CQNA 4AJWA 4W9JA 3ONSA 2LVQA 1VRAB 3W9CB 1GG3A 3DWGC 3KUZA 2C7NB 3CSTA 4GOCA 4DBGA 4AQ7A 3PO0A 4LDTD 2N9PC 3ZDMC 2M56B 3CSFA 4OW0A 4Q2JA 1KM7A 4HJGE 3AECB 3AN1A 3FC4A 1T3QA 2N1WA 1WWTA 3BY4B 1XLQA 2KQ4X 2ASQA 3AI5A 1E0ZA 3H6NA 1E8WA 3ZJUA 1YIWA 1ZW7A 3NS8A 4BBNF 1HZ5A 2LFIA 5T8IA 2RDBC 4HEA1 4HWIB 1C79A 3NY5A 2IJ0A 4GDKB 4NJ6A 3VTUA 2IO2B 3KVFB 3ML8A 4USAA 1F9JA 4C4VA 1VLBA 1ZXHA 3ML9A 2Y5BB 5G5GA 2JWUA 3DPDA 3RI7C 2NPTA 3PREA 1IBXB 2D2QA 3QIJA 1M4VA 1M94A 3RNCC 3AE3B 3PV1A 4HXDA 3ZGZA 3TEZA 1MHXA 4FN2A 1VJKA 4IM3A 3MHSD 3ZIMA 4ITKA 1DGJA 3SEBA 4JWUC 4K7WA 4XYCA 1TS5A 1YX6B 4EUTA 3ZNZB 4B95A 3DOWA 1N61A 2YVCA 1L4DB 2W3SA 2KAJA 3VHTC 2LEKA 3AEFB 4A20A 1XF5L 1F52A 5BMGA 4DHZB 3ZW3A 2JX5A 4WAFA 5JH5C 1ET9A 1TZ1A 2PPHA 3EGRA 1JW9D 1TYGB 1LQBA 2LRUA 4IWPA 1G6JA 2X38A 4EFOA 1MG8A 2JU6X 2K9XA 5EE9A 3DQVA 4YSXB 2JZ3B 1J8CA 1QOAA 2LXAA 1YQ4B 2A5UA 1XQQA 4FULA 1XLNA 2KC1A 5CTRC 2ZZPB 4AWJA 3BZDB 2WU2B 1Z2MA 2M17A 2K8HA 2HTME 4GMVA 3NRZA 4ZRQA 3U7DA 1TGZB 1ESFA 1VDVA 4J3OD 2WXGA 3KLSX 2FIFA 2M4NA 2WDRB 1C4AA 1T0SC 3R7RA 1VR9A 3MHZA 4HCPB 2SAKA 3T3NA 4B0MA 1V86A 1SIJA 4TSSA 2VZKB 2CKHB 2A4ZA 3FILB 2QILA 1ISNA 1FIQA 3PZDA 2KWCA 4J6IA 4DWFA 1AARA 4P1BC 2NBWB 4NAMA 4WWMA 2HDEA 4G0NB 2AX5A 2FUHB 2O6VA 4EZLA 1UD7A 2LGSA 5HKHA 2CHWA 2KVZA 2KLGA 4FJZA 4IDIA 2KDFB 2Z0DB 1MG4A 4IWQA 1GOZA 1AN8A 4PT5A 1C3TA 3P63A 5J17A 1GJZA 3IVFA 1E90A 1XO3A 3DBLI 2KC2A 4RF0A 4YT0B 3AE4B 4KDIC 1XCTL 3PHXB 1WXQA 3WAMA 4HDQA 2R61A 3MP9A 3NVYA 3RD2A 2PTLA 3IAS1 1KLUD 5CHVC 4WJOA 2QEJC 1PGAA 4RH6A 4A3OA 5D3IB 1UH6A 2JSVX 2LRWA 3W1YA 2PVOD 4OVUA 2MJ3A 3OJ4B 4OVVA 5LXHA 1U4AA 1V1PB 2LI5A 1EO6A 4JLCA 5LXIB 1D5ZC 3L4PA 3ZJVA 2KK8A 1PUTA 2GRIA 2IO1B 1C4CA 3V61A 3QCAA 4C7YA 1I4RA 2D10A 3ENEA 3ZQ4A 1J7AA 3NJTA 1SGHA 2XK5A 4NY0A 5IAAC 3SDLC 4ZRPA 4CO7A 4GSWA 1Q1OA 2MBBB 1UWMA 4BKTA 2LZ6A 2L0TA 5EE3A 3W1SA 3ZNID 2MCNB 2IYDB 3EA6A 3U2SC 2LHEA 2HJ8A 1P0RA 3NOBA 2I1JA 5IA7A 2WXPA 3R2IA 1RAXA 3BYYB 1Q10A 1WJ6A 1SSNA 2ACZB 1T0RC 3AE2B 1N62A 2M0AA 3R8BA 3VVWB 3PGEA 1D4BA 3LXFA 2KJ6A 2L32A 2VH1A 1D6EC 2G4SA 3U7ZA 3I57A 1VZ6A 1OQYA 2MRPA 1OEYJ 2BB6A 1FD6A 3VQIA 1WM3A 1YN3A 4LNIA 4PYUA 1GB1A 2DAJA 1WGHA 2K39A 3PLUA 3KUDB 1ET6A 3WAOA 2WYQA 4GDKA 3TIXA 2VZKD 4C56C 3KWLA 2K22A 4KVGB 4HDOA 3TCAA 2KWVB 4WJPA 1ZDXA 1WGDA 1TY2A 2NPTB 1DYQA 3VRBB 4JWSC 2W9NA 1QLBB 2G1EA 4S0RA 1TKEA 1LGRA 2KTFA 4KGRA 2INDC 2UYZB 2BB5A 3N1XC 2ZVOA 1EUVB 4LJPB 1WZ3A 2K1FA 1ZPSA 1OFFA 1KJTA 1L0XB 2EKEC 4RF1A 1V80A 3C8YA 2CJOA 3TEWA 3DBSA 3P4PB 2OOBB 4HRSA 1N6ZA 2PKOA 4WWOA 2BGFA 1XT9B 4MGKE 4D2KA 3SFDB 4F1SA 4PS3A 4IM0A 4P1CC 4K3BA 4CHKA 3NVWA 2J52A 4KSKC 4NQLB 1WFYA 2CR5A 4BKSA 2GB1A 1HQRD 1PFDA 2MHJA 2XN9C 1WJUA 4K7UA 3WAPA 3L13A 1PGBA 2KN4A 3UI3A 1EU3A 1V1OA 3HHMA 3B2GA 5E6PA 3DVNU 1XEEA 3PPAA 3RNGC 4QAYA 3TMPB 3DBHI 2LASA 2LGDA 2QIEB 2R2OA 1WXVA 1YN4A 4AS1A 2WU5B 1WYGA 4WJQA 3RNBC 3QX1A 3OG5A 1SE3A 4HPLB 5G2NA 5FKAC 2ZW0A 3CMMB 4DXGA 3A1QB 2VRRB 2DLBA 2RDGA 4PS7A 3GB1A 4KIKB 3U4EG 3W1SC 2NVUI 2KDIA 3ALBA 3OJ3A 1TZOA 3H7SA 5LLIA 4HROA 1FCLA 5JHAA 2ON8A 2KLCA 2BYVE 1GUAB 3RNEC 3RYTA 3VRAB 2KQSA 1FCCC 2GMIC 4A90A 4E71A 3BVZA 1WY8A 3VXWA 4LDTB 1D5XC 2MBOA 5BYRA 1K51A 3ABVB 3AULA 4R3DA 3ETRA 2N9LA 1OGWA 1WXSA 2WNMA 3P1MA 3BYTB 4L2YA 3UQAA 3QWZB 3H8HA 4N6EB 2KANA 1CZPA 4YSYB 2OJRA 1AWDA 1I4QA 1I42A 1YMHE 2WXNA 1GB4A 1XD3B 4HVBA 1JQ4A 2RR9A 2RSUA 1V5OA 3CWIA 2JRHA 3AEAB 4W9DA 2N4FA 1E7UA 3VDZA 1I4HA 4MJSA 2OJWA 3L54A 3N1ZC 2JQRB 5AZFA 2FAZA 4KZCA 2YLMA 2MX2A 3MC0B 4M0WB 3AEDB 3VUXA 2DZKA 2HTHA 1C78A 4GDLB 4HJKA 5FK9C 3JW0X 1R4NB 2MBHA 3CIRB 1HEZE 1NDDA 3TUOA 4DQOC 4KDLB 4BOZB 1V97A 1TIFA 1MHHE 4KGTA 2M0XA 5AEKB 2KTRB 3BINA 2NBUA 3T3OA 1WX9A 2C7HA 2IGGA 3JYUA 3MJ5A 3NG0A 1ZOYB 4IG7B 1B9RA 2GBMA 1RWSA 3Q3OC 2M8SA 3DBRB 4YTMB 1WYWB 5EDSA 1RLFA 1UGMA 4II3B 4YXDB 4W9GA 2KFJA 2WDTB 4B6WA 1WXMA 1V49A 2MP2A 3D32A 5AUKA 2LGIA 1FXIA 1P9DU 2V4LA 3APFA 2HJ1A 2Q5WD 3JSVB 4MT5A 3A9JA 1OEYA 3OLMD 4MGIE 2JWZA 3EC8A 4XGAB 2V3NA 1V6EA 3ZTDA 5JHBA 3MC8A 3MFGA 2K5PA 2WX0A 3BWUD 3K9OB 3Q8CA 3VUWA 3EECA 2L0FA 3HUIA 2C7MB 5DPSA 2G45B 4LNNA 1N5XA 2QMTA 3DVGY 4AUQC 1KH0A 4DDID 1N63A 2M19A 3B0AA 1WE6A 3NZ3A 5TSSA 4DDGD 4K1RB 4B9KA 3M63B 3R7QA 4N9F4 2NCNA 3HM6X 3U30A 3Q3NC 3GZNI 1TKGA 2G3QB 2GLSA 1FPYA 1K52A 3Q8EA 1FNUA 1YQBA 2Z8LA 1WRIA 4HCNB 5HI1A 1NEKB 3ZVVA 5IP4D 2MA9B 2RMMA 2M1MA 1GC7A 5HFYA 3AE9B 3BK1A 3NVVA 1YN5A 3AM9A 1TJEA 4MSMB 1BUIC 4EKUA 2Y3AA 4AP4C 3M62B 1GAQB 1MVKA 2KT7A 3UGBB 1IBXA 4FJYA 2KFKB 1PDXA 4FA6A 4HKQA 2QHOA 1XLOA 4KKJA 1L4ZB 4FLHA 2N1VA 3NZUA 1NYRA 1A5RA 2BPSA 4MM3B 4MGYE 3DDCB 4GB9A 4EZJA 4H2AA 2WXJA 1QOFA 1CMXB 2KN5A 2ZVNA 3UIOB 2BWFA 2K3UA 4IC7B 1IPGA 2KMMA 2EKIA 2VH2A 2DAFA 3JVZX 3GE3C 2Z59B 4B0EA 4DHJD 4YWGG 2DENB 2WWZA 5HHDG 4M8MA 1XCQL 5EE0A 2KWDA 3RUIB 1FRRA 3J9CA 1KF6B 4FADA 1SE9A 3AE6B 3PS6A 2FIDA 3EFCA 1E7PB 1UELA 3Q8FA 3IAM1 5DPRA 2LJIA 2WXKA 1KLVA 4IM2A 2CJNA 1WR1A 1HTQA 2H88B 3MTNB 4DXFA 1TBEA 3FILA 3VTWA 2CU1A 4C7ZA 1L0YB 1QQRA 1TS3A 1UZXB 3LDZE 1ZP0B 2C9WB 1P1AA 2NMQA 1QZEA 2KWUB 4ZRJA 1TT5B 2J0KA 2O6VB 3PT2B 3WCQA 2PE9A 2MEKA 2QDFA 1IGCA 1R4MI 1RRBA 4DHJB 2LGXA 3PZ7A 2BYEA 2DZMA 4YSZB 1V5TA 1OQQA 1MPEA 2PEAA 2L3ZA 1I7HA 4MDKE 2QJLA 3UIPB 3SD5A 4BBNC 1EU4A 2L7RA 3KYCD 2BF8B 3T9LA 4A6QA 2N9EB 2KACA 5E6JA 3V60A 2GBRA 4M0WA 1JMLA 2ZCCA 2BTEA 3U8ZA 4WH4A 1MFWA 1V8CA 3NVZA 4E3CA 2JVCA 1NI2A 1QOGA 3RULA 4ANUA 1WGRA 2L00B 1WXAA 2WLBA 2NTTA 1E9MA 4G3XB 4ACFA 4REZA 2FCNA 1JWMD 2KHWB 3FKYA 4K81A 1Q0WB 4TKNA 1C76A 4XC2A 4L1BA 1UBIA 1FNWA 3RT3B 2X8XX 4ZDVA 1RFKA 3TBLD 3AEBB 2TSSA 1HZ6A 2N9KA 4GGQA 1PQSA 1UGJA 1V81A 4PS8A 3BVMA 1IP9A 2IO3B 2EELA 5C1ZA 2REXA 4I6PA 2JZZA 5D94A 1VZ7A 3E9SA 3EHVA 3DCGA 4PYZA 2KVRA 3TEYA 3HVZA 4EE2A 4URKA 5D6JB 4HKZE 1TS4A 3SR6A 2B3AA 3IT4B 5EE1A 2LUMA 4TV3A 4RNAA 1RM6C 1V9JA 2BVCA 1SEBD 3AU4A 2RPVA 2BYTA 3VH4B 1DOIA 3SFEB 3ZJTA 2GBNA 2WXHA 3OWEB 3BVGA 3V62A 4A9AA 1SJED 1WX8A 1FXTB 3H1UA 2DHZA 2WGSA 4US8A 2JRIB 1WE7A 2ZCBA 3GOEA 1NVID 2ZW1A 4G50A 3H7PB 1IGDA 2JXTA 2KZRA 3C19A 3EUB2 2ZNVB 2NR2A 2JYTA 2KXJA 2KDMA 3PZ8A 1WRDB 4GIVA 4F8CB 3DBRI 3S2AA 5KHQA 4RFBA 4GN1A 4W9LA 4BOSC 1YD8U 2L76A 4WURA 4P7IA 2AL6A 4HPMB 2L05A 1LM8B 2LVOA 2D3BA 4NZLB 5KHOA 2KFKA 5E6OA 4W9KA 1ROEA 1FNVA 4NQKE 4EOYA 1ENFA 4BFRA 1NYQA 3L16A 2KX3A 4XE0A 3R66C 1J7BA 3RPFC 2K6QA 3ZXRA 1ZKHA 2FCMA 4FBJB 1E8XA 4MM3A 3HRDD 1WF9A 3Q8AA 1QOBA 1MJDA 1AW7A 3EFUA 2I1KA 5CX3A 2Z0EB 1WM2A 4N59A 4YTNB 1T6BX 2QC8A 4ZYSA 3V6EB 3DHGC 4I6NB 3LB8C 3DVNV 4DXAB 5L95C 2WXFA 3Q3JA 4MELA 2ONQA 3N9YC 3AU5A 3AE7B 4KX6B 4IWOA 2GBJA 4IUMB 3ZNHB 2PLPA 4ZYNA 4MH8A 3PSEB 1JWUD 3N1YC 3AMZA 5CHFA 1WX7A 5C23A 2KMCA 2DNFA 5D2MB 4MEMA 4RGTA 4BZAA 2E3TA 2BYFA 1PGXA 3RN9C 3AB5A 4EZKA 3HVDA 1WMHB 4K7SA 1SIFA 2SEBD 4O1NA 5H8YE 4BKGA 3W5VB 1S3SG 2DWQA 3KYDD 4RM9A 3APCA 1JRUA 3DBLB 1N60A 3PRMB 3KWVA 1FEHA 3O65B 4KIKA 2LXCA 4BVUC 4MSQB 5AZGA 3WA0A 2KKCA 1H4RA 4XDDA 1TTNA 2INCC 1N5WA 3W2DA 2KNBA 2AWTA 2DZJA 3IG3A 4OZAA 2IZVB 4NJCA 2L8JA 3PRPB 1FXAA 1JROA 1BMLC 1ZXIA 1ZDVA 2D5GA 1K8RB 2BT6A 3AH7A 3Q2AC 2G9HD 5DPWA 3ZUNA 1WGKA 4KKIA 2LVPA 2WS3B 3DHIC 3IBEA 2KJRA 2EMTA 2GOWA 5FR3A 5DCNA 1JWBD 4NAWA 2AQ1B 1KOTA 1F1HA 1J0GA 3GP7A 3MC9A 2KX0A 4LNKA 4IW0A 4ANVA 2L1AA 1D3ZA 1F77A 1C4PA 2N7JA 2DYOA 1STEA 4WQOB 1S1QB 2RGFA 2UWQA 4A8XC 1QT9A 3P4QB 1F2RC 3DBHB 4OVZA 2KDBA 2MBQA 1KRHA 4WAAA 1GPXA 1HA5A 3KH0A 2KJHB 3N20C 4XZ4A 1P98A 4RM8A 1UF0A 4ICUA 4ANWA 2R2QA 1FMAD 2WXQA 3I3TB 4ICVA 1CJEA 1TKYA 5IKCM 2AQ2B 3I5JC 4XWWA 3VR8B 2IGHA 2FCSA 3RZFA 2LUEA 2QCZA 4RGOS 3X23A 4ARCA 2KTRA 3DWMA 4C4VB 2Y5CA 1I35A 2HE7A 2E6XA 2W82A 1F0ZA 2D3GA 1UUPA 5D7GA 2BBCA 4OZCA 2D07B 4W9HA 3A9KB 1WH3A 3R3MA 3FAHA 1OQRA 3RFZB 2JT4B 4BAXA 2GBKA 4P6VF 3AE5B 3E56A 1J7CA 4N58A 3KUCB 4TUUA 2W55A 4S17A 4FHJA 1KFYB 2PVGC 1NI3A 4KSLC 3H9DA 1Y8RC 4W9IA 3Q14C 3B1LX 4LNFA 2IY0B 5GXGB 1EM7A 2W54A 3CF6E 3L10B 2W3RA 4WWPA 2IO0B 4UDUC 5IO9A 2D3CA 4OHJA 1R4NI 2I38A 3HM3A 1FM0D 2WQYB 4ANXA 2KDEB 3P4SB 5H92C 3V3XA 4WWNA 1P7FA 1V2YA 1LXDA 3VFKA 1L2NA 3NS1A 2OEDA 5CHWA 1NBFC 1A70A 2BS2B 1SB3C 3PHWB 4MACA 4MJSB 1E10A 1T5XD 1ZUD2 2AYOB 2V3PA 3V6CB 2N7DA 1JALA 1IYFA 2O2VA 1E8YA 2BKFA 3AEGB 1UWXA 5IOIA 2MJDA 1FFVA 3TSSA 3IT6B 2YEPF 2JPHA 5BMIA 2NBVB 2K8BA 3R2TA 3GS2A 3WANA 5TR5A 1YOVB 3ZDTA 3ZRFA 2MBEA 1I4GA 4NJ7A 2XK5B 2UU7A 1MI0A 1JCKB 2K8CA 1IUEA 2WXLA 3KQ4A 3TEXA 2FNJB 3L0WB 4LK0M 2L83A 1VCBA 2OHFA 2PIAA 4ZHPA 5C3JB 3ZRCA 3JSVA 4JE3B 2AEHA 5FR6A 1XLPA 2IDYA 3N3KB 1D5MC 3Q6BA 3WIMA 3PTFC 1SE4A 3B08A 4CYEA 3KW5B 1WMHA 4RMAA 2N9XA 4HLEA 2WX1A 1PYWD 3ZNGC 3I9V1 4YL8A 3P4RB 4JX1C 4TMAB 1L0VB 5JXVA 2BWES 3MJWA 5AUIA 2IPKD 3M95A 2C60A 1E7VA 3AV8A 3HK0A 3NHEB 1RYJA 2JY6A 3WALA 1QILA 2H89B 2XEWA 1E6EB 3L17A 1YJ1A 2MWSB 1SE2A 4NPNA 3ECIA 3U52E 3RNAC 2DZIA 3VH3B 4JL9A 2JXXA 4M00A 4ASWC 2WXMA 3ZKJC 4TQ0A 2CU3A 1P3QU 1FO4A 1T0YA 2YEPB 4C00A 3QJZA 2KD0A 2NTSA 2WXRA 2BQQA 2ZPYA 1WGYA 4C80A 4HPPA 3C0RB 3ZTCA 2ICIA 2MLBA 3QARA 2IBIB 5L83A 4L23A 3LYYA 1FFUA 1P7EA 1R4MB 3PVLA 3Q69A 1JWAD 1L6UA 3RNFC 4ARIA 3PRZA 4DHZE 1AYFA 1Y56A 1EF5A 4RGNA 5GMVA 2V1YA 5C2TB 2O6VD 4LCDE 4M8NA 4DK5A 3AE8B 1YQ3B 3TL5A 5IN7A 2MW5A 4GU2A 1L6VA 1OTRB 3X0WA 4P16A 4OZBA 2K6DB 2WHIA 4JIOU 3ZLZA 2Y5PA 4TQ1A 1YNTE 2FBWB 2GI9A 1VZ8A 5DPTA 3GE8C 3IFWB 1C77A 4LNOA 2XBBC 3SHQA 1FRDA 1K50A 4ZRKA 3P42A 2J53A 4AOFA 3UF8A 4IKGA 1YX5B 3QAQA 3VUYA 4ZHOA 2RPQA 2MH7A 4G11A 4A3PA 3UQBA 2J0MA 3BK2A 3A9KA 3RCZA 2J4XA 5BO4B 1KTKA 1E8ZA 3DVGX 3NZSA 2KMAA 3Q3MC 2BW2A 2K0PA 2D3AA 1T0QC 2LD9A 2D11A 2LHDA 3L08A 3B2FA 3VR9B 5E6NA 4MGZE 2JYEA 2FE8A 2WXOA 2ZPNA 2N7EA 3PLVA 3V05A 1EWCA 4F7ZA 2PE6B 4MH0E 3ZO5B 1C1YB 1SJHD 2EMSA 4HK2A 4M01A 2WXIA 1GNUA 5D3DA 2RD0A 1H8CA 2CHZA 2FUG1 3LJ3A 2DYMA 1NENB 4GLSC 3SU8X 2DYBA 4ZRIA 1SF0A 1K53A 3OAWA 2V3SA 4KGSA 3BIID 1E5WA 2LWPA 4K3CA 5BYQA 3Q8BA 1BT0A 2LMCA 4KZ0A 1SXTA 2PMVA 2CS4A 4W9FA 1DOXA 4W9CA 4WIPA 3QK0A 2J42A 2G4DB 4PK1A 3B9JA 2PJHA 3VTVA 2BS3B 1C9FA 3A1QA 3A4RA 4M02A 5J18A 3N30A 2V0GA 1YJJA 1I4PA 2MQJA 4KV2A 1TS2A 1KLGD 2N0SB 3QQ8B 4YTPB 4FXCA 5BYSA 2O2VB 1JRPA 1ZE3D 2INNE 1WR6E 2WP9B 1BXTA 4NNJB 4X57B 3QHTA 4A55A 2QSDA 4XX5A 1HE8A 2IY1B 1TY0A 1HTOA 3RZWC 1WI0A 4JQWC 4GDLA 3QC8B 4FJVB 2WDQB 1ACCA 2KYWA 4LJOB 2IGDA 4XWTA 3QA8A 2BKRB 1B1ZA 2MJEA 4WQMA 2MP2B 2PW9A 3UINB 1F2RI 3AE1B 3AXCA 1I4XA 3APDA 1JWSD 2AL3A 2WDVB 1ZGUB 2DX5B 5HG2A 4JGHB 2V4IB 5LNK1 2ZNVC 4E74A 2LGYA 1XXGA 5J2RA 2V9HA 1CQVA 2RDHA 3IXSA 1SBBB 3TJPA 3H7PA 4FHKA 5MPOA 1GC6A 2I2YA 1EF1A 5JZEB 4LLGM 2J0JA 2B76B 4WJNA 1HXYD 1DOYA 2C5LC 1WIAA 2INPE 4W9EA 2DBYA 2ZJDA 3W5UB 3K9PB 2HD5B 4EEWA 1UNSA 2MSED 3A33B 1YJIA 3M3JA 3ZXVA 2FCQA 1WSPA 2NS5A 3DHHC 4XDCA 1R7SA 3VAWA 1WGGA 5AZHA 1WJ4A 2JZPA 3N32A 2JUOA 2L52A 4RGMA 2KQ7A 1QF6A 3IHPC 1Z5SB 3I63C 3ZYYX 4II2B 5BMHA 1UBQA 1V1PA 1EWYC 4ZOHC 3A4SC 4IOIE 4LTUA 2AQ3B 1X1MA 3NUHB 2LJ5A 1QKZA 1LFDA 3GZNB 3HIZA 4GXBA 1CK1A 4US9A 3URYA 2J7QB 3AEEB 3Q3FA 4I6LB 1Q5WB 2BS4B 1L5PA 4BKSD 1J19A 3P2BA 4JPSA 2CHXA 5G5HA 3O13A 4AJYB 1WZ0A 2KOXA 2ZEQA 4RCOA 1VD2A 3A9JB 2KO3A 1LO5D 3RMKC 3T8MA 2JF5A 5G55A 2XNAC 1RFAA 1L7YA 1WJNA
chains in the Genus database with same CATH topology
3DBHI 2LASA 2LGDA 2R2OA 1WXVA 2K25A 4NAWB 3WANA 4ZDVA 4AJWA 5TR5A 4WJQA 3TBLD 4W9JA 3QX1A 3ZDTA 3ONSA 3ZRFA 2LVQA 2MBEA 4GGQA 1GG3A 3KUZA 2C7NB 3CSTA 4HPLB 4NJ7A 2XK5B 5G2NA 4GOCA 1PQSA 1V81A 2K8CA 4PS8A 3CMMB 4DBGA 3A1QB 2VRRB 4PS7A 1IP9A 4LDTD 2N9PC 3ZDMC 2FNJB 3CSFA 3L0WB 4KIKB 3W1SC 2IO3B 1VCBA 2NVUI 1KM7A 2KDIA 5C1ZA 2REXA 3ALBA 3OJ3A 4I6PA 3ZRCA 2JZZA 3H7SA 5LLIA 2N1WA 3JSVA 5JHAA 2KLCA 5D94A 2BYVE 2AEHA 1GUAB 4BVUC 3EHVA 3RYTA 5FR6A 3DCGA 4PYZA 3BY4B 3N3KB 2KVRA 2ASQA 3AI5A 4URKA 3WIMA 3PTFC 5D6JB 3H6NA 1E8WA 2KQSA 1YIWA 1ZW7A 3B08A 3NS8A 4CYEA 2GMIC 2B3AA 3KW5B 1WMHA 4RMAA 4BBNF 4E71A 4TV3A 1WY8A 2N9XA 3VXWA 4HLEA 2WX1A 1V9JA 3ZNGC 3AU4A 4HWIB 4YL8A 4LDTB 2MBOA 3NY5A 3VH4B 4GDKB 4NJ6A 2BWES 3AULA 3MJWA 3VTUA 1OGWA 2GBNA 2IO2B 3M95A 3KVFB 3ML8A 1WXSA 3UQAA 2C60A 1F9JA 3QWZB 3V62A 1E7VA 1WX8A 3HK0A 3NHEB 3ML9A 1FXTB 2Y5BB 3H1UA 2KANA 3DPDA 2DHZA 2NPTA 3PREA 2D2QA 2JY6A 2OJRA 3QIJA 3WALA 1I42A 1M94A 3PV1A 2JRIB 1XD3B 2XEWA 1WE7A 4HXDA 3L17A 1YJ1A 4FN2A 2MWSB 4IM3A 3MHSD 2ZCBA 3GOEA 3ZIMA 4G50A 3H7PB 4HVBA 4NPNA 3ECIA 4K7WA 1YX6B 2DZIA 4EUTA 2KZRA 3VH3B 3ZNZB 2RR9A 4B95A 3DOWA 4JL9A 2RSUA 1V5OA 2YVCA 2JXXA 2ZNVB 4ASWC 2JRHA 2NR2A 3VHTC 4W9DA 2N4FA 4A20A 2KXJA 1E7UA 1WRDB 4GIVA 3ZKJC 3DBRI 3S2AA 4F8CB 5KHQA 3VDZA 4GN1A 4TQ0A 1P3QU 4W9LA 1T0YA 4MJSA 4BOSC 3QJZA 4DHZB 3L54A 2KD0A 3ZW3A 5JH5C 5AZFA 2FAZA 4KZCA 2L76A 1YD8U 1TZ1A 2YLMA 1GJZA 2PPHA 2MX2A 4M0WB 4P7IA 2AL6A 4HPMB 3VUXA 2ZPYA 2L05A 1WGYA 2DZKA 1LM8B 2HTHA 2LVOA 3C0RB 4GDLB 3ZTCA 1LQBA 4HJKA 5KHOA 2KFKA 2LRUA 4IWPA 5E6OA 4W9KA 1G6JA 4NQKE 2MLBA 4EOYA 3JW0X 2IBIB 3QARA 5L83A 2MBHA 4BFRA 4EFOA 1MG8A 3PVLA 3L16A 2KX3A 1NDDA 3R66C 4KDLB 4BOZB 3DQVA 3PRZA 4DHZE 2K6QA 2M0XA 1ZKHA 2JZ3B 2KTRB 5AEKB 1J8CA 3BINA 2FCMA 4FBJB 2LXAA 1E8XA 2NBUA 2A5UA 1XQQA 1EF5A 4FULA 2KC1A 4MM3A 5CTRC 1WF9A 1WX9A 2ZZPB 4AWJA 2C7HA 3JYUA 5GMVA 3EFUA 2I1KA 1Z2MA 2M17A 2V1YA 2Z0EB 1WM2A 2K8HA 5CX3A 2O6VD 4GMVA 4LCDE 4M8NA 4DK5A 4IG7B 3U7DA 1TGZB 3TL5A 3V6EB 2GBMA 2MW5A 2M8SA 4GU2A 4I6NB 2FIFA 1OTRB 2M4NA 3DVNV 4DXAB 3X0WA 5L95C 3Q3JA 1WYWB 5EDSA 3R7RA 2K6DB 4MELA 1RLFA 1UGMA 4HCPB 4JIOU 3ZLZA 1V86A 3AU5A 4II3B 4TQ1A 4IWOA 2GBJA 2CKHB 4IUMB 3IFWB 4W9GA 5DPTA 2KFJA 2A4ZA 2XBBC 3SHQA 2WDTB 4B6WA 3ZNHB 1WXMA 1V49A 2MP2A 1ISNA 3D32A 4ZRKA 4ZYNA 3PZDA 2KWCA 4J6IA 3PSEB 4DWFA 1AARA 4AOFA 1P9DU 2V4LA 5CHFA 1WX7A 3APFA 5C23A 3UF8A 2KMCA 2NBWB 3JSVB 1YX5B 3QAQA 4G0NB 5D2MB 3VUYA 2RPQA 3A9JA 4MEMA 1OEYA 4G11A 4A3PA 2FUHB 3OLMD 3UQBA 2J0MA 2O6VA 4MGIE 2JWZA 2BYFA 3EC8A 3A9KA 3RCZA 5BO4B 1V6EA 3ZTDA 4EZLA 5JHBA 1UD7A 1E8ZA 4EZKA 3DVGX 1WMHB 4K7SA 3NZSA 5HKHA 1SIFA 2CHWA 2KMAA 2WX0A 3K9OB 2KLGA 3VUWA 4FJZA 4BKGA 3EECA 2L0FA 2KDFB 2LD9A 1S3SG 2D11A 2Z0DB 3KYDD 4IWQA 2C7MB 5DPSA 2G45B 4RM9A 3L08A 3DVGY 3APCA 4AUQC 1C3TA 1JRUA 4DDID 5E6NA 3B0AA 4MGZE 1WE6A 4DDGD 3PRMB 2ZPNA 4K1RB 4B9KA 5J17A 3M63B 3R7QA 3O65B 2N7EA 2LXCA 3IVFA 3PLVA 4KIKA 4N9F4 4MSQB 5AZGA 1E90A 2KKCA 1H4RA 3WA0A 2NCNA 1TTNA 3HM6X 4F7ZA 3U30A 3DBLI 2PE6B 2KC2A 4MH0E 4KDIC 3GZNI 2KNBA 2AWTA 2DZJA 3ZO5B 2G3QB 3IG3A 3PHXB 3WAMA 4HDQA 1C1YB 4HK2A 2EMSA 2IZVB 1GNUA 3RD2A 2L8JA 3PRPB 2RD0A 1H8CA 1YQBA 2CHZA 5CHVC 4WJOA 4HCNB 1K8RB 2DYMA 3LJ3A 3SU8X 3ZVVA 2DYBA 4A3OA 4ZRIA 5DPWA 3ZUNA 2MA9B 1UH6A 2LRWA 3W1YA 4OVUA 2M1MA 3OJ4B 3OAWA 2V3SA 1GC7A 4OVVA 5LXHA 1U4AA 1E5WA 2LWPA 2LVPA 2LI5A 4MSMB 1EO6A 4JLCA 1BT0A 4EKUA 5LXIB 3IBEA 2KJRA 2KK8A 4AP4C 2EMTA 2GOWA 3M62B 4KZ0A 2IO1B 5DCNA 3UGBB 2CS4A 4W9FA 3V61A 4NAWA 1KOTA 1J0GA 3QCAA 4W9CA 2KX0A 4FJYA 2KFKB 4FA6A 2QHOA 4IW0A 2D10A 4ANVA 3QK0A 1D3ZA 3ENEA 2G4DB 1SGHA 2XK5A 4NY0A 5IAAC 3SDLC 4CO7A 4GSWA 2DYOA 1Q1OA 2PJHA 3VTVA 2MBBB 4WQOB 4FLHA 1S1QB 2LZ6A 2RGFA 4BKTA 3A1QA 3A4RA 5J18A 2UWQA 2L0TA 3N30A 2N1VA 3W1SA 3ZNID 2MCNB 2MQJA 2IYDB 4KV2A 3NZUA 1A5RA 2BPSA 2KDBA 2MBQA 3QQ8B 4MGYE 3DDCB 2HJ8A 4GB9A 4WAAA 2O2VB 4EZJA 1P0RA 3NOBA 1WR6E 2I1JA 4NNJB 5IA7A 1RAXA 3KH0A 2KJHB 4X57B 3QHTA 4XZ4A 1P98A 4RM8A 1CMXB 4XX5A 1HE8A 2KN5A 2IY1B 2ZVNA 1WJ6A 3UIOB 4ICUA 4ANWA 2R2QA 2BWFA 1IPGA 4IC7B 3RZWC 1WI0A 4JQWC 4GDLA 2DAFA 3QC8B 3JVZX 4FJVB 3I3TB 4LJOB 4ICVA 3QA8A 2Z59B 3VVWB 2BKRB 3PGEA 4DHJD 3RZFA 2FCSA 2MP2B 2LUEA 3UINB 2DENB 2WWZA 4M8MA 2KJ6A 3X23A 3RUIB 2KTRA 2G4SA 3AXCA 1I35A 2HE7A 1OQYA 3APDA 4FADA 2MRPA 2AL3A 2D3GA 1SE9A 1OEYJ 1ZGUB 2DX5B 3PS6A 4JGHB 2FIDA 5D7GA 2ZNVC 4E74A 2D07B 3VQIA 1WM3A 2LGYA 4W9HA 5J2RA 3A9KB 1WH3A 1UELA 3R3MA 4PYUA 5DPRA 3TJPA 2JT4B 1KLVA 3H7PA 4FHKA 1GC6A 2DAJA 2GBKA 4IM2A 1EF1A 1WR1A 1WGHA 2K39A 3MTNB 3PLUA 3KUDB 5JZEB 2J0JA 4WJNA 3WAOA 2WYQA 4TUUA 3KUCB 1TBEA 4GDKA 3TIXA 2C5LC 4FHJA 1WIAA 3VTWA 2CU1A 4W9EA 2ZJDA 4KVGB 3K9PB 4HDOA 4KSLC 1UZXB 3H9DA 1Y8RC 3LDZE 4W9IA 3TCAA 2C9WB 2KWVB 2HD5B 4EEWA 4WJPA 2MSED 1P1AA 1WGDA 1QZEA 3B1LX 2KWUB 2IY0B 2NPTB 3A33B 3M3JA 4ZRJA 2FCQA 2NS5A 2W9NA 3CF6E 2J0KA 2O6VB 3L10B 2KTFA 3VAWA 3PT2B 4WWPA 2IO0B 1WGGA 2PE9A 2UYZB 5AZHA 2ZVOA 1WJ4A 1R4MI 1EUVB 3N32A 2JUOA 1WZ3A 1RRBA 2K1FA 1R4NI 4LJPB 3HM3A 4DHJB 1KJTA 2KDEB 2LGXA 4ANXA 2KQ7A 2BYEA 2DZMA 2EKEC 1V5TA 1V80A 3IHPC 4WWNA 1Z5SB 2PEAA 1V2YA 3DBSA 4II2B 2OOBB 1LXDA 2L3ZA 3VFKA 1L2NA 4WWOA 1UBQA 2BGFA 4MDKE 5CHWA 3UIPB 3A4SC 3SD5A 4BBNC 1NBFC 1XT9B 2L7RA 1X1MA 3PHWB 3KYCD 2BF8B 3T9LA 4MGKE 4F1SA 4MJSB 2N9EB 4PS3A 2LJ5A 4IM0A 3V60A 1LFDA 3HIZA 4CHKA 2GBRA 4GXBA 4KSKC 2ZCCA 4NQLB 3U8ZA 1WFYA 2AYOB 2CR5A 4E3CA 2JVCA 1NI2A 3RULA 4BKSA 2J7QB 3Q3FA 4I6LB 4ANUA 1WGRA 1Q5WB 2L00B 1WXAA 1WJUA 4K7UA 3WAPA 3L13A 3V6CB 4BKSD 1J19A 2N7DA 4G3XB 3P2BA 2CHXA 1IYFA 3HHMA 2FCNA 2O2VA 1E8YA 2BKFA 2KHWB 4AJYB 1WZ0A 4K81A 2KOXA 1Q0WB 2ZEQA 4TKNA 5E6PA 3DVNU 1VD2A 4XC2A 3A9JB 2KO3A 2JPHA 1UBIA 3PPAA 2NBVB 3T8MA 2JF5A 2K8BA 5G55A 3RT3B 1RFAA 1L7YA 3TMPB 1WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBH I;  2LAS A;  2LGD A;  2R2O A;  1WXV A;  2K25 A;  4NAW B;  3WAN A;  4ZDV A;  4AJW A;  5TR5 A;  4WJQ A;  3TBL D;  4W9J A;  3QX1 A;  3ZDT A;  3ONS A;  3ZRF A;  2LVQ A;  2MBE A;  4GGQ A;  1GG3 A;  3KUZ A;  2C7N B;  3CST A;  4HPL B;  4NJ7 A;  2XK5 B;  5G2N A;  4GOC A;  1PQS A;  1V81 A;  2K8C A;  4PS8 A;  3CMM B;  4DBG A;  3A1Q B;  2VRR B;  4PS7 A;  1IP9 A;  4LDT D;  2N9P C;  3ZDM C;  2FNJ B;  3CSF A;  3L0W B;  4KIK B;  3W1S C;  2IO3 B;  1VCB A;  2NVU I;  1KM7 A;  2KDI A;  5C1Z A;  2REX A;  3ALB A;  3OJ3 A;  4I6P A;  3ZRC A;  2JZZ A;  3H7S A;  5LLI A;  2N1W A;  3JSV A;  5JHA A;  2KLC A;  5D94 A;  2BYV E;  2AEH A;  1GUA B;  4BVU C;  3EHV A;  3RYT A;  5FR6 A;  3DCG A;  4PYZ A;  3BY4 B;  3N3K B;  2KVR A;  2ASQ A;  3AI5 A;  4URK A;  3WIM A;  3PTF C;  5D6J B;  3H6N A;  1E8W A;  2KQS A;  1YIW A;  1ZW7 A;  3B08 A;  3NS8 A;  4CYE A;  2GMI C;  2B3A A;  3KW5 B;  1WMH A;  4RMA A;  4BBN F;  4E71 A;  4TV3 A;  1WY8 A;  2N9X A;  3VXW A;  4HLE A;  2WX1 A;  1V9J A;  3ZNG C;  3AU4 A;  4HWI B;  4YL8 A;  4LDT B;  2MBO A;  3NY5 A;  3VH4 B;  4GDK B;  4NJ6 A;  2BWE S;  3AUL A;  3MJW A;  3VTU A;  1OGW A;  2GBN A;  2IO2 B;  3M95 A;  3KVF B;  3ML8 A;  1WXS A;  3UQA A;  2C60 A;  1F9J A;  3QWZ B;  3V62 A;  1E7V A;  1WX8 A;  3HK0 A;  3NHE B;  3ML9 A;  1FXT B;  2Y5B B;  3H1U A;  2KAN A;  3DPD A;  2DHZ A;  2NPT A;  3PRE A;  2D2Q A;  2JY6 A;  2OJR A;  3QIJ A;  3WAL A;  1I42 A;  1M94 A;  3PV1 A;  2JRI B;  1XD3 B;  2XEW A;  1WE7 A;  4HXD A;  3L17 A;  1YJ1 A;  4FN2 A;  2MWS B;  4IM3 A;  3MHS D;  2ZCB A;  3GOE A;  3ZIM A;  4G50 A;  3H7P B;  4HVB A;  4NPN A;  3ECI A;  4K7W A;  1YX6 B;  2DZI A;  4EUT A;  2KZR A;  3VH3 B;  3ZNZ B;  2RR9 A;  4B95 A;  3DOW A;  4JL9 A;  2RSU A;  1V5O A;  2YVC A;  2JXX A;  2ZNV B;  4ASW C;  2JRH A;  2NR2 A;  3VHT C;  4W9D A;  2N4F A;  4A20 A;  2KXJ A;  1E7U A;  1WRD B;  4GIV A;  3ZKJ C;  3DBR I;  3S2A A;  4F8C B;  5KHQ A;  3VDZ A;  4GN1 A;  4TQ0 A;  1P3Q U;  4W9L A;  1T0Y A;  4MJS A;  4BOS C;  3QJZ A;  4DHZ B;  3L54 A;  2KD0 A;  3ZW3 A;  5JH5 C;  5AZF A;  2FAZ A;  4KZC A;  2L76 A;  1YD8 U;  1TZ1 A;  2YLM A;  1GJZ A;  2PPH A;  2MX2 A;  4M0W B;  4P7I A;  2AL6 A;  4HPM B;  3VUX A;  2ZPY A;  2L05 A;  1WGY A;  2DZK A;  1LM8 B;  2HTH A;  2LVO A;  3C0R B;  4GDL B;  3ZTC A;  1LQB A;  4HJK A;  5KHO A;  2KFK A;  2LRU A;  4IWP A;  5E6O A;  4W9K A;  1G6J A;  4NQK E;  2MLB A;  4EOY A;  3JW0 X;  2IBI B;  3QAR A;  5L83 A;  2MBH A;  4BFR A;  4EFO A;  1MG8 A;  3PVL A;  3L16 A;  2KX3 A;  1NDD A;  3R66 C;  4KDL B;  4BOZ B;  3DQV A;  3PRZ A;  4DHZ E;  2K6Q A;  2M0X A;  1ZKH A;  2JZ3 B;  2KTR B;  5AEK B;  1J8C A;  3BIN A;  2FCM A;  4FBJ B;  2LXA A;  1E8X A;  2NBU A;  2A5U A;  1XQQ A;  1EF5 A;  4FUL A;  2KC1 A;  4MM3 A;  5CTR C;  1WF9 A;  1WX9 A;  2ZZP B;  4AWJ A;  2C7H A;  3JYU A;  5GMV A;  3EFU A;  2I1K A;  1Z2M A;  2M17 A;  2V1Y A;  2Z0E B;  1WM2 A;  2K8H A;  5CX3 A;  2O6V D;  4GMV A;  4LCD E;  4M8N A;  4DK5 A;  4IG7 B;  3U7D A;  1TGZ B;  3TL5 A;  3V6E B;  2GBM A;  2MW5 A;  2M8S A;  4GU2 A;  4I6N B;  2FIF A;  1OTR B;  2M4N A;  3DVN V;  4DXA B;  3X0W A;  5L95 C;  3Q3J A;  1WYW B;  5EDS A;  3R7R A;  2K6D B;  4MEL A;  1RLF A;  1UGM A;  4HCP B;  4JIO U;  3ZLZ A;  1V86 A;  3AU5 A;  4II3 B;  4TQ1 A;  4IWO A;  2GBJ A;  2CKH B;  4IUM B;  3IFW B;  4W9G A;  5DPT A;  2KFJ A;  2A4Z A;  2XBB C;  3SHQ A;  2WDT B;  4B6W A;  3ZNH B;  1WXM A;  1V49 A;  2MP2 A;  1ISN A;  3D32 A;  4ZRK A;  4ZYN A;  3PZD A;  2KWC A;  4J6I A;  3PSE B;  4DWF A;  1AAR A;  4AOF A;  1P9D U;  2V4L A;  5CHF A;  1WX7 A;  3APF A;  5C23 A;  3UF8 A;  2KMC A;  2NBW B;  3JSV B;  1YX5 B;  3QAQ A;  4G0N B;  5D2M B;  3VUY A;  2RPQ A;  3A9J A;  4MEM A;  1OEY A;  4G11 A;  4A3P A;  2FUH B;  3OLM D;  3UQB A;  2J0M A;  2O6V A;  4MGI E;  2JWZ A;  2BYF A;  3EC8 A;  3A9K A;  3RCZ A;  5BO4 B;  1V6E A;  3ZTD A;  4EZL A;  5JHB A;  1UD7 A;  1E8Z A;  4EZK A;  3DVG X;  1WMH B;  4K7S A;  3NZS A;  5HKH A;  1SIF A;  2CHW A;  2KMA A;  2WX0 A;  3K9O B;  2KLG A;  3VUW A;  4FJZ A;  4BKG A;  3EEC A;  2L0F A;  2KDF B;  2LD9 A;  1S3S G;  2D11 A;  2Z0D B;  3KYD D;  4IWQ A;  2C7M B;  5DPS A;  2G45 B;  4RM9 A;  3L08 A;  3DVG Y;  3APC A;  4AUQ C;  1C3T A;  1JRU A;  4DDI D;  5E6N A;  3B0A A;  4MGZ E;  1WE6 A;  4DDG D;  3PRM B;  2ZPN A;  4K1R B;  4B9K A;  5J17 A;  3M63 B;  3R7Q A;  3O65 B;  2N7E A;  2LXC A;  3IVF A;  3PLV A;  4KIK A;  4N9F 4;  4MSQ B;  5AZG A;  1E90 A;  2KKC A;  1H4R A;  3WA0 A;  2NCN A;  1TTN A;  3HM6 X;  4F7Z A;  3U30 A;  3DBL I;  2PE6 B;  2KC2 A;  4MH0 E;  4KDI C;  3GZN I;  2KNB A;  2AWT A;  2DZJ A;  3ZO5 B;  2G3Q B;  3IG3 A;  3PHX B;  3WAM A;  4HDQ A;  1C1Y B;  4HK2 A;  2EMS A;  2IZV B;  1GNU A;  3RD2 A;  2L8J A;  3PRP B;  2RD0 A;  1H8C A;  1YQB A;  2CHZ A;  5CHV C;  4WJO A;  4HCN B;  1K8R B;  2DYM A;  3LJ3 A;  3SU8 X;  3ZVV A;  2DYB A;  4A3O A;  4ZRI A;  5DPW A;  3ZUN A;  2MA9 B;  1UH6 A;  2LRW A;  3W1Y A;  4OVU A;  2M1M A;  3OJ4 B;  3OAW A;  2V3S A;  1GC7 A;  4OVV A;  5LXH A;  1U4A A;  1E5W A;  2LWP A;  2LVP A;  2LI5 A;  4MSM B;  1EO6 A;  4JLC A;  1BT0 A;  4EKU A;  5LXI B;  3IBE A;  2KJR A;  2KK8 A;  4AP4 C;  2EMT A;  2GOW A;  3M62 B;  4KZ0 A;  2IO1 B;  5DCN A;  3UGB B;  2CS4 A;  4W9F A;  3V61 A;  4NAW A;  1KOT A;  1J0G A;  3QCA A;  4W9C A;  2KX0 A;  4FJY A;  2KFK B;  4FA6 A;  2QHO A;  4IW0 A;  2D10 A;  4ANV A;  3QK0 A;  1D3Z A;  3ENE A;  2G4D B;  1SGH A;  2XK5 A;  4NY0 A;  5IAA C;  3SDL C;  4CO7 A;  4GSW A;  2DYO A;  1Q1O A;  2PJH A;  3VTV A;  2MBB B;  4WQO B;  4FLH A;  1S1Q B;  2LZ6 A;  2RGF A;  4BKT A;  3A1Q A;  3A4R A;  5J18 A;  2UWQ A;  2L0T A;  3N30 A;  2N1V A;  3W1S A;  3ZNI D;  2MCN B;  2MQJ A;  2IYD B;  4KV2 A;  3NZU A;  1A5R A;  2BPS A;  2KDB A;  2MBQ A;  3QQ8 B;  4MGY E;  3DDC B;  2HJ8 A;  4GB9 A;  4WAA A;  2O2V B;  4EZJ A;  1P0R A;  3NOB A;  1WR6 E;  2I1J A;  4NNJ B;  5IA7 A;  1RAX A;  3KH0 A;  2KJH B;  4X57 B;  3QHT A;  4XZ4 A;  1P98 A;  4RM8 A;  1CMX B;  4XX5 A;  1HE8 A;  2KN5 A;  2IY1 B;  2ZVN A;  1WJ6 A;  3UIO B;  4ICU A;  4ANW A;  2R2Q A;  2BWF A;  1IPG A;  4IC7 B;  3RZW C;  1WI0 A;  4JQW C;  4GDL A;  2DAF A;  3QC8 B;  3JVZ X;  4FJV B;  3I3T B;  4LJO B;  4ICV A;  3QA8 A;  2Z59 B;  3VVW B;  2BKR B;  3PGE A;  4DHJ D;  3RZF A;  2FCS A;  2MP2 B;  2LUE A;  3UIN B;  2DEN B;  2WWZ A;  4M8M A;  2KJ6 A;  3X23 A;  3RUI B;  2KTR A;  2G4S A;  3AXC A;  1I35 A;  2HE7 A;  1OQY A;  3APD A;  4FAD A;  2MRP A;  2AL3 A;  2D3G A;  1SE9 A;  1OEY J;  1ZGU B;  2DX5 B;  3PS6 A;  4JGH B;  2FID A;  5D7G A;  2ZNV C;  4E74 A;  2D07 B;  3VQI A;  1WM3 A;  2LGY A;  4W9H A;  5J2R A;  3A9K B;  1WH3 A;  1UEL A;  3R3M A;  4PYU A;  5DPR A;  3TJP A;  2JT4 B;  1KLV A;  3H7P A;  4FHK A;  1GC6 A;  2DAJ A;  2GBK A;  4IM2 A;  1EF1 A;  1WR1 A;  1WGH A;  2K39 A;  3MTN B;  3PLU A;  3KUD B;  5JZE B;  2J0J A;  4WJN A;  3WAO A;  2WYQ A;  4TUU A;  3KUC B;  1TBE A;  4GDK A;  3TIX A;  2C5L C;  4FHJ A;  1WIA A;  3VTW A;  2CU1 A;  4W9E A;  2ZJD A;  4KVG B;  3K9P B;  4HDO A;  4KSL C;  1UZX B;  3H9D A;  1Y8R C;  3LDZ E;  4W9I A;  3TCA A;  2C9W B;  2KWV B;  2HD5 B;  4EEW A;  4WJP A;  2MSE D;  1P1A A;  1WGD A;  1QZE A;  3B1L X;  2KWU B;  2IY0 B;  2NPT B;  3A33 B;  3M3J A;  4ZRJ A;  2FCQ A;  2NS5 A;  2W9N A;  3CF6 E;  2J0K A;  2O6V B;  3L10 B;  2KTF A;  3VAW A;  3PT2 B;  4WWP A;  2IO0 B;  1WGG A;  2PE9 A;  2UYZ B;  5AZH A;  2ZVO A;  1WJ4 A;  1R4M I;  1EUV B;  3N32 A;  2JUO A;  1WZ3 A;  1RRB A;  2K1F A;  1R4N I;  4LJP B;  3HM3 A;  4DHJ B;  1KJT A;  2KDE B;  2LGX A;  4ANX A;  2KQ7 A;  2BYE A;  2DZM A;  2EKE C;  1V5T A;  1V80 A;  3IHP C;  4WWN A;  1Z5S B;  2PEA A;  1V2Y A;  3DBS A;  4II2 B;  2OOB B;  1LXD A;  2L3Z A;  3VFK A;  1L2N A;  4WWO A;  1UBQ A;  2BGF A;  4MDK E;  5CHW A;  3UIP B;  3A4S C;  3SD5 A;  4BBN C;  1NBF C;  1XT9 B;  2L7R A;  1X1M A;  3PHW B;  3KYC D;  2BF8 B;  3T9L A;  4MGK E;  4F1S A;  4MJS B;  2N9E B;  4PS3 A;  2LJ5 A;  4IM0 A;  3V60 A;  1LFD A;  3HIZ A;  4CHK A;  2GBR A;  4GXB A;  4KSK C;  2ZCC A;  4NQL B;  3U8Z A;  1WFY A;  2AYO B;  2CR5 A;  4E3C A;  2JVC A;  1NI2 A;  3RUL A;  4BKS A;  2J7Q B;  3Q3F A;  4I6L B;  4ANU A;  1WGR A;  1Q5W B;  2L00 B;  1WXA A;  1WJU A;  4K7U A;  3WAP A;  3L13 A;  3V6C B;  4BKS D;  1J19 A;  2N7D A;  4G3X B;  3P2B A;  2CHX A;  1IYF A;  3HHM A;  2FCN A;  2O2V A;  1E8Y A;  2BKF A;  2KHW B;  4AJY B;  1WZ0 A;  4K81 A;  2KOX A;  1Q0W B;  2ZEQ A;  4TKN A;  5E6P A;  3DVN U;  1VD2 A;  4XC2 A;  3A9J B;  2KO3 A;  2JPH A;  1UBI A;  3PPA A;  2NBV B;  3T8M A;  2JF5 A;  2K8B A;  5G55 A;  3RT3 B;  1RFA A;  1L7Y A;  3TMP B;  1WJN A; 
#chains in the Genus database with same CATH topology
 5I4D A;  2K25 A;  4NAW B;  4CQN A;  4AJW A;  4W9J A;  3ONS A;  2LVQ A;  1VRA B;  3W9C B;  1GG3 A;  3DWG C;  3KUZ A;  2C7N B;  3CST A;  4GOC A;  4DBG A;  4AQ7 A;  3PO0 A;  4LDT D;  2N9P C;  3ZDM C;  2M56 B;  3CSF A;  4OW0 A;  4Q2J A;  1KM7 A;  4HJG E;  3AEC B;  3AN1 A;  3FC4 A;  1T3Q A;  2N1W A;  1WWT A;  3BY4 B;  1XLQ A;  2KQ4 X;  2ASQ A;  3AI5 A;  1E0Z A;  3H6N A;  1E8W A;  3ZJU A;  1YIW A;  1ZW7 A;  3NS8 A;  4BBN F;  1HZ5 A;  2LFI A;  5T8I A;  2RDB C;  4HEA 1;  4HWI B;  1C79 A;  3NY5 A;  2IJ0 A;  4GDK B;  4NJ6 A;  3VTU A;  2IO2 B;  3KVF B;  3ML8 A;  4USA A;  1F9J A;  4C4V A;  1VLB A;  1ZXH A;  3ML9 A;  2Y5B B;  5G5G A;  2JWU A;  3DPD A;  3RI7 C;  2NPT A;  3PRE A;  1IBX B;  2D2Q A;  3QIJ A;  1M4V A;  1M94 A;  3RNC C;  3AE3 B;  3PV1 A;  4HXD A;  3ZGZ A;  3TEZ A;  1MHX A;  4FN2 A;  1VJK A;  4IM3 A;  3MHS D;  3ZIM A;  4ITK A;  1DGJ A;  3SEB A;  4JWU C;  4K7W A;  4XYC A;  1TS5 A;  1YX6 B;  4EUT A;  3ZNZ B;  4B95 A;  3DOW A;  1N61 A;  2YVC A;  1L4D B;  2W3S A;  2KAJ A;  3VHT C;  2LEK A;  3AEF B;  4A20 A;  1XF5 L;  1F52 A;  5BMG A;  4DHZ B;  3ZW3 A;  2JX5 A;  4WAF A;  5JH5 C;  1ET9 A;  1TZ1 A;  2PPH A;  3EGR A;  1JW9 D;  1TYG B;  1LQB A;  2LRU A;  4IWP A;  1G6J A;  2X38 A;  4EFO A;  1MG8 A;  2JU6 X;  2K9X A;  5EE9 A;  3DQV A;  4YSX B;  2JZ3 B;  1J8C A;  1QOA A;  2LXA A;  1YQ4 B;  2A5U A;  1XQQ A;  4FUL A;  1XLN A;  2KC1 A;  5CTR C;  2ZZP B;  4AWJ A;  3BZD B;  2WU2 B;  1Z2M A;  2M17 A;  2K8H A;  2HTM E;  4GMV A;  3NRZ A;  4ZRQ A;  3U7D A;  1TGZ B;  1ESF A;  1VDV A;  4J3O D;  2WXG A;  3KLS X;  2FIF A;  2M4N A;  2WDR B;  1C4A A;  1T0S C;  3R7R A;  1VR9 A;  3MHZ A;  4HCP B;  2SAK A;  3T3N A;  4B0M A;  1V86 A;  1SIJ A;  4TSS A;  2VZK B;  2CKH B;  2A4Z A;  3FIL B;  2QIL A;  1ISN A;  1FIQ A;  3PZD A;  2KWC A;  4J6I A;  4DWF A;  1AAR A;  4P1B C;  2NBW B;  4NAM A;  4WWM A;  2HDE A;  4G0N B;  2AX5 A;  2FUH B;  2O6V A;  4EZL A;  1UD7 A;  2LGS A;  5HKH A;  2CHW A;  2KVZ A;  2KLG A;  4FJZ A;  4IDI A;  2KDF B;  2Z0D B;  1MG4 A;  4IWQ A;  1GOZ A;  1AN8 A;  4PT5 A;  1C3T A;  3P63 A;  5J17 A;  1GJZ A;  3IVF A;  1E90 A;  1XO3 A;  3DBL I;  2KC2 A;  4RF0 A;  4YT0 B;  3AE4 B;  4KDI C;  1XCT L;  3PHX B;  1WXQ A;  3WAM A;  4HDQ A;  2R61 A;  3MP9 A;  3NVY A;  3RD2 A;  2PTL A;  3IAS 1;  1KLU D;  5CHV C;  4WJO A;  2QEJ C;  1PGA A;  4RH6 A;  4A3O A;  5D3I B;  1UH6 A;  2JSV X;  2LRW A;  3W1Y A;  2PVO D;  4OVU A;  2MJ3 A;  3OJ4 B;  4OVV A;  5LXH A;  1U4A A;  1V1P B;  2LI5 A;  1EO6 A;  4JLC A;  5LXI B;  1D5Z C;  3L4P A;  3ZJV A;  2KK8 A;  1PUT A;  2GRI A;  2IO1 B;  1C4C A;  3V61 A;  3QCA A;  4C7Y A;  1I4R A;  2D10 A;  3ENE A;  3ZQ4 A;  1J7A A;  3NJT A;  1SGH A;  2XK5 A;  4NY0 A;  5IAA C;  3SDL C;  4ZRP A;  4CO7 A;  4GSW A;  1Q1O A;  2MBB B;  1UWM A;  4BKT A;  2LZ6 A;  2L0T A;  5EE3 A;  3W1S A;  3ZNI D;  2MCN B;  2IYD B;  3EA6 A;  3U2S C;  2LHE A;  2HJ8 A;  1P0R A;  3NOB A;  2I1J A;  5IA7 A;  2WXP A;  3R2I A;  1RAX A;  3BYY B;  1Q10 A;  1WJ6 A;  1SSN A;  2ACZ B;  1T0R C;  3AE2 B;  1N62 A;  2M0A A;  3R8B A;  3VVW B;  3PGE A;  1D4B A;  3LXF A;  2KJ6 A;  2L32 A;  2VH1 A;  1D6E C;  2G4S A;  3U7Z A;  3I57 A;  1VZ6 A;  1OQY A;  2MRP A;  1OEY J;  2BB6 A;  1FD6 A;  3VQI A;  1WM3 A;  1YN3 A;  4LNI A;  4PYU A;  1GB1 A;  2DAJ A;  1WGH A;  2K39 A;  3PLU A;  3KUD B;  1ET6 A;  3WAO A;  2WYQ A;  4GDK A;  3TIX A;  2VZK D;  4C56 C;  3KWL A;  2K22 A;  4KVG B;  4HDO A;  3TCA A;  2KWV B;  4WJP A;  1ZDX A;  1WGD A;  1TY2 A;  2NPT B;  1DYQ A;  3VRB B;  4JWS C;  2W9N A;  1QLB B;  2G1E A;  4S0R A;  1TKE A;  1LGR A;  2KTF A;  4KGR A;  2IND C;  2UYZ B;  2BB5 A;  3N1X C;  2ZVO A;  1EUV B;  4LJP B;  1WZ3 A;  2K1F A;  1ZPS A;  1OFF A;  1KJT A;  1L0X B;  2EKE C;  4RF1 A;  1V80 A;  3C8Y A;  2CJO A;  3TEW A;  3DBS A;  3P4P B;  2OOB B;  4HRS A;  1N6Z A;  2PKO A;  4WWO A;  2BGF A;  1XT9 B;  4MGK E;  4D2K A;  3SFD B;  4F1S A;  4PS3 A;  4IM0 A;  4P1C C;  4K3B A;  4CHK A;  3NVW A;  2J52 A;  4KSK C;  4NQL B;  1WFY A;  2CR5 A;  4BKS A;  2GB1 A;  1HQR D;  1PFD A;  2MHJ A;  2XN9 C;  1WJU A;  4K7U A;  3WAP A;  3L13 A;  1PGB A;  2KN4 A;  3UI3 A;  1EU3 A;  1V1O A;  3HHM A;  3B2G A;  5E6P A;  3DVN U;  1XEE A;  3PPA A;  3RNG C;  4QAY A;  3TMP B;  3DBH I;  2LAS A;  2LGD A;  2QIE B;  2R2O A;  1WXV A;  1YN4 A;  4AS1 A;  2WU5 B;  1WYG A;  4WJQ A;  3RNB C;  3QX1 A;  3OG5 A;  1SE3 A;  4HPL B;  5G2N A;  5FKA C;  2ZW0 A;  3CMM B;  4DXG A;  3A1Q B;  2VRR B;  2DLB A;  2RDG A;  4PS7 A;  3GB1 A;  4KIK B;  3U4E G;  3W1S C;  2NVU I;  2KDI A;  3ALB A;  3OJ3 A;  1TZO A;  3H7S A;  5LLI A;  4HRO A;  1FCL A;  5JHA A;  2ON8 A;  2KLC A;  2BYV E;  1GUA B;  3RNE C;  3RYT A;  3VRA B;  2KQS A;  1FCC C;  2GMI C;  4A90 A;  4E71 A;  3BVZ A;  1WY8 A;  3VXW A;  4LDT B;  1D5X C;  2MBO A;  5BYR A;  1K51 A;  3ABV B;  3AUL A;  4R3D A;  3ETR A;  2N9L A;  1OGW A;  1WXS A;  2WNM A;  3P1M A;  3BYT B;  4L2Y A;  3UQA A;  3QWZ B;  3H8H A;  4N6E B;  2KAN A;  1CZP A;  4YSY B;  2OJR A;  1AWD A;  1I4Q A;  1I42 A;  1YMH E;  2WXN A;  1GB4 A;  1XD3 B;  4HVB A;  1JQ4 A;  2RR9 A;  2RSU A;  1V5O A;  3CWI A;  2JRH A;  3AEA B;  4W9D A;  2N4F A;  1E7U A;  3VDZ A;  1I4H A;  4MJS A;  2OJW A;  3L54 A;  3N1Z C;  2JQR B;  5AZF A;  2FAZ A;  4KZC A;  2YLM A;  2MX2 A;  3MC0 B;  4M0W B;  3AED B;  3VUX A;  2DZK A;  2HTH A;  1C78 A;  4GDL B;  4HJK A;  5FK9 C;  3JW0 X;  1R4N B;  2MBH A;  3CIR B;  1HEZ E;  1NDD A;  3TUO A;  4DQO C;  4KDL B;  4BOZ B;  1V97 A;  1TIF A;  1MHH E;  4KGT A;  2M0X A;  5AEK B;  2KTR B;  3BIN A;  2NBU A;  3T3O A;  1WX9 A;  2C7H A;  2IGG A;  3JYU A;  3MJ5 A;  3NG0 A;  1ZOY B;  4IG7 B;  1B9R A;  2GBM A;  1RWS A;  3Q3O C;  2M8S A;  3DBR B;  4YTM B;  1WYW B;  5EDS A;  1RLF A;  1UGM A;  4II3 B;  4YXD B;  4W9G A;  2KFJ A;  2WDT B;  4B6W A;  1WXM A;  1V49 A;  2MP2 A;  3D32 A;  5AUK A;  2LGI A;  1FXI A;  1P9D U;  2V4L A;  3APF A;  2HJ1 A;  2Q5W D;  3JSV B;  4MT5 A;  3A9J A;  1OEY A;  3OLM D;  4MGI E;  2JWZ A;  3EC8 A;  4XGA B;  2V3N A;  1V6E A;  3ZTD A;  5JHB A;  3MC8 A;  3MFG A;  2K5P A;  2WX0 A;  3BWU D;  3K9O B;  3Q8C A;  3VUW A;  3EEC A;  2L0F A;  3HUI A;  2C7M B;  5DPS A;  2G45 B;  4LNN A;  1N5X A;  2QMT A;  3DVG Y;  4AUQ C;  1KH0 A;  4DDI D;  1N63 A;  2M19 A;  3B0A A;  1WE6 A;  3NZ3 A;  5TSS A;  4DDG D;  4K1R B;  4B9K A;  3M63 B;  3R7Q A;  4N9F 4;  2NCN A;  3HM6 X;  3U30 A;  3Q3N C;  3GZN I;  1TKG A;  2G3Q B;  2GLS A;  1FPY A;  1K52 A;  3Q8E A;  1FNU A;  1YQB A;  2Z8L A;  1WRI A;  4HCN B;  5HI1 A;  1NEK B;  3ZVV A;  5IP4 D;  2MA9 B;  2RMM A;  2M1M A;  1GC7 A;  5HFY A;  3AE9 B;  3BK1 A;  3NVV A;  1YN5 A;  3AM9 A;  1TJE A;  4MSM B;  1BUI C;  4EKU A;  2Y3A A;  4AP4 C;  3M62 B;  1GAQ B;  1MVK A;  2KT7 A;  3UGB B;  1IBX A;  4FJY A;  2KFK B;  1PDX A;  4FA6 A;  4HKQ A;  2QHO A;  1XLO A;  4KKJ A;  1L4Z B;  4FLH A;  2N1V A;  3NZU A;  1NYR A;  1A5R A;  2BPS A;  4MM3 B;  4MGY E;  3DDC B;  4GB9 A;  4EZJ A;  4H2A A;  2WXJ A;  1QOF A;  1CMX B;  2KN5 A;  2ZVN A;  3UIO B;  2BWF A;  2K3U A;  4IC7 B;  1IPG A;  2KMM A;  2EKI A;  2VH2 A;  2DAF A;  3JVZ X;  3GE3 C;  2Z59 B;  4B0E A;  4DHJ D;  4YWG G;  2DEN B;  2WWZ A;  5HHD G;  4M8M A;  1XCQ L;  5EE0 A;  2KWD A;  3RUI B;  1FRR A;  3J9C A;  1KF6 B;  4FAD A;  1SE9 A;  3AE6 B;  3PS6 A;  2FID A;  3EFC A;  1E7P B;  1UEL A;  3Q8F A;  3IAM 1;  5DPR A;  2LJI A;  2WXK A;  1KLV A;  4IM2 A;  2CJN A;  1WR1 A;  1HTQ A;  2H88 B;  3MTN B;  4DXF A;  1TBE A;  3FIL A;  3VTW A;  2CU1 A;  4C7Z A;  1L0Y B;  1QQR A;  1TS3 A;  1UZX B;  3LDZ E;  1ZP0 B;  2C9W B;  1P1A A;  2NMQ A;  1QZE A;  2KWU B;  4ZRJ A;  1TT5 B;  2J0K A;  2O6V B;  3PT2 B;  3WCQ A;  2PE9 A;  2MEK A;  2QDF A;  1IGC A;  1R4M I;  1RRB A;  4DHJ B;  2LGX A;  3PZ7 A;  2BYE A;  2DZM A;  4YSZ B;  1V5T A;  1OQQ A;  1MPE A;  2PEA A;  2L3Z A;  1I7H A;  4MDK E;  2QJL A;  3UIP B;  3SD5 A;  4BBN C;  1EU4 A;  2L7R A;  3KYC D;  2BF8 B;  3T9L A;  4A6Q A;  2N9E B;  2KAC A;  5E6J A;  3V60 A;  2GBR A;  4M0W A;  1JML A;  2ZCC A;  2BTE A;  3U8Z A;  4WH4 A;  1MFW A;  1V8C A;  3NVZ A;  4E3C A;  2JVC A;  1NI2 A;  1QOG A;  3RUL A;  4ANU A;  1WGR A;  2L00 B;  1WXA A;  2WLB A;  2NTT A;  1E9M A;  4G3X B;  4ACF A;  4REZ A;  2FCN A;  1JWM D;  2KHW B;  3FKY A;  4K81 A;  1Q0W B;  4TKN A;  1C76 A;  4XC2 A;  4L1B A;  1UBI A;  1FNW A;  3RT3 B;  2X8X X;  4ZDV A;  1RFK A;  3TBL D;  3AEB B;  2TSS A;  1HZ6 A;  2N9K A;  4GGQ A;  1PQS A;  1UGJ A;  1V81 A;  4PS8 A;  3BVM A;  1IP9 A;  2IO3 B;  2EEL A;  5C1Z A;  2REX A;  4I6P A;  2JZZ A;  5D94 A;  1VZ7 A;  3E9S A;  3EHV A;  3DCG A;  4PYZ A;  2KVR A;  3TEY A;  3HVZ A;  4EE2 A;  4URK A;  5D6J B;  4HKZ E;  1TS4 A;  3SR6 A;  2B3A A;  3IT4 B;  5EE1 A;  2LUM A;  4TV3 A;  4RNA A;  1RM6 C;  1V9J A;  2BVC A;  1SEB D;  3AU4 A;  2RPV A;  2BYT A;  3VH4 B;  1DOI A;  3SFE B;  3ZJT A;  2GBN A;  2WXH A;  3OWE B;  3BVG A;  3V62 A;  4A9A A;  1SJE D;  1WX8 A;  1FXT B;  3H1U A;  2DHZ A;  2WGS A;  4US8 A;  2JRI B;  1WE7 A;  2ZCB A;  3GOE A;  1NVI D;  2ZW1 A;  4G50 A;  3H7P B;  1IGD A;  2JXT A;  2KZR A;  3C19 A;  3EUB 2;  2ZNV B;  2NR2 A;  2JYT A;  2KXJ A;  2KDM A;  3PZ8 A;  1WRD B;  4GIV A;  4F8C B;  3DBR I;  3S2A A;  5KHQ A;  4RFB A;  4GN1 A;  4W9L A;  4BOS C;  1YD8 U;  2L76 A;  4WUR A;  4P7I A;  2AL6 A;  4HPM B;  2L05 A;  1LM8 B;  2LVO A;  2D3B A;  4NZL B;  5KHO A;  2KFK A;  5E6O A;  4W9K A;  1ROE A;  1FNV A;  4NQK E;  4EOY A;  1ENF A;  4BFR A;  1NYQ A;  3L16 A;  2KX3 A;  4XE0 A;  3R66 C;  1J7B A;  3RPF C;  2K6Q A;  3ZXR A;  1ZKH A;  2FCM A;  4FBJ B;  1E8X A;  4MM3 A;  3HRD D;  1WF9 A;  3Q8A A;  1QOB A;  1MJD A;  1AW7 A;  3EFU A;  2I1K A;  5CX3 A;  2Z0E B;  1WM2 A;  4N59 A;  4YTN B;  1T6B X;  2QC8 A;  4ZYS A;  3V6E B;  3DHG C;  4I6N B;  3LB8 C;  3DVN V;  4DXA B;  5L95 C;  2WXF A;  3Q3J A;  4MEL A;  2ONQ A;  3N9Y C;  3AU5 A;  3AE7 B;  4KX6 B;  4IWO A;  2GBJ A;  4IUM B;  3ZNH B;  2PLP A;  4ZYN A;  4MH8 A;  3PSE B;  1JWU D;  3N1Y C;  3AMZ A;  5CHF A;  1WX7 A;  5C23 A;  2KMC A;  2DNF A;  5D2M B;  4MEM A;  4RGT A;  4BZA A;  2E3T A;  2BYF A;  1PGX A;  3RN9 C;  3AB5 A;  4EZK A;  3HVD A;  1WMH B;  4K7S A;  1SIF A;  2SEB D;  4O1N A;  5H8Y E;  4BKG A;  3W5V B;  1S3S G;  2DWQ A;  3KYD D;  4RM9 A;  3APC A;  1JRU A;  3DBL B;  1N60 A;  3PRM B;  3KWV A;  1FEH A;  3O65 B;  4KIK A;  2LXC A;  4BVU C;  4MSQ B;  5AZG A;  3WA0 A;  2KKC A;  1H4R A;  4XDD A;  1TTN A;  2INC C;  1N5W A;  3W2D A;  2KNB A;  2AWT A;  2DZJ A;  3IG3 A;  4OZA A;  2IZV B;  4NJC A;  2L8J A;  3PRP B;  1FXA A;  1JRO A;  1BML C;  1ZXI A;  1ZDV A;  2D5G A;  1K8R B;  2BT6 A;  3AH7 A;  3Q2A C;  2G9H D;  5DPW A;  3ZUN A;  1WGK A;  4KKI A;  2LVP A;  2WS3 B;  3DHI C;  3IBE A;  2KJR A;  2EMT A;  2GOW A;  5FR3 A;  5DCN A;  1JWB D;  4NAW A;  2AQ1 B;  1KOT A;  1F1H A;  1J0G A;  3GP7 A;  3MC9 A;  2KX0 A;  4LNK A;  4IW0 A;  4ANV A;  2L1A A;  1D3Z A;  1F77 A;  1C4P A;  2N7J A;  2DYO A;  1STE A;  4WQO B;  1S1Q B;  2RGF A;  2UWQ A;  4A8X C;  1QT9 A;  3P4Q B;  1F2R C;  3DBH B;  4OVZ A;  2KDB A;  2MBQ A;  1KRH A;  4WAA A;  1GPX A;  1HA5 A;  3KH0 A;  2KJH B;  3N20 C;  4XZ4 A;  1P98 A;  4RM8 A;  1UF0 A;  4ICU A;  4ANW A;  2R2Q A;  1FMA D;  2WXQ A;  3I3T B;  4ICV A;  1CJE A;  1TKY A;  5IKC M;  2AQ2 B;  3I5J C;  4XWW A;  3VR8 B;  2IGH A;  2FCS A;  3RZF A;  2LUE A;  2QCZ A;  4RGO S;  3X23 A;  4ARC A;  2KTR A;  3DWM A;  4C4V B;  2Y5C A;  1I35 A;  2HE7 A;  2E6X A;  2W82 A;  1F0Z A;  2D3G A;  1UUP A;  5D7G A;  2BBC A;  4OZC A;  2D07 B;  4W9H A;  3A9K B;  1WH3 A;  3R3M A;  3FAH A;  1OQR A;  3RFZ B;  2JT4 B;  4BAX A;  2GBK A;  4P6V F;  3AE5 B;  3E56 A;  1J7C A;  4N58 A;  3KUC B;  4TUU A;  2W55 A;  4S17 A;  4FHJ A;  1KFY B;  2PVG C;  1NI3 A;  4KSL C;  3H9D A;  1Y8R C;  4W9I A;  3Q14 C;  3B1L X;  4LNF A;  2IY0 B;  5GXG B;  1EM7 A;  2W54 A;  3CF6 E;  3L10 B;  2W3R A;  4WWP A;  2IO0 B;  4UDU C;  5IO9 A;  2D3C A;  4OHJ A;  1R4N I;  2I38 A;  3HM3 A;  1FM0 D;  2WQY B;  4ANX A;  2KDE B;  3P4S B;  5H92 C;  3V3X A;  4WWN A;  1P7F A;  1V2Y A;  1LXD A;  3VFK A;  1L2N A;  3NS1 A;  2OED A;  5CHW A;  1NBF C;  1A70 A;  2BS2 B;  1SB3 C;  3PHW B;  4MAC A;  4MJS B;  1E10 A;  1T5X D;  1ZUD 2;  2AYO B;  2V3P A;  3V6C B;  2N7D A;  1JAL A;  1IYF A;  2O2V A;  1E8Y A;  2BKF A;  3AEG B;  1UWX A;  5IOI A;  2MJD A;  1FFV A;  3TSS A;  3IT6 B;  2YEP F;  2JPH A;  5BMI A;  2NBV B;  2K8B A;  3R2T A;  3GS2 A;  3WAN A;  5TR5 A;  1YOV B;  3ZDT A;  3ZRF A;  2MBE A;  1I4G A;  4NJ7 A;  2XK5 B;  2UU7 A;  1MI0 A;  1JCK B;  2K8C A;  1IUE A;  2WXL A;  3KQ4 A;  3TEX A;  2FNJ B;  3L0W B;  4LK0 M;  2L83 A;  1VCB A;  2OHF A;  2PIA A;  4ZHP A;  5C3J B;  3ZRC A;  3JSV A;  4JE3 B;  2AEH A;  5FR6 A;  1XLP A;  2IDY A;  3N3K B;  1D5M C;  3Q6B A;  3WIM A;  3PTF C;  1SE4 A;  3B08 A;  4CYE A;  3KW5 B;  1WMH A;  4RMA A;  2N9X A;  4HLE A;  2WX1 A;  1PYW D;  3ZNG C;  3I9V 1;  4YL8 A;  3P4R B;  4JX1 C;  4TMA B;  1L0V B;  5JXV A;  2BWE S;  3MJW A;  5AUI A;  2IPK D;  3M95 A;  2C60 A;  1E7V A;  3AV8 A;  3HK0 A;  3NHE B;  1RYJ A;  2JY6 A;  3WAL A;  1QIL A;  2H89 B;  2XEW A;  1E6E B;  3L17 A;  1YJ1 A;  2MWS B;  1SE2 A;  4NPN A;  3ECI A;  3U52 E;  3RNA C;  2DZI A;  3VH3 B;  4JL9 A;  2JXX A;  4M00 A;  4ASW C;  2WXM A;  3ZKJ C;  4TQ0 A;  2CU3 A;  1P3Q U;  1FO4 A;  1T0Y A;  2YEP B;  4C00 A;  3QJZ A;  2KD0 A;  2NTS A;  2WXR A;  2BQQ A;  2ZPY A;  1WGY A;  4C80 A;  4HPP A;  3C0R B;  3ZTC A;  2ICI A;  2MLB A;  3QAR A;  2IBI B;  5L83 A;  4L23 A;  3LYY A;  1FFU A;  1P7E A;  1R4M B;  3PVL A;  3Q69 A;  1JWA D;  1L6U A;  3RNF C;  4ARI A;  3PRZ A;  4DHZ E;  1AYF A;  1Y56 A;  1EF5 A;  4RGN A;  5GMV A;  2V1Y A;  5C2T B;  2O6V D;  4LCD E;  4M8N A;  4DK5 A;  3AE8 B;  1YQ3 B;  3TL5 A;  5IN7 A;  2MW5 A;  4GU2 A;  1L6V A;  1OTR B;  3X0W A;  4P16 A;  4OZB A;  2K6D B;  2WHI A;  4JIO U;  3ZLZ A;  2Y5P A;  4TQ1 A;  1YNT E;  2FBW B;  2GI9 A;  1VZ8 A;  5DPT A;  3GE8 C;  3IFW B;  1C77 A;  4LNO A;  2XBB C;  3SHQ A;  1FRD A;  1K50 A;  4ZRK A;  3P42 A;  2J53 A;  4AOF A;  3UF8 A;  4IKG A;  1YX5 B;  3QAQ A;  3VUY A;  4ZHO A;  2RPQ A;  2MH7 A;  4G11 A;  4A3P A;  3UQB A;  2J0M A;  3BK2 A;  3A9K A;  3RCZ A;  2J4X A;  5BO4 B;  1KTK A;  1E8Z A;  3DVG X;  3NZS A;  2KMA A;  3Q3M C;  2BW2 A;  2K0P A;  2D3A A;  1T0Q C;  2LD9 A;  2D11 A;  2LHD A;  3L08 A;  3B2F A;  3VR9 B;  5E6N A;  4MGZ E;  2JYE A;  2FE8 A;  2WXO A;  2ZPN A;  2N7E A;  3PLV A;  3V05 A;  1EWC A;  4F7Z A;  2PE6 B;  4MH0 E;  3ZO5 B;  1C1Y B;  1SJH D;  2EMS A;  4HK2 A;  4M01 A;  2WXI A;  1GNU A;  5D3D A;  2RD0 A;  1H8C A;  2CHZ A;  2FUG 1;  3LJ3 A;  2DYM A;  1NEN B;  4GLS C;  3SU8 X;  2DYB A;  4ZRI A;  1SF0 A;  1K53 A;  3OAW A;  2V3S A;  4KGS A;  3BII D;  1E5W A;  2LWP A;  4K3C A;  5BYQ A;  3Q8B A;  1BT0 A;  2LMC A;  4KZ0 A;  1SXT A;  2PMV A;  2CS4 A;  4W9F A;  1DOX A;  4W9C A;  4WIP A;  3QK0 A;  2J42 A;  2G4D B;  4PK1 A;  3B9J A;  2PJH A;  3VTV A;  2BS3 B;  1C9F A;  3A1Q A;  3A4R A;  4M02 A;  5J18 A;  3N30 A;  2V0G A;  1YJJ A;  1I4P A;  2MQJ A;  4KV2 A;  1TS2 A;  1KLG D;  2N0S B;  3QQ8 B;  4YTP B;  4FXC A;  5BYS A;  2O2V B;  1JRP A;  1ZE3 D;  2INN E;  1WR6 E;  2WP9 B;  1BXT A;  4NNJ B;  4X57 B;  3QHT A;  4A55 A;  2QSD A;  4XX5 A;  1HE8 A;  2IY1 B;  1TY0 A;  1HTO A;  3RZW C;  1WI0 A;  4JQW C;  4GDL A;  3QC8 B;  4FJV B;  2WDQ B;  1ACC A;  2KYW A;  4LJO B;  2IGD A;  4XWT A;  3QA8 A;  2BKR B;  1B1Z A;  2MJE A;  4WQM A;  2MP2 B;  2PW9 A;  3UIN B;  1F2R I;  3AE1 B;  3AXC A;  1I4X A;  3APD A;  1JWS D;  2AL3 A;  2WDV B;  1ZGU B;  2DX5 B;  5HG2 A;  4JGH B;  2V4I B;  5LNK 1;  2ZNV C;  4E74 A;  2LGY A;  1XXG A;  5J2R A;  2V9H A;  1CQV A;  2RDH A;  3IXS A;  1SBB B;  3TJP A;  3H7P A;  4FHK A;  5MPO A;  1GC6 A;  2I2Y A;  1EF1 A;  5JZE B;  4LLG M;  2J0J A;  2B76 B;  4WJN A;  1HXY D;  1DOY A;  2C5L C;  1WIA A;  2INP E;  4W9E A;  2DBY A;  2ZJD A;  3W5U B;  3K9P B;  2HD5 B;  4EEW A;  1UNS A;  2MSE D;  3A33 B;  1YJI A;  3M3J A;  3ZXV A;  2FCQ A;  1WSP A;  2NS5 A;  3DHH C;  4XDC A;  1R7S A;  3VAW A;  1WGG A;  5AZH A;  1WJ4 A;  2JZP A;  3N32 A;  2JUO A;  2L52 A;  4RGM A;  2KQ7 A;  1QF6 A;  3IHP C;  1Z5S B;  3I63 C;  3ZYY X;  4II2 B;  5BMH A;  1UBQ A;  1V1P A;  1EWY C;  4ZOH C;  3A4S C;  4IOI E;  4LTU A;  2AQ3 B;  1X1M A;  3NUH B;  2LJ5 A;  1QKZ A;  1LFD A;  3GZN B;  3HIZ A;  4GXB A;  1CK1 A;  4US9 A;  3URY A;  2J7Q B;  3AEE B;  3Q3F A;  4I6L B;  1Q5W B;  2BS4 B;  1L5P A;  4BKS D;  1J19 A;  3P2B A;  4JPS A;  2CHX A;  5G5H A;  3O13 A;  4AJY B;  1WZ0 A;  2KOX A;  2ZEQ A;  4RCO A;  1VD2 A;  3A9J B;  2KO3 A;  1LO5 D;  3RMK C;  3T8M A;  2JF5 A;  5G55 A;  2XNA C;  1RFA A;  1L7Y A;  1WJN A; 
#chains in the Genus database with same CATH homology
 3DBH I;  2LAS A;  2LGD A;  2R2O A;  1WXV A;  2K25 A;  4NAW B;  3WAN A;  4ZDV A;  4AJW A;  5TR5 A;  4WJQ A;  3TBL D;  4W9J A;  3QX1 A;  3ZDT A;  3ONS A;  3ZRF A;  2LVQ A;  2MBE A;  4GGQ A;  1GG3 A;  3KUZ A;  2C7N B;  3CST A;  4HPL B;  4NJ7 A;  2XK5 B;  5G2N A;  4GOC A;  1PQS A;  1V81 A;  2K8C A;  4PS8 A;  3CMM B;  4DBG A;  3A1Q B;  2VRR B;  4PS7 A;  1IP9 A;  4LDT D;  2N9P C;  3ZDM C;  2FNJ B;  3CSF A;  3L0W B;  4KIK B;  3W1S C;  2IO3 B;  1VCB A;  2NVU I;  1KM7 A;  2KDI A;  5C1Z A;  2REX A;  3ALB A;  3OJ3 A;  4I6P A;  3ZRC A;  2JZZ A;  3H7S A;  5LLI A;  2N1W A;  3JSV A;  5JHA A;  2KLC A;  5D94 A;  2BYV E;  2AEH A;  1GUA B;  4BVU C;  3EHV A;  3RYT A;  5FR6 A;  3DCG A;  4PYZ A;  3BY4 B;  3N3K B;  2KVR A;  2ASQ A;  3AI5 A;  4URK A;  3WIM A;  3PTF C;  5D6J B;  3H6N A;  1E8W A;  2KQS A;  1YIW A;  1ZW7 A;  3B08 A;  3NS8 A;  4CYE A;  2GMI C;  2B3A A;  3KW5 B;  1WMH A;  4RMA A;  4BBN F;  4E71 A;  4TV3 A;  1WY8 A;  2N9X A;  3VXW A;  4HLE A;  2WX1 A;  1V9J A;  3ZNG C;  3AU4 A;  4HWI B;  4YL8 A;  4LDT B;  2MBO A;  3NY5 A;  3VH4 B;  4GDK B;  4NJ6 A;  2BWE S;  3AUL A;  3MJW A;  3VTU A;  1OGW A;  2GBN A;  2IO2 B;  3M95 A;  3KVF B;  3ML8 A;  1WXS A;  3UQA A;  2C60 A;  1F9J A;  3QWZ B;  3V62 A;  1E7V A;  1WX8 A;  3HK0 A;  3NHE B;  3ML9 A;  1FXT B;  2Y5B B;  3H1U A;  2KAN A;  3DPD A;  2DHZ A;  2NPT A;  3PRE A;  2D2Q A;  2JY6 A;  2OJR A;  3QIJ A;  3WAL A;  1I42 A;  1M94 A;  3PV1 A;  2JRI B;  1XD3 B;  2XEW A;  1WE7 A;  4HXD A;  3L17 A;  1YJ1 A;  4FN2 A;  2MWS B;  4IM3 A;  3MHS D;  2ZCB A;  3GOE A;  3ZIM A;  4G50 A;  3H7P B;  4HVB A;  4NPN A;  3ECI A;  4K7W A;  1YX6 B;  2DZI A;  4EUT A;  2KZR A;  3VH3 B;  3ZNZ B;  2RR9 A;  4B95 A;  3DOW A;  4JL9 A;  2RSU A;  1V5O A;  2YVC A;  2JXX A;  2ZNV B;  4ASW C;  2JRH A;  2NR2 A;  3VHT C;  4W9D A;  2N4F A;  4A20 A;  2KXJ A;  1E7U A;  1WRD B;  4GIV A;  3ZKJ C;  3DBR I;  3S2A A;  4F8C B;  5KHQ A;  3VDZ A;  4GN1 A;  4TQ0 A;  1P3Q U;  4W9L A;  1T0Y A;  4MJS A;  4BOS C;  3QJZ A;  4DHZ B;  3L54 A;  2KD0 A;  3ZW3 A;  5JH5 C;  5AZF A;  2FAZ A;  4KZC A;  2L76 A;  1YD8 U;  1TZ1 A;  2YLM A;  1GJZ A;  2PPH A;  2MX2 A;  4M0W B;  4P7I A;  2AL6 A;  4HPM B;  3VUX A;  2ZPY A;  2L05 A;  1WGY A;  2DZK A;  1LM8 B;  2HTH A;  2LVO A;  3C0R B;  4GDL B;  3ZTC A;  1LQB A;  4HJK A;  5KHO A;  2KFK A;  2LRU A;  4IWP A;  5E6O A;  4W9K A;  1G6J A;  4NQK E;  2MLB A;  4EOY A;  3JW0 X;  2IBI B;  3QAR A;  5L83 A;  2MBH A;  4BFR A;  4EFO A;  1MG8 A;  3PVL A;  3L16 A;  2KX3 A;  1NDD A;  3R66 C;  4KDL B;  4BOZ B;  3DQV A;  3PRZ A;  4DHZ E;  2K6Q A;  2M0X A;  1ZKH A;  2JZ3 B;  2KTR B;  5AEK B;  1J8C A;  3BIN A;  2FCM A;  4FBJ B;  2LXA A;  1E8X A;  2NBU A;  2A5U A;  1XQQ A;  1EF5 A;  4FUL A;  2KC1 A;  4MM3 A;  5CTR C;  1WF9 A;  1WX9 A;  2ZZP B;  4AWJ A;  2C7H A;  3JYU A;  5GMV A;  3EFU A;  2I1K A;  1Z2M A;  2M17 A;  2V1Y A;  2Z0E B;  1WM2 A;  2K8H A;  5CX3 A;  2O6V D;  4GMV A;  4LCD E;  4M8N A;  4DK5 A;  4IG7 B;  3U7D A;  1TGZ B;  3TL5 A;  3V6E B;  2GBM A;  2MW5 A;  2M8S A;  4GU2 A;  4I6N B;  2FIF A;  1OTR B;  2M4N A;  3DVN V;  4DXA B;  3X0W A;  5L95 C;  3Q3J A;  1WYW B;  5EDS A;  3R7R A;  2K6D B;  4MEL A;  1RLF A;  1UGM A;  4HCP B;  4JIO U;  3ZLZ A;  1V86 A;  3AU5 A;  4II3 B;  4TQ1 A;  4IWO A;  2GBJ A;  2CKH B;  4IUM B;  3IFW B;  4W9G A;  5DPT A;  2KFJ A;  2A4Z A;  2XBB C;  3SHQ A;  2WDT B;  4B6W A;  3ZNH B;  1WXM A;  1V49 A;  2MP2 A;  1ISN A;  3D32 A;  4ZRK A;  4ZYN A;  3PZD A;  2KWC A;  4J6I A;  3PSE B;  4DWF A;  1AAR A;  4AOF A;  1P9D U;  2V4L A;  5CHF A;  1WX7 A;  3APF A;  5C23 A;  3UF8 A;  2KMC A;  2NBW B;  3JSV B;  1YX5 B;  3QAQ A;  4G0N B;  5D2M B;  3VUY A;  2RPQ A;  3A9J A;  4MEM A;  1OEY A;  4G11 A;  4A3P A;  2FUH B;  3OLM D;  3UQB A;  2J0M A;  2O6V A;  4MGI E;  2JWZ A;  2BYF A;  3EC8 A;  3A9K A;  3RCZ A;  5BO4 B;  1V6E A;  3ZTD A;  4EZL A;  5JHB A;  1UD7 A;  1E8Z A;  4EZK A;  3DVG X;  1WMH B;  4K7S A;  3NZS A;  5HKH A;  1SIF A;  2CHW A;  2KMA A;  2WX0 A;  3K9O B;  2KLG A;  3VUW A;  4FJZ A;  4BKG A;  3EEC A;  2L0F A;  2KDF B;  2LD9 A;  1S3S G;  2D11 A;  2Z0D B;  3KYD D;  4IWQ A;  2C7M B;  5DPS A;  2G45 B;  4RM9 A;  3L08 A;  3DVG Y;  3APC A;  4AUQ C;  1C3T A;  1JRU A;  4DDI D;  5E6N A;  3B0A A;  4MGZ E;  1WE6 A;  4DDG D;  3PRM B;  2ZPN A;  4K1R B;  4B9K A;  5J17 A;  3M63 B;  3R7Q A;  3O65 B;  2N7E A;  2LXC A;  3IVF A;  3PLV A;  4KIK A;  4N9F 4;  4MSQ B;  5AZG A;  1E90 A;  2KKC A;  1H4R A;  3WA0 A;  2NCN A;  1TTN A;  3HM6 X;  4F7Z A;  3U30 A;  3DBL I;  2PE6 B;  2KC2 A;  4MH0 E;  4KDI C;  3GZN I;  2KNB A;  2AWT A;  2DZJ A;  3ZO5 B;  2G3Q B;  3IG3 A;  3PHX B;  3WAM A;  4HDQ A;  1C1Y B;  4HK2 A;  2EMS A;  2IZV B;  1GNU A;  3RD2 A;  2L8J A;  3PRP B;  2RD0 A;  1H8C A;  1YQB A;  2CHZ A;  5CHV C;  4WJO A;  4HCN B;  1K8R B;  2DYM A;  3LJ3 A;  3SU8 X;  3ZVV A;  2DYB A;  4A3O A;  4ZRI A;  5DPW A;  3ZUN A;  2MA9 B;  1UH6 A;  2LRW A;  3W1Y A;  4OVU A;  2M1M A;  3OJ4 B;  3OAW A;  2V3S A;  1GC7 A;  4OVV A;  5LXH A;  1U4A A;  1E5W A;  2LWP A;  2LVP A;  2LI5 A;  4MSM B;  1EO6 A;  4JLC A;  1BT0 A;  4EKU A;  5LXI B;  3IBE A;  2KJR A;  2KK8 A;  4AP4 C;  2EMT A;  2GOW A;  3M62 B;  4KZ0 A;  2IO1 B;  5DCN A;  3UGB B;  2CS4 A;  4W9F A;  3V61 A;  4NAW A;  1KOT A;  1J0G A;  3QCA A;  4W9C A;  2KX0 A;  4FJY A;  2KFK B;  4FA6 A;  2QHO A;  4IW0 A;  2D10 A;  4ANV A;  3QK0 A;  1D3Z A;  3ENE A;  2G4D B;  1SGH A;  2XK5 A;  4NY0 A;  5IAA C;  3SDL C;  4CO7 A;  4GSW A;  2DYO A;  1Q1O A;  2PJH A;  3VTV A;  2MBB B;  4WQO B;  4FLH A;  1S1Q B;  2LZ6 A;  2RGF A;  4BKT A;  3A1Q A;  3A4R A;  5J18 A;  2UWQ A;  2L0T A;  3N30 A;  2N1V A;  3W1S A;  3ZNI D;  2MCN B;  2MQJ A;  2IYD B;  4KV2 A;  3NZU A;  1A5R A;  2BPS A;  2KDB A;  2MBQ A;  3QQ8 B;  4MGY E;  3DDC B;  2HJ8 A;  4GB9 A;  4WAA A;  2O2V B;  4EZJ A;  1P0R A;  3NOB A;  1WR6 E;  2I1J A;  4NNJ B;  5IA7 A;  1RAX A;  3KH0 A;  2KJH B;  4X57 B;  3QHT A;  4XZ4 A;  1P98 A;  4RM8 A;  1CMX B;  4XX5 A;  1HE8 A;  2KN5 A;  2IY1 B;  2ZVN A;  1WJ6 A;  3UIO B;  4ICU A;  4ANW A;  2R2Q A;  2BWF A;  1IPG A;  4IC7 B;  3RZW C;  1WI0 A;  4JQW C;  4GDL A;  2DAF A;  3QC8 B;  3JVZ X;  4FJV B;  3I3T B;  4LJO B;  4ICV A;  3QA8 A;  2Z59 B;  3VVW B;  2BKR B;  3PGE A;  4DHJ D;  3RZF A;  2FCS A;  2MP2 B;  2LUE A;  3UIN B;  2DEN B;  2WWZ A;  4M8M A;  2KJ6 A;  3X23 A;  3RUI B;  2KTR A;  2G4S A;  3AXC A;  1I35 A;  2HE7 A;  1OQY A;  3APD A;  4FAD A;  2MRP A;  2AL3 A;  2D3G A;  1SE9 A;  1OEY J;  1ZGU B;  2DX5 B;  3PS6 A;  4JGH B;  2FID A;  5D7G A;  2ZNV C;  4E74 A;  2D07 B;  3VQI A;  1WM3 A;  2LGY A;  4W9H A;  5J2R A;  3A9K B;  1WH3 A;  1UEL A;  3R3M A;  4PYU A;  5DPR A;  3TJP A;  2JT4 B;  1KLV A;  3H7P A;  4FHK A;  1GC6 A;  2DAJ A;  2GBK A;  4IM2 A;  1EF1 A;  1WR1 A;  1WGH A;  2K39 A;  3MTN B;  3PLU A;  3KUD B;  5JZE B;  2J0J A;  4WJN A;  3WAO A;  2WYQ A;  4TUU A;  3KUC B;  1TBE A;  4GDK A;  3TIX A;  2C5L C;  4FHJ A;  1WIA A;  3VTW A;  2CU1 A;  4W9E A;  2ZJD A;  4KVG B;  3K9P B;  4HDO A;  4KSL C;  1UZX B;  3H9D A;  1Y8R C;  3LDZ E;  4W9I A;  3TCA A;  2C9W B;  2KWV B;  2HD5 B;  4EEW A;  4WJP A;  2MSE D;  1P1A A;  1WGD A;  1QZE A;  3B1L X;  2KWU B;  2IY0 B;  2NPT B;  3A33 B;  3M3J A;  4ZRJ A;  2FCQ A;  2NS5 A;  2W9N A;  3CF6 E;  2J0K A;  2O6V B;  3L10 B;  2KTF A;  3VAW A;  3PT2 B;  4WWP A;  2IO0 B;  1WGG A;  2PE9 A;  2UYZ B;  5AZH A;  2ZVO A;  1WJ4 A;  1R4M I;  1EUV B;  3N32 A;  2JUO A;  1WZ3 A;  1RRB A;  2K1F A;  1R4N I;  4LJP B;  3HM3 A;  4DHJ B;  1KJT A;  2KDE B;  2LGX A;  4ANX A;  2KQ7 A;  2BYE A;  2DZM A;  2EKE C;  1V5T A;  1V80 A;  3IHP C;  4WWN A;  1Z5S B;  2PEA A;  1V2Y A;  3DBS A;  4II2 B;  2OOB B;  1LXD A;  2L3Z A;  3VFK A;  1L2N A;  4WWO A;  1UBQ A;  2BGF A;  4MDK E;  5CHW A;  3UIP B;  3A4S C;  3SD5 A;  4BBN C;  1NBF C;  1XT9 B;  2L7R A;  1X1M A;  3PHW B;  3KYC D;  2BF8 B;  3T9L A;  4MGK E;  4F1S A;  4MJS B;  2N9E B;  4PS3 A;  2LJ5 A;  4IM0 A;  3V60 A;  1LFD A;  3HIZ A;  4CHK A;  2GBR A;  4GXB A;  4KSK C;  2ZCC A;  4NQL B;  3U8Z A;  1WFY A;  2AYO B;  2CR5 A;  4E3C A;  2JVC A;  1NI2 A;  3RUL A;  4BKS A;  2J7Q B;  3Q3F A;  4I6L B;  4ANU A;  1WGR A;  1Q5W B;  2L00 B;  1WXA A;  1WJU A;  4K7U A;  3WAP A;  3L13 A;  3V6C B;  4BKS D;  1J19 A;  2N7D A;  4G3X B;  3P2B A;  2CHX A;  1IYF A;  3HHM A;  2FCN A;  2O2V A;  1E8Y A;  2BKF A;  2KHW B;  4AJY B;  1WZ0 A;  4K81 A;  2KOX A;  1Q0W B;  2ZEQ A;  4TKN A;  5E6P A;  3DVN U;  1VD2 A;  4XC2 A;  3A9J B;  2KO3 A;  2JPH A;  1UBI A;  3PPA A;  2NBV B;  3T8M A;  2JF5 A;  2K8B A;  5G55 A;  3RT3 B;  1RFA A;  1L7Y A;  3TMP B;  1WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...