2V3XA

His243ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3xA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3xA02
5JFRA 3TAVA 1XGNA 4HXXA 1WLRA 1JAWA 4ZWOA 2Q93A 1YW8A 4IKUA 3OOOA 1WL6A 4B28A 1CHMA 2HOWA 2GG2A 2Q96A 5FCFA 2DFIA 4Z7MA 2EA2A 2BWTA 3S6BA 5CDVA 4U75A 3BIPA 2GU5A 2GA2A 1KQ9A 5CE6A 3IU9A 3PN9A 2BWXA 2GG3A 3MX6A 3CB6A 3BITA 5CIKA 2B3KA 4FO7A 3BIQA 4PNCA 3CB5A 3L7GA 4IF7A 4RZYA 5CLSA 1YJ3A 2BN7A 2V3YA 3D27A 1YW9A 3PKBA 4ZWUA 2BWYA 4IKTA 2V3ZA 2P99A 3IU8A 4S2TP 2G6PA 1Y1NA 2Q8KA 2ADUA 4IECA 4A6VA 4U6WA 1WY2A 2GGCA 2BHBA 1QXWA 2GGBA 2GG5A 2BHCA 1R5HA 2P9AA 2Q94A 3RORA 1B6AA 4U76A 4FLJA 4KM3A 3FM3A 3CTZA 2EVMA 4U69A 4U6JA 4OOKA 2GU4A 4U73A 5JHUA 1A16A 1YW7A 4U70A 1KP0A 2NQ6A 3MR1A 3O5VA 2GG9A 4FLKA 1QXYA 2BWUA 1XNZA 5JI6A 2GU7A 2BWSA 1PV9A 4EGEA 3PKEA 3PEBA 4S2RP 4U71A 2GU6A 4IKRA 2EVCA 4IDYA 3IL0A 4PV4A 1WN1A 4U6CA 2V6CA 3FMRA 5CNXA 3Q6DA 3PKAA 1C22A 1W7VA 3IU7A 4U6ZA 2BWWA 5CDEA 1O0XA 3TB5A 1MATA 2OKNA 1R5GA 4RGZ1 2GTXA 4A6WA 4JUQA 4FO8A 1M35A 2BWVA 4ZNGA 4IKSA 1WKMA 2BH3A 2GG7A 4FLIA 4IPAA 3I7MA 2BHAA 1R58A 2ZSGA 4IU6A 3FMQA 3OVKA 1N51A 1KQ0A 2IW2A 1QXZA 1C21A 4U6EA 1XGMA 2BHDA 1BN5A 4S00A 2MATA 4MATA 1WBQA 4ZWPA 4U1BA 5FCHA 1XGSA 2GG0A 3PKCA 3RVAA 2Q92A 4RZZA 2OAZA 2NQ7A 4FKCA 4S01A 5D6FA 5E5BA 1W2MA 2GZ5A 2P98A 4FLLA 1C27A 3MATA 4R60A 5E2CA 1BOAA 2B3LA 2BB7A 2GG8A 2Q95A 3IG4A 3L24A 1C23A 2EVOA 3PKDA 2B3HA 4QR8A 4FUKA 1QZYA 5D6EA 2EA4A 1XGOA 1YVMA 1WL9A 1C24A 2V3XA 5CDLA 1B59A 3QOCA
chains in the Genus database with same CATH superfamily
5JFRA 3TAVA 1XGNA 4HXXA 1WLRA 1JAWA 4ZWOA 2Q93A 1YW8A 4IKUA 3OOOA 1WL6A 4B28A 1CHMA 2HOWA 2GG2A 2Q96A 5FCFA 2DFIA 4Z7MA 2EA2A 2BWTA 3S6BA 5CDVA 4U75A 3BIPA 2GU5A 2GA2A 1KQ9A 5CE6A 3IU9A 3PN9A 2BWXA 2GG3A 3MX6A 3CB6A 3BITA 5CIKA 2B3KA 4FO7A 3BIQA 4PNCA 3CB5A 3L7GA 4IF7A 4RZYA 5CLSA 1YJ3A 2BN7A 2V3YA 3D27A 1YW9A 3PKBA 4ZWUA 2BWYA 4IKTA 2V3ZA 2P99A 3IU8A 4S2TP 2G6PA 1Y1NA 2Q8KA 2ADUA 4IECA 4A6VA 4U6WA 1WY2A 2GGCA 2BHBA 1QXWA 2GGBA 2GG5A 2BHCA 1R5HA 2P9AA 2Q94A 3RORA 1B6AA 4U76A 4FLJA 4KM3A 3FM3A 3CTZA 2EVMA 4U69A 4U6JA 4OOKA 2GU4A 4U73A 5JHUA 1A16A 1YW7A 4U70A 1KP0A 2NQ6A 3MR1A 3O5VA 2GG9A 4FLKA 1QXYA 2BWUA 1XNZA 5JI6A 2GU7A 2BWSA 1PV9A 4EGEA 3PKEA 3PEBA 4S2RP 4U71A 2GU6A 4IKRA 2EVCA 4IDYA 3IL0A 4PV4A 1WN1A 4U6CA 2V6CA 3FMRA 5CNXA 3Q6DA 3PKAA 1C22A 1W7VA 3IU7A 4U6ZA 2BWWA 5CDEA 1O0XA 3TB5A 1MATA 2OKNA 1R5GA 4RGZ1 2GTXA 4A6WA 4JUQA 4FO8A 1M35A 2BWVA 4ZNGA 4IKSA 1WKMA 2BH3A 2GG7A 4FLIA 4IPAA 3I7MA 2BHAA 1R58A 2ZSGA 4IU6A 3FMQA 3OVKA 1N51A 1KQ0A 2IW2A 1QXZA 1C21A 4U6EA 1XGMA 2BHDA 1BN5A 4S00A 2MATA 4MATA 1WBQA 4ZWPA 4U1BA 5FCHA 1XGSA 2GG0A 3PKCA 3RVAA 2Q92A 4RZZA 2OAZA 2NQ7A 4FKCA 4S01A 5D6FA 5E5BA 1W2MA 2GZ5A 2P98A 4FLLA 1C27A 3MATA 4R60A 5E2CA 1BOAA 2B3LA 2BB7A 2GG8A 2Q95A 3IG4A 3L24A 1C23A 2EVOA 3PKDA 2B3HA 4QR8A 4FUKA 1QZYA 5D6EA 2EA4A 1XGOA 1YVMA 1WL9A 1C24A 2V3XA 5CDLA 1B59A 3QOCA
chains in the Genus database with same CATH topology
5JFRA 3TAVA 1XGNA 4HXXA 1WLRA 1JAWA 4ZWOA 2Q93A 1YW8A 4IKUA 3OOOA 1WL6A 4B28A 1CHMA 2HOWA 2GG2A 2Q96A 5FCFA 2DFIA 4Z7MA 2EA2A 2BWTA 3S6BA 5CDVA 4U75A 3BIPA 2GU5A 2GA2A 1KQ9A 5CE6A 3IU9A 3PN9A 2BWXA 2GG3A 3MX6A 3CB6A 3BITA 5CIKA 2B3KA 4FO7A 3BIQA 4PNCA 3CB5A 3L7GA 4IF7A 4RZYA 5CLSA 1YJ3A 2BN7A 2V3YA 3D27A 1YW9A 3PKBA 4ZWUA 2BWYA 4IKTA 2V3ZA 2P99A 3IU8A 4S2TP 2G6PA 1Y1NA 2Q8KA 2ADUA 4IECA 4A6VA 4U6WA 1WY2A 2GGCA 2BHBA 1QXWA 2GGBA 2GG5A 2BHCA 1R5HA 2P9AA 2Q94A 3RORA 1B6AA 4U76A 4FLJA 4KM3A 3FM3A 3CTZA 2EVMA 4U69A 4U6JA 4OOKA 2GU4A 4U73A 5JHUA 1A16A 1YW7A 4U70A 1KP0A 2NQ6A 3MR1A 3O5VA 2GG9A 4FLKA 1QXYA 2BWUA 1XNZA 5JI6A 2GU7A 2BWSA 1PV9A 4EGEA 3PKEA 3PEBA 4S2RP 4U71A 2GU6A 4IKRA 2EVCA 4IDYA 3IL0A 4PV4A 1WN1A 4U6CA 2V6CA 3FMRA 5CNXA 3Q6DA 3PKAA 1C22A 1W7VA 3IU7A 4U6ZA 2BWWA 5CDEA 1O0XA 3TB5A 1MATA 2OKNA 1R5GA 4RGZ1 2GTXA 4A6WA 4JUQA 4FO8A 1M35A 2BWVA 4ZNGA 4IKSA 1WKMA 2BH3A 2GG7A 4FLIA 4IPAA 3I7MA 2BHAA 1R58A 2ZSGA 4IU6A 3FMQA 3OVKA 1N51A 1KQ0A 2IW2A 1QXZA 1C21A 4U6EA 1XGMA 2BHDA 1BN5A 4S00A 2MATA 4MATA 1WBQA 4ZWPA 4U1BA 5FCHA 1XGSA 2GG0A 3PKCA 3RVAA 2Q92A 4RZZA 2OAZA 2NQ7A 4FKCA 4S01A 5D6FA 5E5BA 1W2MA 2GZ5A 2P98A 4FLLA 1C27A 3MATA 4R60A 5E2CA 1BOAA 2B3LA 2BB7A 2GG8A 2Q95A 3IG4A 3L24A 1C23A 2EVOA 3PKDA 2B3HA 4QR8A 4FUKA 1QZYA 5D6EA 2EA4A 1XGOA 1YVMA 1WL9A 1C24A 2V3XA 5CDLA 1B59A 3QOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFR A;  3TAV A;  1XGN A;  4HXX A;  1WLR A;  1JAW A;  4ZWO A;  2Q93 A;  1YW8 A;  4IKU A;  3OOO A;  1WL6 A;  4B28 A;  1CHM A;  2HOW A;  2GG2 A;  2Q96 A;  5FCF A;  2DFI A;  4Z7M A;  2EA2 A;  2BWT A;  3S6B A;  5CDV A;  4U75 A;  3BIP A;  2GU5 A;  2GA2 A;  1KQ9 A;  5CE6 A;  3IU9 A;  3PN9 A;  2BWX A;  2GG3 A;  3MX6 A;  3CB6 A;  3BIT A;  5CIK A;  2B3K A;  4FO7 A;  3BIQ A;  4PNC A;  3CB5 A;  3L7G A;  4IF7 A;  4RZY A;  5CLS A;  1YJ3 A;  2BN7 A;  2V3Y A;  3D27 A;  1YW9 A;  3PKB A;  4ZWU A;  2BWY A;  4IKT A;  2V3Z A;  2P99 A;  3IU8 A;  4S2T P;  2G6P A;  1Y1N A;  2Q8K A;  2ADU A;  4IEC A;  4A6V A;  4U6W A;  1WY2 A;  2GGC A;  2BHB A;  1QXW A;  2GGB A;  2GG5 A;  2BHC A;  1R5H A;  2P9A A;  2Q94 A;  3ROR A;  1B6A A;  4U76 A;  4FLJ A;  4KM3 A;  3FM3 A;  3CTZ A;  2EVM A;  4U69 A;  4U6J A;  4OOK A;  2GU4 A;  4U73 A;  5JHU A;  1A16 A;  1YW7 A;  4U70 A;  1KP0 A;  2NQ6 A;  3MR1 A;  3O5V A;  2GG9 A;  4FLK A;  1QXY A;  2BWU A;  1XNZ A;  5JI6 A;  2GU7 A;  2BWS A;  1PV9 A;  4EGE A;  3PKE A;  3PEB A;  4S2R P;  4U71 A;  2GU6 A;  4IKR A;  2EVC A;  4IDY A;  3IL0 A;  4PV4 A;  1WN1 A;  4U6C A;  2V6C A;  3FMR A;  5CNX A;  3Q6D A;  3PKA A;  1C22 A;  1W7V A;  3IU7 A;  4U6Z A;  2BWW A;  5CDE A;  1O0X A;  3TB5 A;  1MAT A;  2OKN A;  1R5G A;  4RGZ 1;  2GTX A;  4A6W A;  4JUQ A;  4FO8 A;  1M35 A;  2BWV A;  4ZNG A;  4IKS A;  1WKM A;  2BH3 A;  2GG7 A;  4FLI A;  4IPA A;  3I7M A;  2BHA A;  1R58 A;  2ZSG A;  4IU6 A;  3FMQ A;  3OVK A;  1N51 A;  1KQ0 A;  2IW2 A;  1QXZ A;  1C21 A;  4U6E A;  1XGM A;  2BHD A;  1BN5 A;  4S00 A;  2MAT A;  4MAT A;  1WBQ A;  4ZWP A;  4U1B A;  5FCH A;  1XGS A;  2GG0 A;  3PKC A;  3RVA A;  2Q92 A;  4RZZ A;  2OAZ A;  2NQ7 A;  4FKC A;  4S01 A;  5D6F A;  5E5B A;  1W2M A;  2GZ5 A;  2P98 A;  4FLL A;  1C27 A;  3MAT A;  4R60 A;  5E2C A;  1BOA A;  2B3L A;  2BB7 A;  2GG8 A;  2Q95 A;  3IG4 A;  3L24 A;  1C23 A;  2EVO A;  3PKD A;  2B3H A;  4QR8 A;  4FUK A;  1QZY A;  5D6E A;  2EA4 A;  1XGO A;  1YVM A;  1WL9 A;  1C24 A;  2V3X A;  5CDL A;  1B59 A;  3QOC A; 
#chains in the Genus database with same CATH topology
 5JFR A;  3TAV A;  1XGN A;  4HXX A;  1WLR A;  1JAW A;  4ZWO A;  2Q93 A;  1YW8 A;  4IKU A;  3OOO A;  1WL6 A;  4B28 A;  1CHM A;  2HOW A;  2GG2 A;  2Q96 A;  5FCF A;  2DFI A;  4Z7M A;  2EA2 A;  2BWT A;  3S6B A;  5CDV A;  4U75 A;  3BIP A;  2GU5 A;  2GA2 A;  1KQ9 A;  5CE6 A;  3IU9 A;  3PN9 A;  2BWX A;  2GG3 A;  3MX6 A;  3CB6 A;  3BIT A;  5CIK A;  2B3K A;  4FO7 A;  3BIQ A;  4PNC A;  3CB5 A;  3L7G A;  4IF7 A;  4RZY A;  5CLS A;  1YJ3 A;  2BN7 A;  2V3Y A;  3D27 A;  1YW9 A;  3PKB A;  4ZWU A;  2BWY A;  4IKT A;  2V3Z A;  2P99 A;  3IU8 A;  4S2T P;  2G6P A;  1Y1N A;  2Q8K A;  2ADU A;  4IEC A;  4A6V A;  4U6W A;  1WY2 A;  2GGC A;  2BHB A;  1QXW A;  2GGB A;  2GG5 A;  2BHC A;  1R5H A;  2P9A A;  2Q94 A;  3ROR A;  1B6A A;  4U76 A;  4FLJ A;  4KM3 A;  3FM3 A;  3CTZ A;  2EVM A;  4U69 A;  4U6J A;  4OOK A;  2GU4 A;  4U73 A;  5JHU A;  1A16 A;  1YW7 A;  4U70 A;  1KP0 A;  2NQ6 A;  3MR1 A;  3O5V A;  2GG9 A;  4FLK A;  1QXY A;  2BWU A;  1XNZ A;  5JI6 A;  2GU7 A;  2BWS A;  1PV9 A;  4EGE A;  3PKE A;  3PEB A;  4S2R P;  4U71 A;  2GU6 A;  4IKR A;  2EVC A;  4IDY A;  3IL0 A;  4PV4 A;  1WN1 A;  4U6C A;  2V6C A;  3FMR A;  5CNX A;  3Q6D A;  3PKA A;  1C22 A;  1W7V A;  3IU7 A;  4U6Z A;  2BWW A;  5CDE A;  1O0X A;  3TB5 A;  1MAT A;  2OKN A;  1R5G A;  4RGZ 1;  2GTX A;  4A6W A;  4JUQ A;  4FO8 A;  1M35 A;  2BWV A;  4ZNG A;  4IKS A;  1WKM A;  2BH3 A;  2GG7 A;  4FLI A;  4IPA A;  3I7M A;  2BHA A;  1R58 A;  2ZSG A;  4IU6 A;  3FMQ A;  3OVK A;  1N51 A;  1KQ0 A;  2IW2 A;  1QXZ A;  1C21 A;  4U6E A;  1XGM A;  2BHD A;  1BN5 A;  4S00 A;  2MAT A;  4MAT A;  1WBQ A;  4ZWP A;  4U1B A;  5FCH A;  1XGS A;  2GG0 A;  3PKC A;  3RVA A;  2Q92 A;  4RZZ A;  2OAZ A;  2NQ7 A;  4FKC A;  4S01 A;  5D6F A;  5E5B A;  1W2M A;  2GZ5 A;  2P98 A;  4FLL A;  1C27 A;  3MAT A;  4R60 A;  5E2C A;  1BOA A;  2B3L A;  2BB7 A;  2GG8 A;  2Q95 A;  3IG4 A;  3L24 A;  1C23 A;  2EVO A;  3PKD A;  2B3H A;  4QR8 A;  4FUK A;  1QZY A;  5D6E A;  2EA4 A;  1XGO A;  1YVM A;  1WL9 A;  1C24 A;  2V3X A;  5CDL A;  1B59 A;  3QOC A; 
#chains in the Genus database with same CATH homology
 5JFR A;  3TAV A;  1XGN A;  4HXX A;  1WLR A;  1JAW A;  4ZWO A;  2Q93 A;  1YW8 A;  4IKU A;  3OOO A;  1WL6 A;  4B28 A;  1CHM A;  2HOW A;  2GG2 A;  2Q96 A;  5FCF A;  2DFI A;  4Z7M A;  2EA2 A;  2BWT A;  3S6B A;  5CDV A;  4U75 A;  3BIP A;  2GU5 A;  2GA2 A;  1KQ9 A;  5CE6 A;  3IU9 A;  3PN9 A;  2BWX A;  2GG3 A;  3MX6 A;  3CB6 A;  3BIT A;  5CIK A;  2B3K A;  4FO7 A;  3BIQ A;  4PNC A;  3CB5 A;  3L7G A;  4IF7 A;  4RZY A;  5CLS A;  1YJ3 A;  2BN7 A;  2V3Y A;  3D27 A;  1YW9 A;  3PKB A;  4ZWU A;  2BWY A;  4IKT A;  2V3Z A;  2P99 A;  3IU8 A;  4S2T P;  2G6P A;  1Y1N A;  2Q8K A;  2ADU A;  4IEC A;  4A6V A;  4U6W A;  1WY2 A;  2GGC A;  2BHB A;  1QXW A;  2GGB A;  2GG5 A;  2BHC A;  1R5H A;  2P9A A;  2Q94 A;  3ROR A;  1B6A A;  4U76 A;  4FLJ A;  4KM3 A;  3FM3 A;  3CTZ A;  2EVM A;  4U69 A;  4U6J A;  4OOK A;  2GU4 A;  4U73 A;  5JHU A;  1A16 A;  1YW7 A;  4U70 A;  1KP0 A;  2NQ6 A;  3MR1 A;  3O5V A;  2GG9 A;  4FLK A;  1QXY A;  2BWU A;  1XNZ A;  5JI6 A;  2GU7 A;  2BWS A;  1PV9 A;  4EGE A;  3PKE A;  3PEB A;  4S2R P;  4U71 A;  2GU6 A;  4IKR A;  2EVC A;  4IDY A;  3IL0 A;  4PV4 A;  1WN1 A;  4U6C A;  2V6C A;  3FMR A;  5CNX A;  3Q6D A;  3PKA A;  1C22 A;  1W7V A;  3IU7 A;  4U6Z A;  2BWW A;  5CDE A;  1O0X A;  3TB5 A;  1MAT A;  2OKN A;  1R5G A;  4RGZ 1;  2GTX A;  4A6W A;  4JUQ A;  4FO8 A;  1M35 A;  2BWV A;  4ZNG A;  4IKS A;  1WKM A;  2BH3 A;  2GG7 A;  4FLI A;  4IPA A;  3I7M A;  2BHA A;  1R58 A;  2ZSG A;  4IU6 A;  3FMQ A;  3OVK A;  1N51 A;  1KQ0 A;  2IW2 A;  1QXZ A;  1C21 A;  4U6E A;  1XGM A;  2BHD A;  1BN5 A;  4S00 A;  2MAT A;  4MAT A;  1WBQ A;  4ZWP A;  4U1B A;  5FCH A;  1XGS A;  2GG0 A;  3PKC A;  3RVA A;  2Q92 A;  4RZZ A;  2OAZ A;  2NQ7 A;  4FKC A;  4S01 A;  5D6F A;  5E5B A;  1W2M A;  2GZ5 A;  2P98 A;  4FLL A;  1C27 A;  3MAT A;  4R60 A;  5E2C A;  1BOA A;  2B3L A;  2BB7 A;  2GG8 A;  2Q95 A;  3IG4 A;  3L24 A;  1C23 A;  2EVO A;  3PKD A;  2B3H A;  4QR8 A;  4FUK A;  1QZY A;  5D6E A;  2EA4 A;  1XGO A;  1YVM A;  1WL9 A;  1C24 A;  2V3X A;  5CDL A;  1B59 A;  3QOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...