2V3XA

His243ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 159
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3xA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3xA02
2BWUA 3IU8A 2V3ZA 2GA2A 4U6CA 3TB5A 4PV4A 1XGMA 1XGNA 4FUKA 4ZWUA 2GTXA 4U1BA 3PKCA 2BHAA 2BWVA 1WKMA 1YVMA 3MATA 4RZYA 4B28A 1KQ0A 3IG4A 4U75A 5CLSA 2Q96A 3RVAA 1YW9A 3FMQA 4OOKA 2Q93A 3FMRA 1C21A 4PNCA 4RGZ1 1YJ3A 4U76A 5CE6A 3PKAA 1C27A 5E5BA 4S2TP 2EVCA 4IDYA 5D6EA 2B3LA 4Z7MA 4U6ZA 2GGCA 2BHBA 1CHMA 2GGBA 3MX6A 2B3HA 1XGOA 2MATA 3FM3A 1B6AA 2Q8KA 3I7MA 4IU6A 4RZZA 1WBQA 1KP0A 2BB7A 1YW7A 2P98A 1C22A 2ZSGA 1O0XA 2EA4A 4ZNGA 2GG0A 5FCHA 4FO8A 4S00A 2GU4A 2ADUA 1W7VA 2Q92A 3PN9A 1JAWA 1WY2A 4ZWOA 3PKDA 2B3KA 2BHDA 1R5GA 5JFRA 1A16A 3L24A 5CNXA 1C23A 1C24A 4U70A 5CIKA 2EVMA 3CTZA 4U6WA 3TAVA 4IPAA 4A6WA 3O5VA 1QXZA 2EVOA 5CDEA 2BWTA 2BWSA 4JUQA 4IKTA 2GG7A 2EA2A 2BHCA 2P9AA 2Q95A 2P99A 5CDLA 1WLRA 3CB5A 4HXXA 3PEBA 3PKEA 2NQ7A 2BH3A 3IL0A 2GG5A 2HOWA 3L7GA 4IKSA 2OKNA 3Q6DA 1KQ9A 2DFIA 1W2MA 2GZ5A 3OVKA 4FLLA 4R60A 1R58A 2V3XA 4FLIA 4IECA 4U6JA 3RORA 2GU6A 3PKBA 4QR8A 5E2CA 2BWXA 1MATA 4U73A 3IU7A 2V3YA 5D6FA 2GG9A 1Y1NA 1BOAA 2G6PA 1M35A 3QOCA 1WN1A 1XGSA 1BN5A 5FCFA 1PV9A 2BN7A 1R5HA 3MR1A 4U69A 1XNZA 4S01A 1QZYA 3BIPA 5CDVA 1YW8A 2GG3A 1QXWA 4S2RP 2GG2A 4U71A 3IU9A 2IW2A 4KM3A 4MATA 4FKCA 1WL9A 3OOOA 1WL6A 1N51A 2BWYA 1B59A 2GU7A 2Q94A 5JHUA 4FLJA 3D27A 3BIQA 2OAZA 2V6CA 4FO7A 3CB6A 1QXYA 3S6BA 4ZWPA 2BWWA 4IKUA 4EGEA 2GU5A 4U6EA 4IF7A 4FLKA 4IKRA 3BITA 2NQ6A 5JI6A 2GG8A 4A6VA
chains in the Genus database with same CATH superfamily
2BWUA 3IU8A 2V3ZA 2GA2A 4U6CA 3TB5A 4PV4A 1XGMA 1XGNA 4FUKA 4ZWUA 2GTXA 4U1BA 3PKCA 2BHAA 2BWVA 1WKMA 1YVMA 3MATA 4RZYA 4B28A 1KQ0A 3IG4A 4U75A 5CLSA 2Q96A 3RVAA 1YW9A 3FMQA 4OOKA 2Q93A 3FMRA 1C21A 4PNCA 4RGZ1 1YJ3A 4U76A 5CE6A 3PKAA 1C27A 5E5BA 4S2TP 2EVCA 4IDYA 5D6EA 2B3LA 4Z7MA 4U6ZA 2GGCA 2BHBA 1CHMA 2GGBA 3MX6A 2B3HA 1XGOA 2MATA 3FM3A 1B6AA 2Q8KA 3I7MA 4IU6A 4RZZA 1WBQA 1KP0A 2BB7A 1YW7A 2P98A 1C22A 2ZSGA 1O0XA 2EA4A 4ZNGA 2GG0A 5FCHA 4FO8A 4S00A 2GU4A 2ADUA 1W7VA 2Q92A 3PN9A 1JAWA 1WY2A 4ZWOA 3PKDA 2B3KA 2BHDA 1R5GA 5JFRA 1A16A 3L24A 5CNXA 1C23A 1C24A 4U70A 5CIKA 2EVMA 3CTZA 4U6WA 3TAVA 4IPAA 4A6WA 3O5VA 1QXZA 2EVOA 5CDEA 2BWTA 2BWSA 4JUQA 4IKTA 2GG7A 2EA2A 2BHCA 2P9AA 2Q95A 2P99A 5CDLA 1WLRA 3CB5A 4HXXA 3PEBA 3PKEA 2NQ7A 2BH3A 3IL0A 2GG5A 2HOWA 3L7GA 4IKSA 2OKNA 3Q6DA 1KQ9A 2DFIA 1W2MA 2GZ5A 3OVKA 4FLLA 4R60A 1R58A 2V3XA 4FLIA 4IECA 4U6JA 3RORA 2GU6A 3PKBA 4QR8A 5E2CA 2BWXA 1MATA 4U73A 3IU7A 2V3YA 5D6FA 2GG9A 1Y1NA 1BOAA 2G6PA 1M35A 3QOCA 1WN1A 1XGSA 1BN5A 5FCFA 1PV9A 2BN7A 1R5HA 3MR1A 4U69A 1XNZA 4S01A 1QZYA 3BIPA 5CDVA 1YW8A 2GG3A 1QXWA 4S2RP 2GG2A 4U71A 3IU9A 2IW2A 4KM3A 4MATA 4FKCA 1WL9A 3OOOA 1WL6A 1N51A 2BWYA 1B59A 2GU7A 2Q94A 5JHUA 4FLJA 3D27A 3BIQA 2OAZA 2V6CA 4FO7A 3CB6A 1QXYA 3S6BA 4ZWPA 2BWWA 4IKUA 4EGEA 2GU5A 4U6EA 4IF7A 4FLKA 4IKRA 3BITA 2NQ6A 5JI6A 2GG8A 4A6VA
chains in the Genus database with same CATH topology
2BWUA 3IU8A 2V3ZA 2GA2A 4U6CA 3TB5A 4PV4A 1XGMA 1XGNA 4FUKA 4ZWUA 2GTXA 4U1BA 3PKCA 2BHAA 2BWVA 1WKMA 1YVMA 3MATA 4RZYA 4B28A 1KQ0A 3IG4A 4U75A 5CLSA 2Q96A 3RVAA 1YW9A 3FMQA 4OOKA 2Q93A 3FMRA 1C21A 4PNCA 4RGZ1 1YJ3A 4U76A 5CE6A 3PKAA 1C27A 5E5BA 4S2TP 2EVCA 4IDYA 5D6EA 2B3LA 4Z7MA 4U6ZA 2GGCA 2BHBA 1CHMA 2GGBA 3MX6A 2B3HA 1XGOA 2MATA 3FM3A 1B6AA 2Q8KA 3I7MA 4IU6A 4RZZA 1WBQA 1KP0A 2BB7A 1YW7A 2P98A 1C22A 2ZSGA 1O0XA 2EA4A 4ZNGA 2GG0A 5FCHA 4FO8A 4S00A 2GU4A 2ADUA 1W7VA 2Q92A 3PN9A 1JAWA 1WY2A 4ZWOA 3PKDA 2B3KA 2BHDA 1R5GA 5JFRA 1A16A 3L24A 5CNXA 1C23A 1C24A 4U70A 5CIKA 2EVMA 3CTZA 4U6WA 3TAVA 4IPAA 4A6WA 3O5VA 1QXZA 2EVOA 5CDEA 2BWTA 2BWSA 4JUQA 4IKTA 2GG7A 2EA2A 2BHCA 2P9AA 2Q95A 2P99A 5CDLA 1WLRA 3CB5A 4HXXA 3PEBA 3PKEA 2NQ7A 2BH3A 3IL0A 2GG5A 2HOWA 3L7GA 4IKSA 2OKNA 3Q6DA 1KQ9A 2DFIA 1W2MA 2GZ5A 3OVKA 4FLLA 4R60A 1R58A 2V3XA 4FLIA 4IECA 4U6JA 3RORA 2GU6A 3PKBA 4QR8A 5E2CA 2BWXA 1MATA 4U73A 3IU7A 2V3YA 5D6FA 2GG9A 1Y1NA 1BOAA 2G6PA 1M35A 3QOCA 1WN1A 1XGSA 1BN5A 5FCFA 1PV9A 2BN7A 1R5HA 3MR1A 4U69A 1XNZA 4S01A 1QZYA 3BIPA 5CDVA 1YW8A 2GG3A 1QXWA 4S2RP 2GG2A 4U71A 3IU9A 2IW2A 4KM3A 4MATA 4FKCA 1WL9A 3OOOA 1WL6A 1N51A 2BWYA 1B59A 2GU7A 2Q94A 5JHUA 4FLJA 3D27A 3BIQA 2OAZA 2V6CA 4FO7A 3CB6A 1QXYA 3S6BA 4ZWPA 2BWWA 4IKUA 4EGEA 2GU5A 4U6EA 4IF7A 4FLKA 4IKRA 3BITA 2NQ6A 5JI6A 2GG8A 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  3IU8 A;  2V3Z A;  2GA2 A;  4U6C A;  3TB5 A;  4PV4 A;  1XGM A;  1XGN A;  4FUK A;  4ZWU A;  2GTX A;  4U1B A;  3PKC A;  2BHA A;  2BWV A;  1WKM A;  1YVM A;  3MAT A;  4RZY A;  4B28 A;  1KQ0 A;  3IG4 A;  4U75 A;  5CLS A;  2Q96 A;  3RVA A;  1YW9 A;  3FMQ A;  4OOK A;  2Q93 A;  3FMR A;  1C21 A;  4PNC A;  4RGZ 1;  1YJ3 A;  4U76 A;  5CE6 A;  3PKA A;  1C27 A;  5E5B A;  4S2T P;  2EVC A;  4IDY A;  5D6E A;  2B3L A;  4Z7M A;  4U6Z A;  2GGC A;  2BHB A;  1CHM A;  2GGB A;  3MX6 A;  2B3H A;  1XGO A;  2MAT A;  3FM3 A;  1B6A A;  2Q8K A;  3I7M A;  4IU6 A;  4RZZ A;  1WBQ A;  1KP0 A;  2BB7 A;  1YW7 A;  2P98 A;  1C22 A;  2ZSG A;  1O0X A;  2EA4 A;  4ZNG A;  2GG0 A;  5FCH A;  4FO8 A;  4S00 A;  2GU4 A;  2ADU A;  1W7V A;  2Q92 A;  3PN9 A;  1JAW A;  1WY2 A;  4ZWO A;  3PKD A;  2B3K A;  2BHD A;  1R5G A;  5JFR A;  1A16 A;  3L24 A;  5CNX A;  1C23 A;  1C24 A;  4U70 A;  5CIK A;  2EVM A;  3CTZ A;  4U6W A;  3TAV A;  4IPA A;  4A6W A;  3O5V A;  1QXZ A;  2EVO A;  5CDE A;  2BWT A;  2BWS A;  4JUQ A;  4IKT A;  2GG7 A;  2EA2 A;  2BHC A;  2P9A A;  2Q95 A;  2P99 A;  5CDL A;  1WLR A;  3CB5 A;  4HXX A;  3PEB A;  3PKE A;  2NQ7 A;  2BH3 A;  3IL0 A;  2GG5 A;  2HOW A;  3L7G A;  4IKS A;  2OKN A;  3Q6D A;  1KQ9 A;  2DFI A;  1W2M A;  2GZ5 A;  3OVK A;  4FLL A;  4R60 A;  1R58 A;  2V3X A;  4FLI A;  4IEC A;  4U6J A;  3ROR A;  2GU6 A;  3PKB A;  4QR8 A;  5E2C A;  2BWX A;  1MAT A;  4U73 A;  3IU7 A;  2V3Y A;  5D6F A;  2GG9 A;  1Y1N A;  1BOA A;  2G6P A;  1M35 A;  3QOC A;  1WN1 A;  1XGS A;  1BN5 A;  5FCF A;  1PV9 A;  2BN7 A;  1R5H A;  3MR1 A;  4U69 A;  1XNZ A;  4S01 A;  1QZY A;  3BIP A;  5CDV A;  1YW8 A;  2GG3 A;  1QXW A;  4S2R P;  2GG2 A;  4U71 A;  3IU9 A;  2IW2 A;  4KM3 A;  4MAT A;  4FKC A;  1WL9 A;  3OOO A;  1WL6 A;  1N51 A;  2BWY A;  1B59 A;  2GU7 A;  2Q94 A;  5JHU A;  4FLJ A;  3D27 A;  3BIQ A;  2OAZ A;  2V6C A;  4FO7 A;  3CB6 A;  1QXY A;  3S6B A;  4ZWP A;  2BWW A;  4IKU A;  4EGE A;  2GU5 A;  4U6E A;  4IF7 A;  4FLK A;  4IKR A;  3BIT A;  2NQ6 A;  5JI6 A;  2GG8 A;  4A6V A; 
#chains in the Genus database with same CATH topology
 2BWU A;  3IU8 A;  2V3Z A;  2GA2 A;  4U6C A;  3TB5 A;  4PV4 A;  1XGM A;  1XGN A;  4FUK A;  4ZWU A;  2GTX A;  4U1B A;  3PKC A;  2BHA A;  2BWV A;  1WKM A;  1YVM A;  3MAT A;  4RZY A;  4B28 A;  1KQ0 A;  3IG4 A;  4U75 A;  5CLS A;  2Q96 A;  3RVA A;  1YW9 A;  3FMQ A;  4OOK A;  2Q93 A;  3FMR A;  1C21 A;  4PNC A;  4RGZ 1;  1YJ3 A;  4U76 A;  5CE6 A;  3PKA A;  1C27 A;  5E5B A;  4S2T P;  2EVC A;  4IDY A;  5D6E A;  2B3L A;  4Z7M A;  4U6Z A;  2GGC A;  2BHB A;  1CHM A;  2GGB A;  3MX6 A;  2B3H A;  1XGO A;  2MAT A;  3FM3 A;  1B6A A;  2Q8K A;  3I7M A;  4IU6 A;  4RZZ A;  1WBQ A;  1KP0 A;  2BB7 A;  1YW7 A;  2P98 A;  1C22 A;  2ZSG A;  1O0X A;  2EA4 A;  4ZNG A;  2GG0 A;  5FCH A;  4FO8 A;  4S00 A;  2GU4 A;  2ADU A;  1W7V A;  2Q92 A;  3PN9 A;  1JAW A;  1WY2 A;  4ZWO A;  3PKD A;  2B3K A;  2BHD A;  1R5G A;  5JFR A;  1A16 A;  3L24 A;  5CNX A;  1C23 A;  1C24 A;  4U70 A;  5CIK A;  2EVM A;  3CTZ A;  4U6W A;  3TAV A;  4IPA A;  4A6W A;  3O5V A;  1QXZ A;  2EVO A;  5CDE A;  2BWT A;  2BWS A;  4JUQ A;  4IKT A;  2GG7 A;  2EA2 A;  2BHC A;  2P9A A;  2Q95 A;  2P99 A;  5CDL A;  1WLR A;  3CB5 A;  4HXX A;  3PEB A;  3PKE A;  2NQ7 A;  2BH3 A;  3IL0 A;  2GG5 A;  2HOW A;  3L7G A;  4IKS A;  2OKN A;  3Q6D A;  1KQ9 A;  2DFI A;  1W2M A;  2GZ5 A;  3OVK A;  4FLL A;  4R60 A;  1R58 A;  2V3X A;  4FLI A;  4IEC A;  4U6J A;  3ROR A;  2GU6 A;  3PKB A;  4QR8 A;  5E2C A;  2BWX A;  1MAT A;  4U73 A;  3IU7 A;  2V3Y A;  5D6F A;  2GG9 A;  1Y1N A;  1BOA A;  2G6P A;  1M35 A;  3QOC A;  1WN1 A;  1XGS A;  1BN5 A;  5FCF A;  1PV9 A;  2BN7 A;  1R5H A;  3MR1 A;  4U69 A;  1XNZ A;  4S01 A;  1QZY A;  3BIP A;  5CDV A;  1YW8 A;  2GG3 A;  1QXW A;  4S2R P;  2GG2 A;  4U71 A;  3IU9 A;  2IW2 A;  4KM3 A;  4MAT A;  4FKC A;  1WL9 A;  3OOO A;  1WL6 A;  1N51 A;  2BWY A;  1B59 A;  2GU7 A;  2Q94 A;  5JHU A;  4FLJ A;  3D27 A;  3BIQ A;  2OAZ A;  2V6C A;  4FO7 A;  3CB6 A;  1QXY A;  3S6B A;  4ZWP A;  2BWW A;  4IKU A;  4EGE A;  2GU5 A;  4U6E A;  4IF7 A;  4FLK A;  4IKR A;  3BIT A;  2NQ6 A;  5JI6 A;  2GG8 A;  4A6V A; 
#chains in the Genus database with same CATH homology
 2BWU A;  3IU8 A;  2V3Z A;  2GA2 A;  4U6C A;  3TB5 A;  4PV4 A;  1XGM A;  1XGN A;  4FUK A;  4ZWU A;  2GTX A;  4U1B A;  3PKC A;  2BHA A;  2BWV A;  1WKM A;  1YVM A;  3MAT A;  4RZY A;  4B28 A;  1KQ0 A;  3IG4 A;  4U75 A;  5CLS A;  2Q96 A;  3RVA A;  1YW9 A;  3FMQ A;  4OOK A;  2Q93 A;  3FMR A;  1C21 A;  4PNC A;  4RGZ 1;  1YJ3 A;  4U76 A;  5CE6 A;  3PKA A;  1C27 A;  5E5B A;  4S2T P;  2EVC A;  4IDY A;  5D6E A;  2B3L A;  4Z7M A;  4U6Z A;  2GGC A;  2BHB A;  1CHM A;  2GGB A;  3MX6 A;  2B3H A;  1XGO A;  2MAT A;  3FM3 A;  1B6A A;  2Q8K A;  3I7M A;  4IU6 A;  4RZZ A;  1WBQ A;  1KP0 A;  2BB7 A;  1YW7 A;  2P98 A;  1C22 A;  2ZSG A;  1O0X A;  2EA4 A;  4ZNG A;  2GG0 A;  5FCH A;  4FO8 A;  4S00 A;  2GU4 A;  2ADU A;  1W7V A;  2Q92 A;  3PN9 A;  1JAW A;  1WY2 A;  4ZWO A;  3PKD A;  2B3K A;  2BHD A;  1R5G A;  5JFR A;  1A16 A;  3L24 A;  5CNX A;  1C23 A;  1C24 A;  4U70 A;  5CIK A;  2EVM A;  3CTZ A;  4U6W A;  3TAV A;  4IPA A;  4A6W A;  3O5V A;  1QXZ A;  2EVO A;  5CDE A;  2BWT A;  2BWS A;  4JUQ A;  4IKT A;  2GG7 A;  2EA2 A;  2BHC A;  2P9A A;  2Q95 A;  2P99 A;  5CDL A;  1WLR A;  3CB5 A;  4HXX A;  3PEB A;  3PKE A;  2NQ7 A;  2BH3 A;  3IL0 A;  2GG5 A;  2HOW A;  3L7G A;  4IKS A;  2OKN A;  3Q6D A;  1KQ9 A;  2DFI A;  1W2M A;  2GZ5 A;  3OVK A;  4FLL A;  4R60 A;  1R58 A;  2V3X A;  4FLI A;  4IEC A;  4U6J A;  3ROR A;  2GU6 A;  3PKB A;  4QR8 A;  5E2C A;  2BWX A;  1MAT A;  4U73 A;  3IU7 A;  2V3Y A;  5D6F A;  2GG9 A;  1Y1N A;  1BOA A;  2G6P A;  1M35 A;  3QOC A;  1WN1 A;  1XGS A;  1BN5 A;  5FCF A;  1PV9 A;  2BN7 A;  1R5H A;  3MR1 A;  4U69 A;  1XNZ A;  4S01 A;  1QZY A;  3BIP A;  5CDV A;  1YW8 A;  2GG3 A;  1QXW A;  4S2R P;  2GG2 A;  4U71 A;  3IU9 A;  2IW2 A;  4KM3 A;  4MAT A;  4FKC A;  1WL9 A;  3OOO A;  1WL6 A;  1N51 A;  2BWY A;  1B59 A;  2GU7 A;  2Q94 A;  5JHU A;  4FLJ A;  3D27 A;  3BIQ A;  2OAZ A;  2V6C A;  4FO7 A;  3CB6 A;  1QXY A;  3S6B A;  4ZWP A;  2BWW A;  4IKU A;  4EGE A;  2GU5 A;  4U6E A;  4IF7 A;  4FLK A;  4IKR A;  3BIT A;  2NQ6 A;  5JI6 A;  2GG8 A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...