2V3XA

His243ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3xA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3xA02
2V3XA 2BWTA 1KQ0A 3QOCA 4FO8A 2B3KA 2P99A 4U6JA 2GU7A 4A6VA 1C21A 4R60A 2BWSA 1B59A 2Q95A 3IG4A 5D6EA 4FLIA 1PV9A 3S6BA 3I7MA 2V3ZA 1WLRA 2V3YA 1WKMA 4OOKA 2EVCA 4MATA 2GG9A 4QR8A 3RORA 1QXYA 3CTZA 2B3LA 4S2RP 2GZ5A 3O5VA 1W2MA 2G6PA 1BN5A 1YW9A 4S01A 1QXZA 2GG3A 4U73A 1M35A 3CB6A 5FCHA 1C23A 4IKTA 2BWVA 5E5BA 1WN1A 1C27A 2GTXA 2GGBA 2Q96A 5CE6A 4IKUA 1WBQA 2BB7A 5CDEA 2EA2A 1O0XA 2BHCA 2OKNA 4PV4A 1C22A 1CHMA 3Q6DA 4RZZA 2GG0A 4FLKA 4IF7A 4Z7MA 1QXWA 2P9AA 1B6AA 2GU6A 1XGNA 1YW7A 1JAWA 2GG8A 3IU9A 4IDYA 5JFRA 3MX6A 3TB5A 2Q94A 1R5HA 1C24A 3FMRA 2ADUA 2GU5A 4A6WA 5CDLA 2BHAA 4JUQA 1WL9A 4U75A 1YVMA 2IW2A 3PKAA 4PNCA 1A16A 1W7VA 2GU4A 3PKEA 1N51A 3BITA 4IKSA 3PKDA 3CB5A 5E2CA 4B28A 2GG2A 4U6EA 4FLJA 4IPAA 3BIPA 3OVKA 4IKRA 4IU6A 1Y1NA 3FM3A 4U6CA 1YW8A 2BWYA 1QZYA 2OAZA 4U6WA 3D27A 5CLSA 4FKCA 3TAVA 4HXXA 2EVOA 2HOWA 3PKBA 2NQ6A 5FCFA 1WL6A 2DFIA 2EVMA 1MATA 4U1BA 3RVAA 3MR1A 4FUKA 5JHUA 1KQ9A 5CIKA 2BWWA 4ZNGA 2BWUA 1KP0A 2BWXA 2ZSGA 2P98A 4ZWOA 4EGEA 2BHBA 3L7GA 1XNZA 2MATA 3FMQA 4U70A 2V6CA 2EA4A 1XGMA 1R58A 2BH3A 2GGCA 3L24A 5CDVA 2Q8KA 3PEBA 1R5GA 4U69A 2GG7A 3MATA 2B3HA 3PN9A 1YJ3A 3IU8A 4FO7A 5CNXA 1XGSA 2BN7A 4S2TP 4RGZ1 4S00A 4ZWUA 4KM3A 2GA2A 4RZYA 3PKCA 4FLLA 1XGOA 2Q92A 3IU7A 2NQ7A 4U71A 5JI6A 2Q93A 3BIQA 2GG5A 2BHDA 4IECA 5D6FA 3OOOA 4U76A 1WY2A 3IL0A 4U6ZA 1BOAA 4ZWPA
chains in the Genus database with same CATH superfamily
2V3XA 2BWTA 1KQ0A 3QOCA 4FO8A 2B3KA 2P99A 4U6JA 2GU7A 4A6VA 1C21A 4R60A 2BWSA 1B59A 2Q95A 3IG4A 5D6EA 4FLIA 1PV9A 3S6BA 3I7MA 2V3ZA 1WLRA 2V3YA 1WKMA 4OOKA 2EVCA 4MATA 2GG9A 4QR8A 3RORA 1QXYA 3CTZA 2B3LA 4S2RP 2GZ5A 3O5VA 1W2MA 2G6PA 1BN5A 1YW9A 4S01A 1QXZA 2GG3A 4U73A 1M35A 3CB6A 5FCHA 1C23A 4IKTA 2BWVA 5E5BA 1WN1A 1C27A 2GTXA 2GGBA 2Q96A 5CE6A 4IKUA 1WBQA 2BB7A 5CDEA 2EA2A 1O0XA 2BHCA 2OKNA 4PV4A 1C22A 1CHMA 3Q6DA 4RZZA 2GG0A 4FLKA 4IF7A 4Z7MA 1QXWA 2P9AA 1B6AA 2GU6A 1XGNA 1YW7A 1JAWA 2GG8A 3IU9A 4IDYA 5JFRA 3MX6A 3TB5A 2Q94A 1R5HA 1C24A 3FMRA 2ADUA 2GU5A 4A6WA 5CDLA 2BHAA 4JUQA 1WL9A 4U75A 1YVMA 2IW2A 3PKAA 4PNCA 1A16A 1W7VA 2GU4A 3PKEA 1N51A 3BITA 4IKSA 3PKDA 3CB5A 5E2CA 4B28A 2GG2A 4U6EA 4FLJA 4IPAA 3BIPA 3OVKA 4IKRA 4IU6A 1Y1NA 3FM3A 4U6CA 1YW8A 2BWYA 1QZYA 2OAZA 4U6WA 3D27A 5CLSA 4FKCA 3TAVA 4HXXA 2EVOA 2HOWA 3PKBA 2NQ6A 5FCFA 1WL6A 2DFIA 2EVMA 1MATA 4U1BA 3RVAA 3MR1A 4FUKA 5JHUA 1KQ9A 5CIKA 2BWWA 4ZNGA 2BWUA 1KP0A 2BWXA 2ZSGA 2P98A 4ZWOA 4EGEA 2BHBA 3L7GA 1XNZA 2MATA 3FMQA 4U70A 2V6CA 2EA4A 1XGMA 1R58A 2BH3A 2GGCA 3L24A 5CDVA 2Q8KA 3PEBA 1R5GA 4U69A 2GG7A 3MATA 2B3HA 3PN9A 1YJ3A 3IU8A 4FO7A 5CNXA 1XGSA 2BN7A 4S2TP 4RGZ1 4S00A 4ZWUA 4KM3A 2GA2A 4RZYA 3PKCA 4FLLA 1XGOA 2Q92A 3IU7A 2NQ7A 4U71A 5JI6A 2Q93A 3BIQA 2GG5A 2BHDA 4IECA 5D6FA 3OOOA 4U76A 1WY2A 3IL0A 4U6ZA 1BOAA 4ZWPA
chains in the Genus database with same CATH topology
2V3XA 2BWTA 1KQ0A 3QOCA 4FO8A 2B3KA 2P99A 4U6JA 2GU7A 4A6VA 1C21A 4R60A 2BWSA 1B59A 2Q95A 3IG4A 5D6EA 4FLIA 1PV9A 3S6BA 3I7MA 2V3ZA 1WLRA 2V3YA 1WKMA 4OOKA 2EVCA 4MATA 2GG9A 4QR8A 3RORA 1QXYA 3CTZA 2B3LA 4S2RP 2GZ5A 3O5VA 1W2MA 2G6PA 1BN5A 1YW9A 4S01A 1QXZA 2GG3A 4U73A 1M35A 3CB6A 5FCHA 1C23A 4IKTA 2BWVA 5E5BA 1WN1A 1C27A 2GTXA 2GGBA 2Q96A 5CE6A 4IKUA 1WBQA 2BB7A 5CDEA 2EA2A 1O0XA 2BHCA 2OKNA 4PV4A 1C22A 1CHMA 3Q6DA 4RZZA 2GG0A 4FLKA 4IF7A 4Z7MA 1QXWA 2P9AA 1B6AA 2GU6A 1XGNA 1YW7A 1JAWA 2GG8A 3IU9A 4IDYA 5JFRA 3MX6A 3TB5A 2Q94A 1R5HA 1C24A 3FMRA 2ADUA 2GU5A 4A6WA 5CDLA 2BHAA 4JUQA 1WL9A 4U75A 1YVMA 2IW2A 3PKAA 4PNCA 1A16A 1W7VA 2GU4A 3PKEA 1N51A 3BITA 4IKSA 3PKDA 3CB5A 5E2CA 4B28A 2GG2A 4U6EA 4FLJA 4IPAA 3BIPA 3OVKA 4IKRA 4IU6A 1Y1NA 3FM3A 4U6CA 1YW8A 2BWYA 1QZYA 2OAZA 4U6WA 3D27A 5CLSA 4FKCA 3TAVA 4HXXA 2EVOA 2HOWA 3PKBA 2NQ6A 5FCFA 1WL6A 2DFIA 2EVMA 1MATA 4U1BA 3RVAA 3MR1A 4FUKA 5JHUA 1KQ9A 5CIKA 2BWWA 4ZNGA 2BWUA 1KP0A 2BWXA 2ZSGA 2P98A 4ZWOA 4EGEA 2BHBA 3L7GA 1XNZA 2MATA 3FMQA 4U70A 2V6CA 2EA4A 1XGMA 1R58A 2BH3A 2GGCA 3L24A 5CDVA 2Q8KA 3PEBA 1R5GA 4U69A 2GG7A 3MATA 2B3HA 3PN9A 1YJ3A 3IU8A 4FO7A 5CNXA 1XGSA 2BN7A 4S2TP 4RGZ1 4S00A 4ZWUA 4KM3A 2GA2A 4RZYA 3PKCA 4FLLA 1XGOA 2Q92A 3IU7A 2NQ7A 4U71A 5JI6A 2Q93A 3BIQA 2GG5A 2BHDA 4IECA 5D6FA 3OOOA 4U76A 1WY2A 3IL0A 4U6ZA 1BOAA 4ZWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3X A;  2BWT A;  1KQ0 A;  3QOC A;  4FO8 A;  2B3K A;  2P99 A;  4U6J A;  2GU7 A;  4A6V A;  1C21 A;  4R60 A;  2BWS A;  1B59 A;  2Q95 A;  3IG4 A;  5D6E A;  4FLI A;  1PV9 A;  3S6B A;  3I7M A;  2V3Z A;  1WLR A;  2V3Y A;  1WKM A;  4OOK A;  2EVC A;  4MAT A;  2GG9 A;  4QR8 A;  3ROR A;  1QXY A;  3CTZ A;  2B3L A;  4S2R P;  2GZ5 A;  3O5V A;  1W2M A;  2G6P A;  1BN5 A;  1YW9 A;  4S01 A;  1QXZ A;  2GG3 A;  4U73 A;  1M35 A;  3CB6 A;  5FCH A;  1C23 A;  4IKT A;  2BWV A;  5E5B A;  1WN1 A;  1C27 A;  2GTX A;  2GGB A;  2Q96 A;  5CE6 A;  4IKU A;  1WBQ A;  2BB7 A;  5CDE A;  2EA2 A;  1O0X A;  2BHC A;  2OKN A;  4PV4 A;  1C22 A;  1CHM A;  3Q6D A;  4RZZ A;  2GG0 A;  4FLK A;  4IF7 A;  4Z7M A;  1QXW A;  2P9A A;  1B6A A;  2GU6 A;  1XGN A;  1YW7 A;  1JAW A;  2GG8 A;  3IU9 A;  4IDY A;  5JFR A;  3MX6 A;  3TB5 A;  2Q94 A;  1R5H A;  1C24 A;  3FMR A;  2ADU A;  2GU5 A;  4A6W A;  5CDL A;  2BHA A;  4JUQ A;  1WL9 A;  4U75 A;  1YVM A;  2IW2 A;  3PKA A;  4PNC A;  1A16 A;  1W7V A;  2GU4 A;  3PKE A;  1N51 A;  3BIT A;  4IKS A;  3PKD A;  3CB5 A;  5E2C A;  4B28 A;  2GG2 A;  4U6E A;  4FLJ A;  4IPA A;  3BIP A;  3OVK A;  4IKR A;  4IU6 A;  1Y1N A;  3FM3 A;  4U6C A;  1YW8 A;  2BWY A;  1QZY A;  2OAZ A;  4U6W A;  3D27 A;  5CLS A;  4FKC A;  3TAV A;  4HXX A;  2EVO A;  2HOW A;  3PKB A;  2NQ6 A;  5FCF A;  1WL6 A;  2DFI A;  2EVM A;  1MAT A;  4U1B A;  3RVA A;  3MR1 A;  4FUK A;  5JHU A;  1KQ9 A;  5CIK A;  2BWW A;  4ZNG A;  2BWU A;  1KP0 A;  2BWX A;  2ZSG A;  2P98 A;  4ZWO A;  4EGE A;  2BHB A;  3L7G A;  1XNZ A;  2MAT A;  3FMQ A;  4U70 A;  2V6C A;  2EA4 A;  1XGM A;  1R58 A;  2BH3 A;  2GGC A;  3L24 A;  5CDV A;  2Q8K A;  3PEB A;  1R5G A;  4U69 A;  2GG7 A;  3MAT A;  2B3H A;  3PN9 A;  1YJ3 A;  3IU8 A;  4FO7 A;  5CNX A;  1XGS A;  2BN7 A;  4S2T P;  4RGZ 1;  4S00 A;  4ZWU A;  4KM3 A;  2GA2 A;  4RZY A;  3PKC A;  4FLL A;  1XGO A;  2Q92 A;  3IU7 A;  2NQ7 A;  4U71 A;  5JI6 A;  2Q93 A;  3BIQ A;  2GG5 A;  2BHD A;  4IEC A;  5D6F A;  3OOO A;  4U76 A;  1WY2 A;  3IL0 A;  4U6Z A;  1BOA A;  4ZWP A; 
#chains in the Genus database with same CATH topology
 2V3X A;  2BWT A;  1KQ0 A;  3QOC A;  4FO8 A;  2B3K A;  2P99 A;  4U6J A;  2GU7 A;  4A6V A;  1C21 A;  4R60 A;  2BWS A;  1B59 A;  2Q95 A;  3IG4 A;  5D6E A;  4FLI A;  1PV9 A;  3S6B A;  3I7M A;  2V3Z A;  1WLR A;  2V3Y A;  1WKM A;  4OOK A;  2EVC A;  4MAT A;  2GG9 A;  4QR8 A;  3ROR A;  1QXY A;  3CTZ A;  2B3L A;  4S2R P;  2GZ5 A;  3O5V A;  1W2M A;  2G6P A;  1BN5 A;  1YW9 A;  4S01 A;  1QXZ A;  2GG3 A;  4U73 A;  1M35 A;  3CB6 A;  5FCH A;  1C23 A;  4IKT A;  2BWV A;  5E5B A;  1WN1 A;  1C27 A;  2GTX A;  2GGB A;  2Q96 A;  5CE6 A;  4IKU A;  1WBQ A;  2BB7 A;  5CDE A;  2EA2 A;  1O0X A;  2BHC A;  2OKN A;  4PV4 A;  1C22 A;  1CHM A;  3Q6D A;  4RZZ A;  2GG0 A;  4FLK A;  4IF7 A;  4Z7M A;  1QXW A;  2P9A A;  1B6A A;  2GU6 A;  1XGN A;  1YW7 A;  1JAW A;  2GG8 A;  3IU9 A;  4IDY A;  5JFR A;  3MX6 A;  3TB5 A;  2Q94 A;  1R5H A;  1C24 A;  3FMR A;  2ADU A;  2GU5 A;  4A6W A;  5CDL A;  2BHA A;  4JUQ A;  1WL9 A;  4U75 A;  1YVM A;  2IW2 A;  3PKA A;  4PNC A;  1A16 A;  1W7V A;  2GU4 A;  3PKE A;  1N51 A;  3BIT A;  4IKS A;  3PKD A;  3CB5 A;  5E2C A;  4B28 A;  2GG2 A;  4U6E A;  4FLJ A;  4IPA A;  3BIP A;  3OVK A;  4IKR A;  4IU6 A;  1Y1N A;  3FM3 A;  4U6C A;  1YW8 A;  2BWY A;  1QZY A;  2OAZ A;  4U6W A;  3D27 A;  5CLS A;  4FKC A;  3TAV A;  4HXX A;  2EVO A;  2HOW A;  3PKB A;  2NQ6 A;  5FCF A;  1WL6 A;  2DFI A;  2EVM A;  1MAT A;  4U1B A;  3RVA A;  3MR1 A;  4FUK A;  5JHU A;  1KQ9 A;  5CIK A;  2BWW A;  4ZNG A;  2BWU A;  1KP0 A;  2BWX A;  2ZSG A;  2P98 A;  4ZWO A;  4EGE A;  2BHB A;  3L7G A;  1XNZ A;  2MAT A;  3FMQ A;  4U70 A;  2V6C A;  2EA4 A;  1XGM A;  1R58 A;  2BH3 A;  2GGC A;  3L24 A;  5CDV A;  2Q8K A;  3PEB A;  1R5G A;  4U69 A;  2GG7 A;  3MAT A;  2B3H A;  3PN9 A;  1YJ3 A;  3IU8 A;  4FO7 A;  5CNX A;  1XGS A;  2BN7 A;  4S2T P;  4RGZ 1;  4S00 A;  4ZWU A;  4KM3 A;  2GA2 A;  4RZY A;  3PKC A;  4FLL A;  1XGO A;  2Q92 A;  3IU7 A;  2NQ7 A;  4U71 A;  5JI6 A;  2Q93 A;  3BIQ A;  2GG5 A;  2BHD A;  4IEC A;  5D6F A;  3OOO A;  4U76 A;  1WY2 A;  3IL0 A;  4U6Z A;  1BOA A;  4ZWP A; 
#chains in the Genus database with same CATH homology
 2V3X A;  2BWT A;  1KQ0 A;  3QOC A;  4FO8 A;  2B3K A;  2P99 A;  4U6J A;  2GU7 A;  4A6V A;  1C21 A;  4R60 A;  2BWS A;  1B59 A;  2Q95 A;  3IG4 A;  5D6E A;  4FLI A;  1PV9 A;  3S6B A;  3I7M A;  2V3Z A;  1WLR A;  2V3Y A;  1WKM A;  4OOK A;  2EVC A;  4MAT A;  2GG9 A;  4QR8 A;  3ROR A;  1QXY A;  3CTZ A;  2B3L A;  4S2R P;  2GZ5 A;  3O5V A;  1W2M A;  2G6P A;  1BN5 A;  1YW9 A;  4S01 A;  1QXZ A;  2GG3 A;  4U73 A;  1M35 A;  3CB6 A;  5FCH A;  1C23 A;  4IKT A;  2BWV A;  5E5B A;  1WN1 A;  1C27 A;  2GTX A;  2GGB A;  2Q96 A;  5CE6 A;  4IKU A;  1WBQ A;  2BB7 A;  5CDE A;  2EA2 A;  1O0X A;  2BHC A;  2OKN A;  4PV4 A;  1C22 A;  1CHM A;  3Q6D A;  4RZZ A;  2GG0 A;  4FLK A;  4IF7 A;  4Z7M A;  1QXW A;  2P9A A;  1B6A A;  2GU6 A;  1XGN A;  1YW7 A;  1JAW A;  2GG8 A;  3IU9 A;  4IDY A;  5JFR A;  3MX6 A;  3TB5 A;  2Q94 A;  1R5H A;  1C24 A;  3FMR A;  2ADU A;  2GU5 A;  4A6W A;  5CDL A;  2BHA A;  4JUQ A;  1WL9 A;  4U75 A;  1YVM A;  2IW2 A;  3PKA A;  4PNC A;  1A16 A;  1W7V A;  2GU4 A;  3PKE A;  1N51 A;  3BIT A;  4IKS A;  3PKD A;  3CB5 A;  5E2C A;  4B28 A;  2GG2 A;  4U6E A;  4FLJ A;  4IPA A;  3BIP A;  3OVK A;  4IKR A;  4IU6 A;  1Y1N A;  3FM3 A;  4U6C A;  1YW8 A;  2BWY A;  1QZY A;  2OAZ A;  4U6W A;  3D27 A;  5CLS A;  4FKC A;  3TAV A;  4HXX A;  2EVO A;  2HOW A;  3PKB A;  2NQ6 A;  5FCF A;  1WL6 A;  2DFI A;  2EVM A;  1MAT A;  4U1B A;  3RVA A;  3MR1 A;  4FUK A;  5JHU A;  1KQ9 A;  5CIK A;  2BWW A;  4ZNG A;  2BWU A;  1KP0 A;  2BWX A;  2ZSG A;  2P98 A;  4ZWO A;  4EGE A;  2BHB A;  3L7G A;  1XNZ A;  2MAT A;  3FMQ A;  4U70 A;  2V6C A;  2EA4 A;  1XGM A;  1R58 A;  2BH3 A;  2GGC A;  3L24 A;  5CDV A;  2Q8K A;  3PEB A;  1R5G A;  4U69 A;  2GG7 A;  3MAT A;  2B3H A;  3PN9 A;  1YJ3 A;  3IU8 A;  4FO7 A;  5CNX A;  1XGS A;  2BN7 A;  4S2T P;  4RGZ 1;  4S00 A;  4ZWU A;  4KM3 A;  2GA2 A;  4RZY A;  3PKC A;  4FLL A;  1XGO A;  2Q92 A;  3IU7 A;  2NQ7 A;  4U71 A;  5JI6 A;  2Q93 A;  3BIQ A;  2GG5 A;  2BHD A;  4IEC A;  5D6F A;  3OOO A;  4U76 A;  1WY2 A;  3IL0 A;  4U6Z A;  1BOA A;  4ZWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...