2V3XA

His243ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 159
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3xA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3xA02
3CTZA 2OKNA 1BOAA 4JUQA 3IL0A 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 3QOCA 1QXWA 3RORA 4FKCA 5CNXA 5E5BA 4U6EA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1W7VA 3CB6A 1BN5A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1A16A 1XNZA 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 5CDEA 1KP0A 3BIPA 4FLJA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 3OVKA 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 5FCHA 3MATA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 3OOOA 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 3PN9A 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 2BWUA 5E2CA 1XGNA 4IDYA 2Q8KA 2V3YA 1WBQA 1MATA 4RGZ1 2B3LA 2BB7A 3I7MA 1YVMA 2B3HA 2P9AA 3IU9A 3PKDA 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3O5VA 3PKCA 2EVCA 1KQ9A 3RVAA 2GG9A 2GG3A 2BWTA 2V3ZA 4EGEA 1C21A 2BHDA 1R5GA 3MR1A 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 3L7GA 1C27A 1QZYA 3PEBA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH superfamily
3CTZA 2OKNA 1BOAA 4JUQA 3IL0A 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 3QOCA 1QXWA 3RORA 4FKCA 5CNXA 5E5BA 4U6EA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1W7VA 3CB6A 1BN5A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1A16A 1XNZA 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 5CDEA 1KP0A 3BIPA 4FLJA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 3OVKA 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 5FCHA 3MATA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 3OOOA 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 3PN9A 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 2BWUA 5E2CA 1XGNA 4IDYA 2Q8KA 2V3YA 1WBQA 1MATA 4RGZ1 2B3LA 2BB7A 3I7MA 1YVMA 2B3HA 2P9AA 3IU9A 3PKDA 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3O5VA 3PKCA 2EVCA 1KQ9A 3RVAA 2GG9A 2GG3A 2BWTA 2V3ZA 4EGEA 1C21A 2BHDA 1R5GA 3MR1A 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 3L7GA 1C27A 1QZYA 3PEBA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH topology
3CTZA 2OKNA 1BOAA 4JUQA 3IL0A 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 3QOCA 1QXWA 3RORA 4FKCA 5CNXA 5E5BA 4U6EA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1W7VA 3CB6A 1BN5A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1A16A 1XNZA 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 5CDEA 1KP0A 3BIPA 4FLJA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 3OVKA 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 5FCHA 3MATA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 3OOOA 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 3PN9A 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 2BWUA 5E2CA 1XGNA 4IDYA 2Q8KA 2V3YA 1WBQA 1MATA 4RGZ1 2B3LA 2BB7A 3I7MA 1YVMA 2B3HA 2P9AA 3IU9A 3PKDA 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3O5VA 3PKCA 2EVCA 1KQ9A 3RVAA 2GG9A 2GG3A 2BWTA 2V3ZA 4EGEA 1C21A 2BHDA 1R5GA 3MR1A 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 3L7GA 1C27A 1QZYA 3PEBA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTZ A;  2OKN A;  1BOA A;  4JUQ A;  3IL0 A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  3QOC A;  1QXW A;  3ROR A;  4FKC A;  5CNX A;  5E5B A;  4U6E A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1W7V A;  3CB6 A;  1BN5 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1A16 A;  1XNZ A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  5CDE A;  1KP0 A;  3BIP A;  4FLJ A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  3OVK A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  5FCH A;  3MAT A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  3OOO A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  3PN9 A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  2BWU A;  5E2C A;  1XGN A;  4IDY A;  2Q8K A;  2V3Y A;  1WBQ A;  1MAT A;  4RGZ 1;  2B3L A;  2BB7 A;  3I7M A;  1YVM A;  2B3H A;  2P9A A;  3IU9 A;  3PKD A;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3O5V A;  3PKC A;  2EVC A;  1KQ9 A;  3RVA A;  2GG9 A;  2GG3 A;  2BWT A;  2V3Z A;  4EGE A;  1C21 A;  2BHD A;  1R5G A;  3MR1 A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  3L7G A;  1C27 A;  1QZY A;  3PEB A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
#chains in the Genus database with same CATH topology
 3CTZ A;  2OKN A;  1BOA A;  4JUQ A;  3IL0 A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  3QOC A;  1QXW A;  3ROR A;  4FKC A;  5CNX A;  5E5B A;  4U6E A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1W7V A;  3CB6 A;  1BN5 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1A16 A;  1XNZ A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  5CDE A;  1KP0 A;  3BIP A;  4FLJ A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  3OVK A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  5FCH A;  3MAT A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  3OOO A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  3PN9 A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  2BWU A;  5E2C A;  1XGN A;  4IDY A;  2Q8K A;  2V3Y A;  1WBQ A;  1MAT A;  4RGZ 1;  2B3L A;  2BB7 A;  3I7M A;  1YVM A;  2B3H A;  2P9A A;  3IU9 A;  3PKD A;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3O5V A;  3PKC A;  2EVC A;  1KQ9 A;  3RVA A;  2GG9 A;  2GG3 A;  2BWT A;  2V3Z A;  4EGE A;  1C21 A;  2BHD A;  1R5G A;  3MR1 A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  3L7G A;  1C27 A;  1QZY A;  3PEB A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
#chains in the Genus database with same CATH homology
 3CTZ A;  2OKN A;  1BOA A;  4JUQ A;  3IL0 A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  3QOC A;  1QXW A;  3ROR A;  4FKC A;  5CNX A;  5E5B A;  4U6E A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1W7V A;  3CB6 A;  1BN5 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1A16 A;  1XNZ A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  5CDE A;  1KP0 A;  3BIP A;  4FLJ A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  3OVK A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  5FCH A;  3MAT A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  3OOO A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  3PN9 A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  2BWU A;  5E2C A;  1XGN A;  4IDY A;  2Q8K A;  2V3Y A;  1WBQ A;  1MAT A;  4RGZ 1;  2B3L A;  2BB7 A;  3I7M A;  1YVM A;  2B3H A;  2P9A A;  3IU9 A;  3PKD A;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3O5V A;  3PKC A;  2EVC A;  1KQ9 A;  3RVA A;  2GG9 A;  2GG3 A;  2BWT A;  2V3Z A;  4EGE A;  1C21 A;  2BHD A;  1R5G A;  3MR1 A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  3L7G A;  1C27 A;  1QZY A;  3PEB A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...