2V4DA

Re-refinement of mexa adaptor protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
b'NTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIDRUG RESISTANCE PROTEIN MEXA
molecule tags Membrane protein
source organism Pseudomonas aeruginosa
publication title The Assembled Structure of a Complete Tripartite Bacterial Multidrug Efflux Pump.
pubmed doi rcsb
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2v4dA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v4dA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2v4dA02
2JEBI 3BG3A 4IQZA 1OXVA 3WDNA 2KCCA 3D4RA 3QJYA 1V43A 1H9KA 3LNNA 1H9JA 2BE5C 2K33A 3PV0A 4OO1G 1H9SA 4H13C 1HCZA 4TQUS 2E76C 1DD2A 3OPOA 1H9SB 2EJGC 2A68C 3A7AB 3VR4A 1E2ZA 3T56B 1K8MA 1GJXA 2JXMB 3WB2A 2Q8IB 5JJNB 4BA1I 3QIAA 5D5QA 4LJZC 3PUZA 4KKUA 1DCZA 4G7ZC 1OXSC 2LMCB 1GHJA 3FMCA 1E2VA 1O7LA 1K8OA 1Q12A 3QG1A 1T5EA 3VR6A 1YNNC 2EVBA 1FYCA 2A69D 2NN6G 4XTCS 1YNJC 4DNTB 3PUWA 4H44C 1IW7C 1CTMA 3PUXA 3VA7A 4DNRB 4KKTA 1VF5C 2BDOA 2EJFC 2K32A 5K36H 1Y8OB 3WB1A 3IFTA 1OXUA 1VCIA 1Z6HA 2DNEA 1IW7D 2K7VA 1V8QA 1ONLA 2EDGA 4KI0A 3ND9A 4TKOB 2D5DA 3BRCA 1B9MA 2EJMA 5C0XH 3MFYA 4H0LC 1O78A 3I4LA 2F1MA 3GQBA 3PUVA 1GHKA 3CRKC 3A7LA 3VR2A 1OXXK 1PMRA 1LABA 2YYZA 3TZUA 5BN5A 1Z7TA 1RSOA 2V4DA 2NN6H 1CFMA 2B8GA 2BE5D 2JEAI 2A6HD 3IKJA 1Q1EA 4KHZA 2F93B 2IT1A 5KNBA 1FR3A 4KKSA 5K36G 2E74C 3HGBA 3P20A 3A8IE 1SMYC 3I73A 1GUNA 3U9SA 2A69C 3H94A 3EQLC 3M85A 2A6ED 2QF7A 2CW0C 4OGQC 4PV1C 1Y69U 2E75C 2O5IC 2AUJD 3AB9A 4IFDH 2PPBC 5KNCA 1EWHA 3MXUA 4LK1C 3T53B 3D31A 2PNRC 5D5PA 3T51B 3ND8A 2DN8A 3SE0A 1OXTA 5JJJB 1GUSA 3W3AA 5C0XG 4JBWA 2A68D 3VR5A 4G7OC 2L5TA 3SDZA 4DK0A 1Y8NB 2PCFB 4DK1A 4HR7B 1H9RA 4KMUC 2D2CC 3CRLC 1CI3M 1VF7A 5BN4A 1VDZA 4KN7C 1GUGA 2KA7A 2A6EC 2A6HC 1IYVA 2BA1A 5JEAH 5BN3A 2JE6I 2D62A 4IFDG 2DNCA 3L7ZC 4KN4C 4JK1C 4L8JA 2B8FA 3OW7A 1TKWB 3N6RA 3VR3A 2AUKA 3LWUA 2AWOA 3A8JE 4G7HC 4BA2I 1G291 1Q90A 3M4YA 5JJEB 1E2WA 4OO1H 2O5JC 1H2SB 1GUOA 2NN6I 3I72A 1Y8PB 4GYCB 4XIGS 3A8KE 3WB0A 1Q1BA 1ZYRC 3KLRA 1ZKOA 3RLFA 3NE5B 1B9NA 1GUTA 3OOCA 1TU2B 3BDOA 4GZYC 1I6VC 2ZT9C 1DXMA 3DXJC 5KNDA 3FPPA 5A35A 4I7ZC 1H9MA 1IYUA 3PUYA 1A6XA 4RCNA 1HQMC 5JEAG 2F95B 1HTPA 2BA0A 2R6GA 3GD7A 1QJOA 1HPCA 1LACA 1BDOA 3M7NA
chains in the Genus database with same CATH superfamily
1DDGA 1UNSA 5DNFA 5KIXA 3KZIZ 4MVMA 4B47A 2M9VA 4PNYA 4TSSA 2EYPA 3B2EE 1IXMA 4YAWA 5CA1A 4JGSA 3EVQA 4V0BA 1UD4A 3L70H 3E2EA 1STEA 4K5XA 1QGYA 2HUGA 4J9ZB 4R50A 2UUAB 1Q3LA 3QE2A 3HOWG 4FLUA 2F0EA 2Y69C 3MTSA 4GLVB 2ZIMA 1E2ZA 1BBXC 3THOA 4NXNO 1AIPA 1U4PA 4KY7A 4QJFB 1N34O 1NBWA 1A3TA 1TIID 4DR1L 3QIAA 3X3NA 2LGQA 4ODGA 4OXPA 1SR3A 1XMOL 1B06A 1DCZA 1NQTA 3I4NG 3SEJA 4FLXA 4JAAA 1WJJA 2ZXHA 1CXZB 1NNXA 1UAPA 1PZJD 3SK5A 3CRZA 3W2DA 3G71V 4ZKBB 4Z9CB 2LXKA 2A19A 3H9NA 1I94Q 4DNRB 2IW5A 4R6ZA 4DU9A 1RQRA 2BF4A 2LZJA 3BY2A 4JI2L 1LT4D 1VQPB 4NP5A 2JDIG 3JARA 1HZAA 4X66B 3A0RA 4JI3O 2IWHA 3OFNG 1H8EG 4JYCA 2FMCA 4PHZA 5D3DA 1NBMA 3UKMA 3AK2A 2KQXA 4DV5O 3QFTA 2WZPP 2VZAA 3T1HL 1SC5B 2QWOB 4IPDA 3QTCA 3T16A 1PM9A 2DN9A 1N0VC 4MYTA 4O1NA 1ET9A 2ETNA 4Z4UA 3STBC 1NU1H 1G7RA 3J7YW 4N3NA 3KJPA 2CC2A 1UD6A 1SYGA 2NN6H 1K8GA 4CKEA 3ZUGA 1K8AW 1B2TA 5FLXL 4NB5A 4I55B 4PA6A 2WLKA 1E7ZA 1PJ6A 2BE5D 4DYLA 1VQFA 3IKJA 3K5NA 4HSVA 3CRQA 4DKAC 1EL0A 3N2KB 4MN3A 3E8BA 5C4XH 1GM5A 1WPBA 5JQGA 1F20A 4K2KA 2CK3G 2F03A 4AQYQ 1AILA 3AG3C 4G7XA 1VQKV 1K7DA 3H94A 4X7EA 3I73A 4CH6A 4GKKB 5IGEA 4ZI7B 4A3EG 5KMGB 2AZ0A 3Q8DA 2FB5A 5GONB 4M1UB 1SRYA 2PMZB 4K8JA 3U10A 3BAAA 1VHEA 1HVXA 4C3HG 2E2JH 5IE9A 1B3AA 4DV5Q 3PUMA 3SJQC 4N23A 4BBSB 1SQGA 1FNBA 2I5LX 1I18A 2MO0A 3LNMB 5IYZA 5D14A 2VYQA 1WP8A 2UU9B 3FKIB 4MZ9A 3S9WA 1M90D 2JK8A 3SDZA 2ZJRA 3OGCC 2HMAA 1SKVA 1XL4A 3DM1A 4PA9A 4X9QA 2CWPA 1ZM9A 3CP0A 4DV4O 4ZHQB 4RD2A 2ZTEA 3K8AA 4MIUA 4EVOA 2B63G 4Q7JB 4ULLA 3E22A 1KB9F 4LFCO 4C3IB 1B3QA 5D3IB 4IFDG 4A3CH 3VYRA 3CD6V 4U9UA 4ASUG 1ZM2A 4IPHA 1SA0B 5FIUA 1K8AD 3S1QH 3FB6C 1FXKA 4AVZA 1K0RA 4DNIA 4DV7L 3RLOA 1N34Q 1EZJA 1XOUA 2E5LB 1XNQO 3BDCA 3KBGA 4A3IG 2ZR2A 1HXYD 5L3BA 1I50H 1OZ0A 1K83B 2QGGA 5JH7A 3GP7A 1HR0O 1SAPA 4DV1O 1G2SA 1JJCB 2HJFC 1MHWC 4I7ZC 4JI5Q 1V54B 3ABMB 1QG0A 1HDJA 4G6IA 2RCVA 1AW7A 1DOMA 1CP9A 3URYA 1SESA 1LACA 3D8GA 4LFAO 2DCUA 1VMPA 5IYCG 3L75H 1HR0W 1BX0A 3P26A 1KNEA 3GTMB 1KRHA 1ASZA 4KHPL 4O4IB 1M90W 3JD0A 5H6RA 1XNRB 5LHGA 3AG3B 3K0YA 3PO2B 3VNVA 1UEAB 4NMZA 2EJGC 2YUAA 2BOCC 1DARA 4TMTA 2CW0D 3A7AB 4JI8L 3DXRA 4XORA 3I4OA 3I1FA 4P9PA 2FHTA 1YI2A 5L46A 4BBSG 1TWAB 2WSSG 1SETA 1WCMH 1EP3B 4C3HB 4JYAQ 2X6CA 2ZD9A 3H1LH 5EK0A 4OP7A 3BZCA 2ZM6B 2W0FC 2IX3A 5JH7B 4CC6A 3VR6A 2WLIA 1F60A 2K6AA 2NTTA 1VQIA 1OCCB 4IUTA 4JYAB 1N32O 2RVLA 2JA5B 1ROPA 4LFCL 3GVKA 3N2GA 3UQ8A 2FFKB 4BS9A 4LF8O 1TS4A 2K04A 4XQQA 1YEWA 1Y1VH 4AIMA 3VA7A 1BCPD 4A3JH 4Z4SA 1VF5C 1IKLA 3TP7A 1BZKA 3JD1A 5FL7G 4Z1VA 4UXNA 3KOJA 2Q6OA 3ULPA 1JORA 1KJZA 3RN2A 1Q6HA 3FPUB 1ONLA 3APOA 1H85A 2B63B 1W9XA 4KI0A 1U2RA 1E3XA 3CW2A 3RZDH 4QUZA 4P12A 1H2MA 2EIJC 4AYBG 4ZUJA 4LBWA 4NXNL 5IODA 4Y9RA 5J35A 1EM1A 3JC66 2DE0X 2X0LA 2IHEA 3PUVA 2AHOA 4IUNA 1X59A 1G6UA 2VQFB 1PMRA 5LMUO 2YYZA 1Y1WG 1PTOC 1FL0A 1UE5A 3CCJA 1HA6A 5JVDB 1M4UA 1S5DD 2LQTA 1Q81W 2KUMA 2LW1A 1E1RG 2XEXA 2QTOA 1OO9B 3CCLB 4KHZA 5KNBA 1AH9A 3NBHA 1O9GA 1RCVD 1IL2A 5JOBA 3Q23A 4DR3Q 1JWSD 4JBMA 4CQJA 3LX0A 1F23A 5NUCA 3M7GA 3C46A 3UE0A 5E4WC 3NXSA 3EQLC 4QCLA 2GDSA 2YS8A 4RO2A 2VQEO 1CSQA 4DAYB 4R8IA 1SEBD 2O5IC 5JQGB 2XNDA 3F2BA 1PZKD 2GK6A 2M6YA 3BYTB 1J5EQ 2RDCA 4JZGA 2DOGA 5G3LF 5EBWC 2IJ0A 2OTJB 1STGA 1S5JA 4DV5L 1XXGA 4DAMA 1MG1A 1SQPH 1PH6A 5J2TA 2BH8A 1VQ6A 3CRMA 4GKKO 4OOSA 4I65A 4GNXC 2SEBD 1T9HA 3T1YL 4A3MB 3S1NB 1X3FA 2EXDA 2XWBB 1YLOA 3SPCA 4B3TO 4X1YB 4AILC 4HR7B 2PCFB 1I7FA 3CCJV 3CRLC 1R6NA 4WF9V 1YHQV 4XBFA 1L8DA 2D2CB 5LGUA 4I4TA 4FXUA 5ELEA 3TXSA 5FO7B 3J80i 2H4OA 4A3FB 3HOVH 3J7AF 2E2IB 4IHJA 4OOVA 3A3BA 3I70A 1C48A 4B7KA 5LBQA 1ESRA 5BN3A 1VQPA 4YY3Q 5H6QA 1JOKA 1KNAA 2AWNA 3L7ZC 1HNXQ 3VDYA 2CH7A 3QO8A 3CKIB 1QZHA 4FF4A 2E74B 4ZHQA 5IYZB 4DV0O 4Z1MG 4DV5B 2AHOB 2RQXA 3SYQA 4DW1A 5B66Z 4ZRZA 2Z0SA 2HHHL 4U673 4B3RQ 3W5OA 2N78A 3KCXA 1X56A 2XRQD 3B78A 2K4KA 4O2BB 1N34L 1R3LC 2L9HA 1ZYRC 2C4TA 1C8CA 5M5XB 3KEWA 2FYUH 4FLTA 3KLWA 3AG2C 1GM7A 1RPRA 1STAA 5FLXE 2VNJA 1L0XB 3MHBA 3U4VA 4R1JA 5F2VO 3E83A 4KHPO 1PFMA 4H02A 3N2GB 4TOIA 5J2TB 3LNNA 1KDCA 2CKZB 4CHTB 5LMUB 1UMKA 3M7NA 2F0NA 2M7WA 4HTHA 1OXVA 4DN4M 5IY5C 4G57A 4I0XB 5EPKA 1N0JA 1IL8A 5L37A 4JI4Q 1N36Q 1K97A 4Y7NB 1E3PA 2RQ6A 2VUMG 1NKDA 3JSNA 4TV8B 1UD5A 1XTDA 4X88A 1N32L 2H3OA 3QO5A 1W6JA 1IBMB 2B2UA 3CF5A 2K50A 4DV2Q 2ICIA 4DR5L 1EIYB 4I9WA 5D65A 3FDTA 1TUBB 1XYIA 3OEEG 4II2A 2NR5A 3DC6A 1X55A 1BNZA 4A3LH 4FXGC 1LNQA 3SR2C 1IBKB 1PJ7A 2KG7A 5DECA 4LJZC 1WTRA 2SDFA 1NZ6A 3SXHA 2P4KA 3LWEA 2EX3A 1FVIA 1F4MA 4WJWA 2QA4B 3TS0A 2YICA 4ZIBA 1XMOQ 2UXCL 3K59A 2X3UA 5A8AA 4F4LA 2N8NA 2XGJA 4XTCS 2OT5A 3J81j 3A2FA 4LF5L 1XMQQ 4JYYA 1WPXA 2XASA 5BR8B 3UT5A 2X6WA 2KCTA 3RLNA 1NVPD 2V7TA 2NVQB 5HGQA 4WZTA 4Q5VA 3QFRA 3J81N 2HCIA 3FYEB 1BCPF 3E35A 1JA1A 2JIZA 1TAEA 1UE6A 1V8QA 1IDSA 1EZ8A 3CPWU 1F9SA 2NVTB 1DZ1A 2R7ZG 2K75A 4KHPQ 1O78A 1G6PA 2N04A 2R92H 3L2PA 4WFFA 2NZ1D 4X65O 2OQKA 4A93G 2RCFA 1E63A 4K5VA 1I4QA 1RSOA 2RSNA 3S2HH 4ILWA 5C8YB 4IUUA 1VQ4B 2Y0IA 2YSUB 4XKVA 1GKFA 5K36H 1TS2A 4GNXA 1PTOB 2A06H 2LO1A 4B3RO 1F2YA 2QEXA 1HR0B 3BHPA 3B40A 3CRRA 3JARB 1N33O 5EBMC 3FJOA 1EU4A 1TWFB 2PQAB 3WBKA 5C4JB 2BH2A 3HOWB 4K0KQ 2ZINA 3KF8B 3MHHC 3G71A 4BY7B 5FNVA 2V7WA 4A3BH 1OTCA 1VF6C 4UCVA 4P71A 4WJ3M 4IZ8A 1RM1B 1GN2A 2RHSB 2GUZA 3EIVA 5IYBG 4DO2A 4OPHA 3UT5B 3G6BA 2DYSB 2ZJPA 1RD9D 1AZQA 3TP8A 3MXPA 4DK6C 1IX9A 4LUVA 3I5DA 5EPLA 4MSWC 2ZM6Q 4B3TQ 4JC0A 5C44B 4H13C 3SK4A 4A3GB 1GM9A 5LP6C 5J2UB 1SJHD 4A3GG 3RVYA 5EJWA 2WZNA 2EZPA 3D3QA 1FXKB 3A55A 3HOYG 3CD6B 4JASA 1NB9A 1ASYA 4A3BG 2A6HC 4JW0A 4JI7Q 4ZUIA 1FNVA 1PH8A 3ZBHA 5HXBA 3G80A 1YJ9B 1LTBD 1LTGD 3CC2A 2Z1CA 3AVYA 4KN4C 1YNND 2R72A 1ICWA 2FMLA 5CV6A 1KLGD 3DEOA 3NSWA 4X3UA 1I94L 3F1ZA 3CCMA 3PO2G 2Y0SE 3JCZA 1BVSA 2N49A 3CCEV 2FXQA 3U0ZA 2WLJA 4X1YA 4UZEA 1HZ9A 4B7EA 2EYJA 5C8YA 2ZDIA 3CCVB 1VQ8A 2CVRA 3GTGH 3D0FA 2A73B 1M90C 1FNCA 3KLRA 3QSYA 1IZ6A 3ZEDA 3OFNA 3DC5A 2RHQB 5ELOA 1V1QA 1HR0L 4LNQA 1VQLV 2PYKA 4RG1A 1GN3A 2X53S 3CQZH 4JOIC 5IYRA 1OB5A 4RA8A 3JAWB 2F3IA 4G5GA 1M8AA 3IL8A 4PDMA 1BPLA 2QF7A 4OL7A 4NTXA 2DGYA 2JVDA 4FO2A 2E5LQ 2R9AA 2NPFA 2AQ2B 3KK7A 3AEIA 4IT5A 1CNFA 1QNUA 2K33A 1K4CC 1HZEA 1EP2B 4RCYA 4WQMA 1KAAA 3PV0A 5J39A 1Y0RA 1H9SA 3JAML 3IGAC 1V1PB 2JDIA 1N08A 1XL6A 4Y7NH 4JV5Q 4RPBA 4B44A 1KQSB 4YIPA 4L5TA 4PZ7A 2JA8G 3JATA 3HKEA 5IGGA 3CCEA 1JR0D 4QUFA 3T4ZA 4KK7A 3TCUA 1XMQL 1MJEA 4BY1H 4PGOA 4D7SA 4MVRA 1RM1C 1XMOB 4X20B 3N2KA 4YJ2A 1BMFA 1Y74B 1IXRA 1M1KD 2NTSA 4ZOLB 1IURA 1HH2P 2BCCH 3ZIAA 1YX2A 4G2KA 4OONA 3ZC3A 4KY5A 2PI2A 3OW2U 2OYQA 4B3TL 1QHTA 3K7UC 2NVQH 1K0SA 1VLOA 2F0VA 4X64B 4IOAA 4Z4RA 5J3OA 5JJZA 3ZBTA 4XDLA 1IBLQ 1C7YA 1TWHH 3X3MA 3A54A 4H44C 2ZITA 3K9SA 4DV2B 1JJ2U 4CS4A 1FD9A 3AVTA 3PUXA 1SJED 1YIJA 3JAMN 2EY1A 2D9RA 2CBXA 1DOKA 1EUJA 2F0LA 3SEBA 4DV0L 1Z6HA 2EJRA 4OPSA 3WNCA 3G4SA 5KX5B 4L5SA 1AVMA 3BABA 3ASOB 3PUNA 1MBYA 2EDGA 2B2TA 2V7XA 1WJZA 3TZDA 5CB4A 4ASUA 3ZIAG 1WSVA 2NB0A 4QY7A 4A3MG 2H5XA 2UXXA 3CQZB 2B9ZA 5KNLA 4UFZA 2XVSA 2AZ2A 1VMGA 1HNZB 3OYYA 1WYDA 4DV2L 3HKCA 4ICGA 4HCEA 1D5NA 5LMUL 3AG1C 2PW7A 2KVOA 4OPAA 1YDXA 2V31A 3S1NH 1FYJA 1TY2A 2XZOA 1FR3A 2HT1A 1V5VA 4TMVA 3VOUA 2QN6A 3DDYA 4RFBA 5FJ8H 1XNQQ 2E74C 1GJRA 2CHBD 3H0GH 3HGBA 2F4VB 3W7XA 1PRTF 2MHVA 1HNXO 5C5LA 3FHWA 4B3SQ 1ZWIC 3ABKB 4IUPA 4MTOA 1YJNV 4N8FA 4OHJA 4OGQC 5EKKA 4LF8L 4RAUC 4H7BA 4PV1B 4UB6Z 4ZGQB 1YJNA 4M1KA 4GNXB 4GLAC 3I4MB 4P6YA 2O57A 5FA6A 1X3PA 4LF4B 1YJNB 2VNHA 1ZEQX 5EKLA 1RFYA 5IGFA 3UDFA 5I9PA 4A3IB 3QO2A 4DXGA 1S72A 3UDIA 3T51B 2JA7G 1RKNA 1BQZA 1W3SA 3M4QA 4K1XA 1NRKA 5LA6A 1K73D 3J80L 4QGUA 4ZCIA 1U96A 1E1QG 2PLFA 4U3JB 4FNFA 4LF9L 3ZX6A 1TWHB 3F5WC 2D9UA 4HJ8A 1EYDA 5B1OA 3QOJA 2Z9HA 3MXGA 2R70A 5HURA 4H13B 1G2TA 5BSXA 1TS3A 1TGOA 3B8MA 4JI7L 3AEVA 1VMCA 3AK1A 4UCUA 4LFAL 4A3DH 2B2TC 1QVGB 3ZMSA 2KB1A 2VZLA 2BSAA 1N07A 1A62A 2A7WA 1EZVH 3CXCA 1PTOH 5COYA 2QGQA 1Y1VB 4A3JB 4GLXA 1QE6A 3GV3A 4GYCB 4R9WA 4XIGS 2IY5B 3P3PA 4J10A 1Q1BA 5IYNA 5ELBA 4WWVA 3NE5B 3GTQB 2CWAA 3OOCA 1UD2A 3ZRWA 2K5QA 4L87A 2QKSA 4AC9A 3FB8C 1AN8A 3RY8A 1BQEA 3Q3AA 4TQDA 1G7SA 2EYHA 1QVCA 4I4TB 1SSOA 3P7JA 4RKLA 5BR8L 2F95B 3A5UA 4HE5A 1TWAH 4K6LA 1NMGA 2JEBI 4H44B 3K7AB 4IUVA 1JQYD 2BGJA 4UUJC 3J7AU 3I8ZA 5ITZA 3BYYB 2ASBA 5F2DA 4JV5L 2KOLA 5IT9E 4X7FA 1HCZA 2IU0A 4CKCA 2IHFA 4LNUB 1XI1A 4NXML 2GVAA 5A2QN 3RGBA 3CCRB 4JI4B 1TY0A 2XSCA 3X2QB 1KP3A 2ES2A 1X32A 1G51A 4LW1A 1EP1B 1QOHA 1X4TA 1E79G 2HG5C 2F23A 4MTFA 1NE3A 2NZOA 4X66L 2HVKC 3MFGA 4XNFA 3JQQA 4AQYL 4IPGA 3FB5C 1PV4A 3K0XA 1OGIA 1W87A 3LUTB 1X3QA 1QUQA 2VB3X 4G1BA 3AG7A 1FFTB 4JOIA 3JALB 1QFZA 4X65L 3V7AA 1HNZQ 3ONAB 4OX9L 2Q2IA 5BY1A 1FYCA 5KGUA 1QBZA 2LY7A 2JA7B 3OTOB 2UUCB 4YAUA 4MYUA 1IW7C 3NEMA 3OEHA 1N8RW 1UWVA 4OX9O 2EJFC 2VBSA 4U68A 2ZDIC 3CXCU 2LS01 2DW4A 4IYHA 1A63A 1I4PA 2HVJC 1VQ8B 3BU2A 1JE4A 2CH4A 4IOCA 2XAQA 1AR1B 2QTZA 4FLZA 2JJ2G 2IX0A 4RHRA 4DR3L 4JI0B 1N36B 1B9MA 4DQKA 1PYSB 2EJMA 3U11A 2MQHA 2X6LA 4BY7H 3TXQA 3KUPA 3HOWH 2QTLA 1GHKA 4FZ1A 4X65B 3H09A 2PUSA 1AE2A 1VARA 1YNXA 2DY7A 2X69A 3HG9A 5B1BC 3ZHSA 2V4DA 1H2GA 2EIXA 2XZPA 3CCRA 3PF4A 4F6RB 1E1QA 2B5OA 2IW3A 2QKAA 2F0MA 3E6ZX 3FKIH 4EQOA 4JI6L 4DW0A 1S0VA 4AH6A 1R6KA 1AI5A 2NVXB 2K9PA 5IP9H 4D6TH 4P22A 4JI4L 2Z5UA 3EA6A 1SMYC 1GUNA 4EQ5A 2UXBB 1RPOA 4FP5D 4PELA 3AG1B 2A6ED 5LMZA 1Z2GA 4HYOA 3QFCA 4FFBA 3RYCA 2AMCB 5IK2A 2PZWA 5DN6G 1M57B 2C2WA 3V05A 4A93B 3H1IH 4UZFA 1WOOA 5KNCA 1VQOV 2BSKA 1BL8A 3AGPA 1ZLZA 1XILA 1F4NA 3CC7B 4X20A 4DR5Q 4BAYA 5CA3A 2PNRC 4C3JB 2ZTNA 1WP7A 1P4RA 4X1KB 1EFWA 1Y76B 3CC7V 3GWOA 3J7A5 2L5TA 1BCPB 1J9OA 3A56A 4DR4O 3MCAA 4YHHQ 3KLSX 4DPGA 5C3WA 1A2UA 4XOTA 2UXDB 1S3OA 2N74A 3T1YO 5FK9C 4PABA 4XLCA 4LF9O 1NUCA 2DYRC 3AVUA 4JI8Q 4G28B 3WG7C 1OCCC 2FMMA 3CU7A 4OIKA 1CPYA 2D62A 4LP8A 5B3SC 5E79Z 1Q9SA 4QV2A 2ENBA 3CHBD 3JD3A 5CYUA 1LTLA 1OB2A 4PC1A 4BBRH 3S2DB 1F9QA 2AW9A 2I5MX 3J81i 4KHPB 1G291 4PD4F 1UEBA 5JVH3 2BV3A 1WD1A 1GD7A 4XQNA 1NJIC 2UXCB 1QB5D 2K28A 5JPMC 3ZPNA 2EPBA 1WOCA 2NYZD 4UVCA 1E79A 2A5HA 1ZKOA 1Z5WA 5EAYA 4ZAIA 1Q86C 4IYIA 2ZT9C 5FO9B 1DXMA 3H1JH 1VQ9A 3ABTA 4XYQA 4ZKIA 1Q82D 1IYUA 3L9DA 1KD1D 1PH7A 5M5WH 1HZBA 1HQMC 5JEAG 3I4NB 2N88A 4AYBB 5LGNA 5CMUA 1KK0A 5G3LD 1ORQC 4UP9A 3A5ZB 2KCCA 2BM1A 3QJYA 3S1MH 4JI2B 3AQQA 2B63H 3OIPA 5GQOA 2G9HD 2PO4A 1WAZA 5L3FA 3K04A 2DUDA 4OO1G 2UUBQ 3J7AV 3FB7C 1F9PA 2KEEA 3B09A 4HBNA 4BW5A 5KHIA 1XMQO 1AB3A 4TUYA 1G1XB 4LBYA 4EQNA 1PA6A 3S3XA 1YHQA 2HIXA 1ZAUA 2JGDA 4TWKA 3V96A 2JXMB 1QVFA 1H95A 2QKCA 1R73A 3E8FA 3LDDA 4LH6A 4LC1A 1UE1A 2KKWA 3BH4A 4KV6A 4NKLA 1O7IA 2Q0OC 4LF9B 2UUAL 4NXMB 4WCEV 4F6RA 4G7ZC 3S15B 1OXSC 2Q6IA 2UXDO 3MEFA 1N4CA 3SHLA 2E2IH 3SGIA 1B4OA 3HOZG 2PQAA 5IYWA 1SMYD 2WSSA 3Q0AA 1CM9A 4P9SA 1S77D 3D26A 1EFUA 1JFFB 4I50B 2WAMA 2FJ2A 4JCVE 1NJIW 1TA8A 2LFRA 3CMEV 5IYDH 2UUBO 2OYNA 1Y6XA 1QVGU 3DWQA 4XONA 5FLMH 4JI0Q 4DR2L 2WLHA 1VCIA 1MKHA 2ZM6O 1V55B 1M57C 2IL8A 1X3GA 4JAVA 4DGZA 1FFXA 3GV6A 3W2GA 1IYJB 4I7AA 1HA3A 1S5ED 1VQPV 2CTWA 3ASNC 3QR8A 5KYLA 4H0LC 4X64Q 2YXYA 4H33A 5C4ZA 3MHSC 1D2BA 3VR2A 1S72V 4BR6A 5CBEE 3NWTA 3IC7A 3CYOA 1H8HA 2LSSA 4WZKA 2MO1A 3T2MA 3WU2Z 3ASTA 4QIWE 2B8GA 1PH2A 1YJWB 2SNMA 4LF7O 3T4AC 3HP3A 1CUKA 1Q1EA 2EILC 2LFNA 5LHY1 1DGSA 3LSQA 4LWSB 1I4RA 2TSSA 2MW2B 1XUQA 2GA4B 1KC8C 1X65A 3H01A 5B1BB 2F3WA 5LL6Y 2YIBD 1VQ4V 3Q38A 1D6EC 3P20A 2YEVA 1B70B 3M3YB 3H3VI 2V7QA 5C4HA 4POGA 1MZFA 1E24A 3OEEA 5FNVB 5J22A 2F66C 1EYCA 2ZQMA 3QFSA 4UCRA 1TWGH 4RKBA 4JI8O 1TQOA 2D74A 4FM1A 4XQFA 3UI2A 4C2MH 5M3MG 3PO3H 4TV9B 4PMCA 4YWKA 2EZVA 2YWEA 3ASQA 4DR4L 4XKWA 1M56B 1WB8A 2X6XA 1GUSA 1JFFA 4I50A 4CBCA 2DY8A 2JS3A 1K3RA 1FKAO 2WV6D 4F88A 2AQ1B 3UDGA 4B3RL 3VQYA 3ICEA 4RD3A 4KD4A 5B1AC 3R8BA 3D3IA 3CD6A 3CCUA 1FJGL 1CI3M 1ILPA 2CTPA 3I7FA 3RN5A 3HKDB 1PTOF 2RF4A 4X1KA 2CK3A 1EZ6A 3PN1A 4LFCB 2M5SA 1KTVA 2WB1E 4DR7O 3CXCB 2JE6I 3SPIA 4UVBA 2ZTDA 3I55B 4I9QA 1UD8A 3KLSA 2PMDA 1EY9A 1B04A 5H5JA 1HZCA 3E9IA 1YXBA 4NNJA 3MC0B 4J8QA 3CMAA 1YVWA 1EFRA 2L0CA 4PMWA 3I55V 3GVMA 1L2FA 2UU9O 1VQDA 4A75A 2VNUD 2D0PA 2K1EA 2XHBA 4DV7O 1H2SB 3ASRA 3AVXA 2PNHA 5IP7G 1MSDA 1QILA 5A2QL 1PRTB 3ULLA 2JA8H 1IJFA 4DQLA 3IFDA 5M3FH 4PI0A 1DOLA 1I6VC 3HKZB 1WOPA 1AJPA 4KTAA 4U3JA 5LMUQ 1S5CD 2Q8TA 3OTOO 2UUCO 1YIJB 2SNSA 3L73H 1EY6A 4LF7B 3FYIB 4P2ZA 4LF6O 2B2WA 4OWTB 2R9RB 3C3SA 4KY6A 3G6EA 1SYFA 5KW9A 5KX5A 4MW3A 4K8ZA 1BDOA 3BG3A 1RJTA 2PTMA 3WDNA 3W5UA 3P27A 1BOSA 4YCVA 1STNA 1SKYB 4EB6A 2D3LA 3A3GA 2Z6BA 4IJLA 1PH4A 4O4LB 4O0AA 3WWVA 5CA0B 4EB6B 3LVBA 3HOVG 4MS2A 4XYOA 1N8RD 2Y69B 4O2DA 2K05A 1XHZA 3FKSA 4YIJA 3NHHA 4JI5L 1FDRA 4ZYSA 4HAMA 4PA3A 1CA5A 2WR8A 2P4VA 1X9NA 1VQ6B 1S40A 1N8RC 3G05A 3H91A 1VQGA 4HSPA 2KCNA 4WFN3 4FYDA 2ZXWC 3R66A 4DR2Q 2WKDA 5CN0A 2Z6BD 2M2LA 4QGPA 1FXVA 1I7PA 2VNIA 1SNDA 3B8NA 1UUPA 3QG1A 3CCQA 4HJ9A 3M8AA 3VNUA 1SS3A 2HCCA 1WA8A 5ELDA 3OAAA 1CTMA 1O9HA 1EEID 2IPKD 4ZCMA 3GTJB 2VJIA 2V7UA 1PYBA 1SNCA 2JJ2A 1Q7YD 3ZN1A 3G71B 3DSQA 2I46A 2B1GA 3TETA 3KF8A 4DR4Q 3HOXH 4X6AH 4F87A 1L1OC 3BA8A 3A1PA 5JCOA 3H6MA 3PIPA 5H59A 3Q4HA 1XMQB 3C3LA 4XDJA 5IWAL 4DR5O 3J81E 2MFIA 1LUWA 2E76B 5DN6A 1QR9A 4RDKA 1N34B 2QE7A 4Z4YA 3CP2A 1U0LA 1G4YB 1KUQA 1Z47A 3A7LA 2DWEC 4OWXB 3CCLV 4BWAA 2JN9A 1MI2A 4A3FH 1CZGA 3ETDA 1P8LA 2V1CC 3HEJA 3DWPA 1NH2D 2A9HA 1PL4A 1BCCH 5EIBD 1KHIA 4JBKA 1TUIA 3CCQV 2ZE7A 2XAGA 4BIZA 2ZM6L 3CX5F 3JATB 1IVSA 4G27B 3ASPA 4ABMA 1RQPA 3T1HQ 1CT1D 5TISZ 4B3GA 4Z4VA 1YVCA 3JAMc 1YJWA 3O65A 3M4OH 1AFPA 1M1KW 3V76A 1AP6A 4XT1B 2OTLV 3S17B 3L0OA 1M1KC 3KG2A 4LF4O 5AJ3L 2UXBO 1M9NA 4K0KL 1VJSA 1BHBA 3K3WA 1NDHA 3DEPA 2Z4HA 3HKZE 5GAGC 4I7ZB 1FX0A 3KFUA 1VQMV 1ILQA 3JAKB 1VQKA 3CPXA 1B7YB 4JBWA 2R7ZH 1CQFA 3S16H 4NXNB 1EXMA 3W7TA 1VQMB 3ITPA 3ZHVA 1KAWA 2CQAA 3H1KH 3APQA 4K3AA 2NN4A 3CP1A 2ZXIA 2WLNA 2GK7A 1VF7A 2EYMA 2RSOA 3PQIA 1HFNA 3W2HA 1NR4A 1SN8A 1XQ8A 1JE5A 1HNZO 1E64A 4EGVA 4LF8B 3FAVA 1D1IA 4X1IA 2L4NA 4JYAO 1N32B 2WYRA 3WOEA 3CMMA 4N8X1 1FNDA 3KL9A 3G67A 1UE7A 2JA9A 3A8JE 5FO1A 3F2UA 3FX7A 3CJHB 3TN2A 5A88A 1VQ9B 2OTJA 2I07B 1WTHD 3CWBH 4XLHA 4HMIA 1NS1A 1E3ZA 4LFBB 1BE3H 2C5CA 4FDBA 4K14A 1XNRQ 3S14B 2B39A 5GV8A 5CR3A 3RNUA 2MJ8A 4DAYA 4GX1A 1PDQA 1ZL8A 4RPDA 3NENA 1A15A 4MTXA 3NK9A 4J42A 1DJRD 1ZUQA 1N33L 2VBTA 4RDJA 2R6GA 2WPDG 3OW2A 1J5EL 1K9MC 1JOYA 1Q6IA 4LF5B 1G7TA 3OE7A 4FK8A 4PC7A 2DYRB 3E20A 4M0LA 4B43A 3OWFA 3ABLC 3G6JB 4JV5B 1EN6A 1M56C 4JI5O 4WBNA 1SYCA 2DMXA 1P7BA 4XM3A 1VQJA 3E5SA 3VYTA 2UU9L 1MABG 4KXRA 2DOSA 2OBTA 4TQFA 1NR2A 4ME5A 4HIMA 4IHJB 2YTVA 2Z0AA 4J7KA 1K8MA 1STHA 5IJ9B 3PO2H 4GX2A 1SKQA 4G1VA 5H1SE 1SFOH 5DEDA 1TVCA 2A0LA 5D5QA 1LTAD 1K33A 2P3MA 4BY7G 2Z4IA 4A3KH 4H9GA 5M5YB 4Q6GA 3G4SV 5HZAA 3ER0A 4E4EA 3AMUA 4O4JA 1SLJA 2XNJA 2PI4A 3DMUA 1K8OA 1E1OA 4DR6B 5LMNW 2HFEC 1I0HA 4WFHA 2EVBA 2HQEA 2NN6G 2HJDA 5GTIZ 3ULJA 4DNTB 4CGYB 5M3FB 2JA8B 4LR3A 4IIJA 2L15A 2DJFC 2K52A 5E1AC 1LT6D 2EY6A 1JPXA 4KKTA 1BKBA 2A1AA 2K32A 2F0OA 1Q81C 3OJWA 2RC6A 2WLIB 4MVUA 2CW5A 1LLRD 2WA4A 3R6KA 4KLKA 5IE8A 1SA0A 1B1ZA 4DRXA 1WTOA 5CV8A 4RWUA 1AEXA 4HE6A 3ND9A 1N33B 3CC2B 5A9GA 1YJ9A 3MFYA 3PJSK 3MXNA 3ASSA 3TS2A 2X6AA 4LF6Q 1WFQA 4IURA 1EEFD 5B3SB 3OTOQ 4X62B 1XREA 3CC2V 1VQ7B 3AGQA 2UUCQ 1XNRL 4DV7B 3VO2A 1W0JA 1X3EA 4B3SO 1JVMA 3OZVA 3J80c 1D7QA 1S5BD 2QEXV 3D6CA 3RBZA 2J7ZA 2C5HA 4DV7Q 2IX1A 2PGGA 1WTWA 1T5XD 3STLC 4UP7A 4DK3C 2ZXRA 3HKZG 1IHMA 4NB3A 2W0XA 3QOLA 3RYCB 1BMFG 4PC3A 3VYUA 2NVXH 4IPCA 1X54A 2Q9LA 3K5MA 2ZL6A 1VQLA 1KABA 2QJ1A 1JICA 2QDLA 2WIIB 4FJCC 2QCPX 2LJ2A 5B1AB 1EQRA 1ZL8B 1VQOB 5T1IA 5D5PA 3ONUA 5B1NA 2B1IA 3ND8A 2EIFA 2G5DA 4K2LA 3WXMA 2OTJV 1SYEA 3TJTA 1DF4A 4FLYA 3OWEB 2ZXPA 4KMUC 2OF1A 1KECA 4KJOA 5L3DA 1HJPA 4FIPC 2OK7A 1W2BB 4KN7C 3WG7B 4HIZA 4AF6A 1IBLO 1EOTA 4NR1A 4ZOLA 1PJ5A 5J9PC 4QMGA 3TMEA 1YHQB 3EN2A 4ACAA 3TP5A 2CGOA 1JMCA 4JI5B 1E62A 3S17H 1OV9A 2RDGA 3RN4A 3GSIA 4JI1L 4OELB 5IYCH 1AR5A 3FFQA 3OW7A 3TSSA 1N33Q 4DR2O 2EJ7A 1YJ9V 3R65A 5FOBB 4GOPC 5JCOC 3M4OB 4JYAL 1PP9H 3F7VC 2HD3A 3HR0A 3AG4B 1HQRD 1R9TH 5GTHZ 1PL0A 3UO2A 1QLEB 1EIFA 4EH1A 3OR6C 3F7YC 3WB0A 1TUBA 4R4OA 1EN4A 2K1BA 4CBVA 5I2YA 3O9OA 3JAME 3DLLA 2FX3A 3BDOA 1SQVH 2ZZEA 3SDLA 2GTAA 1HA5A 4LF5Q 3VO1A 2GJRA 4Z2WA 4NW2A 1CKNA 2F0KA 5CB4B 1NI8A 3GIRA 4IFDJ 1S5LZ 4IIJB 3AVWA 4JTAB 4CDEC 1MOFA 3EVKA 3G7LA 3W7WA 2XOKG 1V43A 5KEEA 1QVFU 4P25A 1SROA 4LFBQ 2ZIOA 1BBWA 2WLLB 2KEDA 1R6TA 4OOXA 1QGZA 1YZBA 4PA7A 4DUYB 1DD2A 3OPOA 1FJGQ 5IYDG 3BQJA 5FLMG 4LF4L 5H5NA 5KLVH 3S1MB 1L1FA 4YCWA 1JR9A 3BCDA 5CV5A 4JTDB 5H2FZ 5JJNB 3BCFA 5IJ0B 3SPGA 1KC8D 2EZOA 2F4IA 4B9XA 5M5WB 2XNCA 1K5SA 3BNWA 2C2AA 1PFNA 4GZRB 5FLXN 1AE3A 4JYBA 3L71H 3HOUB 3BFRA 4GKJO 1GOZA 5K1PA 5LYJA 4DUYL 5FNZA 2Z3YA 2IM9A 3SJAC 1AP0A 4LBZA 2QDOA 4DV3B 4WORA 1SRUA 1GN6A 4LCUC 1FFXB 1TVKA 2KQ3A 4PDRA 4R4QA 4QFMA 1W34A 3TDQA 2UXBL 5DSZA 1S76D 1SE2A 3ZMZA 3HPLC 4YJ3B 4RH6A 2CGNA 1EN5A 3C3TA 1ML0D 3U2QA 5HFLA 4X3TA 4B9WA 1MRZA 1NTGA 4EEQA 3JSLA 3HKDA 3ASOC 3T1CA 4UZUA 1R5OA 2OIEA 4K35A 2IH3C 2HHHB 2HLDA 1TTTA 2LFSA 3FPKA 1CZWA 1OXXK 5C3XA 1KYOF 2XT9A 2W6JA 1KDBA 2VS0A 2AGAA 2QM8A 1W35A 1R3IC 2ZCEA 5IIFA 4OPVA 4B3TB 2B2VA 3HOYB 3OAAG 3A8IE 2A3QA 1SE3A 1C9OA 4FVMA 3ZBUA 1GVPA 4PZ6A 1QU7A 2K03A 4IUQA 2JGUA 1XPOA 4J6HA 1VQKB 3D8CA 4UAIA 1FNUA 1PZID 3D4WA 2W6IG 4AF7A 1EWHA 4DR4B 4C3IG 4H0LB 2F0UA 3B6YA 3T1YQ 4OGQB 3TEHB 4PJ0Z 2RCNA 3MD0A 3OEHG 1OXTA 3W3AA 1US6A 2ADPA 2F0PA 5LYJB 1XNQL 2JJ1G 4MVQA 2KVMA 1XE1A 3PVDA 1V9PA 2ARHA 1ZM3A 4YAFA 1PH5A 5TR9A 1RTOA 1EFTA 3WY9A 5CV7A 3UDXA 2VQFQ 3RW0A 4QVJA 1YTFD 2N3SA 2QTSA 2Y4TA 1SNQA 3OTOL 2UUCL 1FGBD 2YIDA 1R4QB 1QX4A 1VQ5V 1SERA 2L12A 2MGSA 1B6QA 2XRSD 4ZCKA 1KXLA 1Q3EA 5BZBA 1FRNA 3SPHA 2Q7GA 1NSNS 3NTHA 4G7HC 5IDJA 1YITA 1W6KA 3D36A 2ITDC 1W0KA 4RD0A 2R9VA 3TQYA 4IFDI 2JA5G 4JI1Q 1A0IA 3M3YH 1GKHA 4GN3B 1PFBA 1NT2B 1K8AC 5L3CA 5GROA 1HUNA 1D8LA 1JB9A 4X89A 2F43A 3A8KE 2PIAA 3CCEB 2NWGA 1FJGO 1LTRD 4RM0A 4WRDA 1A8VA 5JEAJ 5IT9L 3WOFA 1WB7A 3BPZA 1JJ2A 1Z5VA 3C90A 5LHIA 1N36O 3LO8A 2YXHA 4DR7L 2EIMC 2V1DA 2NV4A 3G6EB 4FLVA 4ZBMA 1EY0A 2Y4UA 3CB2A 2ZXOA 1HTPA 4MW8A 4JI6B 2KA7A 4YHHB 1K73C 3PIP3 1URFA 4LH7A 2AQ3B 4A3KB 1GMGA 4RD6A 5C3EH 3KYHC 2LGWA 3L72H 3SYOA 1DTOA 5LOVB 2BMWA 4LBVA 5CBGA 3ZHRA 1PXUA 2FINB 4WFGA 5LOVA 4CS3A 1GM8A 1VQNB 2F0GA 1I08A 1CSPA 1F9RA 4PAAA 3S24A 3BZKA 1N36L 4LF8Q 1QCEA 3OJXA 4LNUA 1PNMA 4N9PA 1ENVA 2BM0A 2VBVA 3DHQA 4DV3Q 2Q69A 3JAWA 4B4DA 1SDFA 1Y1WH 2Q8IB 1K4DC 2WFWA 1LUZA 4BA1I 4TMZA 2BVNA 1IZ3A 4OO1I 1VQ6V 3OR7C 1KQSU 2BSKB 2F43G 3QB3A 1WORA 1O7YA 1LUVA 2IJJA 1E43A 4B3XA 1Q8KA 3G48A 3GO5A 4K6DA 1HUMA 5DM73 4YY3L 2RJZA 4J9YB 4YCUA 4UCSA 2ZJQA 2NVYH 4JMQA 3RR5A 3ZHQA 4XLEA 1TWCB 3SR1A 3W5HA 4DUYQ 1D5AA 2RKSA 3K80C 1VQ4A 2L1BA 4DV0B 4YJ2B 4CZZA 1KD1W 1G6ZA 2ZBUA 4N9TA 4TT3A 2OXPA 2K5VA 1HNXL 3JD4A 4QF4A 2CNDA 1LT3D 1MSHA 2D5DA 1D5MC 1TWGB 1JWUD 1RIPA 5C5MA 5C0XH 2OCCC 3NQTA 3QWNA 2ZNJA 1LM0A 2JP1A 3K79A 4D7TA 2K5NA 2L55A 5I6WA 3LSSA 3CCSA 3I4NH 3GTPH 4JPRA 4GCZA 1S4MA 3D6WA 2Q68A 1NY4A 3GB7C 1R5NA 1I5FA 2EY2A 1RP3B 1JJGA 1KIXA 4DV1Q 1IB0A 1KL9A 3NR7A 3J80E 5FO8B 3F8TA 5I9OA 4YAOA 3Q39A 2VWKA 1PFSA 3M9BA 4ZQ3A 2N05A 4EKWA 2DJGC 1H8HG 5GADC 3K5OA 5CA1B 3J81k 3I55A 2R7ZB 3SKBA 1JCKB 2BTOA 3HZXA 4G4KA 1VQOA 3QO7A 2X0KA 1TVXA 4FFKA 3I90A 3I4MH 4YWMA 3RYFB 2VQEB 4JI3B 1JMKC 4PDLA 4QVAA 5CA0A 2E75C 2EE1A 4BIOA 2WACA 4FPPA 3O13A 1JWMD 4K5WA 3CEIA 3MHPA 4DUZO 4PQXA 5HGTA 2MPMA 2WAQB 3H0GB 1JJ2B 2VY3A 4KUMA 2IJKA 5JJJB 4ZV4A 1C0AA 3VR5A 4U7OA 4OX9Q 1GK9A 5C4XG 1Y8NB 1YEZA 2MK3A 1N05A 3MVVA 2VRZA 4FZ0A 4NXMQ 3BVGA 4C3JH 5BN4A 1VDZA 2HIVA 4J0QA 3Q4HB 3ETEA 2VQEL 1I8DA 4WFBV 3U9OA 2F4VO 1DYQA 3RZOB 3DUZA 1RF2D 1TVKB 3RD4A 4X66Q 2E1BA 1JT8A 1X6OA 3T1YB 1MD2D 1PH9A 4C1NK 4L8JA 1O80A 1TKWB 1EY5A 3LWUA 3ZHTA 3K0GA 1KDAA 2F4NA 3HOUG 2BPOA 1PLFA 2KCMA 1U97A 1NVPB 1Q90A 3CC7A 1WNSA 4PC2A 5F4OA 4PDVA 2HKOA 3NXWA 4P2CB 1V0EA 2SOBA 1VQ9V 3FVQA 2CUGA 4CS2A 4LUOA 1SBBB 5GAHC 5FPRA 2L6LA 1JC7A 3W1GA 3H15A 3R2IA 1R1BA 3ZHUA 1EFCA 3I56B 1DM0B 3SK6A 1W2BA 5JJLA 2RDFA 4XN3A 2OBRA 3GVLA 4DV3L 4O4JB 2PYLA 1WLEA 1WN7A 2QWQB 2ZNIA 4ROXA 3OZUA 3WNDA 2OWOA 2ZR3A 1K92A 1RSOB 2I0QA 2UXCQ 1LYLA 5DEHA 2Q67A 1OCZC 2C5BA 1DG1G 2EIJB 3GWKC 1PRTD 1I94O 4LF6B 4RAIA 3KF6B 3PCOB 2DWDC 2Q5ZA 1K73W 4GX5A 1RHPA 1HR0Q 3S16B 4JZ2A 4UPAA 5LMNQ 4NBSA 2YEVB 3ZZUA 3S2DH 2F1LA 1WU8A 1DLBA 3NELA 1FPOA 2LW7A 1S5FD 2WP8J 4GKKL 3SLNA 3RT3C 1BO0A 5FO0A 3GTOB 2BGIA 2VNKA 3DXRB 3ISXA 3FMCA 1E2VA 1BSMA 5LL6X 4LFCQ 2I5HA 2F0SA 2P90A 5KAFZ 4OX9B 1V0FA 3G4SB 4HIDA 2R7FA 5JVG3 2EIKC 3MAQA 5HKKA 3JCUZ 5EPJA 4FM0A 3CSXA 4RGMA 3TBIB 3ES9A 1JQ0A 3PENA 3BC9A 1CHPD 3WQZA 2PW5A 3OIQA 4E6IA 4M2LA 3R2TA 1TT2A 3JASA 1VQEA 1WSRA 1IW7D 1A8PA 4F7DA 3T13A 3H3VC 2LXJA 1K5QA 4BIUA 1PV0A 2JSOA 3GTKH 5M9OA 2VUMH 2X85A 2VL6A 1MNGA 4E0FA 1WCMG 2UXBQ 5DLQE 4NYKA 5K5PA 1EQQA 1M4VA 1STYA 3AK3A 1EQVA 3FEWX 4DV4B 2PYJA 3RVZA 3P32A 1YJWV 4L5QA 5KUKA 2Q4PA 1S0UA 2R7DA 3TZUA 1XPUA 2D3NA 1SE4A 4AQYO 3CMEA 2JEAI 1S72B 3GTQH 2R61A 4AYBE 4MVOA 1Y1VG 4A3JG 2E5LL 2HHHQ 5K36G 2HCJB 1U4MA 3DTUB 4DV1B 3OUFA 1WA8B 4Q20A 2A69C 2X6GA 3TK1A 3U50C 2CW0C 5JWPA 4IN3A 2HQLA 1A2TA 4C2MB 1WD0A 3PO3B 2EYOA 1IBLL 1QFJA 4X7DA 1LO5D 2BDNA 1KC8W 3C1FA 2PPBC 2F4VQ 1F7YA 5I6YA 3HOXG 4P26A 2XAHA 4A3DG 3MXUA 2DQ3A 4X06A 3OMGA 2Q8VA 2CFMA 1NTKH 1IBMQ 2HDNB 3ICXA 5IJ9A 3SE0A 3WYAA 1B2RA 1ESFA 1PPJH 3HB3B 1R3JC 5KUMA 1JOOA 1SMXA 4UY8C 3HOZB 2J0TD 1LTID 2HR3A 4XMYA 2Q7EA 1XQBA 1F77A 3EBEA 3F2CA 5A2QE 1GVHA 1I5YA 2VB2X 4KFMA 1U4RA 3ABUA 4DUZQ 1DONA 1BX1A 4DRXB 3E1YE 4I0XA 3VQWA 3CMAV 2ZBVA 4QE7A 3AG2B 4ZI7A 1KK1A 4B3RB 2ALYB 3L3OC 2OIGA 3U6KA 1CHQD 3CCMB 3OT7A 4GT1A 2ZE5A 1H2NA 3AG4C 5J1ZA 4DR1B 1GO2A 4MTKA 1G7CA 1K3BC 4J7ZA 1GUOA 5ITZB 1Y8PB 4OIJA 4JV5O 2QWRB 4X3KA 3QNEA 1TU2B 3D4DA 3PSIA 5IYBH 2F52A 2ILMA 4LUZA 2B3GA 4UCTA 3FPPA 2NBFA 1Q6UA 3DXJC 4R8NA 4BPRA 2BTQA 1Y4MA 2AKWB 5AJ3Q 1A6XA 3K7AH 2YV5A 4EX5A 4KL1A 1V1OA 4JI0L 2BA0A 3GD7A 2KHSA 1J6QA 3BVZA 5DAUA 4P72A 5EQ0A 4DV6L 2EIKB 4JI2O 2QKIC 3D4RA 1VQNV 3SPJA 5LXTA 4DR6L 4C7UA 1QUQB 5IYCO 2WB1G 2O2LD 1HTLD 3AYHB 4LF7L 2JA6G 2P5ZX 1HNWQ 4DUYO 4NVPA 3CCUB 1BR9A 1K28A 1Y14B 3MWYW 3NBIA 1EFRG 4AI8A 4FFBB 3NP8A 3SJCC 1H9SB 2EINC 2GHYA 1MGSA 1PKXA 2BOSA 4LF6L 1CA6A 3OD4A 3BDLA 4K0KB 1HNWB 3Q6QA 1PD3A 1SQQH 3FD9A 4P6VF 3K06A 4Z4WA 2DERA 3BVOA 1JB3A 1YCIA 2GN5A 3BVMA 5BR8Q 1VQ7A 1IBKO 4A3DB 1A32A 1PHJA 2F0FA 2ZZFA 2Q6KA 4DV6O 3NUCA 3PUZA 1G91A 2LP7A 2Q6AA 3K9AA 3OM3B 5HFMA 2R6HA 3TREA 4M4SA 4MHEA 1IHZA 5TRDA 2FVGA 3CC4B 1I4XA 3I2ZA 2ZZQA 2NLJC 1H42A 4FN5A 1B23P 1ZX3A 1S3JA 2YXLA 2ZXWB 3B77A 3TGUH 2A69D 2E8GA 2JJ1A 2R9IA 3KF6A 5I2XA 4DV2O 3M99B 3CC4V 1BJKA 4UV8A 4J80A 2GPJA 5TV2A 3CESA 3FKIG 4NDXA 5FLXc 3CCVA 2B2YC 2ZTGA 1EQTA 1BLIA 4Q0FA 2Z6KC 5IP9G 1OXUA 4DR2B 4A76A 4P73A 2KHJA 1SF9A 2G38A 2UUAO 3D36C 3K58A 1QLNA 3KDFA 3ETQA 4MT8A 2QA4A 4QPKA 3W7SA 4BBRB 2XZLA 2R93B 2YC0A 4R4IA 2C9OA 3CCLA 1E22A 4OEMB 4TVAB 4B3FX 3BZDB 5CBFA 4K0KO 4MTNA 2E2HH 5CMDA 1MZEA 3ML0A 3SYPA 3A35A 5BN5A 4O4HB 3CCQB 2A6HD 4P9OA 4ME3A 4A3KG 1CNEA 1EOVA 2IT1A 1QVGA 1AROP 1SNPA 1YZ6A 3H9VA 1KBHA 4RD4A 3SJZA 1A3UA 4JI1O 2J7KA 4LF7Q 1HNWL 1ZUNB 4YIOA 4OPOA 1RODA 5GONA 2YI9A 3K57A 1FNWA 1ICFB 3M85A 3BS1A 1JX9A 2OBSA 3AFQA 3K03A 1V54C 3HKSA 2A74C 3OE7G 2EIMB 3MDSA 3TP6A 4X65Q 1AI7A 1IBKL 3ZZTA 1HNZL 5E6TA 4X64O 1VEWA 1LR1A 2WJVA 4JPBW 4PZ8A 4HJ7A 4HCSA 3PIO3 4A93H 5EC2C 4UHVA 2GV9A 1STBA 3BY6A 1QVFB 5IWAB 5IYPA 2A68D 4DR1O 4JI0O 2JN4A 2M00A 1IBLB 4FXKC 4DUZB 3TRZA 4DR6Q 5CDFA 4X05A 1NJID 1SZTA 2A79B 1D8TA 2CAZC 3ABKC 4DK1A 1CKOA 5CC4A 2D2CC 4A3MH 4U3FH 1EIHA 4X8IA 1QUFA 1GUGA 5LXTB 1GAQA 3NPPA 5IWAQ 2WAQG 5JEAH 3CRAA 3K08A 2ZE6A 1XDCA 2QMUA 3JASB 3J81L 2ATWA 3HKCB 2VQEQ 3EHBB 4K8XA 5LGTA 3OTFA 3B82A 2WINB 3C1EA 3N6RA 4JK1C 2UXNA 1WTQA 5E1FA 2ADQB 1LV9A 1VQ5B 4BY1B 4TMWA 4RGTA 4DR3O 1II3A 5HZBA 3H1HH 4OO1H 3VQVA 2Z6KA 2O5JC 1KK2A 5FL7A 2H1EA 4ZLTF 3JD2A 2B2YA 3JAKA 3E0EA 3KCYA 1TR5A 5EGTA 1HRJA 4C56C 1QNKA 3I56V 1WOSA 4Z4TA 2JRIA 4X62L 4BXXH 1I6HH 5K1XA 3S2HB 4JI4O 5KNDA 2Y0SG 5A35A 2JA7H 1JOQA 1SYDA 1JCHA 2Y0SB 3ZN0A 1D2EA 2NNUA 4UB8Z 3X2QC 1KMIZ 4A4IA 1WCMB 4RJLA 2QW7A 3H0GG 1UD3A 2R92B 3UM7A 2AXTZ 2QGNA 3G6EV 2E2DC 4PA4A 3FAVB 4RGNA 4TMXA 1TXYA 5KAIZ 3E89A 1EFID 1CK1A 2NVTH 3GTKB 3K0DA 3QVNA 4GUNA 1D2DA 2GTSA 4P30A 2LKVA 2E1RA 4YELA 2C78A 2B2UC 4GS3A 5CV9A 1TLLA 2HP8A 3A74A 4IO9A 4XR6A 5JVDA 1N32Q 1GJXA 3Q22A 3GTMH 1OB0A 1ZXTA 5F4JA 5LMNL 4RQFA 3CCRV 1T6XA 3W2FA 3NBHB 4DV0Q 1AJQA 4A5UB 2EINB 3FKSG 1XWEA 4JG2A 2Q7HA 1WTXA 2XAFA 5KHKA 4TSFG 2RBMA 4DV6Q 2CCZA 3JALA 4FXDA 4X8AA 2WKCA 1QFYA 3HKEB 3W5VA 1Q86D 4GN4B 5IT9c 1WVLA 3M7MX 4CC5A 1O7LA 3ZMTA 3J80N 3CB4A 5BR8O 2JYOA 3RMHA 3E8GA 1BS3A 1N9WA 4LF9Q 1YNJC 3K81C 4RMFA 4XDXA 1Y76A 4XLAA 1B8AA 3CPWB 2GSMB 5EKIA 5C44H 2QWNB 3A8TA 1J5EB 1SQXH 2ZZGA 2CTRA 5ELNA 4ALPA 4YHHO 4P75A 2AHYA 2K5WA 3IFTA 1AZPA 2EYFA 2DNEA 1THZA 5LMNB 3A0BZ 2KJXA 3J81c 3EROA 3R3OA 4QIWB 4JI2Q 2KENA 4FF3A 2XNDG 4LFAQ 3I4MG 1BUVT 2IH1C 3ONYA 4A3BB 4JAUA 2KG7B 5BXZA 2KBNA 1HFGA 4NPSA 4B3SL 1TWFH 4HIKA 1XBLA 2EYLA 4HZ3A 4RGOS 2GJKA 1TS5A 3KDFB 4QB4A 4LF5O 3T1HO 1Z7TA 1OHHA 1NTZH 1I94B 1RL2A 1OCZB 1P84F 1VP7A 2JIZG 2EQSA 2G9DA 3NWSA 1ZM4A 3IC9A 3HKBB 5M5XH 1S4ZA 2OQ0A 3RYHA 2EOTA 2CH4W 1MABA 2NZHA 4HAEA 4IFDH 4BBRG 4JI1B 5AN9A 2Z8LA 3U9SA 4H37A 2B5UA 2RNBA 4YXWG 5L3EA 2GQFA 1U9RA 4HMJA 3UE1A 1JA8A 5LL6S 4A3IH 4JBJA 1Q86W 1BT8A 1WTPA 4MVSA 5IYBO 2DEUA 4M8AA 4IW3B 2TMPA 2VUMB 1I4HA 1Y67A 4JI8B 4Y9UA 1H38A 4N3GA 4FWTA 1XTCD 5J2UA 2DYSC 4IALA 1V55C 2OTLA 4LK1C 1MMMA 2OTLB 3WNBA 3D31A 2UUAQ 3ZJYC 4JVZA 1WI5A 2C4UA 5IOCA 5GV7A 4TUYB 4GOPB 4MNOA 2QE7G 4A3GH 4DXWA 4CDCC 1PNKA 1H9RA 5M3FG 5FJ8G 3PUWA 4WJ4A 3OHXC 1IBMO 4QJFA 4IL6Z 4NKGB 1KP2A 5EYPB 5E7NA 1K34A 3LGJA 4EQPA 3RZDB 5AG2A 4DAVA 1WDTA 3GTOH 2BA1A 4Y52H 3H3VH 2E2HB 1HHVA 2P22C 2DETA 4DR5B 1MSWD 1D5ZC 4DUZL 4WFEA 3CCSV 2PQEA 3CPFA 3JQRA 1VIBA 1BGYH 4II3A 5EC1C 5HY6A 4QE9A 3CW2C 3DGEA 4F7XA 2AUKA 2KHIA 2R93H 2WJYA 3K6OA 4YWLA 1BHAA 4TV8A 3PMFA 4X64L 1SM4A 1LTSD 5JJEB 5TSSA 3ERSX 1VQMA 1PTOD 2HHHO 3VA5A 4XD7A 4LAAA 4R71A 3RLFA 1Q82C 4XDKA 2PE3A 3K5LA 1ENFA 4W4LA 5T1GA 1NR1A 1HNWO 5GAEC 2F4VL 1H9MA 4WZLA 3SJPA 4B3ML 5ELFA 1YHBA 3GTPB 3N52A 1J8IA 2FKXA 1EWCA 2XTAA 1NB0A 4X7CA 5C0XJ 1QJOA 4R4CA 2YTYA 3DWAA 2HLDG 1Q7YC 1AJNA 1YHAA 2YIAA 2CTQA 2X7RB 5CBHA 1GH6A 4A3CG 2BE5C 3E8HA 2DY1A 3GVJA 2D0OA 4X3SA 4QQBX 3ETGA 1K9MD 2QSAA 4PI2A 4TQUS 1XB2A 3EXAA 5IYQA 1TWCH 4QHYA 3VR4A 4LMQD 4C43A 1A3VA 1RDPD 1Q46A 2PI5A 2E3CA 3LDEA 3OW2B 2XUMA 1TUEB 3WB2A 3JQPA 4GN5A 4ZK9B 2JEXA 3EFFK 2JA5H 1F2ZA 2YU9H 4BA2I 4OXSA 2QDXA 3FRPB 2K14A 4CKBA 1GN4A 2EY5A 1K3EA 1PH1A 1OCOC 4WFAV 1EYGA 4IGGA 2LMCB 5A89A 2OCEA 1GHJA 3HOVB 1W0KG 4JI7B 4J11A 1YTFB 4PG3A 2Q2HA 4NXNQ 3CMEB 2V7QG 1ZSPA 4Z1MA 2QR4A 4DV4Q 3MA2B 1GUWA 5EZYB 2BDOA 3RYFA 3LDCA 3CHXA 5LP6B 3WB1A 3GTGB 5IY5B 5C3EG 1PYWD 2UXCO 4ZCLA 1R5BA 2K7VA 1HWYA 3PO3G 3IJ4A 1P49A 1FXKC 1VQNA 4FMTA 4ABNA 4TKOB 2P5OA 3QG5A 4B3MO 1P4MA 4C0SA 5J3BA 3P1HA 1SQBH 3NTKA 5I4DA 1K28D 4UCOA 2GUZB 2F0HA 4CDDC 5KYIA 3ZJZA 1QH0A 1YNJD 3ZRXA 4EFBA 5IYDO 1EYAA 4HJAA 3NTIA 4JI6Q 4OWWB 5JBQA 3WBJA 2XTIA 5JJIA 1VQ7V 2MUYA 2F0WA 1XNRO 3GDEA 2F93B 2XWJB 4DV1L 3A8IA 4TN1A 1VHOA 1MA1A 2QEXB 1KRSA 2F3VA 3HOZH 3MMPA 4CH3A 5EBCA 2P6JA 1W59A 4LBEC 3LSUA 4JI6O 1E1RA 3W1BA 4W4KA 2I1LA 3ERQA 3OUSA 4N21A 2QILA 4JTCB 4PV1C 3W7UA 2N55A 5IP7H 4F8MA 5C0XI 2EULA 2AUJD 3AB9A 3HRZC 2P67A 1OCRB 3KKYA 1SQFA 1CKMA 4K8IA 2CQOA 1ZTEA 2IBZH 4QPJA 4TV9A 5CBAE 3A0JA 3IFXA 4B3MQ 5KHHA 4X1IB 3E86A 4HIOA 4L5RC 5C93A 4FM2A 3EJIA 5C4JH 4JI3Q 1DK1A 4G7OC 3CAMA 1G8MA 3SYAA 1E1TA 1NCVA 1R3KC 5C0XG 2AHZA 1N0NA 4I55A 2VXWA 2NVYB 2Y0PA 3R6JA 1YITV 2Q8RE 4CDFC 4YHHL 1H2LA 1AMOA 1QWYA 1VQ5A 1LTTD 2YWFA 4P1VA 4A3EH 2L35A 1P16A 4LF4Q 2OCCB 5H9CA 1M93A 3CCMV 2XOKA 2FTKA 2ZT9B 2QM4A 3OZWA 4C3HH 3P30A 4YEJA 1NBMG 1ET6A 5IY0A 2XN9C 3CMAB 4LFAB 2WB1B 2JA6B 2ATKC 1SYBA 3VR3A 1Y1WB 5B6IA 2HDLA 3BA9A 1KRTA 4V190 4YALA 2UUBB 1AI4A 1V1PA 2H8PC 2D3OW 1N06A 1L1OA 3M4YA 4B3SB 5JJKA 1C4QA 3P3NA 5LMNO 4WBNB 4PC6A 4J1MA 2CDYA 4LC0A 4RUFA 5F4MA 3CP8A 1GUTA 4GZYC 3OP1A 3VMFA 1KU9A 2NUCA 1J5EO 1MIUA 2BTQB 1VQHA 3OMAB 5M3MH 1L0LH 3QF7A 1XHXA 1PKVA 3PF5A 2BCOA 1PH3A 4J41A 3HKBA 3U4ZA 3W2IA 4X62Q 3RWRD 4R4TA 2K5HA 2E5LO 1XNQB 3BCCH 5FKAC 2RA4A 1KK3A 2IJHA 1SFOB 2CRVA 4IQZA 4O42A 3WFVA 3CCUV 4RDLA 1Q8IA 1H9KA 2UUBL 3BJUA 4C3JG 3SYCA 1VF5B 3S1RH 1VQAA 4B3MB 2WAQE 5DM6V 4Z4ZA 1U5KA 1OJHA 1K83H 1I50B 2F0DA 2Y48A 3VBBA 1CQVA 1DF5A 2V7VA 1QLEC 3J7ZC 2ITCC 1EY8A 3L9AX 4KHVA 3HOUH 4A3FG 3S1QB 4CH5A 2HEPA 4YXWA 2X6BA 3Q24A 1JNYA 4R8CA 3ZS8C 2A8VA 4B48A 1PVOA 5KA6A 1FRQA 4X66O 1F51A 3RYIB 1U4LA 2VQFL 3CS5A 2BOBC 2B2WC 4KD3A 2VBUA 2W6JG 4JI7O 3JU4A 4DV4L 1S5HC 1T5EA 3ZMVA 5KHJA 4DV3O 1QG7A 5BMVB 1YNNC 2MP1A 1OHHG 4NXMO 5IJ0A 1T6YA 5EMNA 1E0BA 1OCOB 1EIGA 2ZE8A 4CH4A 1K9MW 2L11A 3OGIB 1Q7YW 3S14H 4DXFA 4NTWA 4F6EA 2JK5C 2H94A 1KMHA 4IJHA 4JI3L 4DAPA 1ENCA 3ABLB 1SXTA 4ID6A 4FF1A 1F2LA 1XX8A 3U58A 2KECA 4UVAA 2QWPB 1RTNA 1OCRC 2CF4A 4BBSH 4DR3B 2RN9A 3BRCA 1HP8A 5FPOA 3A8KA 2IJIA 3EFXD 3Q6RA 3UCSC 3ASNB 2F1MA 3HAGA 1EY7A 3GQBA 1UJWB 4RQEA 2EFGA 3RZOH 5IGBA 4RCZA 2Q73A 4XXEA 1FD7D 1GR1A 3T4DA 1LABA 3AU7A 4QUCA 3HOYH 3HS0C 1CFMA 5TY0A 2BN4A 2PZSA 5CORA 3SK8A 5LP6A 1CKNB 5C4XB 1N0UA 3AVVA 4B08A 5DS0A 2CE4A 1KKCA 4X07A 5CGKA 1IKMA 1QNMA 2UU9Q 2JEUA 1CQXA 4YJ3A 1WPCA 4BWGB 5JPNC 4XLFA 5IWAO 3P75A 2IU3A 1VF6A 5IGCA 1QR8A 1O7ZA 2P06A 5BSYA 3C2PA 1NAPA 1BF4A 4DR7Q 2PF4E 3KJOA 3ZZ0A 2GJPA 3DM3A 4O2AB 2WWWA 3MEHA 2VQFO 3JAMi 2DIEA 3ZYYX 1J95A 4FLWA 2MNAA 3CRCA 3F5TA 4LWSA 1HNXB 1GAWA 3CCJB 1ENAA 1NR7A 1COWA 3LQEA 2B2VC 1MSGA 5B5EZ 1CEZA 1UFIA 4UV9A 1Q43A 1XEQA 5LHHA 4M53A 1VS0A 3T1HB 4DK0A 1QGAA 1EWIA 2XGTA 3RYHB 1IBML 4J15A 4BXXG 4HJ5A 4DFAA 1G8ZD 1EBOA 1H8EA 2ODMA 4GKJL 3CCSB 1KTKA 3RUZA 2XNAC 2A6EC 4TSFA 4GQNA 1L0WA 1XMOO 3OKXA 5THXA 4APVA 1AI6A 2BE3A 4AHCA 2VWJA 1KZLA 1GAXA 3PA1A 4S3SA 2X6YA 2W6IA 2YI8A 3JYCA 4RUEA 1FNMA 1Q5OA 2B8FA 2JQOA 2F0QA 2PMZE 1WTVA 2AWOA 3SJBC 1JA0A 2VJJA 1SE8A 2YTXA 4BY1G 3HOXB 5IT9N 2DYIA 1EWYA 1DDIA 4XL9A 3CJHA 1SNOA 2OEOA 4HNAB 3GTJH 4Y7CA 3KBXA 1BQQT 1Q90D 1XPRA 1M5IA 4O2BA 2C35B 2RC5A 4P3IA 1BXTA 1FS0G 2B29A 3OMNB 3CC4A 4ZKCB 4O2AA 2ZKOA 3GTLB 1MJCA 5EYPA 3ZRVA 3I3CA 4KP4A 5C6AA 3STBD 3OSOA 1COWG 1FAFA 1ELOA 4RCOA 3V2TA 3W2EA 1HPCA 3ZCCA 3AFPA 3PUYA 5JAVA 4LFBL 2Q2TA 1XJVA 2YWHA 4XOPA 1L1OB 2E2JB 3R93A 4WZEA 3L74H 1D1KA 2JGDB 1GXDC 2Q0AA 4DV6B 1H9JA 1I3QB 2OCHA 3B4SA 2PY5A 3CPWA 3E0JA 1BQ0A 3I91A 5AFWA 4XT3B 2R3ZA 2E76C 1VLYA 4TRDA 4CJ2C 5C44G 4TT3G 4RD1A 2A68C 3FP9A 5EBDA 3S1RB 4GKJQ 3T56B 3N27A 1Q82W 1W0JG 4U7NA 2QM7A 4QNHB 4GX0A 4RLZA 1FJGB 1I6HB 2J4XA 1GTOA 2QA4V 2UXDQ 4FK5C 1KD1C 3S3WA 5C3EB 1SZXA 2K01A 1EY4A 5KRUA 5EIBC 4KKUA 4XN0A 4E2LA 4YY3O 2YIBA 3A0HZ 5LA6B 1W2BU 2OK8A 1I4GA 5E4XA 4CJ0B 1IBKQ 2YU9B 2ID0A 1Y66A 4PMBA 4MVZA 3PA2A 1Q12A 4P74A 5M3MB 2ZL5A 3NQIA 1IJEA 3B8HA 5L3GA 3CE2A 2XIWA 1Q81D 3E3XA 1P7GA 4X0CA 5DM63 4HN7A 1BBUA 4HNAA 2WPDA 1VQ8V 4G7WA 1F2MA 5CV4A 3I56A 4POFA 4DR6O 2HDMA 3LQ6A 1Y8OB 4DR1Q 4GKKQ 3ZRWB 1GO3F 2GBOA 2KSDA 4GOPA 2JA6H 2PZUA 3OMCA 4A3LG 3ZMUA 1D1NA 1I3QH 1VQCA 3U6BA 4L6TB 1WTHA 2WLMA 3RYIA 4DF7A 1LT5D 1R9TB 3ZRSA 4YHBA 1WP6A 2C77A 4L63B 3I4LA 1I5XA 1KQSA 1JB7A 4A3EB 4KJNA 5BMVA 4X62O 3VQXA 1D5XC 4P3YA 2DQ0A 3CRKC 1H2KA 1YSCA 3HFZB 3MXNB 4C3IH 1Z9FA 3SVMA 3GTLH 2P7TC 1QUEA 3SLDA 2FL4A 4AQYB 3E9HA 1HW7A 3UO3A 5KMGA 2JJQA 1QZGA 3F2DA 4KKSA 1XFOA 5EZYA 4RWSC 4QL5A 4DR7B 2ZL7A 1KLUD 2O4XA 2OT2A 2ZTCA 5KHGA 3STZC 1Y69U 4UAJA 4QIWF 1Y0YA 2GREA 1B44D 3M4PA 4MTGA 1SNMA 2F0IA 4R7CA 2YWGA 2PI2E 2R92G 4LWCA 2R93G 1GRJA 1YI2V 1R4PB 1OGJA 2UXDL 2RDHA 4YY3B 2B7BA 1Y74A 3CXHF 3T53B 3IRBA 4UP8A 2WLLA 2JS5A 4JF3A 1YBYA 2YDEA 2DN8A 1YITB 3Q6SA 4J7JA 3BY1A 1YI2B 3E22B 5EBLC 2EXZA 1NTMH 2RMKB 3RFRA 1ZYRD 1NH2B 1VQBA 1JJOA 1J9ZA 1GO3E 2ICEC 4CJ1B 3CTAA 2PZTA 4O4HA 2B7CA 1IXBA 2XAJA 4UDUC 5E3FA 4ZGNB 1IYVA 1AP5A 2QDBA 5ELCA 5GW7A 5IGDA 2EILB 3OMIB 5M5YH 5KSWB 4XQJA 3PIOA 4DA2A 3BEHA 2DNCA 4GKJB 5ISRA 4NCNA 1FGUA 3D3RA 4HEDA 2E75B 1PNLA 4EFEA 1BCPC 2Q2UA 1NMFA 3MZ5A 2VW9A 1B50A 1L0YB 1FXHA 1YF2A 2Q6LA 1L0NH 1E2WA 4FF2A 2EBOA 1QQCA 1PRTC 1KKDA 2NN6I 3ABMC 4O4IA 3I72A 4C1NI 1B53A 1QCBD 2F0TA 4ACBA 4BW9A 3IAYA 1YIJV 1B9NA 1EU3A 2K5DA 3CCVV 2X8KA 3VYSA 1UPGA 4P2NA 2F0JA 2QEJC 3PGZA 4LFBO 2GVBA 2DJVA 3S15H 2WA3A 1T6ZA 4O4LA 5KA5A 2CH7B 3A8JA 2VS1A 4RHSA 4RCNA 4I5SA 1AR4A 1VQLB 4NTYA
chains in the Genus database with same CATH topology
1UNSA 5DNFA 5KIXA 2M9VA 4TSSA 4PNYA 2EYPA 3B2EE 5CA1A 3EVQA 4V0BA 1UD4A 1STEA 4K5XA 2HUGA 2UUAB 1Q3LA 4FLUA 2F0EA 3MTSA 1BBXC 2ZIMA 1E2ZA 3THOA 1U4PA 4KY7A 1A3TA 1TIID 3QIAA 3X3NA 4ODGA 1DCZA 4FLXA 2ZXHA 1UAPA 1PZJD 3SK5A 3W2DA 4ZKBB 4Z9CB 4DNRB 4DU9A 2LZJA 1LT4D 4NP5A 3JARA 4X66B 2IWHA 2FMCA 4PHZA 5D3DA 1NBMA 2WZPP 3QTCA 3T16A 4O1NA 1ET9A 3J7YW 1SYGA 1UD6A 2NN6H 4CKEA 1B2TA 5FLXL 2BE5D 4I55B 4HSVA 3IKJA 1EL0A 3K5NA 3N2KB 4MN3A 1WPBA 5JQGA 4K2KA 2F03A 4G7XA 3I73A 4FYDA 3H94A 4CH6A 4GKKB 5IGEA 4ZI7B 5KMGB 4M1UB 5GONB 2PMZB 4K8JA 3U10A 3BAAA 4C3HG 1HVXA 1B3AA 4BBSB 1SQGA 1I18A 5IYZA 5D14A 2UU9B 3FKIB 3S9WA 3SDZA 3DM1A 1SKVA 4ZHQB 4EVOA 4MIUA 4ULLA 3E22A 4C3IB 5D3IB 4IFDG 3VYRA 1SA0B 4AVZA 2E5LB 3KBGA 3BDCA 1HXYD 1K83B 5JH7A 3GP7A 1SAPA 1G2SA 4I7ZC 4G6IA 1AW7A 1DOMA 3URYA 1LACA 3D8GA 1VMPA 3GTMB 1KNEA 4O4IB 1XNRB 3K0YA 3PO2B 1UEAB 4NMZA 2EJGC 2CW0D 3A7AB 4XORA 2FHTA 1TWAB 4C3HB 2ZM6B 2IX3A 5JH7B 4CC6A 3VR6A 2K6AA 2NTTA 4IUTA 2JA5B 4JYAB 2RVLA 3GVKA 3N2GA 3UQ8A 2FFKB 4BS9A 1TS4A 2K04A 4XQQA 1YEWA 3VA7A 1BCPD 1VF5C 5K36H 1IKLA 3TP7A 1JORA 3FPUB 1ONLA 2B63B 1W9XA 4KI0A 1E3XA 4ZUJA 5IODA 3PUVA 1G6UA 2VQFB 1PMRA 2YYZA 1PTOC 1HA6A 5JVDB 1M4UA 1S5DD 2KUMA 1OO9B 4KHZA 5KNBA 3NBHA 1O9GA 1RCVD 5JOBA 3Q23A 1JWSD 3LX0A 5NUCA 3M7GA 3C46A 5E4WC 3EQLC 4QCLA 4R8IA 1SEBD 2O5IC 5JQGB 2XNDA 1PZKD 2GK6A 3BYTB 5G3LF 2IJ0A 1STGA 1S5JA 1XXGA 5J2TA 4I65A 2SEBD 3S1NB 2XWBB 4X1YB 4AILC 4HR7B 2PCFB 1I7FA 3CRLC 1L8DA 4I4TA 4FXUA 5ELEA 5FO7B 2H4OA 4A3FB 3J7AF 2E2IB 4IHJA 3A3BA 3I70A 1C48A 5BN3A 1ESRA 1JOKA 1KNAA 2AWNA 3L7ZC 3CKIB 4FF4A 4BA2I 5IYZB 4ZHQA 2RQXA 4DV5B 2YU9B 4ZRZA 4U673 2XRQD 4O2BB 2L9HA 1ZYRC 5M5XB 3KEWA 4FLTA 1STAA 5FLXE 1L0XB 3MHBA 1PFMA 4TOIA 3N2GB 5J2TB 3LNNA 1KDCA 4CHTB 3M7NA 5LMUB 2F0NA 4DN4M 4HTHA 1OXVA 4G57A 5EPKA 1IL8A 4Y7NB 2RQ6A 3JSNA 1UD5A 4TV8B 1W6JA 1IBMB 2B2UA 2ICIA 5D65A 3FDTA 1TUBB 1XYIA 4II2A 1BNZA 4FXGC 1IBKB 3SR2C 4LJZC 1WTRA 2SDFA 3SXHA 3LWEA 2EX3A 4WJWA 4ZIBA 3K59A 2XGJA 4XTCS 3A2FA 5BR8B 3UT5A 2X6WA 4Q5VA 2HCIA 1BCPF 2JIZA 1TAEA 1V8QA 1EZ8A 2NVTB 1F9SA 1DZ1A 1O78A 2NZ1D 4K5VA 1I4QA 1RSOA 2RSNA 4ILWA 5C8YB 4IUUA 4XKVA 1TS2A 1PTOB 1F2YA 1HR0B 3BHPA 3JARB 1EU4A 5C4JB 1TWFB 3HOWB 2ZINA 4BY7B 5FNVA 4UCVA 3UT5B 1RD9D 1AZQA 3TP8A 3MXPA 5EPLA 5C44B 4A3GB 3SK4A 5LP6C 5J2UB 1SJHD 5EJWA 3A55A 2A6HC 4ZUIA 1FNVA 1LTBD 1LTGD 2Z1CA 4KN4C 1YNND 2R72A 1ICWA 5CV6A 1KLGD 3DEOA 3NSWA 4X3UA 4V190 3U0ZA 4X1YA 2EYJA 5C8YA 2CVRA 2A73B 3KLRA 3ZEDA 3OFNA 2PYKA 2X53S 4RA8A 3JAWB 3IL8A 1M8AA 1BPLA 2QF7A 4OL7A 2JVDA 4FO2A 2R9AA 2AQ2B 3KK7A 1QNUA 2K33A 3PV0A 1HZEA 1KAAA 5J39A 1H9SA 3JAML 1V1PB 2JDIA 3JATA 3HKEA 1JR0D 4QUFA 4KK7A 4D7SA 1XMOB 2NTSA 4X20B 3N2KA 4YJ2A 1BMFA 4ZOLB 3ZIAA 4KY5A 2OYQA 1QHTA 2F0VA 4X64B 5JJZA 3X3MA 3A54A 4H44C 4DV2B 3PUXA 4CS4A 1SJED 2EY1A 1DOKA 2F0LA 3SEBA 1Z6HA 5KX5B 1MBYA 3BABA 2EDGA 2B2TA 5CB4A 4ASUA 3CQZB 5KNLA 4UFZA 2XVSA 1HNZB 3HKCA 4HCEA 2PW7A 2KVOA 2V31A 1TY2A 2XZOA 1FR3A 3DDYA 4RFBA 2E74C 2CHBD 3HGBA 2F4VB 1PRTF 2MHVA 5C5LA 4IUPA 4OHJA 4OGQC 5EKKA 4RAUC 4H7BA 4IFDH 3I4MB 1X3PA 1ZEQX 4LF4B 5EKLA 5IGFA 5I9PA 4A3IB 3QO2A 4DXGA 3T51B 1RKNA 1NRKA 5LA6A 3J80L 4U3JB 4FNFA 1TWHB 2D9UA 1EYDA 3QOJA 3MXGA 2R70A 5HURA 1G2TA 1TS3A 1TGOA 1VMCA 4UCUA 2B2TC 1PTOH 5COYA 1Y1VB 4A3JB 4GLXA 1QE6A 3GV3A 4GYCB 4R9WA 4XIGS 1Q1BA 5ELBA 3NE5B 3GTQB 3OOCA 1UD2A 2K5QA 1AN8A 4TQDA 2EYHA 4I4TB 1SSOA 3P7JA 4RKLA 2F95B 4K6LA 2JEBI 4IUVA 3K7AB 1JQYD 3I8ZA 5ITZA 3BYYB 5F2DA 2KOLA 5IT9E 1HCZA 4CKCA 4LNUB 1XI1A 3RGBA 2XSCA 4JI4B 1TY0A 1X32A 1QOHA 1X4TA 3MFGA 4XNFA 1X3QA 2VB3X 3JALB 3ONAB 1FYCA 5KGUA 2LY7A 2JA7B 3OTOB 2UUCB 1IW7C 3OEHA 2EJFC 4U68A 2LS01 1I4PA 1JE4A 4FLZA 2IX0A 4RHRA 4JI0B 1N36B 1B9MA 2EJMA 2X6LA 3U11A 3KUPA 1GHKA 4X65B 3H09A 2PUSA 3HG9A 2DY7A 2X69A 2V4DA 2XZPA 4F6RB 1E1QA 3E6ZX 2IW3A 2F0MA 4EQOA 4P22A 3EA6A 1SMYC 1GUNA 2UXBB 4FP5D 2A6ED 2PZWA 4FFBA 3RYCA 3V05A 5IK2A 4A93B 5KNCA 4X20A 2PNRC 4C3JB 2ZTNA 1J8IA 4X1KB 2L5TA 1BCPB 1J9OA 3A56A 3KLSX 5C3WA 1A2UA 4XOTA 2UXDB 5FK9C 4XLCA 1NUCA 3CU7A 4OIKA 2FMMA 2D62A 2ENBA 3CHBD 5CYUA 3S2DB 1F9QA 4KHPB 1G291 5JVH3 1WD1A 4XQNA 2UXCB 1QB5D 2K28A 5JPMC 3ZPNA 2EPBA 2NYZD 5IGGA 1E79A 2A5HA 4ZAIA 1ZKOA 1Z5WA 2ZT9C 5FO9B 1DXMA 4XYQA 1IYUA 1HQMC 5JEAG 3I4NB 2N88A 4AYBB 5G3LD 2KCCA 3QJYA 4JI2B 3OIPA 2G9HD 2PO4A 4OO1G 3J7AV 1F9PA 2KEEA 4HBNA 5KHIA 4EQNA 4TUYA 1ZAUA 3V96A 2JXMB 4LH6A 4KV6A 4NKLA 2KKWA 3BH4A 4LF9B 4NXMB 4F6RA 4G7ZC 3S15B 1OXSC 3SHLA 3SGIA 1B4OA 1SMYD 2WSSA 3Q0AA 1CM9A 1JFFB 4I50B 2FJ2A 1TA8A 3DWQA 4XONA 1VCIA 2IL8A 4DGZA 1FFXA 3GV6A 1S5ED 5KYLA 4H0LC 5C4ZA 1D2BA 3VR2A 5CBEE 3NWTA 1H8HA 2B8GA 3T4AC 2SNMA 3HP3A 1Q1EA 5LHY1 2LFNA 1DGSA 1I4RA 2TSSA 2GA4B 2F3WA 1D6EC 2YIBD 3P20A 3M3YB 2V7QA 5C4HA 3OEEA 5FNVB 5J22A 2F66C 1EYCA 4UCRA 4RKBA 1TQOA 4FM1A 4XQFA 3UI2A 4TV9B 4PMCA 2EZVA 4XKWA 2X6XA 1GUSA 1JFFA 4I50A 2DY8A 2WV6D 4F88A 2AQ1B 3VQYA 4KD4A 1CI3M 3HKDB 1PTOF 4X1KA 2CK3A 1EZ6A 3PN1A 4LFCB 2M5SA 2JE6I 4I9QA 1UD8A 3KLSA 1EY9A 3MC0B 1B04A 4NNJA 4J8QA 1EFRA 2L0CA 4PMWA 2VNUD 2XHBA 1H2SB 5A2QL 1QILA 1PRTB 3IFDA 4PI0A 1DOLA 1I6VC 3HKZB 4KTAA 4U3JA 1S5CD 2Q8TA 2SNSA 1EY6A 4LF7B 2B2WA 4KY6A 1SYFA 5KX5A 4K8ZA 1BDOA 3BG3A 1RJTA 2PTMA 3WDNA 1BOSA 1STNA 1SKYB 4EB6A 2D3LA 3A3GA 4O4LB 5CA0B 4EB6B 4XYOA 4YIJA 2K05A 1XHZA 3FKSA 4ZYSA 3NHHA 1CA5A 3G05A 3H91A 4HSPA 2KCNA 4WFN3 2WKDA 2Z6BD 2M2LA 1SNDA 1UUPA 3QG1A 2HCCA 5ELDA 3OAAA 1CTMA 1O9HA 1EEID 2IPKD 3GTJB 2VJIA 1SNCA 2JJ2A 2I46A 3DSQA 3KF8A 4F87A 3BA8A 5JCOA 3H6MA 3C3LA 1XMQB 3J81E 5DN6A 1N34B 2QE7A 3CP2A 3A7LA 1Z47A 4BWAA 1MI2A 1CZGA 3HEJA 3DWPA 5EIBD 3JATB 1CT1D 4B3GA 1AFPA 4XT1B 3S17B 1VJSA 3DEPA 2Z4HA 1FX0A 1ILQA 3JAKB 4JBWA 1CQFA 4NXNB 3R8BA 3ITPA 2CQAA 2ZXIA 2GK7A 2EYMA 1VF7A 2RSOA 1HFNA 1NR4A 1XQ8A 4EGVA 4LF8B 1D1IA 4X1IA 2L4NA 1N32B 3WOEA 3CMMA