2V4DA

Re-refinement of mexa adaptor protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
NTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Assembled Structure of a Complete Tripartite Bacterial Multidrug Efflux Pump.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords MULTIDRUG RESISTANCE PROTEIN MEXA
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2v4dA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v4dA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2v4dA02
3A8JE 3A8IE 2BE5D 1EWHA 3DXJC 1H9SB 1OXXK 1GUTA 1ONLA 2KCCA 1T5EA 1LABA 1Z6HA 3PUZA 1Z7TA 3T53B 3IKJA 2PNRC 2R6GA 2KA7A 3VR6A 1VF7A 3PUVA 1OXUA 2EVBA 2LMCB 5JEAH 3BRCA 1GUNA 5KNBA 2A6ED 2DN8A 1I6VC 1VF5C 1OXVA 3VR4A 3PUYA 3AB9A 1O7LA 5BN3A 3LWUA 2BDOA 3KLRA 1FYCA 2NN6I 5JJEB 4KKSA 1FR3A 4GYCB 5JJJB 5KNCA 3IFTA 4G7ZC 4OO1H 1H9KA 2CW0C 4L8JA 2IT1A 1Q12A 2B8FA 4H13C 3VR3A 4G7OC 2O5JC 3GD7A 2A6HD 2L5TA 5BN4A 1IYUA 4H0LC 5C0XH 3SDZA 3QJYA 5K36G 4IFDG 2D5DA 2E76C 5KNDA 2BE5C 1IYVA 3EQLC 3A8KE 3I72A 4G7HC 3FPPA 3H94A 1Q1EA 2K7VA 4LK1C 1VCIA 4DK0A 2EJFC 1B9NA 1PMRA 2E74C 1E2ZA 2JE6I 3WDNA 1GJXA 5JEAG 1VDZA 4JK1C 2PPBC 3RLFA 4DNTB 2B8GA 2DNCA 3OPOA 3T51B 4PV1C 1Q90A 3L7ZC 1HCZA 1V43A 1YNNC 2D62A 3A7LA 3ND9A 4KN4C 3VR2A 1HTPA 3GQBA 3BDOA 4RCNA 2A6HC 4DK1A 5C0XG 3WB0A 3QIAA 4HR7B 4LJZC 3M7NA 1BDOA 2BA1A 1GUSA 1HQMC 1V8QA 5D5QA 1B9MA 3M85A 2AUJD 2AUKA 2F93B 3WB1A 1CI3M 2K33A 3CRLC 3P20A 2A68C 2NN6H 2O5IC 1A6XA 1K8OA 2EJGC 1Y69U 1DCZA 1O78A 2JEAI 4TKOB 2F1MA 2V4DA 1HPCA 3CRKC 3I4LA 3U9SA 1GUOA 1ZKOA 2DNEA 2ZT9C 3PUWA 1CTMA 4GZYC 1RSOA 3PUXA 3D31A 2E75C 1H9SA 4DNRB 1H9JA 3ND8A 2Q8IB 2F95B 5BN5A 3VR5A 3BG3A 4KHZA 5A35A 1H9MA 3OW7A 3HGBA 4H44C 2A6EC 3WB2A 3VA7A 1Y8OB 5K36H 2D2CC 3MXUA 3A7AB 4KKTA 3FMCA 3LNNA 1DD2A 3N6RA 1K8MA 2NN6G 4KKUA 1G291 4KMUC 1H2SB 4TQUS 1GHJA 2PCFB 4XIGS 2A69C 1GUGA 4KI0A 2K32A 4OO1G 3T56B 4OGQC 3MFYA 3OOCA 1IW7C 4IQZA 2JEBI 1TKWB 4KN7C 1E2WA 3W3AA 3QG1A 1ZYRC 5D5PA 2JXMB 3PV0A 1GHKA 1E2VA 3I73A 5JJNB 1OXTA 4JBWA 4IFDH 1QJOA 2EDGA 1SMYC 1TU2B 1OXSC 1Y8NB 4XTCS 3D4RA 2YYZA 1DXMA 3SE0A 1Y8PB 4I7ZC 4BA1I 3NE5B 1CFMA 1Q1BA 2QF7A 3TZUA 4BA2I 2EJMA 2BA0A 3M4YA 2A68D 2AWOA 1IW7D 1YNJC 1H9RA 2A69D 1LACA
chains in the Genus database with same CATH superfamily
3JARB 3V7AA 3RVYA 1LTLA 1YX2A 1J5EQ 1KHIA 1GKFA 4PV1B 1E1OA 5KSWB 1TWAB 2OIGA 4TWKA 2P22C 5LMNO 2CWPA 4FLXA 1X55A 4Y52H 1KKCA 4KP4A 5AJ3L 1EYAA 4RCOA 5EGTA 1NAPA 3T16A 4HMIA 3CE2A 4K6LA 4R6ZA 5CMDA 4JI7Q 3GV6A 3AG3B 4JI2Q 4LWSA 2Q6KA 5ITZB 4J9ZB 2I5LX 3S15H 1JA1A 1I6VC 3OTOL 1S72V 2D0PA 2GVAA 3Q4HA 5TISZ 1NZ6A 3ZRVA 2WJYA 4X65B 2QKCA 4RJLA 1AE3A 3WG7B 3HPLC 4X7DA 4WCEV 4O4HA 1PTOF 1IBKL 3H1LH 1TUIA 3ML0A 1I94B 1SZTA 1ZM3A 3GIRA 2OQ0A 3BY1A 4IL6Z 3SLDA 5C3WA 5FO9B 1Q81W 4FLZA 1M8AA 1VQKV 1LTAD 2IT1A 4H13C 4CGYB 3LUTB 1BQZA 4OWTB 4GKKL 4X62O 3MHHC 4TMWA 2NN4A 2SNSA 3L72H 3UE0A 4A93B 2UXCO 2JA6G 4A3IH 1CA5A 2H4OA 4EQNA 4DV7O 4FFBB 4JI1L 2LO1A 4RO2A 4DR4B 4YXWG 4Q5VA 1SNCA 3NQIA 1VCIA 2JE6I 5FLXL 3PGZA 4QNHB 2PY5A 1CHQD 1PLFA 2QA4A 3F1ZA 1JFFA 4X0CA 2JP1A 1HA6A 2ZTEA 3ZIAA 4O2AB 3OT7A 4LBYA 2D62A 3A54A 1HTLD 5J1ZA 4P9OA 4CH5A 2A6HC 3VYSA 4PC2A 3SJZA 4B43A 5LL6Y 1I4XA 1G51A 1LNQA 3WBKA 1OZ0A 3OE7G 3UO3A 5DEDA 1QVGB 3OE7A 2ZZFA 1SE4A 1WCMB 2NVYH 3HKSA 4WJ3M 3WB1A 4P25A 1CI3M 5ITZA 2QTSA 1M90C 3PIPA 4X3SA 2O5IC 1XNRQ 2JDIG 1S76D 3J81j 4DR6B 1R3JC 2ADPA 1L1FA 4TMXA 1DCZA 1EOVA 3MVVA 5EKKA 1BCCH 1BCPF 1K8AW 2ZM6Q 2M00A 5LBQA 2Z1CA 4RHRA 3SXHA 1XPUA 1STNA 2JS5A 4DR7B 2GVBA 5C5LA 3ULPA 2ICIA 2OF1A 4A3GG 2E75C 4XT1B 4DV4L 2FXQA 5EBDA 4YXWA 5C8YB 1P7GA 4JI8O 3A5UA 5BXZA 2Q73A 2P4KA 1QNMA 2AQ3B 4PA9A 4YY3L 1N33O 2ASBA 4FYDA 4FZ1A 1CEZA 4ZHQA 4QUCA 1JCHA 3R66A 3K9AA 1Q82C 4LH7A 4D6TH 4OXPA 3E8FA 4KKUA 1ET9A 1G291 2PZTA 4FO2A 3AVUA 3GTQB 2F0EA 4OOXA 2PCFB 2XZOA 1RCVD 2HHHB 4N8X1 4IPCA 5A89A 1EZJA 3K06A 5IYDH 1PH4A 3D0FA 1LUVA 2RJZA 1E2WA 2CTRA 2N49A 3MHBA 3P1HA 3R2IA 2CH7A 1N06A 2C2WA 2SEBD 1NTKH 4KHPL 2C35B 1EL0A 1EFID 2Q67A 4DRXA 1L0LH 3CJHB 5LOVA 4I7ZB 4ZAIA 4XXEA 4HJ5A 3CSXA 3JC66 2ATKC 4DR2O 4PC3A 4XN0A 1CSQA 2RA4A 4RAIA 2B2YA 3S1MB 1KQSU 1CFMA 1D5NA 4EFEA 3WU2Z 5KMGA 1FNBA 2F0PA 2V7QA 1VQ7B 1F2ZA 2JA9A 3PIO3 1IBMO 1S72A 2JA8G 3L71H 4JV5B 2ZIOA 4Y9UA 5G3LD 4UP7A 2IH3C 3W5UA 2BE5D 3FRPB 2QKIC 2PO4A 1ONLA 4JCVE 5GAGC 3RN5A 1YHQV 1ZTEA 4TUYA 4XLEA 3PUZA 3T53B 2E1BA 1K83B 4AQYQ 4UB6Z 4AQYO 3CYOA 4P3YA 4QY7A 2VQEQ 1KYOF 3ZPNA 3HOVB 2JJ1A 5J35A 1GVPA 2WKCA 3OFNA 1K7DA 1HFGA 3F2CA 3TZDA 2FFKB 4PG3A 5E3FA 4DV6O 2UXBB 3PUYA 2ZD9A 4FIPC 2MPMA 3AB9A 3P7JA 3C90A 2CC2A 1A32A 1I3QH 4JV5L 1G6ZA 3MXPA 4U9UA 2DOSA 3JAWB 4GX0A 1VQMV 1I08A 2JA8H 4GYCB 2WA4A 3SVMA 2DERA 2CDYA 3SYAA 1H2LA 2E5LO 4RM0A 4YAOA 2DY7A 2YTYA 5IP9G 4G7ZC 2UXDB 1KNAA 1PD3A 3LNMB 4B3XA 2B2WC 3CC7B 3W5VA 3MCAA 5JVG3 1AZQA 2QTZA 1EQVA 3RLNA 3L75H 5BN4A 1PA6A 4DR6L 4G4KA 1AJNA 1YI2A 4WZLA 3TK1A 2NTTA 3TDQA 5IJ0A 4OELB 5GROA 1VQLB 4DR3B 4WFN3 2BVNA 1AROP 3PJSK 1V1OA 3FKSG 1EFWA 3T1YL 4FFBA 3A8KE 2RHQB 1LV9A 2GK7A 2B29A 2LKVA 4LK1C 4DAVA 3STLC 2EJFC 1D6EC 2FYUH 2F43G 3FEWX 2LW1A 4X66B 2B7CA 3BQJA 1I5FA 1TQOA 5IP9H 5CBHA 2Q8RE 4XDXA 1UEBA 1WTHA 4JPRA 4X64L 3FPUB 1KRTA 4BY7H 5A2QE 4ACBA 2NVXB 5IYZA 3GQBA 1FFXA 4IYHA 5C4XB 4NBSA 2YIDA 2X7RB 2NNUA 4JI5B 4BW9A 3TRZA 1F4NA 2BOCC 2R93H 1CT1D 2J7KA 2AHYA 1H85A 3MC0B 3M85A 2ZXRA 4DV4Q 1MABG 1WD0A 2CK3A 4YHHO 1EFUA 1HA3A 2X0KA 2XWJB 3D4DA 4JTDB 4BWAA 4P30A 1K9MW 2Z6KA 4ZGNB 1W35A 1WI5A 2K03A 2OT2A 1JB7A 3K03A 3RR5A 2WB1B 3TREA 5A2QN 4EB6B 4EKWA 2W6IA 1I94Q 4N23A 4S3SA 1V54B 4II2A 1E43A 4Z4WA 5C4XG 1H9JA 2K50A 2R9RB 1GR1A 2D9UA 2WKDA 4YALA 3G6JB 4AYBB 4QUFA 3I90A 2EILB 3E86A 3NP8A 3F2DA 1H9MA 1YHAA 1YJ9A 1E63A 2FHTA 4LCUC 1F20A 2ZZQA 4GNXC 3T4ZA 4JI2O 4KKTA 3AGPA 5TRDA 1JWUD 1SQPH 3CTAA 1M90D 4O42A 1Q6HA 4JI4B 3S1RH 4P26A 2UU9B 2UXNA 5FLXE 1N8RC 1Q6UA 2QWPB 2UUCQ 2VBTA 2DYRB 1H42A 1QR9A 4UV9A 3N2KA 1WORA 5A88A 4QMGA 5GAEC 1QHTA 1SE8A 4G1BA 5FPRA 4X62B 3W2GA 5IGDA 4FFKA 4JYCA 3UCSC 2ZJQA 1AR1B 1R9TB 2Y69C 2P4VA 5KAFZ 1TU2B 2BN4A 1HR0W 1MZEA 4Q0FA 4LF5L 4B3MQ 4DK3C 4RD2A 1AI5A 1DF5A 2CK3G 2YYZA 5B1BC 4ZUJA 2ZE5A 3STZC 5GONB 1NB9A 1Q1BA 2KHIA 1XEQA 5AFWA 1OCRC 3TZUA 2YICA 1GVHA 4BIOA 2KBNA 1JE5A 3DWQA 4X05A 2BM1A 3LWEA 4YWMA 1YNJC 4RDKA 3J81k 1F2MA 2BMWA 1AVMA 1YDXA 4RWUA 4HCSA 4BAYA 2FTKA 1H9SB 2EYLA 1SQFA 1PXUA 4N3NA 1SSOA 4B3RQ 1BSMA 1GN3A 5IYNA 3RZOB 4O0AA 1VQAA 2V31A 1A3TA 1K9MD 3CWBH 1PRTF 4WFBV 4QUZA 1EY4A 2FB5A 1WA8B 3G6EA 1PHJA 3UDIA 1IXBA 1UD4A 3PUVA 2A7WA 1BQ0A 4E6IA 3APOA 2L55A 2KENA 3W2HA 1OXVA 4GOPB 1LTTD 2L4NA 3L70H 5FPOA 3VQYA 3K0YA 5M3MH 4RD1A 1VQ8A 1R3KC 5JJIA 1F51A 2HMAA 5ELEA 4DYLA 3S2HH 4BY7B 2X8KA 3CRMA 1VQJA 1CZWA 1ZXTA 1YEZA 2DY8A 4IUUA 2DYSC 3CCJV 2CUGA 4C3JG 5IYBG 4ZI7B 1DDGA 2DN9A 3B8MA 2X6YA 1PTOD 4HSVA 1IB0A 1QVFU 4X64B 1PV0A 3C3TA 3ETQA 2XT9A 4FLYA 2ZTGA 1MNGA 2R6HA 4OOVA 1Q12A 1VQBA 2B8FA 2UUAQ 4IUQA 4FPPA 2N04A 2F0FA 5EPLA 3U6BA 2IJ0A 2L5TA 5CC4A 5I6WA 3TS2A 4QL5A 5IGGA 2F0SA 4H13B 2ZXWB 5F4JA 1I4PA 3DWPA 3P3NA 1XMQB 3EVKA 3M4QA 1CKMA 1C7YA 4YIOA 2MP1A 4L5QA 2BTQA 2K7VA 1IX9A 3WOEA 4P9SA 4I7AA 4PMBA 1JOQA 4AI8A 2ODMA 1IBLB 1E3ZA 3J80N 4ILWA 4A3LG 1I5YA 2X0LA 4Q20A 4P3IA 1EU4A 3W7UA 3EA6A 4JK1C 5JEAG 4BBSB 1B53A 5KRUA 5KHJA 3NXWA 1JA0A 1VF5B 1PTOB 3EFXD 3N2KB 5KX5B 1VQ5A 2N78A 4C2MH 1VQ4A 2GV9A 2EZPA 3WB0A 1NDHA 1B23P 1T5XD 4JI7B 1VQ9B 2O4XA 4UHVA 3TCUA 1ILPA 1EWIA 3M7MX 3FKIH 1QH0A 1XOUA 3SJPA 2VNHA 1MBYA 2WLJA 2YTXA 1I7PA 2A68C 4WBNA 4QE7A 4M1KA 5KA6A 1UUPA 3Q22A 4MS2A 5E1AC 1WU8A 1ENCA 2VBSA 4II3A 4YHBA 3I7FA 1PRTB 4NXNL 2YEVA 5KUKA 1FXKC 4V0BA 2I0QA 3WG7C 2WIIB 3EFFK 3CMAV 4Y7NH 3K0GA 2ZM6B 2VW9A 4GZYC 3D31A 2GTSA 4AQYB 4JASA 1PRTC 1KXLA 2OEOA 2YS8A 1GXDC 3NXSA 4RKLA 1OO9B 2EBOA 2EIMB 1O7IA 3LGJA 4K0KL 3W2IA 4H44C 5BR8Q 4YJ2A 4DXWA 1WTVA 5KLVH 3IRBA 5H9CA 1II3A 1NMGA 1ESFA 2WPDA 3TXQA 4PELA 5IJ0B 2KJXA 4RFBA 3J81i 3FFQA 3VBBA 4A3EB 4LFAL 3E1YE 4PC6A 4YCUA 3ZHTA 1XNRB 2KKWA 3BA9A 1ILQA 2A69C 1GUGA 2WB1G 5IYBH 3SJQC 3OW2B 1K28A 1U4PA 4KI0A 4MTXA 3AVYA 4OGQC 4J42A 5HFMA 1NH2B 3CCJB 2Y0SB 5I6YA 2E5LL 4CBVA 3GDEA 2JA7B 2JA7G 2OTJA 4MYTA 3WXMA 2PYLA 3A1PA 3CCEA 1JT8A 4X20B 3H09A 1UD8A 1STBA 1R9TH 1MGSA 4EGVA 3RUZA 3PCOB 5IGFA 1Q8KA 2EE1A 5K1PA 4FLWA 1NUCA 4AYBE 4DO2A 2IH1C 1PJ7A 2V7XA 3CCQB 1TY0A 3DWAA 4GN3B 2V7UA 1KBHA 5LYJA 4ASUA 4DV0Q 4U68A 4ZKCB 1EM1A 1FS0G 1E0BA 3OIPA 2QDBA 1Q81D 1NI8A 1KNEA 1PM9A 3A8JE 3H6MA 1U4LA 3JD1A 3HKBB 1ASYA 2JJ2G 2MW2B 2CWAA 3RD4A 5B3SC 1TVXA 1EIGA 1NR1A 5EIBC 2WFWA 3OR6C 1EIYB 2RMKB 3E8BA 1E1QA 1IDSA 3I4NB 4IOAA 2R7DA 4XBFA 3S16B 4TQFA 1I18A 3OSOA 5JPNC 4O4IA 3GVLA 1GJRA 2VWKA 4X1IB 1TAEA 2DQ3A 2SOBA 1O7LA 1PKXA 2P06A 4OPHA 4WWVA 2NPFA 4HZ3A 2N8NA 3TP6A 3MDSA 3OUSA 1FYCA 3HOZB 4QQBX 1CQFA 3ITPA 5EKLA 3O65A 5JJJB 4TVAB 4LF6O 2QDOA 2R7ZB 1MRZA 1JQ0A 5H5NA 1R3LC 1OCZC 3BABA 1I5XA 3G6EV 1R5OA 1AI7A 1BL8A 3AVWA 3OJWA 3ABLC 2SDFA 4X88A 3I4MB 4A3DG 5C0XH 1Q82W 3ZUGA 3KF8B 4BBRB 2GK6A 5I9OA 1G4YB 5B1AB 4XOPA 1S5BD 1DJRD 4U7NA 3A0JA 1KABA 4GLVB 5IWAQ 4MIUA 1JJ2A 4FVMA 1CNEA 4IPDA 3CCLV 3MWYW 3OW2U 4DR3Q 3J7AF 3MEHA 1WB7A 1FPOA 1Q1EA 4KL1A 1IBMQ 2R7ZH 1PVOA 2Q6AA 3AG2C 2WJVA 4R4OA 1AMOA 5CMUA 1XHXA 2NWGA 4XQNA 2RDCA 2UUCB 2VS1A 2EX3A 3KDFA 2VQFQ 2OTLA 1WSRA 5FKAC 3BU2A 4WF9V 2ZITA 1K97A 1ML0D 1V43A 3A7LA 2DGYA 3VR2A 1J95A 1HTPA 3UDGA 4JI4L 2HT1A 1RD9D 5DS0A 5C0XG 1J9ZA 4A3JG 2XAFA 1ZM9A 2X6XA 2XRSD 4B9WA 2B5OA 1JWSD 3FX7A 2B3GA 3ZIAG 2C2AA 2PTMA 2QTOA 3OZUA 5EZYA 3KLSX 3I55V 4JI5Q 4RQFA 4LFAB 2FJ2A 2UUBQ 3RNUA 4HNAB 3P20A 1FGBD 3CB2A 4WFGA 2ZJPA 5TY0A 2UUBB 5LXTA 1YNXA 2BF4A 2EJGC 5FL7G 3A74A 1FJGL 3HOWH 3VO2A 1A3UA 1F77A 2QWRB 1O78A 2JEAI 4I9WA 2PQAB 3OUFA 3UO2A 1QOHA 4ABNA 1ASZA 4UV8A 1ESRA 1G8ZD 1SFOB 1O9HA 3H3VC 3VYUA 4DR1Q 1M56B 5L3FA 1XWEA 3ZHVA 4DV1L 4GNXB 1M9NA 3A8TA 4WFAV 4G7XA 3VR5A 5A35A 1C48A 1M56C 1QQCA 1K8GA 1KUQA 1EN4A 2PI2A 4GOPC 1Y8OB 3GTMH 1NQTA 4AVZA 3QO7A 4CH4A 3PN1A 5LL6S 2EIXA 4HSPA 1DTOA 4NTWA 5J2TB 2WLIA 2CGOA 3GVMA 1OHHA 3RYIB 3B8HA 3R6KA 4XNFA 1KRHA 5DN6A 3R2TA 2ZL7A 2RC6A 3R93A 4XMYA 4I4TA 4XLAA 3T13A 4XDJA 4X66Q 3CCLB 1VQ4B 5C4ZA 2BH8A 4DUZO 4X64O 4F6EA 1EY5A 1VHEA 3JD4A 3E22B 1EP3B 1U9RA 1HR0B 1SS3A 3EROA 4DV3Q 3CRRA 5M3FB 3MFGA 1DZ1A 1UD2A 4UPAA 3CCLA 1GHKA 3K5OA 1BUVT 1E22A 1K83H 1X3GA 3A55A 4DU9A 4QCLA 1X59A 4JI3L 4A4IA 1W87A 1HNXB 5CA0B 4K1XA 1U5KA 2KCTA 1I6HB 1Y8PB 1Z9FA 2R7ZG 3NE5B 3CCVV 1TVCA 3KL9A 2DOGA 5BMVB 4J0QA 1DM0B 1FD7D 4P75A 1XMOL 2KECA 2YIBD 4A3GB 1XMQL 4UCTA 5LP6C 3GWOA 4ABMA 1V0EA 1PTOH 1EEFD 3RFRA 2A69D 4IJLA 5H1SE 3T1HL 4UP8A 3S1QB 1VQ9V 4PI2A 1GN4A 1GUTA 1TXYA 4PMWA 1AIPA 2VUMH 1HRJA 1VARA 2DYIA 1VQ7V 1Z7TA 1YITA 3ZZTA 1R5BA 2R9IA 3PO3H 2JDIA 2VJIA 1R3IC 1Y0YA 4O4HB 4A3CG 5LXTB 1GUNA 4G1VA 2DN8A 1WP6A 4LBWA 4OX9L 1XMOB 2IJJA 4LFCO 1UD3A 1YZBA 4X62L 2X6WA 3BDCA 4B3RL 5C5MA 5CN0A 1NRKA 4I5SA 2IU0A 2VBUA 5H59A 1NJID 4HN7A 2Q7GA 3S2DH 1SQBH 1QG0A 1JJGA 3OTOO 1Q3LA 3D6CA 5BY1A 5GQOA 5KGUA 1HQRD 3CCSV 1JR9A 3A0RA 1H9KA 3JALB 1YLOA 5FJ8G 5IT9c 1FXVA 3TP5A 3GVJA 3LVBA 2K32A 4RGTA 1YHBA 3CXCB 5HXBA 1CA6A 1CKOA 3KCYA 3KCXA 4CH3A 3K0XA 1N4CA 1GAXA 1W3SA 3VA5A 4DV2Q 1F60A 4MVQA 5CBAE 3G71V 3BY2A 1UE7A 5B66Z 1G7TA 4X07A 1NB0A 5FO1A 5BR8O 2E76C 4FP5D 1KB9F 2E2JH 4JBMA 5K5PA 3M99B 1DG1G 2ES2A 1QB5D 4G7HC 1AP6A 3MMPA 5E6TA 3G6BA 4UAIA 4DR6Q 2MK3A 1NR4A 3J7ZC 2P7TC 2UU9Q 2Z6BA 1WB8A 1WTPA 1H2KA 4B3RO 4WJWA 4JI8L 1YVWA 2GBOA 5B5EZ 3CC4V 2F4VQ 2A5HA 3GB7C 4GLXA 1FGUA 1TY2A 1YNNC 3D8GA 5CR3A 1FJGQ 1LLRD 1AJQA 4LF7L 2OCCC 3A56A 4A3FB 3K7AH 1CKNA 2KEEA 2A3QA 4B3MB 1HQMC 1PZKD 4BIZA 3UQ8A 3CRLC 1SQGA 3ZN0A 1MZFA 3E9IA 3U4ZA 3CPWA 1K73W 4EVOA 1M1KC 1ZM4A 1K4DC 1LTRD 4XLCA 5H6RA 3TMEA 3U4VA 3WWVA 3NSWA 2QW7A 1XHZA 3JATA 1JPXA 4TUYB 4LF8B 1QFJA 2EILC 3S15B 3PO3G 1DARA 2UUAB 3NTHA 4A3BB 4Z4UA 4K14A 1RTNA 4KHVA 4C3IB 1B2RA 2QR4A 1VQNV 1HNZQ 2R92H 1D5ZC 3JAMi 1BLIA 1AP5A 3GTKB 1Q5OA 4F6RA 4QF4A 1ZAUA 2MO0A 1L2FA 4NXNQ 2WPDG 1LTGD 3AMUA 4Z1MA 1NKDA 1N07A 4LFCQ 2NN6G 5LMZA 1T6YA 1FXHA 1H2SB 3CRQA 1JOKA 2F0WA 1KKDA 4DNIA 2Q5ZA 4ZGQB 2CAZC 2X6CA 1P8LA 4C56C 2BCCH 4RAUC 4X20A 3J7AV 5FJ8H 2TSSA 3VOUA 1FFXB 4LF6Q 3UT5A 2L6LA 4CKBA 1ZYRC 3H0GH 5DSZA 1SROA 2MO1A 3PV0A 4R1JA 3Q3AA 1OXTA 3ONAB 4YHHL 1XFOA 1IXRA 1VQGA 1ENFA 2W0XA 3I56V 2EZOA 4K8XA 3BZCA 3CB4A 1SM4A 1SMYC 3LQ6A 2MFIA 1UNSA 2NVTH 4AF6A 1B4OA 1GM7A 4DV7B 2D9RA 1LUZA 2HIXA 5IWAO 2JJ2A 2EXZA 3DGEA 2XIWA 4DR4O 5FO8B 3CXCU 5EYPA 4X89A 1IZ6A 1KD1D 4HBNA 4I65A 4UP9A 3S9WA 1EQQA 1NY4A 3M4YA 2A68D 3KJOA 4X9QA 4X6AH 1Y1WB 2VQFL 1QUEA 1T6ZA 1VJSA 3K6OA 4TSSA 3BCDA 5JEAH 4DR2L 1IBLQ 4RPDA 4K6DA 3T4AC 1W0KG 4XDKA 1CHPD 2A73B 2EFGA 3QFSA 4DQKA 1KL9A 2YTVA 1XNQQ 1QWYA 4JYAB 2XAJA 4FK8A 1YXBA 1FXKA 1ICFB 1L0XB 3KBXA 2YSUB 5CBEE 3ASQA 4KHPQ 3R8BA 1TVKA 2WAMA 4FZ0A 1JICA 1BQQT 1IHZA 1ZYRD 5C4HA 2MNAA 3J81L 4L5SA 2IX3A 4MN3A 4GKJL 2VXWA 4QJFB 3H3VH 1K3BC 4XQQA 1URFA 4MTFA 4A75A 2CH7B 2QM4A 4DR7O 2V7VA 1EWCA 3MAQA 4B3SQ 2QEJC 1N34Q 1BHAA 3F7YC 3U6KA 1YIJB 3TBIB 3KUPA 5KUMA 3CC7V 3HOYG 3NTIA 4JI8Q 2GPJA 1AEXA 1RQRA 4IFDG 1N33B 3A8KA 4N21A 4WFEA 3H15A 4G2KA 3L9AX 4DAMA 1VMCA 2UUCL 4RDLA 3T2MA 3K79A 3BVMA 2ZNIA 3P32A 4DV0B 4YJ3A 1LO5D 4PQXA 1NJIC 1EFRA 1B9NA 1N05A 5LHGA 2K75A 3NBHA 2R3ZA 3ZYYX 1Q6IA 2F0VA 1MOFA 2JSOA 4N9TA 3MZ5A 3GTMB 4DUZB 1B8AA 2VRZA 3KLWA 3KG2A 3QF7A 3X2QB 4DNTB 4DAYA 1Q7YC 3T51B 1KMIZ 1THZA 1SZXA 4PA3A 1IVSA 1HR0O 2GJPA 1K73D 1IL8A 1KDCA 2PQEA 3BA8A 1TUBB 3JAKB 2F4NA 1IKLA 1PH3A 1SE3A 4AYBG 5FL7A 4HR7B 2HHHL 4W4LA 1R6TA 5JCOC 1AI6A 3Q8DA 2KHJA 5NUCA 3OM3B 5L3CA 4YHHQ 3VNUA 1KDBA 3HFZB 1DF4A 4L5TA 4ZUIA 4XLFA 5K1XA 4XQFA 5M3MG 5C44B 1SC5B 4A3MB 1TWFH 1SYFA 1LTSD 3JCUZ 3U9SA 3Q6QA 3RY8A 4P1VA 3A2FA 1C8CA 4C3JH 5C8YA 2YWHA 5KYLA 1SETA 1AP0A 3PUMA 5GV7A 2Q8IB 4PI0A 4J11A 4X8AA 1A62A 4GLAC 3JSNA 3D36A 1PDQA 4IUVA 3TS0A 2VNJA 2LY7A 2F1LA 1XBLA 2BPOA 3ZJZA 3STBD 4XYQA 1V55C 2ZDIC 5IJ9A 4DV6B 2WLLB 4PC1A 2NB0A 3BHPA 1K8MA 4F7DA 2DE0X 2YDEA 4IT5A 3UI2A 4CKCA 3DM3A 4GKJQ 1PTOC 2FL4A 3G4SV 1EEID 2JYOA 5JEAJ 4XKVA 5H6QA 1IW7C 4DGZA 2LXKA 1P84F 2G5DA 3ZCCA 2G38A 1MSGA 3W5OA 1YSCA 1AJPA 1NR7A 1GM5A 1W6KA 1EN5A 1HZAA 2MUYA 4JBWA 3PIOA 3CF5A 2HDLA 4DV3B 1XUQA 3W7TA 1K5QA 2IJIA 4K0KB 1PZID 3HEJA 4A76A 4UVAA 2I5MX 5CBGA 1VLOA 4FWTA 2NYZD 5CORA 5HURA 4LNUA 3CCSB 3D4RA 1EP1B 1PH8A 1V9PA 2OTLV 1NJIW 3MEFA 4BA1I 3DC6A 2EPBA 4B7EA 1W2BB 3CAMA 4UZFA 1Z2GA 4DPGA 1S0VA 3L2PA 3CCMB 1JWMD 4DW1A 1NS1A 1N8RD 3T1YB 4AC9A 4LH6A 4OPAA 4CS2A 4RCYA 4TMTA 1IYJB 4H44B 1H2MA 3U11A 1L8DA 2OWOA 1UFIA 1YF2A 3W2EA 3RZDH 2XNCA 3JATB 3I70A 2LSSA 3E89A 4DK6C 1Q3EA 5M5YH 5EQ0A 3ABUA 1KK3A 4O4JB 2A79B 3BVZA 3HKZG 4HEDA 3CXHF 4DUYL 3S17B 1FDRA 2LMCB 1XMQQ 4JI0Q 3C46A 3BRCA 3GTGH 1N33L 1HWYA 2XHBA 1B04A 4LF9Q 3VR4A 1SQVH 4ZK9B 1UD5A 2YWFA 1DDIA 2CW5A 3KLRA 1GN6A 1W2BU 1PH1A 2L15A 4RUFA 4IUTA 3HOVG 1FR3A 5B1NA 3NPPA 4JTCB 5JJKA 2LXJA 4XKWA 3ZHRA 3R65A 3IFTA 3K8AA 5J9PC 1HZEA 2CF4A 4K5VA 2QEXV 1BT8A 1L1OB 4QIWE 3OW2A 3LQEA 1HNZL 1D8TA 2IJKA 4JYYA 3GD7A 5KHKA 5C6AA 3JD0A 1FNUA 3OMGA 4KV6A 3HS0C 3STBC 3CW2A 2XAQA 4RMFA 4DV2B 2AGAA 2JGDB 5HZBA 2W6IG 4JI2B 3CW2C 5KNDA 2Q9LA 4PA4A 4NXNO 4JI6L 3S14H 4LF4Q 3FPPA 3ABMB 1P7BA 2A9HA 2JGDA 2HQEA 2PI2E 3HZXA 4JBJA 2UU9O 2HDMA 2JJ1G 4IIJA 5H2FZ 3CEIA 1ZUNB 5BSYA 3A3GA 1WJJA 4KJOA 1XL6A 4PABA 4D7SA 3OEHG 2HCIA 2DJVA 3N52A 4TSFA 4C3HB 4KN4C 3QO5A 3G6EB 5C4JH 2WWWA 2DYRC 4ZBMA 3JAME 3QIAA 1HNWL 4YELA 2M9VA 4LF5Q 1CP9A 3F5WC 1HR0Q 1Y1WH 3HKCA 3OMIB 1H8EA 2JEXA 5LGUA 5DECA 2K33A 2M5SA 2CQOA 5CV5A 4IO9A 2KQ3A 3E5SA 1P4RA 2Z0SA 1QG7A 1Y76B 4BS9A 3R6JA 4P73A 5IT9L 4DR4Q 5IJ9B 4K5WA 3HOUB 2V1DA 1FRNA 2PNHA 1Q7YW 3I4LA 1YITB 2QWNB 5IYDG 3QWNA 2YU9B 1UE1A 3PUWA 3PO2G 3K57A 2QA4B 2I07B 4XDLA 5GW7A 3C3SA 3W2FA 4QHYA 2ZTDA 3PSIA 1XPRA 3W5HA 1E1RG 3BG3A 4FMTA 2ZJRA 4JYAO 3OW7A 2E75B 4K3AA 1H2GA 1VQLV 2AKWB 1W59A 3CQZB 1VMGA 3U9OA 3VA7A 3AK2A 1AW7A 1JX9A 3CMMA 1CK1A 3A7AB 4TV9B 1ZWIC 4LFBB 1I6HH 3SJCC 5EIBD 4OPOA 4IHJA 1BO0A 1LUWA 3OKXA 4KMUC 3K9SA 3T4DA 4GKJO 1MMMA 5AN9A 2PMDA 4OXSA 1C4QA 4OO1G 4RDJA 4U7OA 5ELFA 1VQ5V 3QFCA 3JD2A 1VS0A 1H95A 3D26A 4JI7L 1RODA 1TWGH 2F3VA 1TS3A 1N34O 4EH1A 3I73A 5JJNB 1DYQA 1WP8A 3AGQA 5AJ3Q 2Q0AA 4CBCA 5FK9C 2VWJA 1QVFB 2XTIA 2ZDIA 3B4SA 2ALYB 4G57A 4GCZA 2K5DA 2AQ2B 3SR1A 3K5LA 2E2HH 3FYIB 1VQHA 3S1NH 4B9XA 4MVZA 1VLYA 4IN3A 1EIFA 4L63B 2AMCB 2NZOA 1G8MA 1SA0B 4MTOA 4LUOA 2YV5A 4PD4F 4JI6Q 4WZTA 1D2BA 5IYBO 2D3NA 1KIXA 1VIBA 1IBLO 4YAFA 5GADC 3SEJA 4C2MB 4GNXA 2WA3A 2AHZA 2HJDA 3CRAA 5BZBA 2OYQA 2Z6BD 2Y48A 1NVPD 4FJCC 4P74A 2F4IA 4V190 2OBTA 2JA7H 2BSAA 3GTLH 4EB6A 3IKJA 2BOSA 1M4UA 3QE2A 2PQAA 2ZE7A 3CMAB 4A3JB 4IPGA 4JI7O 2JA6B 3QO2A 2IM9A 1S5LZ 3OAAA 1SMYD 1OCOB 1HJPA 2K52A 4KLKA 4PZ6A 5FOBB 3ZMSA 4HNAA 4QGPA 4UCSA 4KHPB 2WSSG 2IWHA 5IIFA 2VZLA 2PI4A 2ZKOA 2NVQB 2LFRA 3S3WA 2Z5UA 1CQVA 1VQNA 3OFNG 3IC9A 3C3LA 2Q6IA 4A3GH 4HJ9A 2QEXA 2GREA 3CC4B 4UY8C 2CTQA 3CCQV 2ZM6O 2IBZH 3JAMc 1XJVA 3HR0A 1EBOA 2YI8A 3E0JA 5E1FA 3DSQA 3C1FA 3TSSA 3NUCA 4UZEA 4DV1O 3VNVA 1BMFG 1Y14B 4IW3B 2B2UC 3ONYA 1EY0A 2NUCA 5D3IB 4DV1Q 1VQKA 3BC9A 2EYPA 2BE3A 5LHIA 1I3QB 3CQZH 3QJYA 2X85A 4G27B 3W7XA 4UCRA 5EBLC 1COWA 4LFAQ 1XREA 1ZEQX 1GO3E 5EYPB 1BBUA 3AK3A 2X3UA 1S5JA 5JAVA 3HOWB 4LMQD 2NV4A 1SERA 3WYAA 2WLHA 1WN7A 2NBFA 1XQ8A 4KUMA 4PAAA 2F0LA 3RW0A 2YUAA 1KC8W 1OJHA 5DM6V 4B7KA 3K5MA 3ZRWA 1WTOA 1JOYA 4HTHA 1J5EB 4PA6A 1D2EA 2VUMG 3HB3B 1E3PA 3RYCB 2HLDG 3ASNC 1SKVA 4E4EA 2QMUA 1QVCA 3GP7A 2RQXA 4YIJA 3I4NG 4POFA 3S16H 3EXAA 5C3XA 3CP2A 2F0KA 3RWRD 1FVIA 3KZIZ 4Z4SA 4UUJC 2AUJD 1MABA 1YJNV 3GTKH 2B63B 1H8HG 3JQQA 2IX0A 4GUNA 2OT5A 1K8OA 2XZPA 1Y69U 4X65Q 1WJZA 2K9PA 2YWEA 3HOUH 4I0XB 3T1YO 1IURA 2Z8LA 2GJRA 4D7TA 1FD9A 3FAVA 4NKLA 5B1OA 4DFAA 4IUNA 1HR0L 1WDTA 4LNQA 3SJAC 1WP7A 4PA7A 3RT3C 3M4OH 1R4QB 2R9AA 3AG3C 2KB1A 1O80A 1AI4A 1JVMA 1SDFA 3I4MH 3F5TA 4L6TB 4A93H 4P71A 1F9QA 1K3EA 2XEXA 1A8VA 3V2TA 1H8EG 4IYIA 2D2CC 1YEWA 3L9DA 3QFRA 3MXUA 2JGUA 1WPXA 1F9RA 2NTSA 2H3OA 5LMNL 4DV6Q 1KDAA 4MVMA 1K9MC 2GJKA 4TQUS 1STHA 4XONA 1CZGA 2D2CB 1Y1VG 1H2NA 4R4CA 4ULLA 4Y7NB 2KG7B 3CD6V 4XORA 3SLNA 2CH4A 1C9OA 3BS1A 2ZL5A 4IQZA 4NCNA 1BCPD 3DLLA 3GTPB 3I56B 1V0FA 2OXPA 4EQ5A 1C0AA 3U2QA 2E2IH 4W4KA 4RD3A 5F2DA 4U673 1F2YA 5IY0A 3ETGA 1YCIA 4CC6A 3E0EA 4IFDH 3IC7A 4X62Q 4RGNA 4RPBA 3BAAA 3JAML 4X7CA 4XN3A 1VQFA 2R7FA 5CYUA 4ID6A 1PV4A 1OXSC 1Y8NB 2FKXA 4XTCS 1BNZA 4K35A 1PPJH 4GKKO 5IE8A 4I7ZC 1BOSA 2TMPA 3K7AB 2K4KA 1SQQH 3BNWA 4F4LA 2RKSA 3Q6SA 3I5DA 1NSNS 1O7YA 5IYQA 2X6LA 4CHTB 3AEVA 2L9HA 4C1NI 1SE2A 5KYIA 2B9ZA 4CDFC 2XGTA 4JW0A 2GHYA 4NPSA 1HZ9A 3FAVB 1BCPB 2QE7G 1NNXA 1AILA 2PNRC 1NTZH 2X6GA 1VQIA 2CVRA 3CKIB 3H1HH 2K5HA 1SYEA 5JH7A 4HJ7A 5F4MA 5KNBA 3E2EA 1B3QA 1YJWV 5B6IA 4NB5A 4JI0B 1LT5D 1LR1A 4LF9O 2X53S 2IPKD 4E2LA 3S1MH 1JB9A 2JA5B 4Y9RA 2UUBO 2RBMA 5E79Z 4KKSA 2AQ1B 3GO5A 5IYCO 3ABTA 1RM1C 3BDLA 2JN4A 3KBGA 2PE3A 2RVLA 3N2GB 1K33A 3KYHC 2F4VB 2C5BA 2VUMB 2DJGC 4FNFA 1M90W 3B2EE 3P30A 4DAYB 5B1AC 4ZYSA 2E2HB 2OTLB 1N9WA 1KQSB 2PZWA 4CDDC 4HYOA 1EFTA 3EN2A 4ZKBB 4XM3A 5HGTA 4OX9B 3OEEA 3SDZA 5FLXc 1AR5A 1EOTA 1KECA 2OTJV 1SEBD 2D5DA 1Q9SA 3B40A 2YI9A 3FKIG 1SLJA 1Y67A 2BE5C 3CD6A 5BMVA 5LMUL 3TJTA 1GO3F 3H94A 2B2WA 4GKJB 3FVQA 4WJ4A 5C93A 3RBZA 2K5VA 1SNMA 1VQKB 1P49A 1RQPA 1I4HA 3G4SB 3S2HB 1NBWA 3WQZA 3CHBD 4NDXA 5C44H 5L3BA 5JVH3 5J3BA 1R6NA 1EZ8A 2QGGA 1OCOC 2EY6A 5IYWA 4F8MA 4LF6L 4TV8A 1AE2A 1E1TA 1XE1A 4X65L 2NLJC 4YY3Q 2P6JA 1LM0A 4ZCMA 3O9OA 1WFQA 1GH6A 1BE3H 4JI3O 3PA2A 1ICWA 1KK0A 2EY2A 4RD0A 3KLSA 2YXHA 1QUQB 2BA1A 1YHQA 4OIJA 4RGOS 3OGIB 1VQMB 3OJXA 3BZDB 1X56A 5IGBA 2EIKB 4PGOA 1H38A 4TV9A 4PDMA 4O4IB 1KTVA 2RC5A 3HG9A 1XYIA 1ZX3A 1TUEB 2HHHQ 2CTWA 1Q8IA 4DUZL 2Y4TA 2Z3YA 4I50A 1V5VA 4TKOB 2F1MA 2IW5A 3HKDA 3LDCA 4X1KA 2DQ0A 1HVXA 1DOMA 1MI2A 1OB2A 3ERSX 1K28D 2RN9A 2ZT9C 5ELBA 5M3MB 5C44G 5LGNA 3AFQA 1WTRA 3HRZC 5LP6A 5JVDB 1QR8A 2LGWA 2QSAA 3ABKC 3LDEA 3FKIB 4NP5A 4L87A 2VQEL 2WZPP 3NHHA 2R92B 1QZGA 3HOYH 1E24A 5IYPA 2VJJA 1B3AA 4XR6A 2YXLA 3WB2A 1KAWA 3U58A 1UPGA 3BZKA 3KOJA 2CNDA 1XMOO 4LFCB 1D1KA 3DUZA 4KHPO 5FLMG 3F2UA 1W0JA 4DA2A 4BPRA 3GTOB 5JJLA 4AIMA 1M1KD 1YNND 1YJNB 3TEHB 4DQLA 2K1EA 2Q4PA 4DRXB 1M57B 3OTOB 2HG5C 1STYA 1OCZB 2EJ7A 2F3IA 4I55A 4YIPA 1O9GA 3SPJA 4FM2A 4UZUA 1A0IA 5LA6B 1KMHA 1TUBA 1T9HA 2HQLA 3S24A 2JA5G 1JORA 3W1BA 5D5PA 4JAVA 3WOFA 3MHSC 1SNOA 1ENVA 2KVMA 4ME5A 2BTOA 2PYJA 1JA8A 1E79A 4IIJB 4QVJA 3URYA 2C5HA 5BR8B 4HJ8A 3GTOH 1TVKB 2H94A 3V96A 1DXMA 3SE0A 2QF7A 4B3GA 2UU9L 3GTPH 4DKAC 5CA1A 3ICEA 4RGMA 5LMUQ 3DEPA 3BPZA 3W2DA 1A15A 4A3LH 1E79G 5KHHA 5FLMH 4JI1B 2L11A 1B6QA 3BEHA 4XOTA 4A3EG 1J5EO 4A3FH 4CS3A 3MTSA 3PA1A 2XNAC 5DLQE 2R6GA 3CESA 2YIBA 3N2GA 4DV6L 1PH9A 2A06H 4H9GA 4J7KA 1OXUA 1BGYH 1S0UA 2EVBA 1QGZA 3DEOA 4MW3A 4BWGB 1L0NH 1E62A 4PDRA 1K73C 3KEWA 2HJFC 3LSQA 4ZOLA 1YJ9V 3BY6A 2BDOA 2HD3A 4IOCA 2UXXA 3CCUA 4BXXH 3FJOA 1ELOA 2ZTCA 2N88A 1XL4A 1JMKC 3QTCA 5IYZB 2JEUA 2EULA 3QVNA 5JH7B 4ZRZA 3K81C 4O2DA 4DR7Q 4LF8O 5FO7B 2OK8A 1FNVA 2P3MA 1MA1A 4PHZA 2L35A 2UUAO 1BHBA 1JFFB 2O5JC 5CV8A 4FXDA 2V7QG 2R70A 3ER0A 1FNCA 4HE6A 3CX5F 1IYUA 5A2QL 2PF4E 2NVXH 3OWFA 3GWKC 5M3FH 3ZMUA 2F0DA 5CA3A 1BZKA 5FLXN 2ILMA 4YWLA 1WTXA 2Q0OC 1US6A 4NTYA 4O2BB 1PRTD 2B2UA 2HVJC 3MXGA 3FP9A 1UE5A 2WACA 4AQYL 1U4MA 4BXXG 4DK0A 3HOWG 1V1QA 4JV5Q 3P3PA 1KC8C 3ZHUA 1J6QA 1EYCA 1JB3A 5GV8A 4R8IA 1B70B 5ELOA 3RLFA 4HIDA 4YEJA 2C4UA 2EJRA 4WORA 3L7ZC 1STEA 3H9VA 1H8HA 1GN2A 2FX3A 1WLEA 3SYQA 5IDJA 1FAFA 1NU1H 3THOA 2XN9C 5IT9E 1WTQA 2UXBL 2A74C 2ITDC 3JAWA 4K0KQ 1GO2A 4LC0A 1EY9A 1VQ4V 4ZOLB 5IWAB 3ASNB 2N55A 1QUFA 1JOOA 3TETA 4FM1A 4B3TQ 2LP7A 1D1IA 3P75A 1TR5A 2KHSA 1RF2D 2HKOA 1IBLL 3L3OC 2JA8B 1SQXH 3ZZUA 4MTKA 4YCWA 4HJAA 4J7ZA 1X6OA 3DM1A 1VQPB 4TT3A 1Q7YD 4YAUA 4BBSG 2ADQB 1QCBD 1WOCA 1VQ6V 1H9SA 3D3IA 2CHBD 2CQAA 2Q2IA 4LP8A 2V7TA 4RQEA 4JGSA 5T1IA 4APVA 4AHCA 4K8IA 2R93B 5CB4A 3G48A 4UVBA 4A3JH 4JAAA 2XOKA 3Q23A 2F43A 5C4JB 4LF7Q 1D2DA 1FNWA 4C1NK 4JI0O 2BV3A 1RIPA 2CH4W 1SBBB 4LF9B 4P2ZA 2JJQA 5CA0A 3LNNA 5EBCA 4ZCKA 4A3IG 1M57C 3CCQA 1N32L 3B82A 4PMCA 2CTPA 2IJHA 1QGYA 1GKHA 1WD1A 2XOKG 4M53A 2DETA 4XIGS 2ZZEA 2ZM6L 3G67A 3QG5A 4BR6A 1QVGU 4FXUA 3PQIA 3MFYA 4LUZA 4KN7C 4FF4A 1WTWA 3PO2B 5FIUA 3CCEV 1R6KA 4FF2A 3TN2A 4BBSH 3GTLB 3DDYA 1OTCA 3AG4C 4HAMA 4B4DA 4NXML 4JF3A 2D74A 3I91A 4DV5O 1F2LA 2MGSA 1FRQA 1UMKA 1X3PA 1AZPA 2JIZG 2C78A 2ZXIA 2DW4A 1B1ZA 1TT2A 2DUDA 3B78A 5C0XI 1YJNA 3M3YB 1VQ8B 4J9YB 2ENBA 2RDGA 4TRDA 1K0RA 1W6JA 1FNMA 4HIZA 4GOPA 3EJIA 4X1YA 3J80E 3GSIA 4DV0O 1TLLA 2EINC 4ZV4A 2BA0A 1IW7D 3N6RA 2ARHA 2O2LD 2BGJA 2NZ1D 4JYBA 1EP2B 1X3FA 1QX4A 1BCPC 3P26A 2DWEC 1GAWA 4P12A 1U0LA 2Z4HA 3JQRA 3CXCA 3H9NA 1VQPA 2HEPA 4QV2A 1TWHH 1X32A 3EVQA 3K3WA 4I50B 4JI3B 3SK4A 2QEXB 1HH2P 2WINB 4BIUA 1PH5A 1VQOA 1KP3A 4K5XA 4JI3Q 2ZINA 4E0FA 3DMUA 4WFHA 4LF5O 3B77A 3ZBHA 1G1XB 3Q6RA 3ZC3A 3W7SA 1PZJD 1YZ6A 4XL9A 5EBWC 1AR4A 4LF4B 2BOBC 1I4GA 4K2KA 4ZQ3A 4A3EH 1TS2A 1DOKA 2V1CC 1KJZA 3HOUG 2XUMA 1L0YB 4K8JA 4YWKA 3T1HQ 1EIHA 5EBMC 5KX5A 3HOYB 4J6HA 4OO1I 4OO1H 4FN5A 1N8RW 4P72A 4L8JA 3H0GB 4LR3A 2WSSA 3ZZ0A 2VL6A 1YTFB 4JC0A 1N0NA 5EKIA 4A93G 4G7OC 2ATWA 1OB5A 3ZHSA 4QPKA 2HDNB 1MSDA 1RPRA 1EXMA 1CUKA 2PI5A 4ZCLA 3FB6C 3CHXA 1MG1A 1L1OC 1QCEA 3MXNA 5KHIA 5HFLA 1HZCA 1K0SA 2VNKA 4HE5A 2BCOA 2ZXPA 2E74B 2EY1A 1BBXC 1SESA 3VQVA 1SJHD 3AG1C 1YJ9B 3MXNB 2XZLA 1TGOA 2MJ8A 3OAAG 4U3JA 1CXZB 1K92A 3GVKA 4N3GA 1VDZA 4UCOA 4G7WA 3WNCA 1SMXA 4R8NA 1HHVA 4P9PA 1V1PA 3KF6B 3RN2A 2I1LA 5IYDO 1WOOA 3VR6A 2Q2HA 3IFDA 5M5XB 1EFRG 4B3SL 3E20A 4DV3O 3BDOA 4A3KH 4DK1A 4K0KO 1Y74A 4YY3B 3JASA 2QGQA 3M3YH 2PZSA 2WYRA 1A63A 1GUSA 1B2TA 1YTFD 2F4VL 3WNDA 3M4PA 2VB3X 2M7WA 1X4TA 4MVRA 1YVCA 1I50H 1GM9A 2NN6H 2VB2X 5DAUA 4GX5A 3CPWU 5IYCH 1CPYA 1PL4A 2PLFA 2GUZA 5THXA 4CS4A 4JI1O 1EZ6A 4DV7L 4BW5A 1W34A 4MTNA 1HPCA 2V4DA 1KC8D 1KAAA 4X66L 4KXRA 1A8PA 3DXRB 5L46A 3NWTA 3ZRSA 1PFMA 4CJ2C 1QLEB 3GTGB 3CCRA 1YJWA 3BVGA 1NTMH 3JARA 5BN5A 4F87A 3U50C 3UDXA 3BCFA 5LYJB 1Y1WG 1SNPA 2LGQA 4G5GA 4TOIA 2R61A 4C7UA 1VHOA 2OIEA 5HZAA 2K5WA 2VY3A 4QPJA 1XX8A 1GHJA 2RNBA 3HKCB 1Q43A 1GD7A 3KFUA 2HIVA 1TS4A 3FB5C 3CP1A 2E8GA 2VNIA 2KUMA 4C3IH 4F7XA 4GX1A 5LGTA 2VQFB 3OTOQ 3B09A 3W3AA 1HXYD 4IUPA 1N0VC 4O4LA 3ZX6A 5EC1C 2XGJA 2R72A 4HIMA 3PENA 3CCVB 2KG7A 4BBRH 3HKZB 1QJOA 4DV2O 5LMNW 4UVCA 2SNMA 3KJPA 2Q2TA 3FYEB 2UXCQ 2K05A 4GKKQ 2R93G 3QO8A 4NXNB 3FKSA 1SYCA 4O2BA 3KK7A 4MHEA 3OEHA 1J9OA 2AXTZ 4YJ2B 1XXGA 4LAAA 1IBKQ 1V54C 3BYYB 4NMZA 1TWFB 1QFYA 1IBKB 1QLNA 2PW5A 3VYRA 2PMZE 1FKAO 1XB2A 3BVOA 3OZWA 1EQTA 4TT3G 1MHWC 1OXXK 2XTAA 4P2CB 1T5EA 4RH6A 4DV2L 3OIQA 2OYNA 3DXRA 1BVSA 1IBML 1Q82D 2E2IB 4I0XA 1S72B 3IFXA 2K28A 3O13A 2WAQB 4NVPA 1XNQB 1YIJV 5KMGB 1CNFA 2AZ0A 2WLKA 4KY6A 1STAA 2A6ED 3QB3A 1IHMA 1X3QA 1N36Q 3WY9A 1N36O 2G9DA 4DR4L 1VP7A 4JOIC 3GTJB 4ALPA 2EYHA 4A3MG 4R4TA 5JQGB 2EXDA 4QGUA 2VNUD 3CCEB 1Y66A 1O7ZA 1NMFA 2L1BA 1PNMA 4DV0L 1Q86C 2Y69B 2OBSA 2OTJB 1G2SA 1YITV 1LTID 4C3HH 1OCCB 4FK5C 4RCZA 1JC7A 4WQMA 1LT3D 1GK9A 1SYDA 4JI5L 1NVPB 2RQ6A 4YJ3B 2A19A 4OHJA 3GTJH 4GS3A 2Y0IA 4R4IA 4DV5L 2F0HA 4DV4B 2ZIMA 3E83A 5L3DA 4DUYO 4EFBA 2I46A 3JYCA 4JYAQ 3S1NB 2B63H 4DR7L 4LFBO 1D7QA 1VF6A 3SJBC 3UE1A 5I9PA 2ZE6A 3J80L 4RKBA 2W6JA 5TSSA 4CH6A 3V76A 2E74C 4FLVA 3WDNA 2F23A 5DM63 2CKZB 3OMCA 5JJZA 3ZHQA 2RSOA 1K8AC 3H0GG 3M4OB 5L3GA 3NBIA 1BX1A 4X1KB 2UUAL 4R8CA 1GM8A 5LMNB 1N34B 2Q7EA 4DV5B 4DW0A 3CC4A 2QJ1A 5IGEA 3VQWA 4IFDI 4QVAA 2Q2UA 2EIKC 3JCZA 4PC7A 1LT6D 5J2UB 1WNSA 1BS3A 4R7CA 4HAEA 3K80C 3ZBTA 2F0NA 3KKYA 1VQMA 4NB3A 1JJCB 4JI2L 2B63G 3FD9A 1SNDA 3CRZA 1VQEA 3F7VC 2EIJC 1B44D 2Y0SE 2DMXA 3BH4A 1HNXL 2C5CA 2ZE8A 3QFTA 3CRKC 1A2TA 3MD0A 4CQJA 1EZVH 5F2VO 1KTKA 4KTAA 1BKBA 4DF7A 1Y6XA 1RKNA 4K2LA 2AWNA 3EBEA 3RGBA 3A8JA 5E4XA 1PH6A 3PF5A 3OHXC 1E3XA 1WPBA 3CP8A 1PNLA 4KHZA 3UDFA 4B47A 2B2YC 3NR7A 3HOXH 4EQPA 5DM73 5GONA 2CRVA 2EYOA 1XMOQ 4WBNB 1QGAA 5IODA 4NKGB 1WCMH 3L73H 4G28B 4YCVA 3W7WA 1V55B 2UUBL 1Q81C 5KNLA 4C3HG 4LW1A 3RYFA 3SYCA 4LUVA 5HKKA 1TWAH 1PNKA 1YI2V 3CCMV 1S3JA 2J4XA 5IOCA 3AU7A 5CDFA 2JXMB 2QDXA 5JPMC 4DV1B 1IKMA 3SYPA 4U3JB 2B7BA 1CM9A 3Q4HB 5IP7G 4OX9Q 2C4TA 1TWCB 3A8IA 1X3EA 3IL8A 3T1CA 2F0JA 3CC2A 1AN8A 1IL2A 2E2JB 3ZN1A 4B3TB 1FXKB 3E8HA 4IZ8A 1R1BA 4GX2A 3PVDA 5ELDA 1PH7A 1NT2B 4Z9CB 4CKEA 4NTXA 1UD6A 1XNRL 4XLHA 3K04A 4ZKIA 3FB7C 5L37A 5M5XH 3A8IE 1STGA 4XT3B 1SKYB 2X6BA 2WR8A 4GZRB 4DR1O 3FDTA 4UB8Z 3LX0A 4N9PA 4WRDA 4DN4M 2A8VA 1RSOB 2Z0AA 1Z6HA 2Z4IA 2Z6KC 1NH2D 3HKDB 4RUEA 5DN6G 3LDDA 4ZI7A 1NE3A 4LF7O 1S4MA 4UCUA 3SK6A 1RDPD 1JJOA 5JQGA 2PW7A 3IAYA 2ZR2A 1QFZA 4EX5A 3LWUA 4OWWB 1G91A 4TQDA 3HKEB 5J2UA 5EAYA 4HIKA 1F4MA 1CKNB 4LWSB 1QUQA 2A0LA 2NN6I 3NWSA 4M1UB 1VQCA 5JOBA 5C3EG 4GT1A 4OPSA 3L0OA 4X64Q 3OZVA 1FX0A 3E3XA 2PZUA 5E7NA 1AH9A 4PDLA 1EWYA 5FO0A 2QCPX 3M8AA 4X3UA 1FJGB 1ET6A 1TWGB 2EIJB 4PZ7A 2E76B 4K8ZA 1GRJA 2H8PC 1W0JG 1KU9A 2ID0A 3RLOA 2A6HD 3E35A 4Z1VA 3BYTB 2LS01 3OD4A 4NYKA 1KD1C 1XTCD 3HOXB 4JI0L 4B48A 2B39A 3HOZH 2IU3A 5KAIZ 2LJ2A 4DR2B 4TMZA 2K6AA 3I72A 4X1YB 2BSKA 4LBEC 2WLNA 3ZMZA 1VQLA 1HFNA 2HCJB 4Z4RA 3CP0A 4N8FA 4KJNA 2YWGA 4MTGA 3SPHA 1BR9A 3D3RA 2ZBUA 4JV5O 1I50B 2ZCEA 4M2LA 1UWVA 3N27A 2VQFO 2GA4B 3AG1B 2B8GA 2C9OA 1HP8A 4LF4L 2F66C 3JALA 3M9BA 4UDUC 3K0DA 3TP8A 2OCHA 3AEIA 3UT5B 4C0SA 5IP7H 2CCZA 2QN6A 1HNZB 1R4PB 2Q8VA 1B7YB 4RCNA 5ELCA 4XQJA 3M7NA 4LJZC 1Q46A 5LHY1 4A3BH 1TA8A 3SDLA 3ASRA 1D1NA 1V8QA 5CV4A 4LFCL 3SHLA 4GKKB 3HOZG 4OIKA 3UKMA 2UXBQ 1PJ5A 1Y74B 3T1HO 2CFMA 3J80i 1BMFA 3IJ4A 4UCVA 1IBKO 1EYGA 3AVXA 2ZTNA 1I4QA 4JI1Q 2AW9A 2E1RA 1E64A 2ZR3A 5B1BB 3FHWA 5ELNA 1COWG 5BR8L 1SFOH 4Q7JB 1DK1A 4GQNA 3SKBA 2UXDQ 1YBYA 3DC5A 2P90A 2P5ZX 3HKBA 2F95B 3A5ZB 4JVZA 1HNWQ 1T6XA 1HNWO 2YEVB 4RWSC 2JN9A 1QLEC 4A3DH 4RLZA 4DV7Q 2PGGA 3U0ZA 2YIAA 2CGNA 3LSSA 2ZXWC 3OMNB 1N36B 1EY8A 1RHPA 2LFNA 2MHVA 3B6YA 3NENA 4LNUB 3TXSA 3RMHA 5C3EH 4Z1MG 3CCSA 1I0HA 4LBZA 1FL0A 2NVTB 3S1QH 1E1QG 5J22A 3S2DB 2J7ZA 2EYFA 3A0HZ 1YNJD 1UEAB 3T56B 3CCVA 3S3XA 4P22A 5FNZA 4X66O 2D3LA 1KRSA 2F4VO 1Y1VB 1S5HC 3PO2H 2XASA 5IYRA 5E4WC 3ZEDA 1J8IA 4OL7A 1G7SA 4Z4VA 3QNEA 2LZJA 2F0IA 2DYSB 2Y0SG 1VQ6B 3MA2B 4DV5Q 4ACAA 3HP3A 2YC0A 4ASUG 4OX9O 4M8AA 1MJEA 2JA6H 4JI5O 1TWHB 2IW3A 4AF7A 4DV4O 4EQOA 5CV7A 4MT8A 1N08A 3AFPA 3ZJYC 5D14A 2CBXA 2P67A 4DR5B 4FDBA 4H37A 4FXKC 4YHHB 1FNDA 5F4OA 5I2XA 1Z5WA 2QE7A 3EIVA 3ZRXA 2FVGA 4KY7A 4LFBQ 3AVVA 1EYDA 2AWOA 3Q39A 4MYUA 1S5DD 2XNDA 3IGAC 1TTTA 5FNVA 2N3SA 2ITCC 1SF9A 3I8ZA 5LP6B 1PKVA 3DTUB 1X65A 4XD7A 2QKSA 1B50A 3D6WA 4JMQA 2ICEC 3C1EA 5AG2A 2JQOA 1PYWD 1SR3A 5LMNQ 4O1NA 1P4MA 3VDYA 4A3KG 4JZGA 4TN1A 3ASOC 5IY5B 3ABKB 4P6YA 1FFTB 2GSMB 4QFMA 2ZXOA 1VQ7A 1N33Q 2GUZB 1MKHA 1XILA 2KQXA 2F0GA 5A9GA 2RDHA 2Q69A 3HKEA 2GQFA 4OOSA 5COYA 3Q0AA 3ETDA 1VQNB 3A0BZ 1QVFA 5BN3A 1RM1B 4JI4O 3H3VI 5JWPA 4JTAB 1KZLA 1ZM2A 1VQOB 3K58A 3JAKA 4LF8Q 2HP8A 2Q7HA 3AG7A 1N32Q 1DONA 1CQXA 4A3FG 5IWAL 3RYFB 1OB0A 1OHHG 2Q68A 3H1IH 4QIWF 3MHPA 1E1RA 1Z47A 2F0MA 1KLUD 2BDNA 2J0TD 2CE4A 1IYVA 3EQLC 4MVOA 4X06A 4B3ML 2OQKA 2WB1E 3CC2B 3X3NA 1VF6C 3X2QC 1UJWB 2EQSA 1N36L 1ROPA 3H1JH 1S3OA 4FM0A 2F03A 2LFSA 4R71A 5L3EA 1I8DA 3ASPA 4HMJA 5DNFA 1BBWA 1L1OA 2IX1A 1NR2A 2DNCA 5C4XH 1S5CD 1Q90A 3E22A 3ETEA 1SAPA 3PIP3 4X3KA 3VMFA 2AHOB 4NR1A 4BBRG 4UXNA 3I4MG 2QGNA 4A3DB 2HR3A 1PFBA 2DJFC 3E6ZX 4QJFA 2M6YA 1BDOA 4Q6GA 1EY6A 3CCUV 3D4WA 5J2TA 3G71B 2JRIA 2AUKA 2F93B 2N74A 4B3TO 2UXDL 3K59A 3UM7A 2HLDA 1N0JA 3DHQA 1JQYD 4P6VF 4M4SA 3AK1A 3PMFA 4JOIA 5CV6A 1A6XA 4J80A 5LMUO 2OK7A 2E5LQ 4JI6O 1MSWD 3E9HA 4ODGA 4HIOA 3PO3B 3T1YQ 4DR1B 5CB4B 2I5HA 1ZKOA 2DNEA 5I4DA 3ZS8C 4Z2WA 4B3SB 1RSOA 2BGIA 1VMPA 2RCNA 3KDFB 4IJHA 4KD3A 3ND8A 5FNVB 1GAQA 5H5JA 1S5ED 4NNJA 4LF7B 2WAQE 3I4NH 4Z4ZA 3J80c 2XAHA 3H01A 1W2BA 4H33A 5G3LF 1HNXQ 1XMQO 5K36H 1QZHA 2B2TA 4LBVA 1VQDA 1VEWA 1DD2A 3ASOB 2X69A 1OGIA 4UFZA 2VBVA 2K1BA 4MZ9A 4CZZA 4ZLTF 1G2TA 4OGQB 5EZYB 1TWCH 1R73A 2VS0A 2N05A 1S40A 1QU7A 3A35A 1YHQB 3RVZA 3CC7A 2XAGA 3VO1A 4ME3A 1TIID 4MNOA 5D65A 1XPOA 3K5NA 1TKWB 2EYJA 4DUZQ 3J7AU 2B1IA 1FJGO 1RJTA 1BXTA 3QG1A 5HGQA 3OP1A 1SYGA 2K01A 3CCJA 3H91A 1E2VA 2NZHA 1NCVA 3RYHA 1U4RA 4I4TB 4F88A 1E7ZA 3U10A 3JSLA 3RYIA 1MD2D 2WV6D 3I4OA 4IHJB 2Y0PA 5KHGA 3NK9A 5M5YB 1XTDA 4NXMO 3ABMC 1JJ2U 3ASSA 1D5MC 4BA2I 4WFFA 1ZSPA 5GTHZ 2V7WA 5C0XJ 2FMLA 4MVSA 4O4JA 1U96A 2B2TC 5HY6A 1NTGA 3H1KH 5B3SB 3KF8A 1IXMA 5IYCG 4NW2A 1EWHA 1X54A 3DXJC 1OCRB 4GN5A 4PNYA 2NVQH 1Q86D 2KCCA 1LABA 1KQSA 5KIXA 5IY5C 4B3FX 3APQA 2FMMA 2LQTA 1ORQC 1HNZO 5M5WH 1GMGA 2KA7A 3I55A 1BQEA 4EEQA 1A3VA 4R9WA 1VF7A 3F8TA 1EFCA 2RCVA 2XNDG 4IGGA 3E8GA 2QM7A 5I2YA 3ZMTA 1LT4D 2GDSA 2B2VC 2ZBVA 2K5NA 3CCUB 1HUNA 2DIEA 2QILA 4M0LA 3T1HB 4X1IA 4CDEC 4JI4Q 3JASB 4CJ1B 3LSUA 3WNBA 1XNRO 2JVDA 2D3OW 4J8QA 1M93A 5TR9A 1VQ5B 4O4LB 5KNCA 1IZ3A 5LL6X 1CSPA 3ABLB 1V1PB 3KF6A 3OR7C 5M9OA 1HUMA 4OP7A 2G9HD 3BFRA 4H0LB 3ZRWB 4I55B 4IALA 2PPBC 1F23A 4RD6A 4JG2A 3VR3A 2DWDC 1XNQL 2BH2A 1AFPA 3HOXG 1PP9H 1RP3B 1KD1W 3CC2V 1HNWB 1EQRA 3I2ZA 4KD4A 3ES9A 5K36G 5A8AA 5EPJA 2JK5C 1PH2A 2IHEA 4A3CH 4OPVA 3OWEB 4DUYQ 1N32O 1Z5VA 4ZHQB 1UAPA 4FXGC 2KVOA 2X6AA 1Y4MA 2HFEC 1Y1VH 4ICGA 3HAGA 3ISXA 4QE9A 2JIZA 3GV3A 1PMRA 4XYOA 4JYAL 2VQEO 1E2ZA 2EINB 1VQPV 2KEDA 4DR1L 5JVDA 5M3FG 1QBZA 1WAZA 1W9XA 1JR0D 3OPOA 4IURA 2ZNJA 2WLMA 1VQOV 5KA5A 4Z4YA 2F0TA 3K7UC 3ND9A 1U97A 5LA6A 2VZAA 4FLUA 4J15A 2R92G 2HVKC 2BM0A 1LTBD 3J7A5 1NBMG 1DGSA 3SYOA 3LO8A 4P2NA 4GN4B 1PYSB 3CPXA 5D5QA 4RD4A 2YXYA 3G7LA 4I9QA 4DR5O 5DEHA 2ZL6A 4DV3L 1K4CC 4RG1A 1I94L 1VQ9A 3ZBUA 3ASTA 4TSFG 3G80A 3RZOH 5GTIZ 1PFNA 2QKAA 4X65O 1QNUA 4NXMQ 1F9SA 4MW8A 2AHOA 2EYMA 2A1AA 1BJKA 5C3EB 4LF6B 1GUOA 5LHHA 1I94O 4FF3A 2EIMC 3D8CA 1D8LA 4J41A 1U2RA 1CTMA 3G05A 4QIWB 5EJWA 3G4SA 1D5XC 4DNRB 1WYDA 4DXGA 2K04A 3NBHB 2C77A 1RL2A 1BPLA 3NQTA 1S77D 3S17H 3J81N 3CCMA 2BTQB 3HGBA 1MSHA 4X8IA 2A6EC 1SA0A 2E2DC 1SNQA 4LF5B 2UXCB 5J39A 3SEBA 2F0OA 5CA1B 1A2UA 3CD6B 3NEMA 3B8NA 3NTKA 2PUSA 1KK1A 4BY1G 3C2PA 4LF4O 2RDFA 1SXTA 1GTOA 3BJUA 2AZ2A 1KLGD 2OCEA 4C3JB 1SYBA 2F0QA 4WZEA 2F0UA 1WPCA 2M2LA 3ERQA 3VYTA 5BSXA 4TMVA 1VQ6A 3OEEG 3CMEA 3OOCA 1KP2A 2UUCO 4YAWA 1Q86W 1QNKA 2JEBI 2JK8A 3AYHB 4DXFA 1JCKB 3J7YW 1KK2A 3J81E 1JE4A 4TV8B 4FF1A 4O2AA 1BX0A 5KEEA 4DR2Q 4MSWC 3SR2C 3CMEB 2W6JG 1FYJA 1DOLA 3J81c 1ZL8B 3SPIA 1F9PA 3QR8A 3AG4B 2XSCA 1NBMA 2EDGA 1P16A 2HCCA 4KK7A 3GTQH 3PF4A 2F52A 2WLIB 2H1EA 1W0KA 2PYKA 5D3DA 4C3IG 4AILC 5J3OA 3JAMN 4LFAO 5JBQA 2Y4UA 4F6RB 4ZIBA 1XI1A 1EY7A 1BF4A 3SPGA 5TV2A 4X3TA 2XVSA 3AVTA 3CMAA 4DR6O 2NVYB 2OBRA 3SK5A 1HDJA 1H9RA 4PV1C 4B08A 3OGCC 1LACA 2WZNA 2EJMA 3Q38A 1G7RA 1SJED 4X7EA 3CRCA 4A3KB 2JA5H 3TP7A 5IGCA 1YJWB 2IY5B 3JD3A 3CCRB 2EZVA 1GUWA 1IJFA 1PJ6A 3D36C 4MVUA 5CGKA 4J7JA 3QSYA 3R3OA 1JMCA 4BY7G 3ZMVA 4JI8B 4JZ2A 2EY5A 2L12A 4YY3O 1IJEA 1N0UA 2EIFA 4AH6A 3QOJA 4LFBL 5FA6A 2XWBB 1SRYA 1WSVA 2D0OA 2IL8A 3CPWB 1GOZA 5T1GA 3WFVA 1I7FA 5EMNA 1VF5C 4RA8A 4CC5A 3S14B 2JS3A 1RTOA 1J5EL 1K34A 3FB8C 4DR5Q 1G7CA 5GAHC 1N34L 3VQXA 1WCMG 5LMUB 5JJEB 1QVGA 2QTLA 2L0CA 4IPHA 4JI6B 1LYLA 4IFDJ 2HHHO 4J1MA 4Y7CA 1WA8A 5JCOA 4G6IA 3AQQA 2GTAA 4B3SO 2CW0C 4ZCIA 3I56A 1G6UA 1L0WA 1XDCA 2PMZB 2W0FC 1MIUA 3JQPA 3WBJA 4OWXB 2P5OA 1Y0RA 4H0LC 2O57A 1I4RA 1OCCC 4U3FH 3EHBB 4PDVA 2EOTA 4BY1H 4R50A 3HOVH 4C43A 1OGJA 5KW9A 2DEUA 2RHSB 1HNXO 3ONUA 4LF8L 3CMEV 3SGIA 4ROXA 5EPKA 4CJ0B 4J10A 3CU7A 4A3MH 1MJCA 1JJ2B 3HKZE 1HW7A 2E3CA 1WTHD 1YI2B 4JPBW 1IBMB 4OONA 1GJXA 5IK2A 3OTFA 2KCMA 4KFMA 1ZL8A 1SKQA 2ETNA 3Q24A 1HZBA 3AG2B 4FLTA 2DY1A 1G6PA 1K5SA 2B5UA 1EUJA 3I3CA 1YIJA 4L5RC 2UXCL 1M1KW 4KY5A 4BY1B 3I1FA 1HA5A 1F7YA 2Q8TA 3W1GA 2WAQG 2QM8A 3K08A 1WOPA 2IHFA 3TGUH 2B2VA 1PL0A 1S4ZA 5IT9N 2R9VA 3A3BA 4NXMB 4X7FA 1B9MA 5ISRA 4WZKA 1S5FD 2QDLA 2F3WA 2RCFA 4OEMB 2UXBO 1M4VA 5EC2C 1PYBA 2RF4A 2XRQD 4A3IB 2K5QA 4PZ8A 1UE6A 2Q6OA 4Z4TA 2Q6LA 1B06A 1XQBA 2PIAA 4UAJA 1K3RA 1Q90D 1TS5A 1SN8A 2XNJA 4DR3L 2ZQMA 1R5NA 2E5LB 1K8AD 1RFYA 2MQHA 1ZUQA 3PUXA 2YU9H 3ICXA 2UXDO 1JNYA 1PFSA 1DLBA 1OV9A 2RSNA 4A5UB 2WP8J 4H02A 2FINB 2ZT9B 2GN5A 2H5XA 1XNQO 2DCUA 2HUGA 4PJ0Z 3QOLA 4CDCC 3ULLA 4R4QA 2BSKB 4LWCA 4DAPA 3CPFA 4DR3O 3OMAB 2ZXHA 1Y76A 3NELA 1AB3A 3FMCA 1X9NA 4B3TL 5CBFA 1QE6A 3F2BA 3L74H 4HCEA 3SK8A 1WVLA 5EK0A 2B1GA 3CJHA 5LOVB 4DR5L 1VQ8V 4POGA 3CS5A 2QWQB 3RYHB 1D5AA 1EN6A 3CCRV 4JBKA 1ENAA 3RZDB 3BCCH 1ZLZA 2OCCB 4B3RB 3JU4A 4LC1A 2CW0D 3RYCA 3RN4A 1RPOA 1EU3A 3OYYA 4H7BA 2Z9HA 2NR5A 3PUNA 1QILA 2QA4V 2VYQA 3D3QA 1M5IA 3X3MA 2K14A 3P27A 3S1RB 3FPKA 3SPCA 4DUYB 4JAUA 4B3MO 1N32B 5CV9A 1SRUA 2WLLA 4B44A 5M5WB 4A3BG 3M7GA 4LF9L 2LW7A 5IE9A 2QWOB 1WOSA 2KCNA 2ZZGA 4RHSA 3TQYA 3ULJA 3V05A 3G71A 2KSDA 2VQEB 3I55B 2FMCA 1HCZA 2KOLA 4QB4A
chains in the Genus database with same CATH topology
3JARB 1TWAB 2P22C 4FLXA 1EYAA 4RCOA 5EGTA 1NAPA 3T16A 4HMIA 4K6LA 5CMDA 3GV6A 5ITZB 1I6VC 2WJYA 4X65B 4O4HA 1PTOF 1I94B 5C3WA 5FO9B 2IT1A 4FLZA 1M8AA 1LTAD 4CGYB 4H13C 2SNSA 4A93B 1CA5A 2H4OA 4EQNA 4FFBB 4DR4B 4Q5VA 1SNCA 3NQIA 1VCIA 2JE6I 5FLXL 2PY5A 1CHQD 1PLFA 1JFFA 2JP1A 1HA6A 3ZIAA 4O2AB 2D62A 3A54A 5J1ZA 1HTLD 4CH5A 2A6HC 3VYSA 1I4XA 3OE7A 2ZZFA 1SE4A 1WCMB 3WB1A 1CI3M 5ITZA 4X3SA 2O5IC 4DR6B 1DCZA 3MVVA 5EKKA 1BCPF 2M00A 2Z1CA 4RHRA 3SXHA 1STNA 2JS5A 4DR7B 5C5LA 2ICIA 2OF1A 2E75C 4XT1B 5EBDA 4YXWA 5C8YB 2AQ3B 4FYDA 4QUCA 4ZHQA 4LH7A 4KKUA 1ET9A 2PZTA 1G291 4FO2A 3GTQB 2F0EA 2PCFB 2XZOA 1RCVD 2HHHB 2RJZA 1E2WA 3P1HA 3R2IA 3MHBA 2SEBD 1EL0A 1EFID 4DRXA 5LOVA 4ZAIA 4XXEA 3CSXA 4XN0A 3S1MB 2RA4A 2B2YA 1CFMA 4EFEA 5KMGA 2F0PA 3PIO3 2V7QA 1F2ZA 4JV5B 2ZIOA 5G3LD 2BE5D 3FRPB 2QKIC 2PO4A 1ONLA 3PUZA 4TUYA 4XLEA 3T53B 2E1BA 1K83B 3ZPNA 3HOVB 2JJ1A 2WKCA 3OFNA 1HFGA 3TZDA 2FFKB 5E3FA 2UXBB 3PUYA 2MPMA 3AB9A 3P7JA 1G6ZA 3MXPA 3JAWB 4GYCB 3SVMA 2DY7A 4G7ZC 2UXDB 1KNAA 2B2WC 5JVG3 1AZQA 1EQVA 5BN4A 2NTTA 3TDQA 5IJ0A 4WFN3 4DR3B 1V1OA 4FFBA 3A8KE 1LV9A 2GK7A 2LKVA 4LK1C 4DAVA 2EJFC 1D6EC 3FEWX 1TQOA 4X66B 2Q8RE 4XDXA 3FPUB 5C4XB 5A2QE 2NVXB 5IYZA 3GQBA 1FFXA 4JI5B 4BW9A 1CT1D 3MC0B 3M85A 2ZXRA 1WD0A 2CK3A 2XWJB 3D4DA 4BWAA 2K03A 2OT2A 2WB1B 4EB6B 2W6IA 4S3SA 4II2A 1E43A 1H9JA 1J8IA 2D9UA 3G6JB 2WKDA 4AYBB 3I90A 3NP8A 1H9MA 2FHTA 2ZZQA 4KKTA 1JWUD 4O42A 4JI4B 2UU9B 5FLXE 3N2KA 4QMGA 1QHTA 5FPRA 4X62B 5IGDA 1R9TB 1TU2B 4Q0FA 2YYZA 4ZUJA 5AFWA 1Q1BA 5GONB 3TZUA 4DGZA 3LWEA 3DWQA 1YNJC 1F2MA 4HCSA 2EYLA 1H9SB 1SQFA 1PXUA 1SSOA 3RZOB 2V31A 1A3TA 1PRTF 1EY4A 1UD4A 3PUVA 4E6IA 2L55A 1OXVA 1LTTD 2L4NA 3K0YA 5FPOA 3VQYA 5ELEA 4BY7B 2X8KA 4IUUA 1CZWA 1ZXTA 2DY8A 4C3JG 4ZI7B 1PTOD 2X6YA 4HSVA 3ETQA 4X64B 4FLYA 2ZTGA 3AMUA 1Q12A 2B8FA 4IUQA 2F0FA 5EPLA 2IJ0A 5CC4A 2L5TA 5I6WA 5IGGA 2F0SA 1I4PA 3DWPA 1XMQB 2MP1A 2BTQA 2K7VA 3WOEA 4PMBA 1JOQA 4ILWA 1IBLB 1E3ZA 3EA6A 1EU4A 4JK1C 5JEAG 4BBSB 1B53A 5KRUA 5KHJA 3NXWA 1PTOB 3EFXD 3N2KB 5KX5B 2GV9A 1T5XD 3WB0A 2O4XA 1ILPA 4JI7B 3M7MX 1MBYA 2A68C 4WBNA 1UUPA 3Q22A 1ENCA 4II3A 1PRTB 4V0BA 2WIIB 2ZM6B 4GZYC 3D31A 4AQYB 1PRTC 2OEOA 1GXDC 4RKLA 1OO9B 4H44C 4YJ2A 1WTVA 1II3A 1ESFA 2WPDA 4A3EB 5IJ0B 4RFBA 2KJXA 3FFQA 1XNRB 2KKWA 3BA9A 1ILQA 2A69C 1GUGA 4KI0A 1U4PA 4OGQC 2JA7B 2Y0SB 5I6YA 4CBVA 2PYLA 4X20B 3H09A 1UD8A 1STBA 1MGSA 4EGVA 3RUZA 5IGFA 2EE1A 5K1PA 4FLWA 1NUCA 3DWAA 1TY0A 5LYJA 4ASUA 4U68A 1E0BA 3OIPA 2QDBA 1KNEA 3A8JE 3H6MA 1U4LA 3HKBB 3RD4A 1TVXA 1EIGA 5EIBC 1E1QA 3I4NB 3S16B 4TQFA 1I18A 3OSOA 5JPNC 4O4IA 3GVLA 2VWKA 4X1IB 1TAEA 2SOBA 1O7LA 3TP6A 1FYCA 3HOZB 1CQFA 3ITPA 5EKLA 5JJJB 2R7ZB 3BABA 2SDFA 3I4MB 5C0XH 4BBRB 2GK6A 5I9OA 4XOPA 1S5BD 1DJRD 1KABA 4MIUA 4FVMA 3MWYW 3MEHA 1Q1EA 4KL1A 2WJVA 1XHXA 2NWGA 4XQNA 2UUCB 2EX3A 5FKAC 1ML0D 1V43A 3A7LA 3VR2A 1HTPA 1RD9D 5C0XG 2X6XA 2XRSD 4B9WA 1JWSD 4XQQA 3KLSX 2PTMA 5EZYA 4LFAB 2FJ2A 4HNAB 3P20A 1FGBD 3CB2A 2UUBB 5LXTA 2EJGC 1A3UA 1F77A 1O78A 2JEAI 1QOHA 4ABNA 1ESRA 1G8ZD 1SFOB 1O9HA 3VYUA 1XWEA 4G7XA 3VR5A 5A35A 1C48A 1QQCA 1Y8OB 4AVZA 4CH4A 3PN1A 5LL6S 4HSPA 5J2TB 1OHHA 4ZKCB 5DN6A 3RYIB 4XNFA 3R2TA 3R93A 4XMYA 4I4TA 4XLAA 3T13A 5C4ZA 1EY5A 5M3FB 3E22B 1U9RA 3EROA 1HR0B 1GHKA 3MFGA 1UD2A 3K5OA 1BUVT 3A55A 4DU9A 4QCLA 1HNXB 5CA0B 1Y8PB 3NE5B 1DM0B 5BMVB 1FD7D 4A3GB 2KECA 2YIBD 4UCTA 5LP6C 1V0EA 1PTOH 1EEFD 2A69D 3RFRA 3S1QB 4PI2A 1GUTA 4PMWA 1HRJA 1Z7TA 2JDIA 2VJIA 4O4HB 5LXTB 1GUNA 2DN8A 1WP6A 1XMOB 1UD3A 2X6WA 3BDCA 5C5MA 1NRKA 4HN7A 2Q7GA 1Q3LA 3D6CA 5KGUA 1HQRD 1H9KA 3JALB 3TP5A 3GVJA 4RGTA 1CA6A 4CH3A 2JA6B 3VA5A 5CBAE 2E76C 4FP5D 5K5PA 1QB5D 4G7HC 4UAIA 1NR4A 1WTPA 4WJWA 2A5HA 4GLXA 1TY2A 1YNNC 3D8GA 5CR3A 1LLRD 3A56A 2KEEA 4B3MB 1HQMC 1PZKD 3UQ8A 3CRLC 1SQGA 4EVOA 1LTRD 4XLCA 3TMEA 3NSWA 1XHZA 3JATA 4TUYB 4LF8B 3S15B 2UUAB 3NTHA 4A3BB 4K14A 1RTNA 4KHVA 4C3IB 1D5ZC 1BLIA 3GTKB 1Q5OA 4F6RA 4QF4A 1ZAUA 1LTGD 4Z1MA 2NN6G 1H2SB 1JOKA 2F0WA 2CAZC 4C56C 4RAUC 4X20A 3J7AV 2TSSA 1FFXB 3UT5A 4CKBA 1ZYRC 3PV0A 1OXTA 3ONAB 1ENFA 4K8XA 1SMYC 1UNSA 1B4OA 4DV7B 2XIWA 5FO8B 2JJ2A 2EXZA 5EYPA 4I65A 3S9WA 4HBNA 3M4YA 2A68D 1Y1WB 5JEAH 1VJSA 3K6OA 4TSSA 3BCDA 4K6DA 3T4AC 1CHPD 2A73B 1QWYA 4JYAB 5CBEE 1L0XB 3KBXA 3R8BA 1TVKA 1IHZA 1JICA 1ZYRD 1BQQT 5C4HA 3J81L 2IX3A 4MN3A 2VXWA 2QM4A 1EWCA 3MAQA 2QEJC 3TBIB 3KUPA 3NTIA 1AEXA 4IFDG 1N33B 3L9AX 1VMCA 3BVMA 2ZNIA 4DV0B 4YJ3A 1LO5D 4PQXA 1EFRA 1B9NA 3NBHA 2R3ZA 3ZYYX 2F0VA 4N9TA 2JSOA 3MZ5A 3GTMB 4DUZB 4DAYA 2PPBC 3QF7A 4DNTB 3PO2B 3T51B 1KMIZ 2GJPA 1KDCA 1IL8A 2PQEA 3BA8A 1TUBB 3JAKB 1IKLA 1SE3A 5FL7A 4HR7B 5JCOC 5NUCA 1KDBA 4ZUIA 4XLFA 5K1XA 4XQFA 5C44B 4A3MB 1SYFA 1LTSD 3U9SA 3A2FA 1C8CA 5C8YA 5KYLA 1AP0A 2Q8IB 4PI0A 3JSNA 1PDQA 4IUVA 2LY7A 4XYQA 5IJ9A 4DV6B 2NB0A 3BHPA 1K8MA 3UI2A 4CKCA 1PTOC 1EEID 2JYOA 5JEAJ 4XKVA 1IW7C 1MSGA 1W6KA 2MUYA 4JBWA 2HDLA 4DV3B 3HEJA 1PZID 4K0KB 5CORA 5HURA 2NYZD 4LNUA 3D4RA 1V9PA 4BA1I 2EPBA 1JWMD 3T1YB 4LH6A 4CS2A 3U11A 1L8DA 2OWOA 3JATB 3I70A 1Q3EA 5EQ0A 3BVZA 4O4JB 4HEDA 3S17B 2LMCB 3C46A 3BRCA 2XHBA 1B04A 3VR4A 4ZK9B 1UD5A 3KLRA 4IUTA 1FR3A 3NPPA 4XKWA 3IFTA 1HZEA 4K5VA 3GD7A 5C6AA 5KHKA 1FNUA 3OMGA 4KV6A 3HS0C 4DV2B 4JI2B 5KNDA 3FPPA 2HQEA 3HZXA 2HDMA 4IIJA 3A3GA 4KJOA 4D7SA 2HCIA 4C3HB 3N52A 4TSFA 4KN4C 3JAME 3QIAA 4YELA 2M9VA 3HKCA 1H8EA 5CV5A 2K33A 2M5SA 2KQ3A 3E5SA 4BS9A 1QG7A 5IT9L 5IJ9B 4K5WA 3HOUB 3I4LA 3QWNA 2YU9B 3PUWA 3K57A 2I07B 3BG3A 3OW7A 3CQZB 3U9OA 3VA7A 1AW7A 3A7AB 1CK1A 3CMMA 4TV9B 4LFBB 3SJCC 5EIBD 4IHJA 1BO0A 4KMUC 1C4QA 4OO1G 5ELFA 1RODA 2F3VA 1TS3A 3I73A 5JJNB 1DYQA 2Q0AA 5FK9C 2VWJA 3SR1A 4G57A 2K5DA 2AQ2B 3K5LA 4B9XA 1VLYA 4IN3A 4L63B 1SA0B 1D2BA 2D3NA 4C2MB 2OYQA 1DZ1A 2Z6BD 2F4IA 4V190 4EB6A 3IKJA 2BOSA 1M4UA 4A3JB 3QO2A 2IM9A 3OAAA 1SMYD 5FOBB 4HNAA