2V4DA

Re-refinement of mexa adaptor protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
NTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Assembled Structure of a Complete Tripartite Bacterial Multidrug Efflux Pump.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords MULTIDRUG RESISTANCE PROTEIN MEXA
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2v4dA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v4dA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2v4dA02
1H9RA 4LK1C 1GUOA 1OXXK 2A69D 2BE5D 1VCIA 3W3AA 4JBWA 1OXTA 2JE6I 1IW7D 1ZYRC 4KN7C 4TKOB 4IFDH 1G291 4KKUA 3OOCA 5JJJB 2IT1A 2PNRC 1B9NA 2KCCA 1EWHA 2K33A 4XIGS 1A6XA 5BN4A 1Y8OB 4TQUS 2D2CC 1YNJC 3P20A 3PUYA 4OO1G 2EJGC 5JEAG 1GHKA 4DK1A 1HCZA 1LABA 1YNNC 2K32A 1GUSA 3WB0A 2A68C 4HR7B 3PUXA 2NN6H 4XTCS 4IQZA 1HTPA 2YYZA 2B8FA 1B9MA 3HGBA 1H9KA 2AWOA 2EJFC 3A7AB 5KNCA 3MFYA 1GUNA 2A6HD 3I72A 3SDZA 1PMRA 2PPBC 1IYUA 3VR4A 5JJNB 4I7ZC 3PV0A 5C0XH 2R6GA 1H9MA 4H44C 3FPPA 3U9SA 1OXSC 3RLFA 3LNNA 3I73A 2EJMA 2DNCA 3A8JE 5D5QA 1DD2A 1DCZA 3A8IE 3M85A 3SE0A 3EQLC 1BDOA 1Q12A 3NE5B 1VF5C 3A7LA 1ZKOA 2JEBI 3IFTA 1GJXA 4L8JA 1OXUA 2D5DA 3M7NA 2AUKA 5K36G 3VR6A 3T56B 3N6RA 3AB9A 5BN5A 3WB1A 3VR3A 4KN4C 1E2ZA 3VR2A 1O78A 3T53B 1Q1EA 1GUTA 4KHZA 1Y69U 1I6VC 2KA7A 2A6EC 1LACA 1E2WA 3OW7A 3L7ZC 1IYVA 3A8KE 3BG3A 4OGQC 3GD7A 3TZUA 4DNTB 1CTMA 4KI0A 2EDGA 4PV1C 3T51B 2LMCB 2A6HC 3CRKC 1Y8PB 1E2VA 1FYCA 3I4LA 2K7VA 1TKWB 5D5PA 2E74C 3VA7A 4G7ZC 3WB2A 2B8GA 1FR3A 1VF7A 3PUZA 1VDZA 3KLRA 2JXMB 1H9SA 1V8QA 4IFDG 1H2SB 2QF7A 2E75C 3CRLC 3BRCA 4BA1I 4G7OC 1CI3M 2F95B 1HQMC 4G7HC 1SMYC 4DNRB 1K8MA 3H94A 1ONLA 2CW0C 2E76C 3OPOA 4KKSA 4OO1H 3DXJC 3PUWA 4JK1C 4RCNA 2V4DA 5KNDA 1IW7C 2A68D 2BDOA 1TU2B 2NN6I 5BN3A 3MXUA 2NN6G 1O7LA 1QJOA 1Z7TA 4KKTA 1Z6HA 3WDNA 2BE5C 1DXMA 2A69C 4H0LC 5A35A 5JEAH 1H9JA 4GYCB 2O5JC 1RSOA 2BA1A 3LWUA 2O5IC 2DN8A 1OXVA 1GUGA 5JJEB 3M4YA 1T5EA 2BA0A 2EVBA 1V43A 2F1MA 2PCFB 1CFMA 2JEAI 1GHJA 2ZT9C 3IKJA 3D4RA 5KNBA 3ND8A 2Q8IB 4DK0A 4H13C 5C0XG 1Q1BA 2A6ED 3ND9A 4GZYC 3VR5A 1H9SB 1Y8NB 2D62A 3FMCA 3QG1A 3QIAA 3BDOA 2DNEA 3PUVA 3GQBA 2L5TA 4KMUC 1K8OA 1HPCA 4BA2I 1Q90A 5K36H 2AUJD 3D31A 2F93B 3QJYA 4LJZC
chains in the Genus database with same CATH superfamily
1F9PA 3E20A 2J4XA 1ZM4A 2ZTCA 1WTQA 5GW7A 1I4HA 2Z4HA 2RHSB 1VQCA 2AKWB 4IPDA 1K9MD 1STEA 1FD7D 2DQ0A 5KYIA 2PUSA 5FLXE 1H2GA 3I4MB 3K9SA 4HEDA 1HP8A 3E86A 4KKUA 4QHYA 3DSQA 2C4TA 2RHQB 1IL2A 5TY0A 4XIGS 1L0XB 1PH7A 4WBNB 5BN4A 2QWPB 2QA4A 2HQEA 1U96A 4IJHA 1BQZA 4F4LA 1BCPB 3CC2A 2UUAO 2QTOA 3K0GA 1XFOA 2KQXA 3CS5A 2ZXWB 3BQJA 3ASNB 1XB2A 4AVZA 1A8PA 1VQIA 4IQZA 4LFAQ 3RZOH 3P32A 2B8FA 4QF4A 4HJ8A 3GTOB 4O4JB 2MK3A 1N8RC 4BY1G 1Q86W 3AVYA 1RL2A 1X59A 2DYRB 1WI5A 4JV5O 1B04A 3BDCA 4QGPA 2NVTB 1XMOL 2I5HA 4NMZA 3D3QA 1KLGD 4Z4ZA 5CV5A 1LUWA 3IJ4A 5LL6S 2K1EA 2V1CC 4U3JB 4BWAA 2DNCA 3PIO3 1EYCA 5LMUL 4U68A 4FXGC 4JZGA 3A55A 4BBRH 3RZDH 4XT1B 1CK1A 4EGVA 4DUYO 3SJPA 4DR7L 4KY6A 3FHWA 1RSOB 2IJKA 4CS2A 4NXNB 1KP2A 3A8KA 3M7NA 1XQ8A 4G5GA 2QM8A 5BMVA 1KQSU 4OXPA 4AQYO 1TTTA 2NVTH 3ZMVA 3PO2G 4NXMB 3A8IA 2WAQE 2ZXWC 4A93B 1OCOC 4TMWA 4Q5VA 1WP8A 2BPOA 4OPVA 4KHZA 1URFA 1E1RA 1Y69U 4Q0FA 4JI5Q 3L7ZC 4XDJA 5BR8B 5FLMH 3MXNA 2DYIA 4MTXA 3CTAA 3JU4A 3KKYA 1GN6A 2LGQA 4BWGB 4F8MA 3OZWA 5LA6A 1VQKB 3OAAG 4MSWC 1TKWB 2Y4TA 3U50C 4DAMA 3CXCA 2XOKG 3RN2A 4DR5B 1SEBD 3Q4HA 2B2YC 2B8GA 3NWTA 4MS2A 4RD4A 1VF7A 2PI4A 1N33B 3RY8A 3W5HA 4OEMB 3JAMi 2JSOA 3S16B 4FMTA 5EKIA 3HOXG 1CI3M 1QE6A 1SYBA 2VQEB 3E1YE 2VBTA 3KOJA 2B7BA 4IL6Z 4YHBA 2A9HA 4JAAA 4CH6A 1AI6A 1NT2B 2OK8A 1K8MA 1MD2D 4JASA 5CDFA 2PZWA 2CTQA 4JTAB 2WA3A 1SSOA 3JASB 4X66Q 1DARA 4CDFC 1WU8A 2FMLA 3E2EA 5E3FA 2YS8A 4DUYQ 4A3DB 1TU2B 2VQEO 2OXPA 1PH6A 2ZTEA 3RYFB 4QPJA 1Z5WA 4A93H 2NR5A 1Q82C 4GYCB 3OMAB 2RBMA 3GWOA 3OHXC 1KKCA 4DV7B 4DV3B 3HKDB 1IBKL 1WVLA 4FLUA 2F0VA 3W5UA 5FKAC 2XNDA 1EEID 5JJEB 2EXDA 4CKCA 3GO5A 1STHA 4O4HA 3G4SB 5K1XA 1PRTB 1UJWB 3ZBTA 2XN9C 5KA5A 1KNAA 5J2TA 3B4SA 2E1RA 1TIID 2LFRA 2VQFO 3VO1A 2CWPA 1Q1BA 3EFFK 4RFBA 4DV5O 3I3CA 3M4PA 5C0XG 3QG1A 3CCVV 2R6HA 4XLFA 2K75A 5D3IB 5FIUA 1SFOB 4JI0Q 3GQBA 5JPMC 2X3UA 4G7XA 1NS1A 4LF5O 5KHJA 1HPCA 3CQZB 3E35A 1MSGA 1PM9A 5AG2A 1Q82D 3I2ZA 3P1HA 4X05A 2QA4B 1K0RA 5CYUA 1W2BA 2Q7EA 1LT4D 4GLAC 5IGEA 2Y69B 1ZUQA 1IBLB 1UD8A 3OE7G 3G6EA 3GTLB 1J95A 1WP6A 3ASSA 4UV8A 2WKDA 1GN3A 3OOCA 3T1HL 1RKNA 5M3MB 4A3FB 4X1YA 5DS0A 1S5HC 2ZIMA 4E4EA 4GKKB 1Q6IA 2F0TA 3S24A 3HOWG 1C0AA 4XYQA 1J8IA 2F1LA 3H6MA 1JCHA 2DQ3A 4PHZA 1KAWA 2DY8A 3GIRA 4JI2L 3P20A 1VQ7V 1G7RA 3W7XA 1UEAB 3M7GA 4DR7Q 4I0XB 3W5VA 5T1GA 4MT8A 5CA0B 4JAVA 1TWCH 3WB0A 3CCJV 4X20B 3BZCA 3HKSA 1S77D 4FFKA 3J7AU 4DV0L 2VUMH 5GAEC 2YI8A 5KUKA 1T6XA 1FNCA 2VNIA 1MHWC 2RVLA 4RHRA 1Q86C 3NTHA 4FF2A 3HKDA 2V7XA 3KF8B 4QIWE 1LUVA 3SYOA 2JA5H 2DMXA 2JK5C 2QEXV 4QCLA 1O7YA 4K8IA 5BSYA 4DV0B 1AR1B 4P2CB 2QMUA 5E1AC 3JQRA 3VR4A 5C3EH 4LF6L 3S2DH 4CH3A 4LP8A 3RVZA 5LMNO 2P5OA 1V5VA 2OBSA 4B3FX 1K83H 3JARA 1MKHA 1I5YA 1WCMB 2OCEA 5IYDG 1AH9A 1KB9F 3WBKA 1BKBA 1BGYH 1DCZA 4FPPA 4KHPO 3R2IA 3SE0A 1PH5A 3CP0A 2FYUH 3Q23A 5JCOA 3SK5A 3L73H 2WINB 1JOQA 2D5DA 1YJNV 4LFCO 1JOKA 5EPKA 1TWFB 3HKZB 2AUKA 4ABNA 4OHJA 4C3HB 2JGDA 1NR7A 1IBLL 2V31A 3ASOB 1F51A 4B3SO 1STBA 1ZX3A 2KEEA 1IBKQ 3AG1B 4Z2WA 3SVMA 4R4IA 4X62L 4CJ2C 3GTKB 2PQAA 1ICWA 1QQCA 3HOUB 3BG3A 4AC9A 4JI7O 3BCCH 4RWSC 3B78A 4APVA 1CQFA 4DAYB 1CXZB 1EQTA 1O7IA 1PYBA 5L46A 3B40A 1I5XA 4OPOA 5H6RA 3W1GA 4YHHL 1KYOF 3DEOA 4FYDA 2K03A 1HZ9A 2FB5A 4J6HA 1EIYB 2X6AA 5FNVB 1EQQA 5B1NA 3UDFA 2Q68A 4XT3B 5C3WA 1YJNA 1W0KG 5B3SC 1ORQC 2E74B 3UE1A 3DC5A 3UCSC 1X3FA 2KCMA 2OEOA 4YAUA 4BA1I 3ZMSA 5EQ0A 1TLLA 1YITA 1HNZL 2MW2B 2XGJA 4ZCLA 3T4DA 2K52A 2P06A 1I5FA 2VW9A 1JA1A 3HKBB 5IGGA 3V96A 1X65A 1YZBA 5HKKA 2Q2HA 1WN7A 2YC0A 4Z1MA 1Z5VA 2QE7A 1MG1A 5BN3A 3EFXD 3P75A 4LF7O 1VS0A 3MXPA 1O7LA 3HOYH 4BY7H 4C43A 1V1QA 1Z6HA 1HH2P 4JI5L 2Q7GA 4X3KA 3MMPA 1UD3A 1IYJB 4PG3A 1V1PB 1HNWO 4DRXB 2MGSA 2WJYA 1N4CA 3CCQB 1MABG 2ZE8A 1XPOA 1SNQA 2O5IC 1YITV 1K83B 3L70H 2EPBA 1GTOA 2P67A 2WFWA 1N33L 4F7XA 4E0FA 2GVAA 3JSLA 1IBMQ 2DYRC 3E22B 2QCPX 2F0LA 2K04A 3ERSX 4P73A 2DJVA 5TV2A 4FWTA 4A3MB 2PF4E 3A8TA 4DV6O 2QW7A 2EFGA 1Y8NB 5L3BA 5E7NA 1VQ7A 2DWDC 2DWEC 1CNFA 4DU9A 2CH4W 4HJ5A 4IOAA 1VARA 1BBXC 5K36H 4EEQA 3AGQA 2Y4UA 4YAWA 3RFRA 4JI2B 1W0KA 4FLWA 2VQEQ 1EYDA 2GTSA 4FLVA 3P3PA 5J35A 1VCIA 2PW7A 2UUCQ 1A3TA 1KDCA 2Y69C 3CCUB 3SEBA 1JQ0A 1YITB 4UZUA 4DUYB 1GM7A 4R4CA 4X20A 1G291 4KD3A 4ULLA 1GN4A 1JWMD 1A63A 5LMNW 2KCCA 1AROP 3RWRD 1NTZH 2RDFA 2B63H 3NQIA 4DUZO 1YVCA 2AW9A 1KMHA 4N9PA 4C3JG 3J81i 4DV7O 1GMGA 1SNOA 1WFQA 1S40A 1TWHH 2VBUA 3AFQA 4DK3C 1SC5B 3PJSK 4I4TB 5HZAA 4P75A 4OO1G 5FL7G 4A5UB 3DHQA 4A93G 3H3VC 1ROPA 2A7WA 4CQJA 4B3MB 4WFN3 1WPXA 1QHTA 1I7PA 1KD1D 1ZL8A 4Z1VA 3X3NA 4POFA 5CGKA 3HOVB 1DONA 3HGBA 4HE6A 4FM2A 1JE5A 3RYFA 4WFGA 3F8TA 1BCPF 4J7JA 2WZNA 4DR5L 4FN5A 1K73C 1AZQA 1SZXA 4XLHA 1IKLA 1VIBA 4JYBA 4O2AB 1JR9A 4K0KB 1D5NA 5IT9L 5JVG3 3CRRA 1Q86D 3JALA 4I7ZB 3J80c 2KG7A 2I5LX 3ZPNA 1X3QA 1GRJA 3U10A 4TV8B 5IGCA 1DLBA 2K50A 2ZR2A 3NR7A 2R9RB 4PA3A 4X65O 1XTDA 4NVPA 2XGTA 3E3XA 5BR8L 1N34Q 4GT1A 1ZKOA 2I0QA 3CHXA 1KK2A 4DUZB 4DO2A 1MJCA 5C0XJ 4RLZA 5IIFA 4I5SA 5LGUA 2UUBO 3VNVA 5DN6G 2R9VA 1M5IA 3CB2A 2MO1A 1R6NA 3J81c 2E5LB 3JD0A 3QO2A 1XYIA 5JJLA 4FNFA 4JI4O 1NJID 5FNZA 3FP9A 2ZJQA 5I2YA 5FNVA 1UE7A 4XDXA 1U97A 3CCLV 5BSXA 5HFMA 1YBYA 4LCUC 4DR2B 1QLEB 4BY1H 5IYWA 3GTMB 5C6AA 3VYUA 3GD7A 1D5AA 3OD4A 3Q3AA 4CH4A 1KTVA 2AGAA 1R4PB 2QR4A 2K5NA 2C2AA 3JD2A 2KCTA 2LMCB 2XRQD 3CU7A 4LUOA 3TS2A 4DR1O 1CA5A 2R70A 4J7ZA 4IZ8A 1BLIA 1EQRA 1ENAA 4ZKBB 5AJ3L 4K3AA 3AGPA 3DXRB 2EE1A 2VUMB 2W0XA 3H01A 1K5SA 2F0KA 2H5XA 2CVRA 2R9IA 5ELDA 3GTGB 3E8HA 2OTJV 1L0YB 3GTLH 4DV4O 1SQQH 3UM7A 4YCWA 3TP8A 3K5MA 2VB2X 4XQFA 1XOUA 3K7AH 3HKCA 1XNRL 1HNWB 2JA6G 1GKHA 4DR3B 4DRXA 3H09A 3T1YL 4DN4M 1XEQA 4J80A 2JA8G 1NU1H 1OCOB 1I4QA 2Y0IA 4MW8A 2A68D 1QLEC 1EU4A 2AQ1B 3HG9A 4K8JA 2HHHL 4Z4RA 1E3PA 5GV8A 3STBD 1DF4A 3E22A 4P2NA 4NBSA 5THXA 2BE5C 3EN2A 3PO2H 1N0NA 2UXNA 5F4MA 3HOWB 5CV7A 4H0LB 2EIXA 3G71V 3ITPA 1WTHA 2DYSC 2F4VO 2BH8A 2IHEA 1OGIA 4PMCA 2W6IA 5TR9A 1OXVA 4JI2O 3HEJA 3E6ZX 1ZTEA 1XNQQ 4A76A 1JJOA 1FDRA 4IFDI 4ME5A 4JI8B 3A56A 3K6OA 3GTQB 1PNLA 4H44B 2LGWA 1LO5D 3AG2B 2WPDG 1VQNB 1SAPA 1LNQA 5LOVB 3SDLA 5IWAB 3KLWA 3GTOH 1S4ZA 4PD4F 1SR3A 2PQEA 1KK3A 5IYBG 2XIWA 4O2DA 1NTGA 1XMQL 1A32A 4V190 3D31A 1WTRA 4LC1A 3N2GB 1TS2A 1H9RA 2K5WA 4GLVB 3R6JA 1VQ6A 1EIHA 2EULA 5EPLA 3MA2B 3JYCA 1DF5A 4OWWB 3ICXA 2X6YA 3K0YA 2QDOA 4XQQA 4BIUA 4FJCC 1VQ4B 4LFBL 1X55A 1VF6C 2HJFC 4BIZA 1A3UA 2UUAB 4ZAIA 3OTOL 1ELOA 1KP3A 1XNQO 2HMAA 4TQUS 1S72A 4JI6L 1G7CA 3HOUH 1TUBA 3ZZUA 2I5MX 1YNJC 3EIVA 4Y7NB 1GO3F 3CYOA 1JJ2B 1U4PA 1AN8A 2C9OA 2EJGC 3I91A 4ZLTF 1N34L 3KG2A 2ZL5A 3OMCA 3CAMA 4LWSA 1QLNA 4RHSA 5A8AA 4ZKCB 5M3FB 1O9HA 4GUNA 5EYPA 1FRQA 2KG7B 3QSYA 1TXYA 3PUXA 4NW2A 1Y1WG 3ZS8C 4RD0A 1B9MA 1VQ6V 5T1IA 1QU7A 1Y1VG 1H9KA 3TMEA 5KGUA 4QQBX 3GVJA 3S2HB 3TJTA 2XUMA 3OEHG 4DV2L 5D14A 1EOTA 5M5YB 2A6HD 5M5XH 2IX1A 3Q6RA 1Z47A 3R66A 3OE7A 4M8AA 5C0XH 4MYUA 1Q82W 3ZJYC 1OB0A 4H44C 1QNKA 2WLMA 3BYTB 4YWLA 3CCQA 3CCVA 5F4JA 2Q7HA 2CH7A 1MZFA 4RD1A 2BM1A 1TWGH 5GONB 1TT2A 1NBWA 1VF5C 4QB4A 3IFDA 4X64L 3RYHB 2VWKA 1ZM9A 3EROA 3IFTA 2NV4A 2X0KA 2PI5A 2E2JB 1Q81W 1F9RA 3KFUA 1AE2A 5EBWC 3D4DA 5IT9E 3PA2A 3V05A 1SXTA 2LFSA 5LYJB 5GTIZ 2HLDA 1YJ9B 4GOPC 3A2FA 4PELA 1KZLA 1WD0A 3R6KA 1AFPA 3WY9A 5JH7A 2E3CA 4X64B 4PDRA 2IY5B 3TZUA 1J9ZA 2ITDC 4KI0A 1XMQB 1NJIW 3CP8A 1UE5A 2LY7A 5E4WC 4WZKA 5EZYB 3VQVA 4DGZA 3VDYA 4A3LG 3Q6QA 2C78A 5A2QN 3A1PA 1WB7A 3I4LA 1EN5A 1RTNA 4UZFA 1CHPD 2OCHA 2XRSD 1SNDA 2KOLA 3LDEA 1AJPA 1N32O 3NBHA 4RJLA 1YSCA 4JI7Q 5ELEA 1I50H 1FR3A 2QILA 4I4TA 4RUEA 4RWUA 3CW2C 1QVFA 2FMMA 2E75C 1M90W 3CRLC 3EA6A 4DR4L 1G51A 4X1KA 3CCLB 4MVMA 4FIPC 1Q6HA 2B5UA 4GX5A 5IYDH 1BS3A 4N3NA 2QJ1A 2R9AA 1WNSA 4HNAB 3CCSA 1WOOA 3A3BA 4E2LA 2C5BA 1PRTC 4OXSA 2Q0OC 5KNDA 1SQFA 4UCOA 4P72A 2UUAL 3S1QH 1E43A 1F4MA 3A0RA 4X8AA 2H8PC 2JS5A 1CSQA 2VB3X 3VQYA 1I94Q 2YEVB 4TV8A 1QGYA 1S5FD 1KIXA 4TT3A 1TUEB 4TRDA 4DV2Q 1RSOA 2QKCA 2BA1A 5EJWA 4QNHB 4A3IH 2X6CA 3JATA 2F0PA 2P6JA 5BMVB 2ICIA 2GVBA 3M4YA 4P1VA 3J7AV 2K14A 3BY2A 1SRUA 2VL6A 3F1ZA 1QUFA 1TWAH 4FXDA 3W7SA 5F4OA 1PTOH 5KNBA 3RBZA 3ASRA 4H13C 1I7FA 3HKEB 4JI1B 2B2VA 4RCOA 4G2KA 1Y76A 4RGMA 4WF9V 4JI6Q 1EY7A 2OBTA 3PUVA 1C4QA 5C3XA 1GK9A 4R6ZA 3OEHA 1BOSA 3P7JA 4BA2I 5LA6B 3NK9A 3CEIA 2E2HH 1VQKA 4LNUB 3BY6A 5EBDA 3PO2B 4N21A 5LHGA 1J5EL 2UXBO 2IWHA 1AIPA 1TS3A 3CCRV 3Q4HB 2VZAA 1K33A 4X62Q 3M8AA 1VQ9V 4OL7A 4PQXA 4KHPB 4IFDH 1AMOA 3SJCC 3DWAA 3MXGA 4M1KA 4WORA 2F0WA 5JJJB 2HHHB 1XILA 2F43A 1YJWB 2OT2A 4AYBB 1G6ZA 1R5OA 3CC4V 1TVXA 4HN7A 5FO8B 3JAWA 3HOYG 1Q3EA 2NLJC 4C56C 3STBC 3ABLB 2D2CC 2SDFA 1H8EG 3CMAB 1HDJA 3I4OA 5H1SE 1WLEA 4NXNQ 2OIEA 1NAPA 4RD2A 4B3MQ 2UXXA 4J42A 2YYZA 4QVAA 5J22A 1G2TA 1D6EC 3U58A 4LF7Q 2UUCL 3A7AB 2LFNA 3MFYA 3VO2A 4EB6B 5DAUA 4PC1A 2N88A 1HFNA 5E4XA 3SK6A 3G80A 3SYQA 2HUGA 5DEHA 4HJ7A 2JN9A 4RM0A 3SR1A 2CGOA 2J7ZA 4ZQ3A 4Z9CB 4B3ML 4DV4B 5GADC 4O4HB 5LYJA 3PA1A 4P74A 3ULJA 2D9UA 3G4SA 5D5QA 4M4SA 1YJ9A 1ASZA 5C44B 4B3SB 1S5JA 5J2TB 3K04A 1GM8A 4C3JH 4OOSA 2I07B 2WLNA 5LOVA 2BSKB 3J81N 1XTCD 2JVDA 3GTJB 1NY4A 1FFXA 3CB4A 5IYDO 1S0UA 4MVRA 4B3TB 2F3WA 4DR6B 4KY7A 3NBIA 1JX9A 2X6GA 3UDIA 1PH2A 1S76D 5KMGA 4ILWA 4WFFA 4ZGQB 1PZKD 1RTOA 1X3GA 3KZIZ 3LDCA 5FO9B 3H9VA 5IYBO 3G4SV 3I56B 3JAMN 1WSRA 1YNXA 5CV4A 4K8XA 1TUIA 2MFIA 3RMHA 3AK3A 2E74C 5IP7G 5C4JB 3T4ZA 4DR3O 4Z4VA 2WWWA 4RGTA 4YY3L 2EIMB 3J80E 2JJ1A 1W87A 1AI5A 2KENA 3S17H 1AJNA 2OCCB 1KDAA 1EN6A 4LF9B 1OO9B 4IUQA 2F95B 1HQMC 1TWHB 5GQOA 3I4NG 1F23A 1H8HG 2EY5A 2Z6KA 4PDLA 1PPJH 1P4RA 2F4VB 1YTFB 1NJIC 4BIOA 2HCCA 1PD3A 3J81E 3MXUA 3HPLC 4GKJQ 5A9GA 3CCVB 2VJIA 2ZJPA 5B1OA 3BS1A 1VEWA 1PLFA 4C1NI 3B77A 5A35A 5KRUA 3Q22A 3J81j 3N2KB 4R8CA 2F52A 5ELNA 4LF4B 4PAAA 1BPLA 1HNZB 1SRYA 4IPHA 2PGGA 5DLQE 1XMQQ 2XWBB 1AI7A 5IJ9B 1N08A 3CCEB 3NP8A 4MN3A 2Q73A 2L6LA 2O2LD 1COWG 3S2DB 3D3RA 4FP5D 4C3JB 4HJAA 3CC4A 1NKDA 3FYEB 5J2UA 1YHQB 2E5LO 2JA8B 1UD6A 1K3BC 1L2FA 1VQLV 1N32B 2GK7A 4OOVA 4PC3A 2G5DA 2JA6H 1K0SA 2F0JA 5LL6Y 2PLFA 1UUPA 4MVUA 3HOZB 3J80N 3AG7A 4QMGA 3K8AA 2N49A 3DLLA 4LFCL 1A2TA 4I9QA 2E75B 1J9OA 4LK1C 2QWOB 1G91A 3ZCCA 2JJQA 2NYZD 2VUMG 1R5BA 1WTOA 1YJNB 5LP6C 4CHTB 4JI0O 5EGTA 5F2DA 1D2EA 3GTPB 1L0NH 3F5WC 2NZHA 5B1BB 2K5QA 1QVCA 4A3DG 5CBHA 5C8YA 2UUBQ 1YX2A 2R92B 3BPZA 5JOBA 1BO0A 3RN5A 2WR8A 1G7TA 1M1KD 5DM73 5L3GA 4TWKA 1SMYD 4UB6Z 1US6A 3C3SA 4WFAV 4DV3O 1QVGB 4PI0A 4DK1A 4HR7B 3RYIB 2XNCA 1VQ8A 2WLIB 1CM9A 1VQFA 2MPMA 2CC2A 3VYTA 4C3IG 4XN0A 2HCJB 1Y14B 4ASUG 4HE5A 2N8NA 2JN4A 2ZM6B 4QUFA 2Q67A 4GKJO 1J6QA 2HDLA 5AJ3Q 2DE0X 3TBIB 3L0OA 2CUGA 1SERA 2ZXPA 2CF4A 2BF4A 2JJ2G 4MVSA 4DW1A 2R6GA 3CC4B 3JATB 2CKZB 1YXBA 4ROXA 4BY7G 3A35A 2Y0SE 2BM0A 4JV5L 3QB3A 1Q9SA 2MNAA 3J7A5 3FPKA 2VZLA 2LXKA 1N36B 2AWNA 3FKSA 1JOOA 4DAPA 1VQKV 4JI5O 4HSPA 1OCRB 2WSSA 2PIAA 1SQBH 5KAIZ 3SPHA 4TMVA 1VQOB 1EFID 2BH2A 4P9OA 1JMCA 5LMUO 5DNFA 4PABA 3G7LA 3S1NH 4BXXG 4C3IH 4TMXA 4KHPQ 1IJEA 4A3IB 4LBWA 1PJ7A 1LTTD 4AILC 1D5XC 4BY7B 3TGUH 4HMIA 5M5XB 2Z6BD 3ZHVA 5J39A 5BR8Q 4IIJA 4N8FA 2P7TC 4FLYA 1ZM3A 1M4UA 1D5MC 2WZPP 2JP1A 2WAQG 3CCUA 4YJ2A 4F88A 4XL9A 2FX3A 4DFAA 3AVVA 3RR5A 4J1MA 2OTLB 2BOSA 4LF8B 1HNXL 5IP9H 3JAKA 4I9WA 4UUJC 2BCCH 4YHHQ 3ZN0A 1XREA 4PV1C 4OX9O 4O4JA 1LT5D 2LSSA 1W59A 1YJWA 3Q39A 4IHJB 2D0OA 2NVQH 3NEMA 1VQOV 5IK2A 5D5PA 3PMFA 3L3OC 1IYVA 3AG4C 1K28D 1GVPA 4JAUA 1Q7YC 1NR1A 2CH4A 4U3FH 4QY7A 1N36O 1VDZA 5K5PA 3H15A 4BBSH 1V55C 4XORA 2EYHA 4YJ3A 5IYZB 2FL4A 3TZDA 4LF4L 1SNMA 4H02A 4HIDA 4NXML 2OQKA 4JYAQ 3RNUA 5CA1A 2E2DC 1SA0B 1OHHA 1Y1WB 2MHVA 2JJ2A 3SK8A 2CW0C 2NVYH 3TP7A 2C35B 5LP6A 5IT9c 3DXJC 4EQOA 3AG2C 1Y0YA 4LH7A 1QH0A 4ASUA 1SKVA 3HAGA 1JC7A 1G8ZD 4CJ1B 2BTOA 4FLZA 1VQOA 2P3MA 1MIUA 4LF8O 3ZHTA 2A69C 3F2DA 2JRIA 1Q5OA 3MAQA 2QDLA 5ELFA 4JI4Q 1H2LA 5C3EB 2VQEL 1QBZA 3C1EA 1PFSA 1IHMA 3RD4A 4XDKA 3ZX6A 3UO3A 3OJXA 4TVAB 3W2FA 1WCMH 2BSKA 2EILC 2OTJA 1ZYRD 4JVZA 1OGJA 3BC9A 2YTYA 2JEAI 4KL1A 4PDVA 4FZ1A 1EM1A 2WLJA 4FM1A 4JI0B 4BPRA 2AMCB 1GH6A 1RM1C 3BDLA 3L71H 3DEPA 2D62A 1DGSA 4E6IA 5CA3A 2Q2IA 2D9RA 5LMUQ 3JQQA 3BEHA 3OR7C 4IHJA 5A89A 1E1QA 2VXWA 5CBGA 3A3GA 1AW7A 4JW0A 2UUBL 2DN9A 1EY4A 1W2BU 4PMBA 4PGOA 2BTQB 5J9PC 2UXCO 1AJQA 5LBQA 4B7KA 4ACBA 1EZ8A 2EYLA 1W34A 3VYSA 5JJIA 2AHZA 3KBXA 3C1FA 4ME3A 2EZPA 4P2ZA 1YEWA 2WLIA 1PTOD 3CC7V 2WPDA 1NI8A 5C3EG 2PNRC 3GTGH 4K0KQ 4GKJB 1WSVA 1AR5A 4O1NA 1W0JA 1I3QB 4DR7B 1ESRA 4GNXA 3ABMB 5DEDA 3TXSA 1ML0D 4I7AA 3CMEA 4N8X1 1I8DA 5M3FG 2W6IG 4UHVA 3CRAA 4K0KO 4LF4Q 5CMUA 1XHXA 4AQYQ 4RCZA 1Q43A 4NPSA 3K81C 4J9YB 1HTLD 2NN6H 2ZCEA 4R4TA 1DTOA 2UXDL 1FPOA 2WSSG 2VS0A 4I55A 1NH2B 1YEZA 2K1BA 3D6CA 3AG1C 1BBWA 1Y0RA 1N32Q 3ASOC 4PJ0Z 1YF2A 2N05A 3RVYA 1T5XD 2OTJB 3NQTA 4B9XA 2PPBC 3I55A 3FPPA 4LF9O 4D6TH 1ZLZA 3BCFA 1OXSC 2KSDA 3I73A 2R93B 3M85A 1BX0A 4LF6O 1NB9A 2BGJA 1VQNA 2XAGA 1EXMA 3HOXB 3ASQA 5IYCO 2YXHA 1BQQT 1PJ5A 2SOBA 3E8FA 1VLYA 4Z4SA 1EQVA 4KHPL 4JBJA 4DR6L 1QWYA 1H8HA 3N6RA 5BN5A 2IU0A 1YIJA 3DGEA 1YI2V 1E79A 3IC9A 3I1FA 2QKIC 3I70A 1NMFA 2O4XA 1DOLA 1KUQA 1WOPA 1GUTA 4JBMA 2A8VA 1E2WA 2ZDIC 4V0BA 1XUQA 2KBNA 4B3SL 4XQJA 1EL0A 3W7UA 1VQ4V 4GNXB 2WLHA 2GREA 3CC2B 4W4KA 4X62O 4N9TA 1VQ5A 3M4QA 4HSVA 5C8YB 4UP7A 1WA8A 3OFNA 4FVMA 3F7VC 5IY5B 3ZRWA 4XD7A 4ZCIA 2DY7A 1NQTA 3S1MB 4ZIBA 1KQSA 2Q6OA 1GM5A 3AEVA 5TSSA 4IGGA 2OK7A 5BY1A 4M53A 1LTLA 4S3SA 3DWQA 1AB3A 1VQ8B 2HCIA 3CCSV 2HDMA 2KUMA 4LBYA 2VBVA 1P8LA 4OWTB 3TEHB 1FXKB 4UB8Z 3GTQH 2ZBVA 1A15A 2B7CA 1TVCA 3ONAB 4G4KA 1QVFU 4X1IA 4WJ4A 4EFEA 3CE2A 1WDTA 2DOGA 4MNOA 4UP9A 4KKSA 4TQDA 2CQOA 2ARHA 2F23A 1HNZO 1KRSA 2RCFA 1A62A 2EIFA 2BDOA 4IUUA 3F7YC 3FAVA 5IYBH 3OP1A 1XMOQ 4WZEA 2N78A 2PQAB 5CORA 5JEAH 1HZBA 1B6QA 1VLOA 2ZNJA 1PH8A 3RYHA 3UI2A 4LF7L 2EX3A 1WTXA 5DECA 4DXWA 1TY0A 1VQMA 3TDQA 1XNRQ 5EBMC 4X7DA 2NBFA 1S5LZ 3QO5A 3CCUV 1TS5A 2K4KA 1U4RA 1I6HB 4UCSA 3LSSA 2VRZA 4UCTA 2PCFB 4A3MG 1GHJA 3AEIA 3MCAA 2EXZA 5CV6A 4B3TO 1BSMA 4XOPA 1FX0A 4DK0A 1XBLA 1GAWA 1IB0A 2ENBA 1ZSPA 4K5WA 3K5OA 3UE0A 5JCOC 4PZ6A 4RKLA 5C4XH 3P3NA 3FVQA 1EY6A 3JCZA 3PIP3 4WFEA 4K5VA 4LF5L 1KXLA 4O0AA 4DV6L 4AF7A 4OP7A 1EY5A 1V0FA 3PQIA 4ZRZA 3UKMA 1HW7A 3I4NH 4XLCA 4A3KB 2RC6A 4NKGB 5EAYA 4X65B 4XLAA 4UP8A 4PA4A 1XWEA 3J7ZC 4DXGA 1PRTD 2UXCQ 4D7TA 2YTXA 1X3EA 2L12A 4B3RL 2ODMA 4QVJA 4YAFA 3ZC3A 2DJFC 4JI3B 4F6RB 2QA4V 2K33A 5KUMA 1GM9A 3SJQC 2WJVA 2XNJA 1JCKB 5EPJA 5JJZA 3MVVA 1BQEA 3FJOA 2PTMA 4XXEA 4JOIA 2RDGA 3CP2A 1IZ3A 3JSNA 2XNAC 1R9TH 1VQLA 1K97A 3G05A 3KEWA 3I56V 3OIQA 2ES2A 1M1KW 5GAGC 2WKCA 4B3RQ 5KLVH 4ZOLB 4XTCS 4POGA 4I50B 5LMNB 2A79B 4UPAA 1YCIA 3UT5B 2SEBD 4YELA 5FK9C 3J80i 2ZJRA 3QTCA 4DV0O 1YNND 2WV6D 3S1NB 4OGQB 3E5SA 1VQ7B 3R93A 3CXCU 3TP5A 5IYCG 2KKWA 1YJ9V 1PMRA 4ZCMA 5DM6V 1IYUA 1VHOA 5JJNB 3ASTA 1PFNA 2R7ZB 1OZ0A 2ZT9B 3KJPA 5C4XB 1MMMA 2F66C 1N34B 1JJ2U 3F2CA 1R3LC 1Q46A 4L5RC 4GX0A 2G38A 2RSOA 2EIJC 3S9WA 1AZPA 2EY1A 2QEXB 3OTOB 1KJZA 5LXTB 1JWSD 4IYIA 3ZHSA 2ADPA 1L0WA 1CKNA 1KDBA 1Y1VB 4L8JA 2ZZEA 4MTGA 3OAAA 1THZA 4ID6A 4X65L 1V0EA 3AB9A 1R3KC 3APQA 4JCVE 1SQPH 2KJXA 3ZMZA 4KN4C 2VNUD 3KYHC 1OB5A 3R8BA 4H9GA 1JE4A 3X2QB 1M4VA 1WJJA 3IRBA 4NXMO 1ASYA 5IGDA 3W7WA 2ZE6A 2DJGC 1ILQA 4AQYB 3GDEA 2OF1A 2LQTA 2RCNA 3ABMC 1TWCB 2F4NA 3CXHF 3SJZA 3KDFA 2MUYA 4I0XA 5E6TA 1FXKA 3FB8C 1SE2A 5LHHA 2R61A 3O65A 2ZKOA 1IURA 3CRKC 1I50B 3CMMA 1JA0A 1MGSA 3QFRA 3TSSA 3GTPH 2EJ7A 1Q8IA 4HAEA 3AG3B 3WB2A 4X7EA 2DW4A 3I90A 1QZGA 1QB5D 4LFAL 2E2HB 1KC8D 4CS3A 4YXWA 3E8BA 5LL6X 2QSAA 5H5NA 4KXRA 2M00A 1PNMA 3U0ZA 1X32A 4DR3Q 3BVMA 1FYJA 1KBHA 2YU9H 1KAAA 3MEHA 4RPDA 4A4IA 1K5QA 3MZ5A 4A3CH 5IGBA 5B1AC 3KLSA 5ITZB 2LO1A 4TOIA 2CW5A 4JI1Q 3TQYA 4UZEA 1FVIA 2JJ1G 4JI6B 2HQLA 2YWFA 3UDGA 4XNFA 2FINB 2CBXA 1XNRO 5GTHZ 3ABTA 4LFBB 4K5XA 1PH9A 3I4NB 1KRTA 1CEZA 1LYLA 5JWPA 4RQFA 4TT3G 2HIVA 2R3ZA 2B1IA 5LGTA 2YI9A 1YIJV 2GJKA 1D5ZC 4A3GB 1XNQB 2IU3A 1EFUA 4X89A 4DV6B 2FXQA 4NXMQ 5C5MA 1XPUA 3W5OA 5JJKA 2EIKB 2EVBA 5IP9G 5F2VO 4FK8A 4ZKIA 1VQ9B 4RQEA 1W0JG 2LJ2A 5IE9A 4HCEA 1GN2A 3MHHC 1KD1W 5M5WB 3IKJA 3OMIB 1V54B 2IHFA 4AYBG 5IDJA 4FXUA 2N04A 1FNWA 1X4TA 5B6IA 1QVGU 1K3RA 2A6ED 3U4ZA 3FD9A 3QVNA 2N55A 4CGYB 4ZK9B 1M56B 1CKOA 1Q90A 4JI8L 1VMPA 2E8GA 3T13A 1ZL8B 4L6TB 2JA5B 1RIPA 5EC2C 4DR5Q 4U673 2CDYA 5J1ZA 3EVKA 2VWJA 4LF7B 3W3AA 5ISRA 2X6LA 1ENCA 3OT7A 4AHCA 2OCCC 4DF7A 3ZRWB 3CCJA 1PKXA 5D65A 1KQSB 4P22A 1C48A 3THOA 2ZD9A 3H1KH 2FVGA 4M2LA 1LLRD 3UT5A 3AU7A 4X9QA 1EWHA 5I2XA 2Q5ZA 1WCMG 4JOIC 1FNBA 1W6KA 1GAQA 2PI2E 2KECA 1TWFH 2QWQB 1ZEQX 2HD3A 3SLDA 4DR3L 1C9OA 5JEAG 2KHSA 4B47A 3JAMc 1EP2B 2B2YA 1O80A 1MOFA 2ZM6O 3OW2B 2VQFQ 3S1MH 1EBOA 4PDMA 4XBFA 3QFSA 4HAMA 1AP5A 5IYQA 3H3VI 2ASBA 3CXCB 1B2TA 4O2BA 1D7QA 4LF6Q 4NKLA 3ZHUA 4OX9B 1EWCA 2C2WA 2UXDB 3H0GB 2JA7G 2JEXA 1K73D 1GJRA 1GR1A 4QE7A 1CKMA 1HUMA 5IJ9A 1VMGA 3B82A 1V1OA 1VQMB 2G9DA 3GB7C 4IALA 2BVNA 1Y74B 1RQPA 4IURA 2XEXA 4D7SA 5CMDA 1EZJA 4R1JA 3F5TA 2B2VC 4Y7CA 3T1YQ 1QCEA 4KUMA 1VP7A 1VQJA 2R93G 5BR8O 1IBML 2F3VA 1CUKA 2ID0A 5IWAO 1S0VA 4QJFB 5GROA 3CD6A 1M9NA 5C93A 4DR2O 2KQ3A 4LF9Q 4JI3Q 4HYOA 3T1HQ 4TUYB 1KNEA 3S2HH 2IH3C 1SF9A 1I94O 1HR0B 4JI4L 3MD0A 1MSWD 1ET9A 2QTZA 3K0XA 3U4VA 1GXDC 2Z4IA 5EYPB 4A3JB 4DNTB 4U7NA 1U2RA 2BDNA 2OYQA 1MABA 1ZXTA 2IH1C 3S17B 2PZTA 3WWVA 3M4OB 3ASNC 5LMNQ 2AZ2A 4JI7B 2LP7A 4RUFA 2DETA 1LTRD 4RD6A 1U5KA 4RCYA 1PZJD 3NHHA 4F6RA 3VA7A 2UU9B 3OW2A 2ILMA 4G7ZC 2MP1A 4YWKA 3ZIAA 3ABKB 1SN8A 1CPYA 4ZI7B 1HNZQ 5IYCH 2EIMC 4NB3A 2Z3YA 5E79Z 2M5SA 3BRCA 4GZRB 5GONA 3LUTB 4F87A 1JORA 5EMNA 5FO0A 3OKXA 4PZ8A 5FLXL 1BMFA 3DMUA 3ONUA 3OGCC 3OTOQ 4P30A 3LNMB 3PUWA 4IUPA 3VOUA 1ILPA 1LV9A 5J3BA 3T1YO 2F0OA 1IW7C 2ADQB 2KHJA 1BL8A 4ZYSA 4A3EH 1WB8A 3U6BA 3T2MA 1PHJA 4BBRG 2HHHO 3QFTA 4A3EB 1M90D 2WIIB 1AR4A 1YI2A 2Z0SA 5M5WH 4MTOA 2TSSA 1IVSA 1E64A 1UFIA 2QEXA 3VBBA 2VYQA 3FKIB 4DR7O 2ICEC 1PTOC 2C5CA 1EFTA 3H1IH 2BV3A 1AILA 4FM0A 1RFYA 3T4AC 1OCZC 4OPHA 3ASPA 1V43A 4MVOA 4OIJA 4L87A 5HURA 3JAME 4QL5A 3KF8A 2B2TC 4YIJA 4A3DH 1OTCA 3C3TA 4MHEA 3K03A 1DK1A 3VA5A 3ZEDA 3FB7C 1TUBB 2QTSA 1YDXA 3QG5A 3BH4A 3IFXA 1QVFB 4WRDA 1K8OA 4B48A 3BZKA 1VJSA 1HZAA 1RPOA 4A3BH 4I65A 4HMJA 4LWSB 3HKZE 1UNSA 3GV6A 1X3PA 5J3OA 1M57C 1XMQO 1G1XB 3MC0B 2NB0A 4TN1A 2IX3A 2XAFA 2Q2TA 4X62B 2ZNIA 1IKMA 4ZI7A 3D8CA 1B53A 1B7YB 4XN3A 1BHBA 1GD7A 2OIGA 1VQGA 4JBWA 5L3CA 2HHHQ 1QGAA 3JASA 1ZYRC 3UQ8A 2AHOA 3D6WA 2CK3A 1RDPD 4YHHO 3VQXA 4FFBA 1SBBB 4IFDJ 1HA6A 1IDSA 5H9CA 1B8AA 3JQPA 1CA6A 1NCVA 1EU3A 3Q0AA 4X0CA 1UD4A 4Z4UA 3S1RH 1I4RA 2QGGA 1N36Q 2BOCC 2CHBD 3PUYA 1X9NA 4LBVA 2UUAQ 2GBOA 4GNXC 1W35A 4GOPA 2HFEC 1MA1A 2Y0PA 1HQRD 1HXYD 2K32A 4LWCA 2X85A 4DAYA 4DA2A 2H4OA 2YIBD 1Y74A 2EZOA 5FO1A 3BYYB 3CQZH 5C0XI 3UO2A 2RKSA 1RD9D 2HP8A 3KLSX 1UPGA 1A2UA 1WTWA 1IXMA 3ETQA 1M57B 1K3EA 3H1JH 4OPSA 1OCZB 2F0EA 4X66B 3CCQV 3M3YH 1GVHA 4JF3A 1QG0A 4MTFA 2CK3G 3U6KA 4J11A 1MZEA 2EIJB 1SQXH 1IBKO 4NB5A 2UUCO 4B3SQ 1HR0O 3A8JE 1T6ZA 1Y67A 5GAHC 2O57A 3H1HH 1N06A 1QUQA 3FKIH 2ZTGA 2KEDA 4LF8L 3PF5A 4QIWF 4TQFA 3AK2A 1EFRA 1FRNA 3H0GH 4GKKL 4B44A 2AQ3B 1TVKA 4X64O 2IJ0A 3OFNG 3VQWA 4JI2Q 5B66Z 5IP7H 3KJOA 4DV5L 4IOCA 1B3QA 1G7SA 4XKWA 1V9PA 4AH6A 4DV3Q 5CB4B 2OTLV 1LTBD 1WOSA 1XJVA 4XDLA 4X88A 2R92H 4OPAA 3JD4A 1N05A 2BN4A 2K01A 3RLNA 2AHOB 2RNBA 1VQ4A 2AHYA 4QGUA 2ZZQA 4Y7NH 4RG1A 1JOYA 5LMZA 5EBCA 2FTKA 4KY5A 4HIOA 4OGQC 1S72B 5CBEE 4DV1L 4LFCB 3GSIA 2EDGA 2L0CA 4FLXA 2XSCA 1JJ2A 3BFRA 4N23A 1AP6A 4J41A 3T1HO 2JA9A 3K0DA 1VQAA 1Q7YD 1S5BD 4WZTA 4DW0A 2EQSA 3H91A 2X53S 3LWEA 5EKKA 3E0EA 4X66L 2LXJA 5B3SB 4EKWA 3LGJA 5L37A 2OQ0A 2E2IB 2QM4A 3D36C 3GTMH 2UXDQ 3ES9A 5HZBA 1G8MA 1K34A 1RP3B 1WPBA 3WFVA 2JDIA 1H9SA 4GS3A 3K57A 2OBRA 2CGNA 2H1EA 4K2LA 3ABUA 1WTPA 4DV7L 1IBLQ 4X07A 1UEBA 4CBCA 5C4JH 4GX1A 2CE4A 1EWIA 3APOA 1KTKA 2L55A 3H94A 2NUCA 5JQGB 1B3AA 2ZBUA 3RLOA 4GKKQ 1P16A 1S72V 1KRHA 4OO1H 3HKEA 5IGFA 1PV0A 3G71A 1FAFA 2ZE7A 4JV5Q 2V7QA 1EFRG 4FZ0A 1M90C 3AYHB 4K8ZA 2YV5A 1RM1B 3JAML 1K9MC 5ELCA 1EYGA 2CCZA 1II3A 4H7BA 3OTFA 3DTUB 1TVKB 4LC0A 3QF7A 2L9HA 2F4VQ 4A3GH 4X7FA 4JYAO 1D2DA 3TN2A 3WNBA 5CB4A 1DZ1A 2E5LQ 3W2EA 4WJ3M 1NBMG 4P3IA 2VS1A 4GN3B 2A0LA 2F0UA 4DV0Q 5HGTA 4B3XA 5I4DA 3FKSG 4YY3B 3U2QA 3CD6B 4R71A 2UU9L 3JAWB 3ND8A 4CH5A 3QR8A 1WD1A 3K06A 1IX9A 4KD4A 1DDIA 3CJHA 2CTPA 2GSMB 2N74A 4EFBA 2DNEA 1LUZA 3V2TA 1I4XA 1S5CD 2R7DA 4KMUC 4X6AH 2QDBA 1P4MA 1ICFB 1VQEA 2Q6LA 2PYKA 1VQ5B 3PUMA 5C44G 3WBJA 1WA8B 2JS3A 1OXXK 1DOMA 3CHBD 3QOJA 4X1KB 3CCLA 3EJIA 1OXTA 1KL9A 4MVZA 2BMWA 1IW7D 1QR9A 4OOXA 1ET6A 1K4CC 1KMIZ 4HNAA 3CCSB 5CV8A 5H6QA 3BA8A 1BXTA 3G71B 1U9RA 1HJPA 4NXNL 1E24A 1WJZA 1YVWA 1PL0A 3X2QC 1GOZA 3STLC 2QEJC 2ATWA 1A6XA 1CZGA 1F9SA 3MXNB 2MJ8A 1RJTA 3C3LA 3A0BZ 2OT5A 2BGIA 1CSPA 2L15A 2BOBC 3PIOA 3CCEA 4DV4L 3CC2V 5CBFA 4GX2A 1HCZA 1LABA 5FL7A 3AQQA 4HCSA 4UCUA 1SLJA 5JBQA 3URYA 4II2A 1B2RA 1PYSB 3QE2A 4B08A 4DPGA 1NDHA 4RKBA 5IOCA 4X8IA 3AVTA 3CESA 2B9ZA 1QUQB 1WOCA 2A1AA 5EIBD 3ERQA 3CSXA 2VBSA 2DGYA 2RJZA 3QO7A 1HA3A 1YI2B 3JD3A 5CN0A 3OR6C 4UVAA 1FD9A 4UFZA 4WFHA 3V76A 4P9PA 1A8VA 4H33A 1A0IA 4EH1A 1IL8A 2PZUA 1KC8W 3NXWA 5GV7A 4KHVA 1V54C 3OMGA 1E63A 2RN9A 1N33O 3A8IE 1COWA 5IWAQ 3ZZTA 1XQBA 3EQLC 1E0BA 4O4IA 2IJHA 2L35A 1ENVA 4G27B 3ZIAG 3DM1A 3D8GA 4IPCA 1VQBA 1PZID 1U4LA 2OWOA 4BBSG 5K36G 4RD3A 3BAAA 3WG7B 1EP3B 4L5SA 2P5ZX 2YSUB 4M0LA 2JA7B 2B5OA 4XM3A 4WCEV 5KW9A 2JIZG 1O78A 1SYFA 1PH1A 4LF8Q 3W2IA 2KA7A 1QVGA 1TQOA 1XL4A 4CDEC 3HKZG 1LM0A 2IM9A 2ZITA 4PI2A 1CTMA 3OSOA 3EXAA 4K6LA 2GUZA 5B1AB 2ETNA 2XTAA 3E9HA 3GP7A 4FFBB 3AG3C 1N8RD 4JI1L 4Z4WA 1QG7A 5JQGA 1XMOB 1K73W 5FLXN 1VQ8V 2QGQA 1PVOA 4RDJA 3STZC 4C7UA 1UE6A 4P25A 2VNKA 2V7QG 1PDQA 2Z5UA 2EYMA 3G48A 4OX9L 2UUCB 3AVWA 1I4PA 2ZXHA 1KK1A 2QF7A 3OTOO 1AEXA 3N2GA 4JI6O 4FO2A 1XNQL 4R4OA 3E89A 4B3RO 5AN9A 2Z1CA 4RGOS 2AXTZ 4FXKC 1VQ6B 3A8JA 1VF6A 4C3HH 4P3YA 1P7GA 1R73A 2QDXA 4YALA 1VMCA 5KEEA 2R7ZG 2X6WA 4CS4A 1FNUA 4X1YB 4RPBA 4CDDC 2B39A 1KLUD 3A5ZB 3K79A 4G7WA 2F03A 3TCUA 4DK6C 4O4IB 3DM3A 4XOTA 3IAYA 3G67A 4PMWA 1ZWIC 1PP9H 2TMPA 2KVMA 3GWKC 4A3FG 1T6YA 2QKSA 2IBZH 2K05A 2OTLA 2JEUA 4YCVA 2CNDA 4LR3A 4LFCQ 4JGSA 1OJHA 1FFTB 3FYIB 4TMZA 4J0QA 3RT3C 4XMYA 1DJRD 2X6BA 4C2MH 3Q24A 1D2BA 1FNMA 1BVSA 1S3JA 1JQYD 3G6JB 2VQFL 5M5YH 1XPRA 3CP1A 1BMFG 4TV9B 1K28A 2B2WC 1YZ6A 2G9HD 1HFGA 1F7YA 3DWPA 1F4NA 3GVMA 3OEEA 1PJ6A 5L3EA 1VQ5V 1I0HA 1DG1G 4IUVA 5M3FH 1QFZA 3S1RB 3RYIA 1SYCA 2K5VA 2WP8J 4DUZQ 2UXCL 2CH7B 4CC6A 1S3OA 2D3LA 3QJYA 3CF5A 1SA0A 1YHQV 2RMKB 1QFJA 5IY5C 2ZE5A 4DAVA 1HZEA 2X69A 4UVCA 4ALPA 4DR1L 5IJ0A 1EFCA 3ETGA 4FDBA 3WXMA 4K6DA 1SKQA 2L4NA 2E2IH 3BABA 2JYOA 1MSHA 4J8QA 4DR2Q 1IXBA 4DNIA 1PFMA 2A3QA 4RAUC 1Y6XA 3N27A 4A3LH 4OONA 1FJGL 1JFFB 2B2TA 4A3EG 2NZ1D 5EBLC 1F2YA 2Q8VA 4PV1B 1PL4A 1RQRA 3P30A 2GDSA 3T1CA 1QCBD 3CCMA 2RQ6A 2SNMA 3C46A 1MNGA 4GCZA 1SMXA 1UWVA 3NXSA 4LBZA 4DR4O 1Q6UA 4HBNA 1SS3A 1SNCA 1O9GA 3Q38A 4KV6A 4LNQA 1LT3D 3FB6C 1TWGB 3CW2A 1B23P 4A3JH 1JB9A 2BSAA 1HTPA 3MEFA 2D3NA 3S15B 4DV2B 3NBHB 2RF4A 1YTFD 1W2BB 1SDFA 3VMFA 3OUSA 2YDEA 4LMQD 4XONA 4OIKA 3SYPA 1HNWQ 5LMNL 1RODA 4ZHQA 1QNUA 3OWFA 2K5HA 3JAKB 3NWSA 3L74H 4JPRA 1DD2A 4U9UA 1CP9A 3ZJZA 3SLNA 1HWYA 2D74A 1EZ6A 1EUJA 1YHBA 2EINB 4R8NA 3J7YW 4AQYL 4F7DA 4DYLA 1JB3A 1Q8KA 1K8AW 1GJXA 1FJGB 2KHIA 5CA0A 3RW0A 4A3IG 4L5QA 1G2SA 4A3JG 4P6VF 4OELB 1OCCC 4GLXA 2XT9A 3B6YA 2ZTNA 4DR4Q 3WB1A 5C5LA 1E2ZA 2W6JG 5IYRA 5IT9N 3T53B 3AVXA 2AQ2B 3NSWA 1BZKA 1JNYA 2XZOA 5CA1B 3S3WA 1LACA 1FXKC 4DR6O 4Y9RA 4LF5B 1F2LA 1S5DD 2ZL7A 4NCNA 2V7WA 5KSWB 2ZTDA 4QIWB 5C4HA 3L2PA 5KYLA 4PNYA 3T51B 4A3CG 2CRVA 1PH3A 2UXBB 4IPGA 4JPBW 1VHEA 2QTLA 3K7AB 2MQHA 5FJ8G 1WAZA 2FJ2A 2F0MA 1Y76B 3E0JA 2HR3A 3CWBH 2OYNA 3FKIG 1SE3A 4IO9A 3SPGA 2B3GA 3IC7A 1BUVT 1O7ZA 1V8QA 3J7AF 3B2EE 4IFDG 3VYRA 2YIBA 4LNUA 1N34O 3BA9A 2KB1A 1N33Q 5CV9A 5B1BC 1M8AA 2DEUA 5CBAE 2P22C 4LF4O 1PV4A 1XE1A 1ONLA 1ZM2A 3V7AA 2YWGA 2L11A 3ZHRA 1ZUNB 3WNCA 5LHY1 1R6KA 3WU2Z 3CMAV 3OGIB 3H3VH 4BBRB 2JQOA 5HGQA 3RZDB 4J9ZB 2EBOA 3G6EB 2HJDA 3BHPA 3JD1A 3TK1A 4J7KA 4Q20A 1LTAD 1Z7TA 4BY1B 1E79G 5KA6A 3KBGA 5NUCA 3HB3B 4TV9A 1WPCA 1EY8A 2BTQA 1XNRB 1BCPD 1HNWL 4JI3O 2O5JC 5B5EZ 3WNDA 4IW3B 3HOXH 3CRQA 3BNWA 2EYOA 2PYJA 4TSFA 3WOEA 4B3TQ 4P71A 4DR6Q 4B9WA 4EQ5A 4DV7Q 5DSZA 1G4YB 2D0PA 4KJOA 5COYA 2R7ZH 3OZVA 1CFMA 2V7TA 3HKBA 1F20A 4Q6GA 3ZN1A 3LQEA 4Q7JB 1QILA 2ZT9C 3W2DA 4PA6A 2Q8IB 1C7YA 2ZINA 1BX1A 4BBSB 2NVYB 3JALB 5FPRA 3SJBC 1IBMO 3S15H 3PVDA 1RPRA 1JFFA 1KD1C 3TS0A 4PA9A 3K9AA 4LJZC 4RA8A 2GUZB 3LQ6A 4X7CA 3ZBUA 2ALYB 2IPKD 3KUPA 5EKLA 2A69D 3ZRXA 1YNJD 4BS9A 4DV1Q 1HNXQ 3KCYA 4NTYA 3S14H 4YJ3B 1BE3H 4O4LA 5IYZA 1D1NA 2XWJB 5IYNA 1UMKA 4CJ0B 5FOBB 4DR1Q 2W0FC 3OM3B 3HOVH 2ZDIA 4UXNA 4TKOB 2CAZC 3FPUB 1H85A 1NE3A 4RAIA 4G1BA 1L8DA 2B2UA 1D1KA 4Y9UA 3PCOB 5CR3A 5FO7B 4DUZL 1SQGA 2JA7H 1N07A 3PO3H 2JGDB 1SZTA 1L1OB 4MTKA 1IXRA 4C3IB 2HDNB 4NYKA 1QFYA 4J15A 4QFMA 4J10A 5ELOA 1LR1A 4FF4A 4A3GG 2E1BA 2LZJA 5DN6A 4K0KL 5KX5B 2YIDA 1STGA 4II3A 2A68C 2EY6A 2M9VA 3JC66 1SE4A 1WTVA 1AP0A 2WLLB 2GQFA 3DXRA 2LKVA 4W4LA 1CQXA 1NZ6A 4DR5O 3D3IA 1HA5A 3M9BA 3FEWX 2HVKC 5E1FA 3PIPA 2WB1B 3Q8DA 3OEEG 3F2BA 1NRKA 3HOWH 2HG5C 3K5NA 3A5UA 1EN4A 1I18A 3S3XA 1SM4A 1VF5B 3RYCA 2ZZGA 2EINC 4MIUA 1GO2A 1UD5A 1LTID 1IBLO 3K5LA 1SKYB 3K58A 1G6UA 2X6XA 5I6WA 5C44H 2UU9Q 4CKEA 5I9OA 4Z1MG 1N9WA 2JEBI 3IL8A 4HJ9A 3I4MG 1OXUA 1E1QG 4HIMA 1Q7YW 1DOKA 4QV2A 3NELA 4IJLA 3EBEA 5JPNC 4AI8A 1NNXA 2E5LL 1CT1D 2B63B 2JA5G 3AMUA 4QPKA 2PNHA 2GK6A 1HHVA 2IJJA 1B70B 2GJPA 1VQLB 1NR2A 4JG2A 1W9XA 2CFMA 1BHAA 2FHTA 1NTMH 2D2CB 3ABLC 3SYCA 4CZZA 5IJ0B 2UUBB 3NENA 3BVOA 3CMEB 3K7UC 3CMAA 3ICEA 1L1OC 1PKVA 3SHLA 1YJWV 1P84F 1JICA 2WB1G 2Y0SG 1FYCA 4EX5A 1G6PA 1K9MW 4KJNA 1GKFA 4P9SA 5BXZA 4CC5A 4DXFA 2WACA 4JI0L 3I4MH 3CCRB 5IY0A 1TY2A 1TR5A 3L72H 3X3MA 1N0VC 2RQXA 2NZOA 1R9TB 2JXMB 1CQVA 2GN5A 1UE1A 1BBUA 4RH6A 5M3MG 3ZUGA 2X7RB 3ML0A 3GVKA 4C0SA 1R1BA 2Q8RE 2Z6KC 2Q6AA 2NTTA 3KF6A 4G7HC 4Y52H 4UCRA 1SMYC 3QOLA 4R9WA 3ULLA 1EYAA 4WBNA 1DYQA 3JCUZ 5EIBC 3TETA 4JI5B 2K28A 3I5DA 3CKIB 3W7TA 1XMOO 1E1TA 4JK1C 4LFBQ 2VY3A 2JA8H 3RYCB 4ZHQB 4YEJA 2V1DA 2Q4PA 3ONYA 4GKJL 1D8LA 4TMTA 2GJRA 1NTKH 1SYGA 2NVXB 2ZL6A 2HVJC 4DUYL 1STAA 3QFCA 4UVBA 5L3FA 2DY1A 3OJWA 3SR2C 4DV6Q 2X8KA 4UY8C 4L63B 3WQZA 2VNJA 3TREA 1MI2A 4PA7A 1B50A 1U4MA 3OWEB 3AVUA 4B7EA 2XAHA 2F3IA 4PC6A 4IN3A 4G28B 1P49A 5D3DA 3PUNA 1T9HA 2FFKB 3UDXA 2Y0SB 5G3LF 5JVDB 3HKCB 2F0HA 1YLOA 2F0QA 4BR6A 1AE3A 3OYYA 3O9OA 1QUEA 3D36A 3ISXA 3DC6A 3K3WA 4YHHB 1KKDA 4C3HG 3FMCA 1F2ZA 4UV9A 2PZSA 3BDOA 3QIAA 3M3YB 2L5TA 4BXXH 2R7FA 4ZOLA 4I50A 4ACAA 2ZXRA 4FF3A 5A2QE 3MHBA 3OIPA 3G6BA 2EJRA 1JR0D 4EQPA 3L9DA 3LVBA 4BW9A 4JBKA 3I8ZA 1M1KC 2B1GA 3KF6B 1KHIA 1KABA 2Z6BA 4C1NK 2H3OA 3TXQA 4A3FH 4DV5B 4DV1O 1K92A 4NR1A 1E7ZA 4JYAB 2WLLA 1BJKA 1B9NA 1VQDA 1JB7A 1NVPB 5JAVA 5KAFZ 2PMZE 2A74C 2WAMA 1RCVD 1N36L 3P26A 4X66O 5LXTA 5EZYA 2XVSA 1E3XA 1X56A 2ZQMA 2K9PA 3B8NA 1HVXA 2DERA 5H5JA 1R4QB 1BCCH 1HZCA 4YCUA 1VQ9A 4P12A 4LF6B 4JYCA 1HR0W 3SKBA 4OX9Q 2Z8LA 3S14B 2EYJA 2M6YA 5HFLA 2EJFC 5J2UB 1Y1VH 3R3OA 4PC7A 2ZM6L 3EHBB 1YHQA 1S4MA 3SGIA 3WG7C 2Q6IA 3SDZA 1MRZA 2YWHA 1I4GA 3I72A 4M1UB 2KCNA 3ZRVA 2ATKC 5JVDA 3D4WA 3KDFB 3SK4A 3U9SA 1Q81C 2YTVA 1H2NA 3MHSC 2SNSA 4YIOA 4MW3A 4RMFA 1X6OA 5HY6A 1FNVA 3U11A 1W6JA 2XZPA 1HNXB 3GVLA 4DV1B 3BY1A 3PENA 3MDSA 1DDGA 4CBVA 4TSSA 1Q12A 5IE8A 3J81L 2Z9HA 3CCMV 3ULPA 4WQMA 4JYAL 2A73B 4IYHA 5KHGA 3KK7A 3T1HB 2XOKA 2YEVA 3N52A 1HR0Q 4RO2A 3HOVG 3CPWU 2N3SA 3PGZA 2EYFA 2EYPA 3ZZ0A 2LW7A 1E1OA 4YAOA 1Q1EA 1V55B 2UU9O 3T16A 1E62A 2QE7G 3FX7A 3MHPA 4UAJA 3OW7A 4ZGNB 1EIGA 1I6VC 1PYWD 1FXVA 4O4LB 1NB0A 1SJHD 2EOTA 3A8KE 4LW1A 4UDUC 1J5EQ 2BE3A 1UAPA 4B43A 3L9AX 1RHPA 3MWYW 2NN4A 3RUZA 4JV5B 3OW2U 3S16H 5I9PA 1BQ0A 1JT8A 1N32L 4NTXA 2Z0AA 3MTSA 2IW5A 4A75A 4G1VA 2B2WA 2WA4A 3CPWA 3ABKC 5LHIA 3E9IA 2JDIG 4ZUJA 2RC5A 2GPJA 1KECA 2DOSA 1UD2A 1R3JC 1U0LA 3CC7B 1B1ZA 1H42A 3AK1A 4G7OC 1M93A 3SPIA 1TA8A 1IBKB 2B2UC 4DV3L 3R65A 4NXNO 2A5HA 4ODGA 4YY3Q 1Y4MA 4DNRB 4NP5A 3K80C 1SESA 4LH6A 3ZMTA 1I3QH 1K7DA 3CMEV 5KNLA 2E76C 1D1IA 2WB1E 3GTKH 4O42A 3C90A 4MYTA 4P26A 4DQKA 1P7BA 1VQPV 2XNDG 1Q3LA 2UXDO 3PSIA 1TWAB 2NN6I 1CKNB 2NN6G 4HIZA 2F4VL 5IYPA 3NTKA 2YICA 3FFQA 4A3BG 1I6HH 2V7UA 2WYRA 3WDNA 2NVQB 3QO8A 3CRZA 1HRJA 2CTRA 1H9JA 5G3LD 4IIJB 2K5DA 2DYSB 2ZM6Q 3CD6V 1EZVH 4LF9L 1BNZA 2DN8A 2CW0D 3ZRSA 4R4QA 4UCVA 1GUGA 4DKAC 2MO0A 1JMKC 1WP7A 3JARB 4ZV4A 4G6IA 2ZXIA 4EB6A 4HIKA 1OHHG 3PN1A 4TSFG 2M2LA 3D4RA 2ITCC 1NH2D 1OV9A 1D8TA 2B29A 4BW5A 2HIXA 3NPPA 5K1PA 4LBEC 2Q2UA 4JI7L 1H2MA 1BR9A 2K6AA 4R8IA 4QE9A 3RZOB 2P4KA 3OZUA 1NSNS 1XL6A 2F93B 1J5EO 3BU2A 4LAAA 4JI8O 2XZLA 3M4OH 1ENFA 5M3MH 1GUOA 2J7KA 3B8HA 3EVQA 1H38A 3HRZC 4O2BB 4X3UA 4LFBO 2M7WA 1SROA 4YIPA 3CCRA 2F0DA 5LP6B 2WLKA 3FRPB 4KN7C 1SYEA 4QUCA 4K1XA 5H2FZ 3PO3B 1YIJB 1IBMB 1WORA 2AZ0A 4ZCKA 3QNEA 2NWGA 1NBMA 1SETA 2IX0A 4JZ2A 5TISZ 1JJCB 1XDCA 1RF2D 1H95A 2R72A 4K35A 1B4OA 3I56A 5BZBA 5JH7B 1QX4A 2IJIA 1QZHA 2X0LA 4DV2O 4HTHA 4FLTA 1EWYA 4NTWA 3A74A 2Q0AA 1CHQD 1NUCA 3BJUA 4NDXA 3HOZH 4XYOA 4B3GA 2JA6B 4A3BB 1M56C 4TUYA 1QR8A 3OUFA 2AWOA 1Q81D 2XAJA 3HS0C 1E1RG 4KLKA 2H94A 2YIAA 5ELBA 2F43G 2B63G 2EY2A 3PV0A 3W1BA 1R3IC 2HEPA 5EC1C 2JK8A 2R93H 1GAXA 3RLFA 4H37A 3LNNA 2EIKC 4H13B 1QOHA 4U7OA 1K4DC 4X1IB 2DUDA 2F0SA 2A06H 5I6YA 3PO3G 4K2KA 4KFMA 4F6EA 4YWMA 1OCRC 1SNPA 1V1PA 2PY5A 1LTSD 5M9OA 4JI4B 1PTOF 1HR0L 1Y1WH 1VQMV 4KTAA 4DV5Q 3FAVB 4N3GA 3ETEA 3SEJA 3W2GA 2WAQB 4X3TA 4B3TL 3VR3A 1TAEA 5C4ZA 1QNMA 1SE8A 3VR2A 3M99B 3S1QB 2GHYA 3BZDB 2EZVA 3SPCA 1EY0A 1Z9FA 3NTIA 4GOPB 2A6EC 3HZXA 5IODA 2CWAA 2UXCB 1CZWA 2PW5A 2FMCA 3ER0A 4AIMA 2BCOA 1I94L 1JJGA 2F0FA 4XLEA 3CRCA 3CC7A 5C4XG 5LMUB 2JIZA 2A6HC 3ZHQA 1E2VA 4QUZA 2K7VA 3SJAC 3CCMB 4IUNA 5LGNA 2F0IA 4I55B 4YY3O 3ZMUA 3CCEV 2GA4B 3QWNA 2ZR3A 4EVOA 4Z4YA 3LX0A 1MSDA 1JA8A 3RGBA 3PUZA 4G57A 3J80L 5KHIA 4C2MB 1H2SB 4DQLA 5L3DA 4K14A 2CQAA 1FJGO 1BF4A 5JEAJ 2LW1A 1XI1A 2PO4A 1VQPB 1EFWA 2P90A 3U9OA 3I55V 4HZ3A 2RDCA 2YUAA 2V4DA 2RA4A 4GN5A 1PFBA 2HT1A 3CPFA 3LSQA 3GTJH 1WTHD 2QWNB 4IUTA 2HLDG 3K08A 3GV3A 4H0LC 4LUVA 2E2JH 3HOZG 2Y48A 1A3VA 1H8EA 1XXGA 4B4DA 2EILB 1CNEA 1W3SA 2PMDA 1MBYA 3I7FA 3LWUA 1VQHA 1J5EB 4O2AA 4KP4A 4U3JA 3A0HZ 4LFAB 2ZXOA 2YU9B 3TP6A 2IL8A 4FF1A 1FGBD 3ND9A 1NMGA 3CPXA 1H9SB 4MTNA 2V7VA 1ESFA 5AFWA 1E22A 3VR5A 3WOFA 1FGUA 2UXBL 3HFZB 2D3OW 4ZUIA 4AF6A 2RSNA 1WYDA 4ICGA 2P4VA 1BCPC 1L0LH 2AUJD 4XKVA 3TRZA 3CX5F 3AG4B 1FKAO 3H9NA 1SYDA 4XR6A 2BE5D 2VJJA 4WJWA 1STNA 2Q6KA 4JTCB 1NVPD 2JE6I 3CPWB 2XAQA 1IHZA 3Q6SA 4QJFA 2L1BA 2ZIOA 3RN4A 3IGAC 3DDYA 3LO8A 2IW3A 4NNJA 1QGZA 3CRMA 2XASA 1AVMA 3BCDA 2IT1A 2RDHA 4JI8Q 3L75H 2J0TD 3H1LH 1FFXB 2LS01 2PMZB 1VQPA 4CKBA 1B06A 4P6YA 1EOVA 2QWRB 3WYAA 1Y8OB 3F2UA 5KHKA 4WWVA 4PZ7A 4LFAO 5FLMG 3AFPA 1TS4A 3O13A 1L1FA 4IT5A 4R50A 1STYA 3DUZA 5KMGB 2Q8TA 1FJGQ 1YNNC 1FS0G 1GUSA 4XQNA 3A0JA 1KK0A 4DR4B 3FB5C 1EP1B 1B44D 4BAYA 4WFBV 2PYLA 4B3MO 4PC2A 1EEFD 3SXHA 2C4UA 5JVH3 2QGNA 3CJHB 1MJEA 1N8RW 5KNCA 1GUNA 2QM7A 3ZYYX 2NTSA 1DM0B 2I46A 3NUCA 4I7ZC 4LF5Q 1FNDA 1H9MA 3E83A 4ZBMA 1KC8C 1K8AC 1N0JA 3B8MA 1F9QA 3HOUG 4A3MH 3K59A 2EJMA 1AI4A 2UXBQ 4X06A 3J81k 5FLXc 3ZBHA 2HKOA 4FK5C 4DV4Q 3ETDA 1BDOA 3H0GG 5ITZA 2XHBA 3NE5B 1GHKA 1IZ6A 3A7LA 1OB2A 4JI3L 2QN6A 4JYYA 4WZLA 1C8CA 4DR2L 4GKKO 5FJ8H 3VR6A 3T56B 1PH4A 2R92G 2I1LA 4JMQA 5CC4A 5EK0A 3OMNB 1JWUD 3MFGA 2RCVA 1HNXO 1H2KA 1VQNV 1X54A 5FA6A 4LUZA 1JPXA 5A2QL 3N2KA 2F0NA 5DM63 3C2PA 2W6JA 2FKXA 1SJED 1E3ZA 2E76B 1N0UA 1EY9A 4ABMA 2GV9A 4RDLA 1Y8PB 3D26A 1TGOA 4R7CA 1F60A 1S5ED 4CDCC 1L1OA 3KL9A 4UAIA 2PI2A 5KIXA 2GTAA 2YXYA 2VQFB 4MVQA 3LDDA 2VNHA 3W2HA 2YXLA 4YXWG 2QKAA 1XX8A 1Z2GA 1FXHA 3M7MX 1YHAA 3HR0A 5A88A 1F2MA 1ZAUA 1Q90D 1LT6D 3BVGA 4JI1O 5KX5A 1XHZA 1SQVH 1FL0A 3KLRA 3R2TA 1GUWA 4X65Q 3B09A 3HP3A 1Y66A 2DCUA 4L5TA 5FPOA 4OO1I 3G6EV 4X64Q 2C77A 4YJ2B 1I08A 3OPOA 4GN4B 3CCJB 3SYAA 5KHHA 4RCNA 5H59A 2PE3A 5TRDA 2F0GA 3A54A 1SFOH 3KCXA 2XTIA 5HXBA 4A3KH 1PA6A 1K8GA 1QJOA 1R5NA 1NR4A 3BVZA 4JTDB 1OCCB 4B3RB 4KKTA 3T1YB 2F4IA 3HOYB 1DXMA 1KU9A 1BT8A 1PXUA 4GQNA 4DR1B 1JVMA 1F77A 1LTGD 4RGNA 2Q69A 2NPFA 1K8AD 2NVXH 1T5EA 2BA0A 3SPJA 2F1MA 3E8GA 4Z4TA 1IJFA 4MZ9A 3VNUA 1PTOB 4AYBE 2C5HA 3FDTA 2DIEA 3I55B 4X3SA 2YWEA 2ZZFA 1R6TA 4JC0A 4RDKA 2KVOA 5IWAL 1HUNA 2NNUA 3PF4A 1PNKA 2JGUA 2Q9LA 1GO3E 4GZYC 4A3KG 3LSUA 2A19A 1EIFA 4OWXB 3P27A 3D0FA 4KK7A 2CTWA 1PRTF 4EQNA 1I94B
chains in the Genus database with same CATH topology
1F9PA 2J4XA 1WTQA 1I4HA 2Z4HA 1STEA 1FD7D 5KYIA 2PUSA 5FLXE 3I4MB 4HEDA 4KKUA 3DSQA 4XIGS 1L0XB 4WBNB 5BN4A 2HQEA 1BCPB 4AVZA 4IQZA 2B8FA 4QF4A 3GTOB 4O4JB 1B04A 3BDCA 2NVTB 4NMZA 1KLGD 5CV5A 5LL6S 3PIO3 4U3JB 4BWAA 2DNCA 1EYCA 4U68A 4FXGC 3A55A 4XT1B 1CK1A 4EGVA 4KY6A 4CS2A 4NXNB 3M7NA 1XQ8A 5BMVA 4NXMB 4A93B 4Q5VA 4KHZA 1Y69U 1E1RA 4Q0FA 3L7ZC 5BR8B 3MXNA 3JU4A 4BWGB 4F8MA 5LA6A 1TKWB 4DR5B 1SEBD 2B8GA 2B2YC 3NWTA 1VF7A 1N33B 3S16B 2JSOA 5EKIA 1CI3M 1QE6A 1SYBA 2VQEB 1G6ZA 2B2TC 4CH6A 1NT2B 1K8MA 2PZWA 1MD2D 5CDFA 1SSOA 3JASB 5E3FA 4A3DB 1TU2B 2OXPA 3RYFB 1Z5WA 4GYCB 2RBMA 3OHXC 4DV7B 4DV3B 3HKDB 4FLUA 2F0VA 5FKAC 2XNDA 1EEID 5JJEB 4CKCA 3GO5A 1STHA 4O4HA 5K1XA 1PRTB 2XN9C 1KNAA 5J2TA 4ZAIA 1TIID 4C2MB 5C0XG 1Q1BA 4RFBA 3I3CA 3QG1A 4XLFA 5D3IB 1SFOB 3GQBA 5JPMC 4G7XA 1HPCA 5KHJA 3CQZB 1MSGA 3P1HA 5CYUA 2Q7EA 1LT4D 5IGEA 1IBLB 1UD8A 3GTLB 1WP6A 2WKDA 3OOCA 1RKNA 5M3MB 4A3FB 4X1YA 2ZIMA 2F0TA 4GKKB 4XYQA 1J8IA 3H6MA 2DY8A 4PHZA 3P20A 1UEAB 3M7GA 5T1GA 5CA0B 3WB0A 4X20B 2YI8A 4RHRA 2RVLA 4FF2A 3NTHA 3HKDA 1O7YA 3VR4A 4DV0B 4P2CB 4CH3A 2P5OA 4B3FX 3JARA 1WCMB 1DCZA 3R2IA 3SE0A 3Q23A 5JCOA 3SK5A 1JOQA 2WINB 2D5DA 4ABNA 1JOKA 5EPKA 4C3HB 1TWFB 3HKZB 2AUKA 4OHJA 2V31A 1STBA 2KEEA 3SVMA 4CJ2C 3GTKB 1ICWA 1QQCA 3HOUB 3BG3A 4RWSC 1CQFA 1EQTA 4FYDA 3DEOA 2K03A 4J6HA 5FNVB 4XT3B 5C3WA 2OEOA 4BA1I 5EQ0A 2XGJA 3HKBB 5IGGA 3V96A 5HKKA 1WN7A 4Z1MA 1Z5VA 2QE7A 5BN3A 3EFXD 3P75A 3MXPA 1O7LA 1Z6HA 2Q7GA 4X3KA 1UD3A 1V1PB 4DRXB 2MGSA 2WJYA 2O5IC 1SNQA 1K83B 2EPBA 4F7XA 4E0FA 3JSLA 3E22B 2QCPX 2F0LA 2K04A 4A3MB 1Y8NB 4DU9A 1BBXC 5K36H 4EEQA 3RFRA 4JI2B 1W0KA 4FLWA 1EYDA 4FLVA 1VCIA 2PW7A 1A3TA 1KDCA 3SEBA 4UZUA 4DUYB 4X20A 1G291 4KD3A 4ULLA 1JWMD 2KCCA 3RWRD 2RDFA 3NQIA 4N9PA 4C3JG 1KMHA 1SNOA 4I4TB 4OO1G 3DHQA 3H3VC 4B3MB 4WFN3 1QHTA 3HOVB 3X3NA 5CGKA 1DONA 3HGBA 4FM2A 3RYFA 1BCPF 1AZQA 4XLHA 1IKLA 4O2AB 4K0KB 5IT9L 5JVG3 3JALA 3ZPNA 1X3QA 3U10A 4TV8B 5IGCA 4NVPA 1ZKOA 3CHXA 4DUZB 5C0XJ 5IIFA 2R9VA 1M5IA 3CB2A 2E5LB 3QO2A 1XYIA 4FNFA 5I2YA 5FNVA 4XDXA 4DR2B 3GTMB 5C6AA 3VYUA 3GD7A 1D5AA 2M00A 4CH4A 1R4PB 2XRQD 2LMCB 3CU7A 1CA5A 2R70A 4IZ8A 1BLIA 1ENAA 4ZKBB 2EE1A 2VUMB 2F0KA 5ELDA 2CVRA 3GTGB 1L0YB 3TP8A 3K5MA 2VB2X 4XQFA 3HKCA 1HNWB 4DR3B 4DRXA 3H09A 4DN4M 1I4QA 2A68D 1EU4A 2AQ1B 3HG9A 4K8JA 3E22A 2BE5C 3HOWB 5CV7A 3ITPA 4PMCA 2W6IA 3HEJA 1OXVA 3E6ZX 4IFDI 1JJOA 4ME5A 4JI8B 3A56A 3K6OA 3GTQB 1LO5D 1SAPA 5LOVB 5IWAB 1S4ZA 2PQEA 2XIWA 4V190 3D31A 1WTRA 3N2GB 1TS2A 1H9RA 2K5WA 1EIHA 5EPLA 3MA2B 3ICXA 2X6YA 3K0YA 4XQQA 1A3UA 2UUAB 4TQUS 1TUBA 1WVLA 1YNJC 4Y7NB 2C9OA 1U4PA 4ZLTF 2EJGC 1AN8A 3I91A 1GHKA 3OMCA 4RHSA 4ZKCB 5M3FB 1O9HA 5EYPA 3PUXA 4NW2A 3ZS8C 1B9MA 5T1IA 1H9KA 3TMEA 5KGUA 3GVJA 3S2HB 5M5YB 5D14A 1EOTA 2A6HD 2IX1A 1Z47A 3OE7A 4M8AA 5C0XH 1OB0A 4H44C 1QNKA 3BYTB 2Q7HA 5GONB 1TT2A 4QB4A 1VF5C 3IFDA 3RYHB 2VWKA 3EROA 3IFTA 2E2JB 1F9RA 3D4DA 5IT9E 3V05A 1SXTA 5LYJB 2HLDA 3A2FA 1KZLA 1WD0A 1AFPA 5JH7A 2E3CA 4X64B 3TZUA 4KI0A 1XMQB 3CP8A 2LY7A 5E4WC 5EZYB 3VQVA 4DGZA 3I4LA 1RTNA 1CHPD 2XRSD 1SNDA 2KOLA 3NBHA 5ELEA 1FR3A 2QILA 4I4TA 2FMMA 2E75C 3CRLC 3EA6A 4X1KA 2QJ1A 2R9AA 1WNSA 4HNAB 3A3BA 1PRTC 5KNDA 1SQFA 4UCOA 1E43A 2JS5A 2VB3X 3VQYA 4TV8A 1S5FD 4TT3A 4TRDA 1RSOA 2BA1A 5EJWA 3JATA 2F0PA 2ICIA 5BMVB 3M4YA 3J7AV 4FXDA 1PTOH 5KNBA 4H13C 1I7FA 3HKEB 4JI1B 2B2VA 4RCOA 4RGMA 1EY7A 3PUVA 1C4QA 5C3XA 3OEHA 1BOSA 3P7JA 4BA2I 5LA6B 3NK9A 4LNUB 5EBDA 3PO2B 2IWHA 1TS3A 4OL7A 4PQXA 4KHPB 4IFDH 3SJCC 3DWAA 3MXGA 4WORA 3S17B 2F0WA 5JJJB 2HHHB 2F43A 4AYBB 2OT2A 1TVXA 4HN7A 5FO8B 3JAWA 1Q3EA 4C56C 2D2CC 2SDFA 1NAPA 2YYZA 5J22A 1D6EC 3A7AB 2LFNA 3MFYA 4EB6B 5DAUA 1HFNA 2N88A 5E4XA 3SK6A 5DEHA 2HUGA 3SR1A 2J7ZA 4ZQ3A 4Z9CB 4DV4B 4O4HB 5LYJA 2D9UA 5D5QA 5C44B 4B3SB 1S5JA 5J2TB 2I07B 5LOVA 3GTJB 1XTCD 2JVDA 1FFXA 4B3TB 2F3WA 4DR6B 4KY7A 3NBIA 2X6GA 5KMGA 4ILWA 1PZKD 1RTOA 5FO9B 5CV4A 4K8XA 3RMHA 2E74C 5C4JB 4RGTA 3J80E 2JJ1A 1KDAA 1OO9B 4LF9B 4IUQA 2F95B 1HQMC 1TWHB 2EY5A 2F4VB 2HCCA 3J81E 3MXUA 3BS1A 2VJIA 1PLFA 5A35A 4C1NI 5KRUA 3N2KB 4LF4B 1BPLA 1HNZB 2PGGA 2XWBB 5IJ9B 3NP8A 4MN3A 3S2DB 2O2LD 3D3RA 4FP5D 4C3JB 5J2UA 2JA8B 1UD6A 2GK7A 1N32B 2F0JA 1UUPA 3HOZB 4QMGA 1A2TA 4I9QA 1J9OA 4LK1C 1G91A 2NYZD 1WTOA 5LP6C 4CHTB 5EGTA 5F2DA 3GTPB 2K5QA 5C8YA 2R92B 3BPZA 5JOBA 1BO0A 5DM73 1SMYD 4PI0A 4DK1A 4HR7B 3RYIB 1CM9A 2MPMA 3VYTA 4C3IG 4XN0A 2ZM6B 4QUFA 2HDLA 3TBIB 2ZXPA 2R6GA 3JATB 3A35A 3QB3A 4DAPA 1N36B 2AWNA 3FKSA 1JOOA 4HSPA 2WSSA 1EFID 5DNFA 3G7LA 4A3IB 1LTTD 4AILC 1D5XC 4BY7B 4HMIA 5M5XB 2Z6BD 5J39A 4IIJA 4FLYA 1D5MC 1M4UA 2WZPP 2JP1A 1IYVA 4YJ2A 4F88A 4XL9A 4DFAA 4J1MA 2BOSA 4LF8B 3JAKA 4PV1C 4O4JA 1LT5D 4IHJB 5IK2A 5D5PA 3PMFA 3L3OC 1K28D 1VDZA 5K5PA 4XORA 2EYHA 4YJ3A 5IYZB 3TZDA 1SNMA 5CA1A 2E2DC 1SA0B 1OHHA 1Y1WB 2MHVA 2JJ2A 3SK8A 2CW0C 3TP7A 5LP6A 3DXJC 4EQOA 4LH7A 4ASUA 1SKVA 3HAGA 1JC7A 1G8ZD 4CJ1B 2BTOA 4FLZA 2A69C 1Q5OA 3MAQA 5ELFA 5C3EB 3C1EA 3RD4A 1ZYRD 3BC9A 2JEAI 4KL1A 4FM1A 4JI0B 3BDLA 3DEPA 2D62A 1DGSA 4E6IA 4IHJA 2VXWA 1E1QA 1AW7A 3A3GA 1EY4A 4PMBA 2BTQB 2EYLA 3VYSA 1EZ8A 3KBXA 3C1FA 1YEWA 1PTOD 2WPDA 2PNRC 4GKJB 4O1NA 1W0JA 1I3QB 4DR7B 1ESRA 1ML0D 1I8DA 1XHXA 1Q43A 1HTLD 2NN6H 2ZCEA 4I55A 2K1BA 3D6CA 1T5XD 3NQTA 2PPBC 4B9XA 3FPPA 1OXSC 3BCFA 3I73A 2R93B 3M85A 3HOXB 1BQQT 2SOBA 1VLYA 1EQVA 1QWYA 1H8HA 3N6RA 5BN5A 1E79A 2QKIC 3I70A 2O4XA 1DOLA 1GUTA 1E2WA 4V0BA 4XQJA 1EL0A 4N9TA 4HSVA 5C8YB 3OFNA 4FVMA 4XD7A 2DY7A 3S1MB 4ZIBA 5TSSA 4S3SA 3DWQA 2HCIA 2KUMA 2HDMA 1A15A 4G4KA 3ONAB 4X1IA 4EFEA 4KKSA 4TQDA 2BDOA 4IUUA 5CORA 5JEAH 2ZNJA 3RYHA 3UI2A 2EX3A 1WTXA 1TY0A 3TDQA 2NBFA 1TS5A 1I6HB 1U4RA 4UCSA 4UCTA 2PCFB 1GHJA 2EXZA 5CV6A 4XOPA 1FX0A 4DK0A 2ENBA 4K5WA 3K5OA 5JCOC 4RKLA 3FVQA 1EY6A 3PIP3 4K5VA 1EY5A 4ZRZA 1V0FA 1HW7A 4XLCA 4A3KB 4X65B