2V4DA

Re-refinement of mexa adaptor protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
NTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIDRUG RESISTANCE PROTEIN MEXA
publication title The Assembled Structure of a Complete Tripartite Bacterial Multidrug Efflux Pump.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2v4dA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v4dA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2v4dA02
2E74C 2K32A 3BDOA 2QF7A 4H44C 1Q90A 1IW7C 1ZKOA 3T53B 1H9SB 1Q1BA 1IW7D 3H94A 1G291 1V8QA 2JEAI 1GUOA 4KKUA 1Q1EA 2EVBA 3I4LA 4GYCB 2EJFC 3W3AA 1Y69U 2F95B 3IKJA 4RCNA 2EDGA 1E2VA 1Y8OB 1VCIA 1CI3M 1LACA 3EQLC 5JJJB 1Z7TA 2BA1A 1QJOA 2Q8IB 3SE0A 4DNTB 1HTPA 1H2SB 3L7ZC 5BN4A 5BN5A 2A69C 5D5QA 4LJZC 2L5TA 4XIGS 2K33A 4OO1G 4H13C 1LABA 4JK1C 4IFDG 4KN7C 2PPBC 1VF5C 4KI0A 1IYVA 3WB1A 2PNRC 1V43A 1GUSA 1Z6HA 1H9SA 1GJXA 2E76C 5K36H 5JJNB 2EJGC 3FMCA 3A8JE 3GQBA 4DNRB 3MXUA 5C0XH 2NN6H 3GD7A 2BE5C 4OGQC 3DXJC 3CRLC 3AB9A 3D31A 3TZUA 1O78A 2KCCA 3LWUA 4G7ZC 3M7NA 3VR6A 3NE5B 3VR2A 2A68C 1ONLA 3U9SA 1DD2A 2D5DA 3A8KE 3CRKC 2IT1A 2A68D 3T56B 1OXXK 1K8OA 4KKSA 4BA1I 1T5EA 2LMCB 1GUNA 1A6XA 5KNBA 2EJMA 3I72A 3HGBA 4KN4C 1Q12A 4DK1A 5JJEB 4XTCS 2CW0C 1DCZA 1HQMC 2V4DA 1OXSC 5KNCA 5KNDA 4KMUC 2F93B 1GUTA 2A69D 5K36G 3OPOA 2AUKA 3FPPA 2B8GA 1TKWB 4KHZA 3N6RA 1SMYC 2O5IC 3I73A 3D4RA 5C0XG 3VR4A 2D62A 2NN6G 3M85A 3QJYA 1RSOA 3BG3A 2ZT9C 5JEAG 1H9RA 1BDOA 2O5JC 2F1MA 1YNNC 1H9JA 3OOCA 1IYUA 1OXTA 1HPCA 2JXMB 4JBWA 4GZYC 1TU2B 1GUGA 3T51B 1I6VC 1GHJA 2B8FA 4BA2I 2A6HC 5JEAH 2D2CC 1E2ZA 2BE5D 1FYCA 1Y8NB 3VA7A 2A6HD 2A6EC 3KLRA 4L8JA 2YYZA 3WB0A 4G7HC 1OXVA 3PV0A 1B9MA 1EWHA 2E75C 2DNCA 1O7LA 1GHKA 3SDZA 1OXUA 4G7OC 3PUYA 4HR7B 2AWOA 3A7LA 1PMRA 3VR3A 1H9MA 1VF7A 3WB2A 3OW7A 2R6GA 4H0LC 1HCZA 5D5PA 1DXMA 3M4YA 3P20A 2NN6I 4DK0A 4PV1C 3PUZA 3RLFA 1K8MA 3WDNA 4TQUS 3PUVA 4IQZA 2BA0A 1Y8PB 2KA7A 3ND9A 1YNJC 2DN8A 3QIAA 3LNNA 5A35A 4TKOB 2JE6I 3BRCA 1CTMA 1VDZA 1CFMA 3ND8A 4I7ZC 3MFYA 4LK1C 2JEBI 2K7VA 1ZYRC 2AUJD 1B9NA 2A6ED 3VR5A 3A8IE 3QG1A 1FR3A 3IFTA 3PUWA 2BDOA 2PCFB 1H9KA 3PUXA 4OO1H 2DNEA 3A7AB 5BN3A 4KKTA 4IFDH 1E2WA
chains in the Genus database with same CATH superfamily
1WPXA 1FD7D 1N0NA 4HBNA 4ABNA 2J0TD 1D2DA 1R3JC 3E83A 5B3SB 1VQPV 2CK3A 3W7SA 3D26A 5DEHA 3R65A 5K5PA 3PO2G 1PJ7A 1IVSA 1BOSA 2GSMB 2JA8G 4XT3B 4OX9Q 3ASSA 4KY6A 4JTCB 1F2ZA 3OFNG 1KB9F 2K1BA 2P4VA 4DUZQ 1EWYA 4A3IB 1H38A 1OXXK 4DR5L 3LQEA 2RDFA 2EYPA 3EFFK 3FRPB 3CC4A 1HRJA 3PUNA 4RMFA 1VQMA 1F77A 3DSQA 3KDFB 1YNNC 3CS5A 2VNUD 4B9XA 1OV9A 1QCBD 2W0FC 1C8CA 4CS2A 5LL6Y 1OXUA 4JBKA 1PL0A 2R93G 3HOXH 3ZHUA 5JBQA 1CKNA 1WB8A 5FO8B 1M8AA 4TKOB 1XILA 4X65L 1PZJD 3VR5A 3A8IE 3X2QB 2AW9A 4K6LA 1SZXA 4W4KA 3F2BA 4NVPA 3GTJH 4CH5A 5LP6B 2KOLA 3BVGA 4X66Q 1EFID 2MJ8A 3TP5A 1LACA 1VHOA 4DR3Q 1UNSA 4K5VA 1H2SB 4P26A 3CCMA 4OO1G 4GOPA 4KN7C 1E3XA 3ONYA 5HXBA 4DV5B 3BQJA 5CBAE 2NYZD 1YTFB 5GAGC 4PELA 3K03A 3IC9A 1D1NA 1UWVA 3FP9A 4AILC 2FX3A 5F2DA 1I5FA 4DR1O 1FVIA 3APQA 3FPPA 1C7YA 4AI8A 3Q8DA 4FLZA 5JH7B 4X7CA 1GHJA 1NTKH 4C3IB 3ZUGA 5H9CA 4CBCA 1KBHA 1YJNV 1JPXA 3H09A 3MEFA 4NXMQ 2NR5A 1QU7A 4ZBMA 2DY7A 3DEPA 2RSNA 3S17H 4JI8L 1SYBA 5C3EH 1SKYB 4OO1I 1T6XA 1A3TA 4FM1A 3QFRA 4CC5A 3TJTA 1HZEA 4DYLA 4DFAA 2X6XA 2X7RB 4JI5Q 3ZHTA 1GMGA 3RN5A 1WTQA 4I55A 4ICGA 2P5ZX 1MI2A 1W6JA 2FMLA 1R9TH 1Z5WA 2VY3A 4A3FH 1XMOO 2D74A 5IYDO 3CC4V 1ZYRD 3NEMA 1QBZA 1VQMV 4XDXA 1AI6A 3B4SA 3BDLA 3GTKH 1SKVA 4TN1A 1MSGA 2WLIA 3GTOB 2HCIA 2X53S 3CXCB 3UE0A 1JA1A 4XN3A 3ZMZA 4RDKA 3STBD 2KQXA 4DV3O 2AGAA 3CHXA 1I50H 5KUKA 1CQXA 1XPUA 3P27A 4P9OA 4ZCLA 3BG3A 1R5NA 3OIQA 2H4OA 2EYOA 3AG4C 5EPLA 1BGYH 2BV3A 2C5HA 3FHWA 1N33Q 2RA4A 4R9WA 1JR9A 4F7DA 1S72B 2UUAL 4O2DA 3FFQA 3OEHG 4A5UB 3I4MH 1VQ5A 1AI5A 2EIFA 4OONA 2OYQA 2VXWA 4TUYA 1JWUD 1N05A 1BCCH 4XM3A 3CCMV 2IJHA 1ILPA 3NP8A 1Q6HA 1KD1W 3SJPA 2GREA 4DK6C 3R6JA 4XN0A 2F0GA 4UV9A 3S1MH 5FPRA 4X0CA 3CPWU 2YI9A 1PA6A 3CRMA 4IPCA 4KKUA 3J7A5 4B48A 4B3TO 4MYTA 2P5OA 4GKKQ 4HMJA 1HTPA 2LW1A 3R2TA 3OMIB 2CW5A 3SR1A 1QNUA 1NDHA 4ZOLB 3KLSX 2F0JA 1KAWA 4OGQB 1TTTA 3I55A 1XMQB 4MTFA 1G7RA 3U9SA 3SPGA 1Z2GA 3RUZA 4MS2A 4DK1A 1K9MW 2XUMA 4OIJA 4TV9B 3GTGH 4PA9A 2VYQA 2F0EA 4NCNA 4JCVE 2QM8A 5EYPB 1E2ZA 1FYCA 2NVTB 4A3IG 1DDIA 4L8JA 1SESA 1KQSA 4ASUG 4X88A 2RKSA 3D0FA 4H0LC 3KFUA 5D5PA 1S0UA 4A3BB 2WSSA 2JJ2A 4HJ7A 4A3LG 3E5SA 1B7YB 3ABUA 4GN5A 2EIKC 2XGTA 4O4IA 1Q46A 4JYAL 4IFDH 2K32A 1FXHA 4DNIA 4ZGQB 2L11A 1GUOA 1US6A 2ODMA 1K5SA 1F2LA 1X65A 1G6PA 1XNRQ 4UZUA 2EYMA 3JATB 4JK1C 1B4OA 2VWJA 1LUVA 3P3NA 2Z6BD 2F0LA 3VYSA 4OWWB 3ITPA 1A3UA 2NUCA 1SQPH 3KOJA 3SLNA 1DTOA 3TMEA 3H1LH 4Q0FA 4OPVA 2A68D 1PV0A 1KD1D 1TLLA 3HOZG 3GTMB 2HVJC 2BGIA 5CN0A 4WRDA 2AMCB 2OTLB 4X20A 1GUWA 4GZRB 1LTID 1VQ5V 2PQAB 3ZPNA 5LXTA 3CQZB 2B5UA 3ETGA 4BA2I 2NVXH 1YIJA 2KBNA 5KX5B 3UDXA 2WV6D 4A3JB 3BZCA 3AK1A 3JASA 1AI4A 3OE7G 2JA5H 2CHBD 4LFBQ 2XSCA 1Q90D 1NR2A 4IURA 3S1NB 1KDAA 2KEEA 3GDEA 4DV6B 2Z3YA 3MTSA 3WYAA 3UKMA 1BQEA 4BPRA 3I55V 2Z0AA 1FNMA 4DO2A 2VUMH 1KC8W 2NZHA 4QGPA 3N2KB 3RZDB 4OOSA 1JJ2B 1STBA 4X3SA 2WIIB 1D5MC 1F20A 3CRQA 4P2ZA 1YNXA 3W7WA 4WBNA 2CC2A 4RG1A 3AFQA 5K1XA 4LF8O 1D2EA 2FMCA 2NN6G 4RD1A 5J2TB 4JTDB 3HB3B 2XWBB 2XOKG 3CC7V 2ZJQA 1FJGL 1JB7A 4DV7Q 2BE3A 4DUYB 4B3RQ 4DV0O 3A74A 1O9GA 3I70A 4WJWA 2QE7A 4M0LA 3S24A 2CTQA 1IKLA 4ULLA 3T1YQ 2PI4A 4B4DA 5GQOA 2E2HB 4HIMA 2F0IA 4LP8A 5HGQA 5IJ9B 4EFBA 1V55B 4BAYA 1N32B 2F3VA 5E79Z 1FRQA 3L7ZC 3KL9A 1HQRD 1WP7A 1BQQT 2ZCEA 4QE7A 4IYIA 2Q5ZA 4X62O 5EZYA 4PMCA 1FFXA 5IE8A 2OF1A 1Q5OA 1PJ6A 4XNFA 5B6IA 3DXJC 1PH2A 1YIJV 2UXDO 5CV8A 5LMZA 1Y4MA 3TETA 4LF9B 3JAMc 3ETEA 4JI6B 4JI3Q 4ABMA 4KXRA 1SQFA 3T1CA 3STZC 5BR8O 1YI2A 1EY5A 3CC2B 1GN2A 1VQ8B 5JPNC 1KC8D 4KHPO 4LF7O 3E89A 4J9ZB 5E6TA 3QE2A 5KSWB 4C3HH 4FF1A 1K8AW 3Q23A 4DR2B 3FAVB 1VQ6B 3EXAA 4NXNO 1SMYD 3CEIA 3DC6A 4JOIC 1KK1A 2QM4A 1QUQA 4RD2A 5A8AA 1EQVA 1O7YA 4OOVA 4MTXA 4K14A 1STGA 1B9NA 4JAVA 2ZR3A 4N23A 2VL6A 1I94L 1BCPD 1D1IA 1WA8B 4JV5B 4I7AA 1CP9A 4DK3C 4DV2B 1N34B 3EFXD 4HJ9A 3CWBH 4NW2A 3CCRA 5JQGA 3ASNB 5GV7A 4KY5A 1SA0A 5CV9A 3PUMA 4Q7JB 3I56B 1GM7A 5FLMH 1PH6A 1CHQD 4ZHQB 5DSZA 1PFMA 5TISZ 1I3QB 5ELEA 1R3KC 5LMNW 3MZ5A 1BXTA 2TSSA 2KG7B 3LX0A 1EIYB 2ES2A 3TCUA 5KNCA 3HFZB 3M3YB 2FB5A 4NPSA 1EFRG 2LKVA 1GK9A 3QJYA 4J1MA 4RWSC 1G4YB 1OCOB 1EN6A 1VMCA 3SPIA 1OTCA 2M7WA 3U4ZA 1SROA 3AVXA 2IY5B 4JI4O 1GN3A 3B40A 3ES9A 2Y69B 3ULLA 4LC0A 1L0YB 2ZL6A 2HFEC 4GN4B 1RM1B 2QA4B 5JJIA 4BBRG 4A93H 2QWNB 2ZL7A 4A3JG 4GKJO 3PUWA 4PZ8A 2DIEA 4N9TA 4CQJA 1K3BC 4YHHL 4C3JH 4GLAC 2YXLA 4RAUC 1LR1A 1STEA 4AYBE 3VQYA 3W2FA 2A19A 3JAMN 2ZBUA 3CKIB 3MFGA 1CUKA 3IGAC 4QE9A 3EQLC 5M3FH 4A3CG 1K8AD 1T5XD 1AJPA 1BHBA 1S5DD 2E2IB 2UUBB 1YI2V 4CDFC 3P1HA 2UUCQ 3AB9A 4LF5Q 3F5TA 5LHIA 2PMDA 1V1PA 2QEXA 5CV4A 2IL8A 2YWHA 3H3VC 2X85A 1O7IA 1RSOA 3ZMUA 5IP7G 1XJVA 1HDJA 3ZC3A 2B2UC 3N27A 3MCAA 3T51B 4PAAA 1HFGA 1QVGB 4LF6Q 4QV2A 4GN3B 3A3BA 3QFSA 1DOMA 2Y48A 4OX9O 1XNQQ 3EROA 2E2JH 4DUZO 2X6CA 1S76D 1LTSD 2QSAA 2WAQB 3CCRV 1XE1A 1EZ6A 2Y0SB 4G57A 4OPAA 2Q7EA 3G6EA 2LJ2A 4PDLA 1T9HA 4O2BA 4ZI7A 4CKBA 3A3GA 5JPMC 1E2WA 2JA6H 2EYJA 1ZKOA 2DYIA 3T53B 2ZM6Q 2UXCQ 3J7YW 2HKOA 3GSIA 1UD3A 4P22A 1XXGA 1PYWD 4GX5A 1FPOA 2CWPA 3SYQA 2XN9C 1M1KW 5EIBC 5EBMC 1Q81D 1XMQL 5GV8A 1CT1D 3U11A 4U3JB 2LS01 4DXGA 1F9RA 4MW3A 3BU2A 4J10A 5C4HA 4UCOA 1FXKB 3BYTB 1P4RA 3FKSG 3BCCH 4DR3O 1SBBB 1K4DC 2BE5D 2OQ0A 1WCMG 3QG5A 3NXSA 1VQKA 2GN5A 2UXBB 2GBOA 1I6HH 1GO3F 5EBWC 3S14B 1K83B 1AR1B 4P9SA 3OW7A 1WTOA 2HCCA 1TS4A 2A5HA 4PV1C 2N49A 3CCSB 1VMPA 3ND8A 2WKDA 3BCDA 1MOFA 1TY2A 1WD1A 4KHVA 4FZ1A 2Q6AA 2R9RB 3OW2B 1U4LA 2GUZB 1U4PA 1UMKA 1L1OB 2BOSA 2VZLA 1UAPA 2HT1A 2C5CA 4NXMO 2QEXV 1BZKA 4Z1VA 1OCZC 1MJCA 4AYBG 2ZQMA 1Q8IA 4RGNA 4HTHA 1D8TA 1Q3LA 3CRLC 1R6KA 4G7ZC 4JI5O 2HDLA 2QWPB 3VA5A 2JSOA 1DGSA 4MTKA 1PTOF 4Z4RA 2HHHB 2R7DA 5JJZA 1YHBA 3MXNA 1TWHH 4YALA 2E1BA 1QUFA 1DARA 3TP7A 5JEAH 4JI2B 2ZDIC 1PKVA 1WTHD 3AGQA 3G6EV 1U96A 2P7TC 1JFFB 3SYOA 1LT5D 4IJLA 4BBSH 3I7FA 4O4HB 2F4VB 1J9ZA 1XTCD 1ZL8A 4J7ZA 2ZE8A 3S1RH 2XAQA 2B2WC 4NKGB 2BOCC 1XREA 3D4DA 3E9IA 1HNZB 3MDSA 4DV6L 4JASA 4DR4B 1ZM3A 5AFWA 2WFWA 1N36B 3I2ZA 3VQXA 1B3AA 3UT5A 5ELNA 5EGTA 1ZM4A 3OAAG 3C3LA 1N33O 5TR9A 1YZBA 5H59A 4E6IA 2F4IA 4K6DA 4GLVB 2C78A 1VQIA 1VQ4B 1MSHA 4EB6A 3MHSC 2EY1A 2Z8LA 1VQKV 2CVRA 2CUGA 2RHQB 4PABA 1DOLA 5IGGA 4KFMA 2XAGA 4HZ3A 4JI0B 3SPHA 4F8MA 4HCSA 4GKKO 2A06H 2BCCH 4EGVA 2ZIMA 5M9OA 3SDZA 1Q82W 2B9ZA 3WB2A 1SE2A 4FWTA 1UUPA 2JE6I 1QFZA 3RYHB 1RF2D 1V54B 3VBBA 1CM9A 5IT9L 3WNDA 3GO5A 3S15H 2YEVA 4KKTA 4M4SA 4I0XB 4JOIA 1Q1EA 2Y69C 4R1JA 2AZ0A 2LGWA 3CCLA 3M7GA 1RM1C 3CMAB 3SK8A 4IL6Z 4QUZA 1N32L 5BN4A 1S72A 1I8DA 1GRJA 5IGBA 2JDIA 3GVJA 2EJGC 5ELCA 2GTSA 3D6WA 3NQTA 1WOPA 4UCVA 1ONLA 4LC1A 4PA7A 4DR6L 3OTOB 1JOQA 4LF9L 1N4CA 1PTOC 2MQHA 5M5WH 1J5EB 1IBKQ 2HJDA 3G48A 3GTPH 4R4QA 1EYDA 4PD4F 2Q6LA 1XNRO 3ZZTA 2D2CC 4LF4B 2WPDG 3NBIA 4PI0A 1K0SA 3W2DA 1KU9A 5IGDA 4NDXA 1H2KA 5IYWA 2IPKD 5KYLA 4C2MH 3BY2A 4ZOLA 4DR2L 2Q69A 3B2EE 2EY6A 2HUGA 2NVYB 4RD3A 4I50B 1BKBA 3CCEB 4K2LA 3NBHB 3SK4A 4F6RA 4TV9A 1YVWA 1A62A 2CBXA 2HR3A 3LUTB 1N34L 5EYPA 2CH7B 2K5VA 1EY8A 1Y66A 5FNZA 4EH1A 1GM8A 2PPBC 5CV5A 3DMUA 4LFBO 3CW2C 4TQFA 2BTQB 4XORA 1Q7YC 3CU7A 1M5IA 1P7GA 2QILA 4KKSA 4BA1I 2LFSA 3BCFA 2DWDC 4APVA 4R8IA 3KUPA 2F0OA 3A0RA 1S5BD 1IYUA 1YJ9B 3RVYA 3JATA 2XTAA 5DN6G 2BH8A 2IJIA 1HNWQ 2LXKA 4RD4A 2B2UA 4P1VA 1I5YA 1FXKC 4A3EH 1F4NA 3CCLV 4RH6A 5EQ0A 1CTMA 2XT9A 2QGQA 1S72V 5GROA 4QIWF 3A5UA 1HR0Q 5IDJA 1BF4A 2PQAA 4H44C 1GAWA 4OELB 2NZOA 3UO3A 2CQAA 2YIBA 5FIUA 3E8BA 3JD2A 4DV7O 4OL7A 3OEEA 4B3RO 5KX5A 2R92G 1GTOA 2HG5C 2ZJRA 2EINB 2BSKA 4TMXA 1V43A 3K5MA 3C90A 1XMOB 1SLJA 4PG3A 1STHA 3RNUA 3TP6A 1HZCA 3ZRWB 4RHSA 4POFA 3T1YO 4NB5A 4ZCMA 5M5YB 2CCZA 3K5LA 2B8GA 1OO9B 2NTTA 1QUEA 2ZE5A 1ENVA 1CQFA 4DV3B 2IJ0A 1LTGD 2E5LB 1WOCA 3BEHA 4JYYA 2F0TA 1K28A 2FKXA 4HMIA 2E75B 3LSUA 2HCJB 1VQGA 1JA8A 2Q2HA 3KEWA 3B8HA 5B66Z 1IL2A 1NR7A 3S16H 3B6YA 2XNJA 1N0UA 3GTLB 4LWSB 2WLJA 4JI3O 3QSYA 5L3EA 5C44G 1MKHA 2EULA 3CYOA 4MNOA 1Q86W 1QGYA 3QOLA 5J2TA 4QVAA 2KHJA 2Z4HA 3UDIA 3I4NB 1QB5D 2G9HD 3HOWB 2GTAA 4FMTA 1FNVA 1TT2A 5JEAJ 4P2NA 2C9OA 1K4CC 3VDYA 5IWAB 1Y1WH 1Y0RA 4IYHA 4C1NK 3OJWA 4J41A 2ZXIA 1WTRA 2Q2IA 3CCUB 4A3MH 4H37A 3ER0A 1B53A 1COWG 2V1DA 1JX9A 4YAWA 4Z4VA 3MA2B 3JALA 3S9WA 3VOUA 4HSPA 3ML0A 3J81L 1AB3A 1OXVA 2X8KA 3LVBA 3T1HQ 4FXGC 2ZDIA 2MO1A 3MHHC 1Q6UA 2EBOA 1XB2A 1VF6C 2BMWA 1ZXTA 4DAYB 1GAXA 5KIXA 3HKZB 3F8TA 2F4NA 4RO2A 1NTZH 4A3DG 2JA7H 2N3SA 3CC2A 2WJYA 5IODA 4BXXG 1VQ8A 1TUIA 3FPUB 5D65A 1XDCA 2B2WA 3AMUA 2KVOA 2XNDA 2PIAA 2BA1A 4AQYO 3Q39A 4H13C 3JSLA 4RLZA 4WZLA 4JI1Q 5LBQA 2OTJA 3WWVA 2JA8H 1O78A 2PF4E 4N3GA 2JIZA 3AG2B 3HOUG 1Y67A 2ZINA 4ZKBB 3QNEA 4KHZA 2HHHL 3OSOA 1H2NA 5TV2A 1GH6A 4K35A 2F23A 3KLSA 4I65A 1JR0D 4DA2A 2ZZEA 3U10A 2QWOB 4X05A 4RA8A 2R70A 2PLFA 1FL0A 4RFBA 2WR8A 2UUCO 1PFSA 1VHEA 4LF5O 2WLMA 4G4KA 1H8HG 3A55A 3KG2A 2F4VL 5IGEA 1XTDA 2KG7A 4PMBA 1THZA 3ISXA 1EBOA 4FLTA 2QR4A 4C0SA 2A7WA 4EVOA 4K3AA 4V0BA 2DYRB 1HNZL 2XRQD 3A2FA 3LNMB 5B1AB 4DR4L 2HMAA 4LF6O 4WF9V 1AJQA 1N36L 1SNOA 5FO7B 3E86A 2IX1A 2Z5UA 3PQIA 3QF7A 4TT3G 3ZRVA 3G67A 1XNQO 5FKAC 3WG7B 2VS1A 4KI0A 4JI7B 3G7LA 1PDQA 2R72A 4ILWA 4O4JA 3R66A 1GJRA 4FFBB 1NVPD 4IN3A 3JD4A 2KENA 3PGZA 2QDOA 5K36G 5LHHA 3CCJB 2ZM6O 3V76A 2UXCO 4BIUA 3D6CA 2Q2UA 5IYDG 3RR5A 3CCVA 1UEAB 3CESA 4JI0L 5B1BB 2X6YA 1VLOA 2Z0SA 2QM7A 4G7OC 2VNHA 2MP1A 1Q43A 3CPXA 1JOOA 4CH6A 3HKEB 2PYJA 4DV5Q 1HNXQ 4QJFA 5ISRA 3K58A 2GJKA 2OTJV 4YCUA 1OHHG 3AK2A 5FLXE 5CBEE 1QVGA 1SR3A 2O57A 4RCNA 4PNYA 3K08A 4LCUC 3WNBA 1AP0A 1E0BA 1XL4A 3IRBA 1GXDC 3P26A 4FVMA 1MG1A 1QFYA 5IYZA 1TWCH 3I4NG 2KCCA 5CMUA 2GK6A 2ZXWB 5KGUA 1MABA 3STBC 1NSNS 2BDNA 5HZBA 3CW2A 2FXQA 2J4XA 1EN5A 1PFBA 3I73A 3W5VA 5DS0A 1J5EL 4DPGA 1KQSU 4TOIA 1WPCA 2K52A 4U673 4LF4L 4C43A 1TWAB 1S5ED 4DAMA 4TQDA 1TS3A 2L35A 3HOXB 2AQ1B 1EM1A 4B47A 1EEFD 4LF7B 2VJIA 4K5WA 1Y74B 2Q0OC 2KA7A 3E9HA 3RYFB 3DDYA 1SYEA 4N8X1 1PD3A 4U3JA 5L3CA 2F52A 1KL9A 1D8LA 5HGTA 1FXKA 1SFOH 4Q20A 3DHQA 3STLC 2W6JA 2ZD9A 3WBJA 3I4LA 5CB4A 4A75A 2ZTCA 5C0XJ 1HA5A 2VB3X 2CDYA 2AXTZ 2QWQB 1GO3E 2QKSA 3H91A 5CA3A 2DE0X 3T4DA 1Y76B 3OR7C 1VJSA 3P3PA 3K7UC 3CCVV 3CE2A 4DKAC 3GD7A 2ATWA 4QL5A 3A54A 1S5HC 1QGZA 1YJWA 4ZK9B 4P2CB 1EP1B 4WORA 2SNSA 3OW2A 3URYA 3ICXA 1EYAA 1JJCB 2WB1E 1EZVH 4A3IH 4DR1L 2RJZA 4K8XA 1E79G 1M4VA 3M9BA 1YHQB 1VQNB 4IGGA 4G6IA 1Q6IA 2CF4A 2DEUA 1TGOA 1Y8PB 3HP3A 2WP8J 4X1YB 4B3SQ 2W6IA 5EKIA 1QNMA 4JI4B 1JE4A 4X07A 1XMQQ 4B3MQ 5IYPA 1IBLQ 1R9TB 4WFN3 3C3TA 1DDGA 2FMMA 4OP7A 2B29A 2QGGA 3H94A 4A3FB 2EJFC 3LDDA 1H8EA 2L4NA 4GUNA 4RGMA 5I9OA 1GR1A 2JN4A 4ZRZA 2ICEC 1EY9A 3BA9A 1H9SA 2E76C 4B43A 3GTKB 5JJNB 4P3YA 3A0HZ 1TQOA 1I4XA 1AP6A 1PH9A 1XMOL 2A68C 2D5DA 1KD1C 2CGNA 3M4PA 2CFMA 1VARA 2Q0AA 3LDCA 3BZKA 3WY9A 3SYCA 2XNAC 3R93A 2WLNA 3MEHA 3TS2A 1VQDA 5G3LD 4P30A 3J80i 4LUOA 2PZSA 1L1FA 3ZN1A 4DV3L 2EQSA 2L9HA 2Q7GA 4ZUJA 2HLDA 1WFQA 2YXHA 2LSSA 3F2UA 2MO0A 3ZHVA 3OMCA 3T13A 2DJGC 2KEDA 1FGBD 2A3QA 1KLUD 1VQAA 4C3IH 1H95A 3NR7A 4L6TB 1IBKO 4DUZB 4P25A 1CHPD 1VQLA 2HEPA 3UDFA 1KRTA 3ZN0A 4YIPA 3B82A 4DR5B 4O1NA 1VF6A 1YJWV 4MVMA 4X8AA 1K73W 3ZMVA 5IWAL 5A88A 3R3OA 2N88A 4A3KB 1AH9A 5LMUB 4B3TL 1M4UA 2IX0A 1NY4A 2DYSB 3WG7C 3GTGB 4I0XA 1LO5D 4IUTA 3CCQA 4G5GA 4XLAA 2EILC 2EZOA 1KK3A 3DLLA 3CMAA 1U5KA 2A6HD 3A1PA 1YITA 1TA8A 1EL0A 1N0JA 3K06A 2OCHA 4X66B 5IOCA 1R6TA 5AJ3L 1BMFG 2WB1G 1LV9A 2P22C 3KF8B 4ME5A 3J7AF 1YNND 3BDCA 4UXNA 1KLGD 1YNJD 4JBMA 3HR0A 3BZDB 1SYDA 2PW5A 1QLEC 4HAMA 1QX4A 2K03A 1EY6A 2CNDA 3HOXG 1URFA 1JWMD 4L87A 3PN1A 3VQWA 3MHPA 2OT2A 4FJCC 5H6QA 3P30A 2KUMA 3N2GB 1HNWO 4XQNA 1KP2A 2G38A 1CZWA 1EQRA 2FFKB 4I50A 4DUYQ 3CCEA 3C3SA 1HR0O 1XFOA 1YF2A 2LZJA 1UE6A 5JCOC 3HZXA 1NQTA 1WTVA 4G7WA 1LTBD 4OIKA 3FYEB 1E1RG 1SE4A 2ZT9B 2CH7A 1KC8C 4A3GB 1DONA 2A6EC 2ATKC 5KNLA 3PVDA 3PA2A 1VQLV 3A7LA 2JA5B 2BTQA 1ICFB 5EC1C 4PC3A 4MW8A 1GM5A 3ZBUA 2X6AA 1XQBA 1OGJA 3OYYA 1BCPC 1E1QG 2NVTH 2KKWA 5C3EG 2HIVA 1DF4A 3ASPA 3HKCB 2D0OA 2KSDA 1YJ9A 4KL1A 2LQTA 3H1HH 3L71H 1U0LA 2ZTNA 4JI6Q 1Y69U 1JB3A 4FXDA 2VUMB 2YV5A 4A3BH 5KHKA 1AE2A 1D6EC 4UV8A 1YLOA 5CORA 4N9PA 4X6AH 3VO1A 3CCQV 3AG1B 2ZL5A 2ZZGA 4A3FG 4Y7NB 3NQIA 4QIWE 2WKCA 1YITV 4ZGNB 2PW7A 4DR2Q 4DU9A 1MSWD 2K50A 2KQ3A 1HW7A 4FP5D 5HY6A 3ZHQA 1XBLA 3RT3C 3ZMSA 3H3VH 1EZJA 3OOCA 3RYCB 3OKXA 2XIWA 4JV5Q 3EVQA 2K01A 1XUQA 2F3WA 3FD9A 4DV2Q 3PO2B 1PPJH 1D5XC 1JT8A 3SJZA 3G6BA 2DNCA 4CZZA 5CA0B 1PRTF 4R8CA 4BY7B 1LTRD 4YCVA 5A89A 1TVKA 1DK1A 2H3OA 3ZRWA 2C2AA 3CQZH 1R73A 4YJ3B 1E1TA 4DV0L 1WTWA 1TUBA 3PJSK 1W0KG 4PQXA 3CCEV 1WTPA 4IPHA 4OPHA 1K8AC 4V190 4Q6GA 4A3CH 3T1HO 2PI5A 3TZDA 3LQ6A 2R93B 4Z1MA 5KMGB 3JAWA 4LWSA 2EXZA 4DW0A 3L9DA 2ZE6A 2CE4A 2Q4PA 2CW0C 5FNVB 3K04A 3RZDH 4XLEA 1RD9D 2IH3C 4UAIA 3AG3C 4GNXB 2YIDA 2UXDL 4H02A 1EXMA 4C3HB 1FJGO 2CRVA 3DC5A 4JI1O 4DV1B 1TWGB 4UP8A 2RMKB 4QF4A 2EIJB 2PO4A 3MHBA 5BR8L 3E22B 1YJ9V 1F4MA 1QR8A 3NWSA 2RSOA 1W35A 4KHPL 1TWFB 4LF7L 1HVXA 4DGZA 4XLFA 2UUBQ 1SRYA 4RD6A 1SQBH 4NXNL 2OCCC 1DZ1A 3ASOC 4KLKA 4ALPA 4DR7Q 4LWCA 3HKDA 3RY8A 1V9PA 5CYUA 4BWGB 5LL6X 1C9OA 2MGSA 3K0DA 3RYIA 1U4MA 2Q8IB 3Q22A 2R9IA 4IFDG 4MTGA 5IY5B 1KYOF 2ZXHA 4JC0A 1S5FD 3VR6A 1AEXA 5L3FA 2XRSD 4FFKA 1MIUA 1VQ7B 3TSSA 1G6UA 2EJMA 4DAYA 2F43G 1O9HA 2DY8A 1HQMC 2V4DA 2F0QA 3DM1A 1QH0A 4GQNA 4J6HA 4PHZA 4IOCA 1H9RA 4CS3A 1N08A 4LBWA 1FYJA 1P84F 3D8GA 5LGNA 3PIO3 1PRTC 4IFDI 5IYNA 5FO9B 1F9PA 2JVDA 3BPZA 3CMEA 2DJVA 1GN6A 4GLXA 4A93B 4PZ7A 2Q8VA 1B70B 3M8AA 1J8IA 2ZKOA 4JI4L 2X0KA 2JA5G 1SQXH 2OBTA 1K97A 1Q90A 1Y6XA 2JEAI 4CKCA 3JAKB 5E7NA 1EZ8A 5M3FB 1EYGA 2K4KA 1NMFA 2OEOA 4N21A 4Z4UA 1UJWB 1VQPB 4XKWA 1IYVA 5KEEA 5A2QE 4GKJQ 1D7QA 2A9HA 2NN4A 4DV7B 5CDFA 4DV5O 1HNXO 2VUMG 2UXBQ 2PGGA 2QWRB 1GUNA 1VQHA 1ICWA 2O5IC 1SSOA 1W59A 1F2MA 1A2TA 1L0LH 3T1YB 4EQ5A 1D2BA 1VQ9V 1M56C 1I4HA 3GWKC 1AP5A 3U2QA 4X64Q 4I4TB 4II3A 2NBFA 1M1KC 1OZ0A 5CV7A 3M3YH 2JGDA 4YCWA 3S2HB 1HJPA 2DN8A 1VDZA 2WLHA 2AQ3B 5M3MH 4I7ZB 3FDTA 4YXWA 1B3QA 1MMMA 4WFHA 4OX9L 4BY1H 2JJ1G 4BY7G 1FS0G 4DUZL 3KCXA 3QWNA 1W3SA 4MHEA 3JAML 4HNAA 2KCMA 3Q38A 1Y8OB 1LTAD 5DECA 1ESFA 1QZGA 4X3UA 1EP2B 2VQEB 1VF5C 1JQ0A 4JI2Q 4JYBA 5JVDB 4P73A 2BM1A 3JYCA 4LR3A 5LMUL 5EMNA 2F4VQ 3WOFA 3AFPA 2V7QA 4YAFA 1PTOH 2D9RA 3CMEV 2E2IH 1GM9A 1RTOA 3OR6C 5JCOA 4H7BA 1W0JG 1I94B 2ZTDA 1WI5A 5GONA 3HKZE 1EFUA 3ERQA 1BR9A 1QGAA 1I6HB 4J7KA 1YJNB 1N36Q 4J7JA 4X66L 2DQ3A 1I7FA 5KA5A 3LNNA 4CS4A 1JORA 3J80c 4C3HG 3HOZB 1S0VA 4K2KA 4YY3B 1IYJB 1EFTA 1GAQA 1FNCA 2IX3A 3BVMA 1W9XA 2E1RA 3U6BA 3ZJYC 3AU7A 4XKVA 4JI0Q 3CAMA 3L3OC 3SPCA 2OQKA 1Y74A 4B3SO 4X1IA 4NTWA 1SNCA 3T16A 4BW5A 5FLMG 1QVFU 1XMQO 5CA1A 4B3MO 1IBLO 3GV6A 1GUTA 1NBMG 4E4EA 2IHFA 5IT9c 2IM9A 4MVOA 2ID0A 4RKBA 5DM63 4TSFA 1RDPD 1EQQA 1CKNB 3PENA 1WDTA 4IIJB 5H6RA 4YHHB 2P4KA 4MVRA 1B50A 4F6EA 3V05A 4RUFA 4GNXC 3V7AA 1S3JA 1XHXA 4J80A 4CDEC 3K0XA 4HSVA 1E3PA 2UUCB 3IJ4A 1SE3A 3WFVA 2VQFB 3CCMB 4GOPB 2EIJC 1SQQH 3ETQA 3OTOQ 1K83H 3DM3A 5FLXc 4WZTA 1NVPB 4A93G 4QVJA 1J5EQ 1Z7TA 4DNTB 1Q82C 2VNJA 2L5TA 3L73H 1G1XB 2B39A 3QO2A 4C3JG 3RGBA 4UVCA 3FPKA 1VQNA 4LF4Q 4PJ0Z 4X06A 1N33L 5BSYA 3PO3B 3K80C 3ABMB 5M3FG 1K33A 2CH4W 1SM4A 4K8JA 2ASBA 2SDFA 4MVZA 3GB7C 4UZEA 2B63B 3K9AA 2LGQA 3SDLA 3FX7A 2D62A 5J22A 5BSXA 3J80N 2QN6A 1I4GA 3PIOA 3ZIAA 4Q5VA 4ZIBA 2QTZA 4NKLA 5L46A 1BBWA 4F7XA 3KKYA 1FGUA 1NI8A 1L0XB 3SR2C 1YEWA 3JQPA 1PLFA 4GKKL 3ABKB 5THXA 3ND9A 3RMHA 2B2VC 2E3CA 5EK0A 5KUMA 3GTQB 1OJHA 5T1GA 1YEZA 2DNEA 4XBFA 4CKEA 3HOVH 4ZKCB 1UD4A 2B7CA 1MNGA 5I2XA 2WLIB 3AG7A 1QJOA 1SXTA 1X56A 1LABA 2JA6G 2B7BA 4LUVA 1IKMA 3FYIB 2GVBA 2XEXA 1NE3A 4M1UB 2DW4A 5A9GA 4O4LA 1RCVD 1S3OA 2PUSA 5KHJA 4ZYSA 1R3IC 3K57A 2Y0IA 1OXTA 5IYCH 1I0HA 4XYQA 3O9OA 3K7AB 1VQ5B 3KLRA 3ZRSA 2CTRA 5B1NA 1OCCC 2QJ1A 4R4TA 4C2MB 1VQOB 4DV1L 2G9DA 5FLXN 1K28D 1B2RA 4DUYO 1E62A 4IO9A 4POGA 3J7AV 4I5SA 1K8MA 3WDNA 1XNRL 3IC7A 4XT1B 3RN4A 2JYOA 1IURA 3S2DB 3PIP3 1SQGA 1VQNV 1JQYD 3PUXA 2R61A 1EOTA 4KUMA 1Q1BA 1W2BB 5B3SC 1RL2A 1PNLA 2CK3G 5D5QA 3VYRA 3KF6B 4UHVA 5KW9A 2FYUH 2E5LQ 3I4OA 4BR6A 1N8RW 3GQBA 1NCVA 3W2IA 4UCTA 2DY1A 3NTHA 4DAPA 4BBRB 3DXRA 3CB4A 3I72A 5HKKA 1JA0A 1JICA 4LFBL 4B08A 1R5BA 5FL7A 4JI6O 2Z1CA 1AN8A 1YDXA 1RP3B 1QWYA 4ZCIA 2Q8RE 4IJHA 4D7SA 1MSDA 3N2GA 2FHTA 3CC7B 1SNMA 1YXBA 4MVQA 2CQOA 1SKQA 2QKIC 1BL8A 4DR2O 1G2SA 3ERSX 3NELA 5IWAQ 3F7VC 3ABLB 2UU9B 1B8AA 1TS2A 3X2QC 4BBSG 5IK2A 1SRUA 1RQPA 5L3DA 3D3RA 4JV5O 1S5JA 5LP6C 4DV2O 2ZBVA 2GA4B 4IPDA 4B7EA 3U50C 2F0FA 4KY7A 3W2EA 4CDCC 1BNZA 4YWKA 3VQVA 5C5MA 4XXEA 3CF5A 4LH6A 1UE1A 4DNRB 4X20B 5FOBB 1QG7A 4DV7L 5IY0A 5LXTB 1Q86C 5C8YA 2ALYB 2JEXA 3T2MA 1YIJB 5JWPA 2O4XA 3OJXA 4KMUC 2AHOB 3OPOA 5C4JH 4DV4Q 1KK2A 1Z5VA 3ZYYX 2VJJA 4AHCA 2H5XA 1E7ZA 2XZOA 1IX9A 1ZX3A 3SGIA 3PCOB 4JAAA 2N04A 3PO3G 4WQMA 1LT4D 2NNUA 3T1YL 4Z4ZA 1UD6A 4Z2WA 3OM3B 2G5DA 4A4IA 2B63G 4S3SA 1EWCA 1N8RD 4AF6A 3S16B 2LFNA 2L12A 2NN6I 2WACA 4IQZA 4IALA 3ZCCA 5CMDA 3WXMA 3LO8A 3IFTA 1QVGU 3CP2A 4M53A 3D8CA 1PNMA 1KMIZ 4RD0A 4DR6B 2AKWB 4F87A 4JI3L 3JARB 1WCMB 1Y1WB 5CA0A 2K33A 4WBNB 5BMVB 3WBKA 2VQEL 1GVPA 5EKKA 3OFNA 4A3MB 2UUBO 1MA1A 1V0FA 4YJ3A 1O7ZA 2B3GA 1NJIW 2YWFA 3WOEA 2I5MX 2D0PA 3CD6B 4NP5A 1K7DA 4DR7O 1S77D 3RLNA 2IWHA 2F1MA 2B1IA 4JBWA 4OXSA 1L0WA 4WJ4A 4AYBB 4UDUC 3JC66 3H6MA 1F60A 1YX2A 3D3IA 1DXMA 3ZBHA 3H9NA 1RPRA 4BW9A 3ZZUA 1J9OA 1UE7A 2WLKA 3MXGA 4JI7Q 2RVLA 5FNVA 4YY3L 3CSXA 2PCFB 2FTKA 1KXLA 3QFTA 1V5VA 4LFAB 2ZE7A 1SERA 4GNXA 1IW7D 4WFFA 1ZUQA 1EY7A 5H1SE 2EOTA 4RHRA 5DM6V 3GTLH 3C1EA 1YZ6A 4YWLA 1R4QB 4L5SA 2A69C 3OUFA 4OEMB 1BUVT 1AROP 4HJ8A 4OGQC 1YI2B 1A15A 2EFGA 1HNWB 3I4NH 3OW2U 3KK7A 3ABTA 3HOWH 4RM0A 2NVQB 4OHJA 4AQYQ 3BVZA 5G3LF 1RIPA 2CWAA 5HFLA 1HR0B 2J7ZA 1DG1G 4IT5A 1AI7A 1Q9SA 1Q81W 3LWEA 1Q7YD 5D3IB 1QUQB 4HJAA 5H5JA 4X1KA 3H0GH 2XTIA 3PIPA 2UXBO 4NNJA 4TMVA 2EYHA 3ONUA 1NJID 3BRCA 5M5XB 4LNQA 2WSSG 2NWGA 5IYBG 2JJ2G 1A2UA 1KUQA 5JQGB 1SA0B 2UUCL 4LF5L 2VQFL 4O42A 4A3EG 4LFCQ 3OHXC 2R7ZB 1EU3A 2B2VA 3H1JH 3K9SA 1G7SA 1OGIA 4X64O 2KVMA 3G4SA 3C1FA 2UXXA 4CH3A 3ZBTA 1PZID 3HPLC 4QPJA 1SYFA 3C2PA 3R6KA 4IHJB 3T56B 1TY0A 4UFZA 1XNQL 4IUVA 4KN4C 1D5AA 1PL4A 3S1QH 2WA4A 3A35A 3QB3A 3JAKA 3CRCA 2B5OA 3AK3A 4JF3A 3AG4B 3RWRD 3K6OA 4EX5A 4UZFA 1D5NA 1NNXA 2M6YA 4JI2O 5T1IA 4J0QA 2YTYA 3SLDA 3OEHA 4LNUA 2UXCL 3FKIB 5GW7A 5BXZA 2I07B 2BTOA 1JCHA 3SKBA 2K04A 3BFRA 3BY1A 5A35A 2F4VO 4Z4SA 1QILA 3OMAB 2L15A 4MVUA 1EU4A 2EY2A 2X3UA 2F0VA 2BCOA 1WTXA 1RHPA 4GYCB 4K0KQ 1ZEQX 3Q24A 1N36O 3JD0A 2X6BA 2V7UA 2QEXB 1V1PB 3KBXA 2YTXA 1MZEA 4AF7A 5EBLC 2QKCA 1TWCB 3GV3A 4P74A 4Z9CB 1RSOB 2A74C 2BGJA 3D36A 1IBMB 5IYCO 1AR4A 2YI8A 4UAJA 1UD8A 1N06A 1Y1WG 1HXYD 1TAEA 1FD9A 1AZQA 1WPBA 1AMOA 4RDLA 4WJ3M 3SJCC 4A3MG 1B04A 2V7XA 3TXSA 4PC7A 4JI0O 4ASUA 3PV0A 5JVG3 1A32A 2HD3A 1KDBA 2F0DA 3G6EB 3KDFA 4H0LB 5JVDA 1B44D 1LNQA 3U9OA 2QE7G 4TSSA 3G4SV 2P67A 4JGSA 2XZPA 1KNEA 4PDRA 3W2HA 1XI1A 1SFOB 2BSAA 4EKWA 2GQFA 5JVH3 3NTIA 2L0CA 1RODA 1X3PA 1V55C 4QMGA 5IGFA 1CZGA 5LMNQ 2RN9A 1YJNA 2K28A 5BN5A 4DW1A 1BX0A 1SETA 1PV4A 2PMZE 3UE1A 5LP6A 1VLYA 2MUYA 1NKDA 4KJNA 1I4PA 4LH7A 1BJKA 1LT3D 1SF9A 1EUJA 4FLWA 3FJOA 4J8QA 5C3XA 5IYRA 5KNDA 4IZ8A 3MWYW 3OTOO 1VQKB 5BZBA 4XOTA 2F0NA 4YELA 2JXMB 5B5EZ 4RPBA 1J5EO 2A6HC 5J9PC 3E1YE 2CTPA 5HZAA 2R92B 3A8TA 4Y7CA 2FVGA 4LF4O 3W7TA 3OE7A 3A0BZ 4DR5Q 1AW7A 4OPSA 5JH7A 1M93A 5CBFA 2X0LA 1HP8A 1EIFA 1YNJC 1M90W 1KTVA 5DM73 2N05A 1BSMA 4O2AB 2UU9L 3HS0C 5LMUQ 1TWAH 1NR1A 3OZVA 3ZEDA 4B7KA 4IIJA 3ASNC 2AZ2A 3D4WA 5JJLA 3J81k 4X65Q 3N52A 1SJED 1LTTD 4ZUIA 4L5QA 2R7ZG 3MXNB 2PYKA 2Y0PA 1K8OA 5C44B 3OGIB 2I5LX 3RFRA 1ET9A 1HNXB 2Z6KC 2Q6OA 2XOKA 2RF4A 1JMCA 1MJEA 3CXCA 3B8NA 3WQZA 1ZL8B 5C4XH 1K73C 1OCOC 1EQTA 1U9RA 1J95A 2KHIA 1WU8A 3PUYA 3SEJA 1RJTA 3IL8A 5IYQA 1T6ZA 2GJPA 3DWAA 1EP3B 3CTAA 3UT5B 4XLHA 5FO1A 4CC6A 3BS1A 1HFNA 5A2QN 2B2YC 2L6LA 3FKIG 1WSVA 1C4QA 3NPPA 4DQKA 4JI8Q 4ZV4A 3NXWA 2F95B 4IW3B 1HWYA 2GHYA 2CAZC 1IBKL 4EB6B 4B3XA 1X3QA 2LY7A 1UFIA 5EC2C 5E4WC 1PNKA 1M90D 2PZTA 3MVVA 4FDBA 5JOBA 1QR9A 5FJ8H 5EBDA 5LYJB 1FNUA 3BVOA 4A3DB 1H85A 2M2LA 3UM7A 4F88A 1KHIA 5C6AA 2BM0A 2B8FA 3SK6A 3KJPA 2I0QA 2AHYA 3CP1A 2K05A 3CX5F 2WLLB 2E5LO 1I4QA 2KCNA 3MD0A 3CMMA 1JOKA 2YEVB 4MTOA 3ASQA 2JK5C 4JZGA 4LK1C 3HOUB 2VNIA 2ZXPA 3CCLB 2DN9A 1GKHA 3DWPA 4B3GA 3CRAA 2A73B 4IUQA 2K5NA 2P3MA 1IB0A 3F2DA 4LFAL 2UUAQ 1FXVA 1XHZA 4J9YB 4MVSA 1VQOA 4Z4YA 4EQPA 1MBYA 5IIFA 1H2MA 1Q8KA 1GO2A 1Z6HA 2HP8A 5IWAO 3ZMTA 3A0JA 3QR8A 4FLXA 4DR1B 1HNWL 3HOYB 2KB1A 3HGBA 5KA6A 4UB6Z 1IDSA 4KK7A 2OXPA 1YHAA 4R50A 1EFRA 3MAQA 2C4UA 4LW1A 1XOUA 4B3SB 1W2BA 4A3KH 1HR0L 3TEHB 4B3MB 1IBLB 2JP1A 4CJ0B 1B9MA 1EWHA 4NTYA 1FDRA 4I9QA 3KF6A 1B6QA 2OTLA 5AG2A 4DRXB 3S3XA 3F5WC 4F6RB 4NTXA 4RQEA 5KHHA 1CKOA 3I1FA 1E3ZA 1H42A 2X6WA 4CJ1B 4JVZA 2X69A 1CXZB 1P16A 4DV4O 3I8ZA 1FAFA 2JJQA 3K59A 2HDMA 1STNA 1DF5A 4ACAA 1L1OC 3K79A 3U6KA 1E2VA 2QDXA 4H9GA 3CC7A 1XPOA 1YVCA 1K34A 3W5HA 4YAUA 4GX2A 4K5XA 4IPGA 5C0XH 1QVFB 4JYAQ 1JJOA 4DV1Q 5BY1A 4FF2A 1HTLD 2Q6KA 3N2KA 3OWFA 1JJ2A 4FXUA 2EZVA 2QTLA 3VR4A 4OWXB 5IP9H 4WFGA 4UUJC 1NB0A 4U7NA 2QMUA 2VBVA 1GN4A 1E24A 1QG0A 1MHWC 3EBEA 5GADC 2OK8A 3A56A 2K5DA 4DK0A 3VO2A 2YU9H 1PVOA 2O2LD 1Y0YA 1L0NH 1MGSA 2JQOA 1E22A 1TVCA 3MFYA 1WORA 4A3GH 1VQOV 3L0OA 4PGOA 2AHOA 3JD1A 2BSKB 1WD0A 4B3TB 2P6JA 3A8JA 2B1GA 4C3IG 4FM0A 1QLNA 5E3FA 3EHBB 2R7FA 1K9MD 4QCLA 3FB6C 1B1ZA 5IJ9A 3RZOB 4FIPC 1FNBA 2X6LA 4JI7O 1DD2A 5D3DA 2BVNA 4PI2A 1IBML 3M4OH 4BIZA 3VNUA 2OTLV 3T1HL 1BPLA 1KZLA 3VYUA 3FKSA 2GVAA 1BDOA 2RBMA 4M2LA 3JARA 3VA7A 4Y7NH 5I9PA 1QE6A 2YS8A 2R6HA 1X3GA 3CPWB 1WN7A 3AYHB 1O7LA 5BMVA 3K5OA 3BH4A 4PV1B 4FPPA 1HHVA 2F66C 2IU3A 3AQQA 1IHZA 4JI1L 1V54C 3CD6A 4LUZA 3FAVA 2PI2A 3PO2H 1FJGQ 1VQ6A 2F3IA 3A7AB 3Q0AA 3EJIA 4BY7H 1V8QA 4YHBA 1VCIA 2D9UA 1WA8A 1OCZB 4J15A 2X6GA 2JGUA 1ZUNB 3ZZ0A 4P71A 4P6YA 1EOVA 2ZNJA 3CXHF 2JDIG 3U58A 3T4ZA 3TZUA 1Y1VB 5LGUA 3JALB 1W87A 3HKBB 2IT1A 5L3BA 2CKZB 3MC0B 4U68A 3I56A 2BN4A 4ZHQA 3Q6QA 3W2GA 4LFCO 3OWEB 2ZIOA 2R93H 3SJQC 1EY0A 1CPYA 3VNVA 3J80E 1ZAUA 3E20A 3HOYG 4K1XA 5E1AC 3HEJA 5DNFA 4FK5C 1V1QA 5B1OA 4G2KA 2Z6KA 2E74B 2ZXRA 3M4YA 2ZITA 2R3ZA 2MNAA 2VQEQ 3HKSA 1Y14B 2A6ED 1SN8A 1C48A 3J7AU 4XL9A 1QNKA 4OO1H 1TWGH 3E8HA 2L55A 2F0UA 3NWTA 3OAAA 2QA4A 1VQEA 2OTJB 1WP8A 4FZ0A 1VIBA 1PFNA 1BE3H 2B2YA 1TWFH 3A8KA 4RDJA 1UPGA 3BNWA 5IT9E 1I94Q 3A8JE 4XDJA 3X3MA 2F0MA 4MZ9A 4A3BG 1WVLA 1TS5A 4LF8B 3CJHB 3AVTA 3EA6A 2F93B 3CC2V 3KBGA 1VQ8V 4M1KA 4K0KO 3H15A 4YY3Q 3D3QA 4DV5L 1HNXL 5LHY1 4NBSA 1L8DA 4DV0B 3CD6V 3BC9A 5C5LA 1UD2A 4B44A 2Q68A 1VQ6V 2HQEA 1JB9A 1T6YA 1AIPA 4RAIA 4R4CA 1EEID 5M3MB 2P06A 4IHJA 1ZYRC 1QCEA 5CBHA 2ZJPA 4XLCA 4BY1B 4G27B 1IJEA 3OZUA 3RN2A 2C35B 4E2LA 2PZWA 2HIXA 1X55A 1B2TA 3J81j 3I56V 4O4JB 3RBZA 1CK1A 2PI2E 2PTMA 2J7KA 3FB5C 2CTWA 4X62B 5ELBA 3OEEG 2RQXA 2EINC 3OUSA 2WB1B 3ZX6A 3H3VI 2UXDB 5GAEC 4YHHQ 4X7EA 2DETA 1CKMA 3CCVB 2OK7A 5BR8B 3ULJA 1PTOB 5F2VO 1K92A 3ASRA 4KHPB 4TWKA 2QDBA 3L75H 1KRSA 4LMQD 2QW7A 3PA1A 2WPDA 4OWTB 2D2CB 2VQFQ 5LMNO 2F0SA 4DR7B 4NXNB 4RCYA 2E75C 1NRKA 3AEVA 2ZZQA 4QJFB 2CW0D 1E64A 2WINB 3GTJB 3VR3A 2QA4V 3K0YA 3PUVA 4IFDJ 2OBRA 1A8PA 2MFIA 5CV6A 2NPFA 2VS0A 1LLRD 2R9AA 1N0VC 2YUAA 2IJKA 5F4MA 3TBIB 4U3FH 2RDGA 3CCSA 1BS3A 3GIRA 2QTOA 4X3KA 3UI2A 2VWKA 5IYZB 2EDGA 3S2HH 4TRDA 4AH6A 4HIKA 4J42A 1SYCA 2K5HA 4DR5O 5LA6B 4LJZC 5J3OA 3M7MX 2N74A 4L5RC 5GTIZ 2GUZA 1GUSA 1L1OA 1GJXA 3BABA 1NH2B 2Q6IA 1CA6A 3R8BA 3D31A 4M8AA 3QO5A 3VR2A 3SHLA 3A8KE 2Y4UA 3S17B 4KD3A 1Z9FA 3G71B 3G05A 2C2WA 5LMUO 5C3EB 2P90A 2YDEA 4FO2A 4R71A 3U4VA 4RQFA 4PA6A 3GVKA 4B3SL 1Y1VG 2EJ7A 1D5ZC 4UVAA 5DN6A 3F1ZA 4X65O 4B3ML 1IBLL 3DEOA 1A0IA 4R8NA 5EKLA 4A3LH 4RGOS 2JS5A 3WU2Z 1DYQA 4QHYA 4X66O 1ASYA 1F2YA 3GP7A 4GKJB 2PE3A 4XMYA 1JFFA 3THOA 5CB4B 4K8IA 3TDQA 3X3NA 4O4HA 4HEDA 4H44B 1X59A 1PRTD 2WWWA 4MYUA 2RCFA 2K14A 4TV8B 2XNDG 1I50B 1YJWB 4KV6A 3HOZH 4DN4M 2WAQE 4X89A 4X64B 2L1BA 2Y0SE 2PYLA 1PH3A 1YCIA 4WFAV 4MSWC 4JPRA 4AVZA 1I7PA 2NLJC 3E3XA 3AG2C 4O2AA 2JIZG 2YXYA 1ELOA 3GVLA 4UB8Z 4WWVA 4JI8O 5J35A 3Q3AA 1NT2B 3I4MB 1GOZA 1VQ4A 3SPJA 4FF3A 3RD4A 1PHJA 1BCPF 2F0PA 1PXUA 4OX9B 3S1MB 3JSNA 2EIMB 2ADQB 4RCOA 3L2PA 5C93A 2IBZH 1B06A 3CCSV 4FLYA 1JE5A 2OCEA 1IXRA 3RLFA 4NMZA 2BA0A 4LAAA 3EIVA 1VP7A 2JK8A 3B8MA 1JWSD 1F9SA 3QG1A 3HOVB 3J81E 3T4AC 2PQEA 1M57B 1M1KD 2DYRC 2E74C 1I5XA 2LW7A 5B1AC 3H1KH 1H9SB 5M3MG 4D7TA 3RYHA 4UCRA 2F03A 1HR0W 3NTKA 1R6NA 1CI3M 4BY1G 1PH5A 4XIGS 1S5CD 2M5SA 1QQCA 2YC0A 3OMNB 1U97A 2NN6H 1BBXC 4DV6Q 1COWA 3ETDA 1DOKA 1I4RA 3GTOH 2AWNA 1YBYA 1SNDA 2IJJA 2A0LA 1TKWB 1K3RA 4DR3B 3J80L 2AQ2B 2UUAO 2IHEA 2UU9Q 1GD7A 5B1BC 1TVXA 1H2GA 4X7DA 2EYLA 4PMWA 1XEQA 1SYGA 3PO3H 3NENA 4FXKC 3O65A 4EQNA 1N8RC 4RWUA 2Q73A 3SJBC 2B63H 2KHSA 1HCZA 5D14A 1VQLB 3PUZA 5LOVB 4UY8C 1PM9A 4XONA 3IFDA 5LL6S 5C4ZA 5LYJA 2RCVA 1DM0B 4QIWB 2DOGA 4GX1A 5F4JA 1G7CA 4NXMB 4DUYL 1EIHA 3IKJA 3NBHA 3CRZA 5GAHC 4UCSA 1G7TA 3ICEA 2WLLA 4H13B 5J3BA 1KK0A 3RVZA 3GTQH 4JI5B 1VQ4V 1SNPA 2H8PC 4P75A 1JC7A 2NVXB 2Z9HA 3O13A 3QFCA 1G91A 3CCQB 2ZXWC 2WAQG 1ML0D 3JU4A 2Y0SG 1KKCA 1A6XA 1S40A 1MABG 1YITB 3I90A 1QZHA 3CB2A 1AILA 2C77A 4TVAB 2AUKA 3U0ZA 1SMYC 1N32Q 5GTHZ 3LDEA 2IW3A 2K5WA 2EJRA 4W4LA 1KKDA 3JQRA 2D3OW 2ZXOA 2XHBA 4FLUA 4ZLTF 5FLXL 4NB3A 4DR6Q 2LO1A 1H8HA 2AWOA 4JI6L 2MW2B 4JYAO 4DV1O 3ZHRA 4LF9Q 2WZNA 2BH2A 2I1LA 3K7AH 2Z4IA 4GX0A 4QGUA 1R5OA 5AN9A 4EEQA 4ZQ3A 1HPCA 2QF7A 1IW7C 1N33B 1SS3A 1SJHD 3CMAV 3ONAB 3HG9A 4LBVA 4TT3A 1OB0A 2W6JG 2A8VA 4O0AA 4DRXA 3S2DH 2EYFA 1X32A 4JV5L 3MXUA 4DV2L 2C5BA 4HYOA 4WCEV 3JQQA 4R4IA 4ZAIA 1N34Q 2EZPA 4LF8L 5H2FZ 5C4JB 1EY4A 4J11A 1Q82D 2M9VA 3GTMH 1FNDA 1ZTEA 4GKKB 4TMZA 3TXQA 5KHGA 4JBJA 1KNAA 1SE8A 4G7HC 2VW9A 4PDMA 4LFAQ 1XX8A 3TN2A 4BBRH 1KP3A 2K9PA 1PYSB 1IHMA 3TK1A 5DLQE 4A3JH 1Z47A 3I4MG 2GDSA 1ENFA 1TR5A 1QVFA 2VB2X 3KLWA 1NJIC 5IJ0B 1NBWA 1FR3A 2DERA 5IYBH 3S1NH 2W6IG 1OHHA 1H9KA 1G8MA 1HA6A 3TS0A 3W5UA 2R9VA 4PA4A 2N78A 3GWOA 4QB4A 1LTLA 1H8EG 1SMXA 3TRZA 2KECA 4X62L 3HOVG 1EN4A 3OGCC 1MRZA 1STAA 4IOAA 5IP7H 2K5QA 3L9AX 3W7XA 1G2TA 2D3NA 1STYA 5FO0A 4NR1A 4X8IA 1XNRB 1I18A 3D4RA 4II2A 3CCUA 3PMFA 2UUBL 4FYDA 2H94A 1IZ6A 5E4XA 1Y8NB 1TVKB 2RC6A 1PH7A 1M9NA 3J81i 1GHKA 1L2FA 3GVMA 1ET6A 4DR7L 1CSQA 5F4OA 1H9MA 5IYCG 3H9VA 2HLDG 1PH1A 1TUBB 1JJGA 4YWMA 2JEBI 4DXWA 2EIMC 3L74H 4CH4A 2CH4A 3DGEA 1A3VA 2E2HH 4WZKA 1E43A 1Q81C 4ID6A 4F4LA 3JAWB 4XDLA 1JOYA 3CPWA 2Z6BA 2RHSB 2ILMA 4LFBB 5J1ZA 4C56C 2C4TA 3ZJZA 3CPFA 4XYOA 1M57C 1H2LA 2Q67A 3FMCA 2VQEO 2BE5C 4LBEC 4JAUA 1XPRA 5I4DA 3V96A 1ZM9A 4CJ2C 3OTFA 2ETNA 5J2UB 2DYSC 1WCMH 3E35A 1ZLZA 2XAJA 3LSSA 2XASA 1S5LZ 2F1LA 4CDDC 1BQZA 4PDVA 2D3LA 3TP8A 4MN3A 3H0GB 4UVBA 2IW5A 1F9QA 1VQ9B 1K0RA 4N8FA 1II3A 4C3JB 1E79A 1I94O 4HE6A 3QTCA 1UEBA 2FL4A 2EPBA 1VF7A 3ASTA 3HKBA 1AE3A 4CHTB 1P8LA 3HKDB 4E0FA 4GKJL 5EJWA 2OBSA 1N9WA 3RYIB 4IUPA 1NMGA 2ARHA 1IBMQ 4YY3O 1NTGA 2UXBL 4UCUA 1HUMA 3OIPA 3J7ZC 4B3RB 2WA3A 1NUCA 1NU1H 4DV4B 1UD5A 3W5OA 1PP9H 5ITZB 3M99B 1O80A 3WB1A 3B78A 1CEZA 3AVVA 3CCUV 2E76B 2MK3A 3UQ8A 4X64L 1I3QH 1LT6D 3PSIA 4XR6A 2A79B 1T5EA 2LMCB 1OCRB 3S1QB 2V31A 1GKFA 2E2JB 4L5TA 3CXCU 1PKXA 2N55A 4KD4A 1CQVA 1K3EA 2ZT9C 3F2CA 2DQ0A 3SJAC 4FFBA 5L3GA 3SYPA 2BF4A 1YTFD 3CMEB 1E63A 1KRHA 4YEJA 1Q86D 3CCJA 4Y9UA 2JA6B 4IUNA 2NVQH 5CGKA 4YHHO 4JI3B 1LUZA 4TQUS 2E2DC 2RC5A 3PF5A 2HHHQ 3CJHA 3APOA 3DWQA 3RLOA 4EQOA 4LBZA 4JI2L 1EWIA 3Q4HB 2RQ6A 1ROPA 3HKEA 1V0EA 2VQFO 1DLBA 4N3NA 4ZKIA 4X3TA 1U4RA 1ENAA 3L72H 3OZWA 1HZAA 5M5XH 1SNQA 3CHBD 3TGUH 4ODGA 2DGYA 3AVUA 3AG1C 2F0HA 1XWEA 3QO8A 4YJ2B 1QFJA 1HNZQ 2EIXA 4RPDA 2R7ZH 1TXYA 4DR4Q 2A1AA 1S4ZA 4RUEA 5FPOA 4WZEA 4DR3L 4TMTA 2YSUB 2EILB 2JGDB 2ICIA 2ZTEA 2BPOA 2JEUA 2YYZA 4HE5A 4HCEA 4JW0A 3CP0A 1BMFA 3P32A 3OP1A 2DJFC 5I6WA 1BVSA 1JCKB 3QIAA 1S4MA 3AVYA 4HNAB 2M00A 1QLEB 2RCNA 2B2TC 3CC4B 5JJKA 2QKAA 4QY7A 1VQMB 3FKIH 4DF7A 4NXML 4AQYB 3RYFA 3SVMA 3VYTA 1WOOA 2W0XA 1TWHB 2JS3A 4R7CA 1KECA 1M90C 4JI5L 4Z1MG 3NSWA 2XGJA 3NE5B 5I2YA 2K1EA 3CCJV 1VQJA 1J6QA 1Y76A 1X3FA 5GONB 4BBSB 1E1RA 1W2BU 2A69D 1EYCA 3NK9A 5IE9A 3S1RB 5KAIZ 1QOHA 5J39A 3BJUA 5EPJA 2RNBA 2NV4A 3HOWG 1WYDA 2QCPX 3EVKA 3KCYA 5LA6A 4LFCB 4LF5B 3OTOL 4WFEA 1EFCA 4RGTA 2V7TA 3KYHC 2HVKC 3S14H 1HA3A 3K5NA 4BIOA 5CBGA 1RTNA 1CNFA 4NYKA 4B3FX 5FK9C 1E1QA 2OIGA 4DAVA 2BOBC 3G71A 3H0GG 1BCPB 1WJZA 2JA9A 3MXPA 1YHQA 4LF6B 5EBCA 2SOBA 1BT8A 4HN7A 1AR5A 1SC5B 2V7VA 4X1YA 1XNQB 5FA6A 4X1IB 3UDGA 4JMQA 1KIXA 4HJ5A 2GV9A 1K8GA 2OT5A 1A63A 5CA1B 2PNRC 2VRZA 2KJXA 5IY5C 1QVCA 5HURA 3G80A 1JJ2U 4UP9A 2AHZA 3CRKC 2RDCA 2ZM6B 2YTVA 2UXCB 4KP4A 2GJRA 4I55B 1JNYA 5LHGA 3HRZC 3HKZG 2ZTGA 2ZR2A 5DAUA 4MT8A 1ENCA 3K81C 3G6JB 1H9JA 1FNWA 4OXPA 1TU2B 3ZRXA 5C4XB 2Q9LA 4TV8A 4YIOA 1RPOA 2Q8TA 2XAFA 4JTAB 3OT7A 3S15B 4AC9A 3IAYA 4K0KB 5CR3A 1FKAO 5IYBO 4HR7B 5EPKA 4DV6O 1WSRA 1BQ0A 4XOPA 4X9QA 4HIDA 4G28B 2OWOA 3PF4A 2VZAA 2YIBD 5IT9N 2BDOA 2TMPA 2R92H 1W0KA 2UU9O 3QVNA 4OOXA 3FB8C 4DR1Q 2ITDC 1G291 2EVBA 3W3AA 2V1CC 2UXNA 3JCUZ 3S3WA 5ELFA 1XQ8A 4H33A 4EFEA 5M5WB 2FINB 3GTPB 1FX0A 3NHHA 5EIBD 2WAMA 3C46A 4TUYB 1Q12A 4Y52H 1DCZA 1OXSC 4QQBX 4ZCKA 3OMGA 2RDHA 2DUDA 5KLVH 1WJJA 3AG3B 4XD7A 5K1PA 3G71V 2YWGA 1P7BA 2NB0A 3WB0A 1SZTA 1OCRC 1YHQV 1XMOQ 5C44H 3BA8A 2KCTA 4Z4TA 1F51A 5E1FA 1WNSA 2MHVA 1FRNA 3CRRA 2NTSA 5LMNB 1KMHA 1A8VA 3W1BA 3I55B 2LP7A 3D36C 4I7ZC 2K7VA 5A2QL 1JVMA 1ZSPA 3WNCA 4YXWG 2E5LL 1N32O 4RJLA 4DV3Q 2OCCB 1MD2D 1IXMA 3KF8A 4DXFA 3ASOB 4O4LB 1F23A 1FFTB 2CGOA 4UP7A 1BHAA 2EXDA 1K9MC 4DR6O 2LXJA 1NR4A 3AEIA 1KQSB 2GPJA 4LF9O 3FEWX 4QPKA 4X7FA 4QUCA 5LOVA 4QUFA 3QOJA 3JD3A 4Y9RA 3MMPA 4CBVA 2F43A 1G6ZA 4DQLA 2XZLA 4O4IB 4A3EB 2V7QG 1R4PB 1WTHA 5JEAG 5JAVA 4U7OA 4YIJA 3RW0A 2K75A 4ACBA 4FF4A 2QEJC 4XQFA 2QGNA 4B3TQ 4JG2A 5DEDA 4PC6A 2QDLA 1PRTB 2H1EA 4A3DH 4QFMA 1JMKC 4X65B 2QTSA 1N34O 4P72A 1WAZA 4BXXH 3TREA 2NVYH 3H01A 3Q6SA 1HH2P 3KZIZ 3CP8A 1X9NA 2XVSA 3UO2A 3J81c 1R1BA 2EY5A 2Q7HA 1KJZA 3Q6RA 1MZFA 2ITCC 5KRUA 3E8FA 5AJ3Q 1YSCA 3DTUB 4B3RL 4LFAO 1RKNA 2I46A 5JJJB 3SE0A 4DV4L 3HOUH 4FM2A 1W34A 3DXRB 3HKCA 3JASB 4YAOA 1HUNA 2ZZFA 4PC2A 1RQRA 1NS1A 3JAME 4ROXA 4XTCS 5KYIA 3M4QA 5TY0A 1NAPA 2SNMA 1PH4A 5HFMA 1EIGA 1KAAA 2EE1A 1G51A 1I6VC 3L70H 1M56B 4TSFG 4GCZA 4JI8B 4PA3A 2V7WA 3HOYH 3LGJA 3K0GA 1AZPA 4JPBW 4JZ2A 1GVHA 3NUCA 3RYCA 5L37A 1IZ3A 2YU9B 2ENBA 5COYA 5C4XG 1IBKB 2I5HA 1Q7YW 1K73D 2JJ1A 3DUZA 3K3WA 1DJRD 1LYLA 2FJ2A 4GOPC 5KHIA 3E0EA 2VNKA 4IUUA 1PJ5A 4A76A 1I08A 2B2TA 1F7YA 3VMFA 4QNHB 5C8YB 1VF5B 4HIZA 3B09A 5K36H 2ADPA 1UE5A 3FVQA 1E1OA 5IJ0A 5IYDH 3M4OB 3ABMC 4P9PA 5H5NA 3UCSC 3SYAA 4ME3A 3ULPA 5KMGA 1KTKA 3N6RA 1PTOD 5M5YH 2ZNIA 3H1IH 4PC1A 2O5JC 3I91A 4JI7L 1W0JA 2Q2TA 2WZPP 1LM0A 3QO7A 5LGTA 5FJ8G 1VQBA 3ZIAG 3J81N 1HZBA 2UUAB 2JA7B 3I3CA 4HAEA 5NUCA 5EZYB 1FFXB 3BHPA 3ABKC 4RKLA 4HIOA 1VEWA 1SQVH 4PZ6A 2PZUA 3E22A 2F0WA 2JA8B 4LF8Q 1BO0A 1OB5A 2XNCA 2GK7A 4AQYL 3FB7C 3B77A 1ZM2A 2HQLA 4TMWA 1XL6A 2OYNA 4DV0Q 1P4MA 4UPAA 1NH2D 1PYBA 3LWUA 1LUWA 4D6TH 3JCZA 2PY5A 3HAGA 2MPMA 1NBMA 1IBMO 1ASZA 2YICA 3BY6A 5CC4A 1X54A 4FLVA 1AVMA 1G8ZD 3SK5A 3M85A 4U9UA 4XQQA 3W7UA 1VQ7A 3RZOH 1SDFA 1IJFA 3CCRB 3BAAA 1X4TA 3IFXA 1WLEA 4LFCL 4G1VA 1KDCA 1NZ6A 1KABA 4A3KG 3P20A 4X62Q 3ZHSA 5J2UA 4KTAA 1ESRA 2UXDQ 4JYAB 5EAYA 4I9WA 3E6ZX 5BN3A 4LF6L 3E2EA 3E8GA 1SAPA 2VBTA 4RCZA 5BR8Q 4R6ZA 1WB7A 1VQ9A 4KHPQ 4LF7Q 3A5ZB 4JYCA 4L63B 3EN2A 1WOSA 1ILQA 3I5DA 2HHHO 1ORQC 4C7UA 5IGCA 4KJOA 1CNEA 2YIAA 4NXNQ 1WP6A 3M7NA 1IL8A 4GT1A 4FN5A 4Z4WA 1RFYA 1R3LC 1ZWIC 5KNBA 1VQPA 2K6AA 1EFWA 1QHTA 2ZM6L 5TRDA 4X1KB 3BYYB 5C0XG 2DWEC 1D1KA 4MTNA 5FL7G 4XQJA 2DOSA 1P49A 1B23P 5ITZA 1V1OA 3R2IA 1Y1VH 4GS3A 4G1BA 3A8IA 4K0KL 1X3EA 4K8ZA 1HNZO 1TUEB 5IP9G 3V2TA 2XAHA 4OPOA 1PZKD 4CGYB 4DR4O 3P75A 1C0AA 1VS0A 2PMZB 5C3WA 3ABLC 4I4TA 2EX3A 2VBSA 1VQCA 3G4SB 3K8AA 4R4OA 5KAFZ 5I6YA 5ELDA 3BDOA 1PH8A 1W6KA 2IH1C 2WYRA 5C0XI 1VQFA 2N8NA 2PNHA 5TSSA 1XYIA 4A3GG 1Q3EA 3JAMi 3T1HB 4LBYA 3KJOA 1N07A 2IU0A 1NTMH 2YWEA 1VQ7V 4WFBV 1X6OA 4JI4Q 3E0JA 2JN9A 1NB9A 3F7YC 3SEBA 3P7JA 1HZ9A 3Q4HA 5JJEB 4G7XA 2NZ1D 3AVWA 4AIMA 2JRIA 2DCUA 4MIUA 4O2BB 4ZI7B 2OIEA 4LNUB 3TQYA 1BX1A 4XDKA 1FJGB 1IXBA 4GZYC 1GUGA 1SEBD 1BBUA 1CSPA 4P12A 4JI1B 4FK8A 3LSQA 3SXHA 4BWAA 2E8GA 1AFPA 1TIID 2HJFC 4B9WA 1OCCB 1CA5A 2EIKB 4FNFA 1BLIA 1PMRA 2R6GA 4YJ2A 1VMGA 2F0KA 1U2RA 3W1GA 5ELOA 3AGPA 5LMNL 1K5QA 4C1NI 2Y4TA 2XWJB 1CFMA 2HDNB 2DMXA 1OB2A 2VBUA 2AUJD 2WJVA 2LFRA 2SEBD 3OD4A 1AJNA 4BS9A 3ZS8C 2JA7G 4P6VF 4P3IA
chains in the Genus database with same CATH topology
2E74C 1FD7D 2WJYA 3D3RA 5IODA 1H9SB 3FPUB 4HBNA 4ABNA 2J0TD 1S5JA 5D65A 2B2WA 5LP6C 4D7TA 3AMUA 3RYHA 2KVOA 2XNDA 4UCRA 2F03A 3NTKA 2GA4B 1CI3M 2CK3A 2BA1A 5K5PA 5DEHA 2F0FA 4KY7A 1BOSA 4XIGS 4H13C 1BNZA 3JSLA 3VQVA 1S5CD 2M5SA 4XT3B 5C5MA 4XXEA 1QQCA 4LH6A 4DNRB 4X20B 2NN6H 5FOBB 1BBXC 4KY6A 1QG7A 1F2ZA 1O78A 1COWA 1DOKA 1I4RA 2K1BA 5LXTB 4A3IB 2JIZA 1OXXK 2RDFA 5C8YA 2AWNA 2EYPA 1SNDA 2ZINA 3FRPB 1HRJA 2O4XA 4KMUC 4ZKBB 3OPOA 4KHZA 1TKWB 4DR3B 3J80L 1Z5VA 2AQ2B 3OSOA 3ZYYX 1F77A 2VJJA 4AHCA 3DSQA 2XZOA 3SGIA 1YNNC 3KLSA 4I65A 1LT4D 1JR0D 1TVXA 2VNUD 2EYLA 4PMWA 4B9XA 1SYGA 2ZZEA 1QCBD 4DA2A 1UD6A 1C8CA 4CS2A 3U10A 4FXKC 4RA8A 1OXUA 4EQNA 4S3SA 2R70A 4RFBA 1EWCA 3SJBC 2KHSA 4G4KA 3S16B 1HCZA 5D14A 2LFNA 2L12A 2NN6I 2WACA 3A55A 3PUZA 5LOVB 4IQZA 5IGEA 5FO8B 4IALA 1M8AA 5CMDA 4TKOB 4PMBA 4XONA 3IFDA 5LL6S 5C4ZA 1PZJD 5LYJA 3VR5A 3A8IE 4FLTA 1DM0B 4QIWB 3IFTA 4K6LA 4EVOA 3CP2A 4V0BA 4NXMB 1KMIZ 2XRQD 1EIHA 3A2FA 4NVPA 4CH5A 4DR6B 5LP6B 2KOLA 3IKJA 4F87A 3BVGA 1SNOA 5FO7B 2IX1A 3NBHA 1EFID 2MJ8A 3TP5A 3QF7A 1LACA 3JARB 1WCMB 4UCSA 1UNSA 4K5VA 1Y1WB 1H2SB 5CA0A 5FKAC 2K33A 4OO1G 4WBNB 4KN7C 4KI0A 1E3XA 4JI5B 5BMVB 4DV5B 1SNPA 4JI7B 3G7LA 1PDQA 5CBAE 2NYZD 1JC7A 2R72A 2NVXB 5EKKA 3OFNA 3O13A 4ILWA 1G91A 4A3MB 4O4JA 1V0FA 1ML0D 4YJ3A 4FFBB 1O7ZA 3JU4A 1A6XA 4IN3A 3WOEA 3I90A 4AILC 4NP5A 5F2DA 3CB2A 5K36G 2AUKA 3FPPA 3U0ZA 1SMYC 2IWHA 3D6CA 4FLZA 2IW3A 2F1MA 2K5WA 4JBWA 5JH7B 1GHJA 1UEAB 3CESA 4C3IB 3H09A 2X6YA 2ZXOA 2XHBA 4AYBB 4FLUA 4ZLTF 2DY7A 3DEPA 2RSNA 4UDUC 5FLXL 4G7OC 1SYBA 3H6MA 1H8HA 1SKYB 2AWOA 4OO1I 1A3TA 4FM1A 1DXMA 4CC5A 2MP1A 1HZEA 1Q43A 1JOOA 4CH6A 3HKEB 2PYJA 4BW9A 1J9OA 4DFAA 2X6XA 3MXGA 2Z4IA 5ISRA 1WTQA 3K58A 4I55A 5FNVA 2RVLA 4EEQA 3CSXA 2GJKA 2PCFB 4ZQ3A 1HPCA 4LFAB 2QF7A 1MI2A 1W6JA 1IW7C 1N33B 1SJHD 5FLXE 1IW7D 5CBEE 1EY7A 3ONAB 3HG9A 1Z5WA 2EOTA 4TT3A 4RCNA 4RHRA 4PNYA 1OB0A 1AP0A 3C1EA 1R4QB 1E0BA 1ZYRD 4DRXA 2A69C 2EYFA 4XDXA 1GXDC 4FVMA 1X32A 5IYZA 1BUVT 3MXUA 3BDLA 1SKVA 4OGQC 2KCCA 1A15A 1MSGA 2GK6A 3GTOB 1HNWB 2HCIA 5KGUA 2X53S 1MABA 4XN3A 3KK7A 4ZAIA 1NSNS 2BDNA 2NVQB 5C4JB 3CHXA 1EY4A 4OHJA 3BVZA 2M9VA 5G3LF 2J4XA 1PFBA 3I73A 4GKKB 5KHGA 3BG3A 3OIQA 1KNAA 1HR0B 2J7ZA 2H4OA 2EYOA 5EPLA 4TOIA 1WPCA 3LWEA 5D3IB 4G7HC 4U673 4X1KA 2RA4A 4R9WA 1TWAB 1XX8A 1S5ED 3TN2A 4TQDA 1TS3A 1Z47A 1ENFA 3FFQA 3HOXB 2AQ1B 1TR5A 1EEFD 4LF7B 2VJIA 2VB2X 4K5WA 4NNJA 2KA7A 2EYHA 2OYQA 3BRCA 2VXWA 4TUYA 5M5XB 3RYFB 5IJ0B 2NWGA 3DDYA 1JWUD 1SYEA 4XM3A 4U3JA 1ILPA 3NP8A 1A2UA 5JQGB 1FR3A 4XN0A 1SA0B 1OHHA 2F0GA 5HGTA 1H9KA 1HA6A 4O42A 5FPRA 2YI9A 3OHXC 3DHQA 2R7ZB 1EU3A 2B2VA 2W6JA 4KKUA 2R9VA 3I4LA 5CB4A 2KVMA 5C0XJ 1HA5A 2VB3X 4QB4A 3C1FA 2P5OA 4HMJA 1HTPA 3H91A 3R2TA 3SR1A 4CH3A 2KECA 1QNUA 1VJSA 1STAA 1PZID 4ZOLB 3KLSX 2F0JA 1SYFA 3GD7A 3C2PA 1XMQB 3A54A 2K5QA 3L9AX 3U9SA 3RUZA 4IHJB 3T56B 1TY0A 4UFZA 4ZK9B 4IUVA 4P2CB 4KN4C 4WORA 4DK1A 1G2TA 1D5AA 2D3NA 1STYA 4OIJA 3A35A 4TV9B 2SNSA 1XNRB 1I18A 3D4RA 3QB3A 3URYA 4II2A 3JAKA 3PMFA 4FYDA 3ICXA 2F0EA 1EYAA 5EYPB 1E2ZA 1FYCA 1Y8NB 5E4XA 2NVTB 4L8JA 3RWRD 3K6OA 1TVKB 5T1IA 1GHKA 2RJZA 3OEHA 4LNUA 1ET6A 2RKSA 3FKIB 4K8XA 1M4VA 1H9MA 2I07B 2BTOA 4H0LC 1TUBB 5D5PA 4G6IA 2K04A 1Y8PB 1TGOA 4A3BB 2WSSA 5A35A 3HP3A 2WP8J 2JJ2A 4X1YB 1QILA 2JEBI 3E5SA 2W6IA 5EKIA 4JI4B 1JE4A 4O4IA 4CH4A 1EU4A 2EY2A 2F0VA 4IFDH 2K32A 1R9TB 4WFN3 1A3VA 2FMMA 2BCOA 3H94A 1WTXA 1E43A 4A3FB 1RHPA 2L11A 1GUOA 4ID6A 4GYCB 2EJFC 1F2LA 1H8EA 3JAWB 1ZEQX 3Q24A 2L4NA 4LFBB 4UZUA 2EYMA 4RGMA 5J1ZA 5I9OA 3JATB 4C56C 1V1PB 4JK1C 1B4OA 2ICEC 3KBXA 4ZRZA 2VWJA 2Z6BD 4XYOA 1EY9A 2F0LA 3VYSA 3BA9A 1H9SA 1TWCB 2E76C 3GV3A 3GTKB 5JJNB 3FMCA 3ITPA 1TQOA 4Z9CB 1I4XA 1A3UA 2NUCA 2BE5C 2A74C 1IBMB 3TMEA 5I4DA 2A68C 3V96A 4Q0FA 2D5DA 2YI8A 4CJ2C 2A68D 3OTFA 1UD8A 2Q0AA 5J2UB 1HXYD 1TAEA 3GTMB 2XNAC 3R93A 3MEHA 4WRDA 1AZQA 4X20A 1WPBA 1GUWA 1LTID 5G3LD 3ZPNA 3SJCC 1B04A 5LXTA 3CQZB 4BA2I 2PZSA 2D3LA 3TP8A 4MN3A 3H0GB 4ASUA 2L9HA 3PV0A 5JVG3 1F9QA 5KX5B 2Q7GA 1II3A 2WV6D 4ZUJA 4C3JB 4A3JB 1E79A 1KDBA 2F0DA 3QTCA 2HLDA 2EPBA 3JASA 1VF7A 5JVDA 1B44D 3F2UA 3U9OA 2CHBD 2XSCA 4TSSA 3OMCA 3HKBA 3T13A 4CHTB 2KEDA 1NR2A 1FGBD 2XZPA 1KNEA 3HKDB 1KLUD 4IURA 4E0FA 3S1NB 5EJWA 1KDAA 4L6TB 2KEEA 1XI1A 3RYIB 4DV6B 4DUZB 1SFOB 4IUPA 1CHPD 5JVH3 2HEPA 3MTSA 3NTIA 2L0CA 4UCUA 1RODA 1HUMA 3OIPA 4B3RB 1X3PA 1NUCA 4DR5B 4O1NA 4DV4B 1UD5A 4QMGA 5IGFA 5ITZB 1CZGA 2K28A 5BN5A 3N2KB 3RZDB 1STBA 4X3SA 1O80A 2WIIB 3WB1A 1D5MC 3R3OA 5LP6A 1VLYA 2N88A 4A3KB 2MUYA 3UQ8A 4KJNA 1I4PA 4LH7A 5LMUB 1LT6D 1LT3D 4XR6A 1M4UA 2IX0A 4FLWA 1T5EA 2LMCB 4WBNA 4J8QA 5C3XA 3S1QB 2V31A 5KNDA 5K1XA 4IZ8A 2E2JB 3MWYW 2N55A 3GTGB 2FMCA 4KD4A 2NN6G 1CQVA 1LO5D 2ZT9C 5J2TB 4IUTA 4XOTA 2F0NA 4YELA 2JXMB 4XLAA 3SJAC 4FFBA 2XWBB 2A6HC 2A6HD 1TA8A 4YEJA 1EL0A 2R92B 4DUYB 2JA6B 4IUNA 1O9GA 4X66B 3OE7A 5IOCA 3I70A 1AW7A 4WJWA 5CGKA 1LV9A 5JH7A 2QE7A 2P22C 1M93A 4JI3B 4TQUS 2E2DC 4ME5A 1YNJC 3J7AF 1YNND 1IKLA 3BDCA 5DM73 1KLGD 1YNJD 3DWQA 4EQOA 3BZDB 1SYDA 4ULLA 2PW5A 4O2AB 2K03A 3HS0C 1EY6A 2RQ6A 2E2HB 1JWMD 3PN1A 3VQWA 3HKEA 1V0EA 2F0IA 5IJ9B 2OT2A 4EFBA 4X3TA 3ZEDA 1U4RA 1N32B 4IIJA 2F3VA 1ENAA 2KUMA 3N2GB 3L7ZC 1SNQA 3D4WA 1HQRD 4XQNA 3CHBD 1BQQT 2ZCEA 4ODGA 3N52A 5EZYA 4PMCA 2F0HA 1FFXA 1SJED 1CZWA 1XWEA 1LTTD 2OF1A 4ZUIA 1Q5OA 4YJ2B 4XNFA 2PYKA 3DXJC 2FFKB 4I50A 5CV8A 1K8OA 5C44B 2LZJA 1S4ZA 5JCOC 4LF9B 3HZXA 4JI6B 1WTVA 5FPOA 4G7WA 1LTBD 4OIKA 1SQFA 3RFRA 1ET9A 1SE4A 1HNXB 1EY5A 2XOKA 4A3GB 5JPNC 2ICIA 3WQZA 1DONA 2A6EC 5KNLA 2YYZA 1EQTA 4HCEA 4FF1A 1U9RA 3Q23A 1BMFA 4DR2B 3PUYA 3A7LA 2JA5B 5I6WA 1RJTA 2BTQA 1SMYD 1JCKB 3IL8A 2GJPA 3DWAA 3QIAA 2QM4A 1EQVA 1O7YA 4HNAB 3UT5B 2M00A 4K14A 1STGA 1B9NA 4XLHA 1BCPC 4CC6A 3BS1A 2KKWA 1HFNA 1BCPD 1D1IA 2B2YC 2B2TC 4JV5B 4DV2B 1C4QA