2V4DA

Re-refinement of mexa adaptor protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
232
structure length
232
Chain Sequence
NTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIDRUG RESISTANCE PROTEIN MEXA
publication title The Assembled Structure of a Complete Tripartite Bacterial Multidrug Efflux Pump.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 57
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2v4dA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2v4dA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2v4dA02
2EDGA 2PNRC 2JE6I 3VR3A 5BN5A 4IFDG 1T5EA 3WB1A 1GJXA 1FYCA 1HCZA 3PUYA 4TQUS 1ZYRC 3SDZA 1Q90A 1Z7TA 1Z6HA 3U9SA 1IYUA 3PUZA 4IQZA 4KKSA 1YNJC 3KLRA 1K8MA 3W3AA 4H44C 1K8OA 4GYCB 3VR6A 4KN7C 3D4RA 1OXXK 4I7ZC 1DCZA 3I72A 3NE5B 3QJYA 4H13C 2BA0A 4HR7B 4DK1A 4KMUC 3T56B 4PV1C 3FMCA 2Q8IB 1Q1EA 1GUSA 2NN6H 5A35A 3OPOA 2BA1A 3GQBA 4DNRB 1PMRA 1E2ZA 4OO1G 1EWHA 1V43A 3BG3A 1LACA 1H2SB 3TZUA 2E74C 1I6VC 1HTPA 3D31A 5C0XG 4TKOB 2DNCA 1G291 3PUVA 3CRKC 2KCCA 3PV0A 4G7HC 2O5JC 1GUTA 3QIAA 2QF7A 1GUOA 1GHJA 3EQLC 1H9JA 2A6HC 3LWUA 2E76C 1OXUA 4DNTB 1H9RA 2E75C 2KA7A 2NN6I 5BN3A 2PCFB 3PUWA 2K32A 5K36G 4RCNA 2A6HD 1BDOA 2F95B 1GUGA 2B8FA 1CTMA 5JEAH 1Y8PB 5D5PA 1VDZA 4XIGS 4DK0A 3BDOA 2JEAI 1O7LA 3RLFA 1SMYC 3T51B 3QG1A 3CRLC 1V8QA 2A68C 2R6GA 5BN4A 1Y69U 1B9NA 4OGQC 2A69C 3MFYA 2F93B 3WB2A 1IW7C 2JEBI 1DXMA 3AB9A 4L8JA 2A68D 2D2CC 2BE5C 4JK1C 5C0XH 2K33A 3BRCA 1YNNC 4LK1C 1VCIA 2IT1A 2A69D 3N6RA 1IW7D 4LJZC 4BA2I 3VR2A 2AWOA 3PUXA 3A8KE 2BE5D 5KNDA 1E2VA 1GUNA 2JXMB 4JBWA 2B8GA 3M7NA 3I4LA 2EJFC 3ND8A 1B9MA 1GHKA 3VR4A 4IFDH 1IYVA 2DN8A 4XTCS 3SE0A 5K36H 5JJNB 3L7ZC 2A6ED 3LNNA 5JJJB 3A7LA 4KI0A 1TKWB 3A8JE 3I73A 3H94A 3HGBA 2LMCB 2V4DA 2BDOA 1H9MA 5KNBA 1E2WA 2PPBC 4H0LC 2D62A 1OXSC 3OW7A 1Q1BA 3M4YA 4KHZA 4GZYC 1RSOA 4KKUA 4KN4C 4BA1I 3A8IE 1TU2B 1H9SB 1Y8OB 2ZT9C 4OO1H 1DD2A 3IFTA 3VA7A 2O5IC 1CFMA 1VF5C 2YYZA 5D5QA 1ZKOA 2D5DA 3A7AB 2F1MA 3VR5A 3DXJC 2DNEA 4KKTA 5KNCA 4G7ZC 1VF7A 1Q12A 1O78A 5JEAG 5JJEB 2EJGC 2CW0C 2EVBA 3T53B 2A6EC 2EJMA 3MXUA 3WB0A 1H9KA 4G7OC 3FPPA 1HQMC 1OXTA 2L5TA 3WDNA 3ND9A 2NN6G 1LABA 2K7VA 1FR3A 1OXVA 3P20A 3IKJA 1H9SA 3OOCA 1Y8NB 3M85A 3GD7A 1QJOA 1A6XA 1CI3M 2AUJD 1ONLA 2AUKA 1HPCA
chains in the Genus database with same CATH superfamily
1S40A 1YHQV 1SF9A 3GTMH 4RD2A 1W2BU 3PIP3 4PMBA 2GN5A 3DC6A 3ZMVA 4UUJC 4IO9A 1EUJA 2WFWA 3R93A 1G1XB 5TR9A 3A74A 1KECA 1IBKO 1CEZA 4JI7Q 3ABUA 2KVMA 4E4EA 2NV4A 3BZCA 1VMCA 3BY6A 2NR5A 1JOOA 3CB4A 3NWTA 3K5MA 4RWSC 2K4KA 1B3AA 1B50A 1HRJA 4YHBA 4DRXA 4K14A 1B8AA 4C0SA 1PH7A 4BY7B 1NR4A 1YNNC 2XZOA 2EYMA 3KKYA 2E3CA 1LV9A 2YWHA 4OO1I 4AC9A 1EQVA 5JJNB 1XXGA 1WTQA 3G71V 4KLKA 1TWAH 1K9MW 1E0BA 4Q6GA 4UCVA 1V54C 1PDQA 3E20A 1LTGD 4JI1L 3QG5A 3H1JH 4PA4A 5IYBO 2QDLA 4A3EH 3BA8A 3S16B 1OGJA 1ZYRC 2F0GA 4ZHQB 5E7NA 3CPWB 5ITZA 2AHOB 3BU2A 2ITCC 3GO5A 1Q43A 2PCFB 1KNEA 5C6AA 3DDYA 1MRZA 2ZT9B 1B70B 4UCRA 4A3DG 4OGQC 3STLC 4K6DA 2VWKA 2D2CC 3L70H 4X8IA 2MO1A 4LJZC 4PELA 1QBZA 5B5EZ 2A0LA 5C3EB 3W7WA 4H0LB 3K08A 3JATA 3NR7A 1EFRA 1Y8OB 3Q4HB 1MSWD 3P7JA 5LP6A 1Q9SA 3RY8A 5EPJA 3P1HA 4JI1Q 1SROA 2F3WA 4DR3B 1LUZA 1MNGA 2NVYB 3OIPA 3HOZH 3ONUA 4LUOA 1BBUA 3R6KA 3WB1A 2LXJA 1EEID 1YEWA 3LX0A 2ZM6O 1JICA 4K5WA 3MC0B 3J7A5 3V96A 2YTVA 3CCLB 3RZDH 1S77D 1K8GA 1PJ5A 1VQFA 2Q8VA 3RFRA 3K57A 2F4VO 5GONB 3W5UA 1NE3A 5J2UA 3FJOA 4MYUA 2GBOA 4X62L 5KGUA 1ZM4A 2R92H 3E2EA 3E22B 2JA6G 4UCSA 3T13A 3ZS8C 4WZLA 4PZ8A 2DN8A 5ELDA 1NBMA 3UO3A 3M4YA 1SRUA 1GAWA 4JBMA 1GMGA 2WINB 5GAGC 3HKZE 5FO0A 3I4OA 1W2BB 1BCCH 3ASPA 3LQ6A 4I7AA 4OONA 3F5WC 3GTLB 2XNJA 1HR0L 4UAJA 4IURA 1C48A 2E2JH 2ZJRA 4PA6A 4CS3A 5LYJB 4IFDG 4I7ZB 3DEPA 4H44C 1N08A 1RPOA 1OCZB 4DV0B 1P4RA 2ZE7A 3BCCH 4Q7JB 3PO2G 1VQLV 1E24A 4QUCA 1KP3A 1K3EA 1MSDA 5L37A 1VQPA 3T51B 2HEPA 4UVAA 2J7ZA 2NTSA 2F0QA 2V31A 4K6LA 5CBAE 4X62Q 1E2VA 1ZL8B 1SQBH 4DV2O 3L7ZC 3LNNA 4R7CA 5KYIA 5A88A 2RQXA 1R9TB 3DXJC 2DIEA 1B7YB 2B9ZA 2CK3G 3FPKA 4XONA 5B66Z 2X3UA 1HR0Q 4DR7O 4LBZA 1EP3B 4U7NA 2WZPP 4KHPO 4Z4UA 3NE5B 1MHWC 2ZXIA 1H8HG 4XMYA 5H9CA 2B63G 3UKMA 3ABMB 5AG2A 4B43A 1GAQA 4HAEA 1BBWA 1J5EL 1PKXA 1I0HA 1XX8A 1H8EG 4QPKA 1EFTA 3LSQA 3CRCA 3KBXA 3S1MH 5B1BB 3M99B 4BY1B 2PZWA 4LC0A 2Z6BA 3H9NA 2YTYA 4JV5B 3AG2C 1EZ6A 1SQGA 3I56A 4DV7Q 2YXYA 3GTOH 4B3MQ 1WCMG 1V54B 2HQLA 3WY9A 4GX5A 4WBNB 4LF9O 4RD0A 2WPDG 3ZEDA 3I4NG 4JI3O 5IYCO 4YXWA 4DUYB 4GX0A 1I94Q 5LMUL 3OMGA 4LNQA 2JN9A 3T4DA 2CH7A 1L0XB 2Q7GA 1U4MA 3O13A 1OCOC 3E86A 3IKJA 3S24A 3P75A 5TV2A 3LDEA 1KHIA 4NR1A 3G7LA 3TS2A 1TWGH 4DAYB 5CGKA 2PGGA 1CQFA 1N0JA 2IY5B 3M3YB 5LMNO 1CUKA 4K8ZA 3RYHB 2AQ3B 2ALYB 5BN3A 3CPWA 1W34A 1NVPD 3S2HH 4DXFA 1JNYA 1J5EQ 4IT5A 4C2MB 2XTIA 5B6IA 2AHOA 2IU0A 4P2ZA 1STGA 4X6AH 2NVQH 3HOWB 2GSMB 1G6PA 2X6XA 3G6JB 4B3SB 1KK1A 2R93G 3H6MA 4JAAA 5JJJB 1EZ8A 3G71B 2CTPA 3VDYA 1MKHA 2VWJA 5JJIA 1UD4A 1SKVA 1L1OC 2XVSA 2K1BA 1NTZH 1X4TA 2P5ZX 3BA9A 4Z1VA 3CAMA 1R6TA 4DN4M 3H01A 4IPDA 1OB0A 3Q4HA 1M1KD 3G6EV 2AZ0A 4L5SA 3ASRA 4R4TA 4X66O 3DWPA 1W87A 4P73A 4ZCLA 1KAAA 1TVKB 3ZIAA 2UUCO 1UE6A 3CXCU 3A3BA 2PMDA 4XLCA 2Y0SG 4JI4Q 3SYCA 5JVDB 4A3GH 2EILC 3OD4A 5I2YA 3TP7A 1WORA 1I6HB 4NMZA 1I4RA 5D5PA 3I55B 3BDOA 1AI7A 1AE2A 4HIKA 1XREA 1V8QA 5ELCA 5EKKA 1QLEC 3MFYA 3MHHC 4NXML 4POGA 3KEWA 1CM9A 1F9RA 2Q2UA 1HHVA 2CDYA 1Z47A 5JPMC 1HZBA 4A93H 3E0EA 3HOXB 1ZLZA 1P7BA 2LMCB 3E22A 3W2GA 3OEEA 1XMOB 4YJ3B 4RD4A 2EIMC 4LH7A 1EP2B 4X1YB 4HNAB 2ZE5A 2CGOA 2XT9A 3X2QC 2HDMA 3U50C 1YLOA 2O4XA 3JQRA 3OFNG 2YICA 1YNJD 2F0FA 4B48A 5EC1C 3FRPB 4NKLA 1N07A 2YEVB 5A2QL 1PRTF 4MVUA 4ZCMA 1W2BA 4W4LA 1WYDA 1IBKL 3CHXA 4X0CA 5KEEA 1JJCB 4CH4A 4FXKC 1WTRA 4ZKCB 1JFFB 1N36O 1FJGO 4PC2A 3GIRA 4N23A 4ID6A 1GUSA 4LF9B 4TT3A 4KTAA 5LYJA 3QIAA 4JI3B 4IYIA 1TS3A 2MQHA 1R5BA 3G4SV 1FNDA 1I3QH 5JCOC 3GTJH 4PA7A 4BBRG 3ERSX 5L3GA 4RGMA 1S72V 3N6RA 5IE8A 2J4XA 2F0PA 2ODMA 5M3FG 4PABA 1GHKA 2F3IA 1NSNS 4NXMQ 3E89A 1KP2A 2Z3YA 1PZID 4JZGA 1SKQA 2JYOA 5LMNB 2F52A 4Q5VA 3VR5A 1ZL8A 2ZTDA 4JI2O 5E6TA 1S5ED 2HIXA 5KLVH 3MWYW 3I7FA 4ZK9B 2A6EC 5HGQA 2X53S 1KK0A 4DV3O 1EIHA 2VZLA 4I50A 2VNJA 4R8CA 5KX5B 4DR4B 2QGNA 1XNRL 3U9SA 5IT9L 1FXKC 1TS2A 3M4QA 5JH7A 2F0HA 4P9PA 5CV7A 1IBKQ 4UHVA 4B3RO 1HW7A 1GKFA 3BFRA 4DV5O 1WP6A 2ZIOA 4AF7A 1Q6IA 4M1KA 1VQLB 3NENA 2EFGA 4I5SA 1MZEA 1OO9B 4YEJA 5IY5B 3OMCA 4I0XB 1KNAA 1SMYD 2UU9L 1BO0A 4HJ8A 5E4XA 4QF4A 2WIIB 4KY6A 3JQQA 5JJKA 1QFYA 4IFDH 5FK9C 1ROPA 2UUCB 2FL4A 4OPOA 3VNVA 3FEWX 1OXSC 1EQQA 1DF4A 3A7AB 1K3RA 1BT8A 4BAYA 4XYQA 3SJZA 4YHHB 3FKIG 1V1OA 3FP9A 1COWA 4RDKA 2HQEA 3WB0A 3OYYA 4MVRA 2PE3A 1OCOB 1OXTA 4Q0FA 1MSHA 2E74B 4QGUA 3CXCB 2DERA 2PW5A 1AVMA 1UE1A 3FKSA 4N3GA 4DK3C 2K28A 2V7VA 1AJNA 4A3LH 2ZXOA 2Q4PA 2F4VL 4A3FB 3VR6A 4UP7A 3Q6QA 4XKWA 4PGOA 2A5HA 3BG3A 3K06A 3R66A 1YHQA 4JYYA 3JD2A 2ZXWC 1S5HC 1M57C 4DAYA 2I07B 4F8MA 4LF4O 4ZV4A 4LF8B 4C3JH 1N8RW 1ENVA 4JI0O 4CS4A 1MOFA 3HKZG 2JQOA 1FAFA 2L6LA 1WTHA 3RYHA 2F3VA 3HFZB 3TK1A 5A2QE 4O4IA 3OUFA 1HR0W 3VR4A 1GM7A 1SNCA 5EAYA 3SE0A 2UU9Q 3CC7V 4JI5O 3ASOB 4G57A 2WAQE 3OTFA 4LFCB 3H09A 1A3TA 3PGZA 2Q7HA 4O4LB 3FD9A 4B3FX 2D74A 3G71A 3HG9A 2KENA 4OXPA 5IDJA 1IKMA 2JP1A 2ZM6Q 3RZDB 1GH6A 2XOKA 2N88A 5FL7G 4CDEC 3E8GA 3PF4A 3PSIA 4UY8C 1R73A 3K80C 1WCMH 2GJKA 4C3IB 1QVFU 2F4VQ 2EILB 1J9OA 1AZQA 3A2FA 1XBLA 4Z4TA 4ZRZA 1GJRA 2RDFA 3IFDA 3I4NH 2HHHL 5K36G 1TVKA 4KHVA 5DLQE 1IXMA 4DV2L 5IT9c 3RYCB 4G5GA 4YAWA 1HWYA 4DV3B 1X65A 2E5LB 4G7WA 5JVDA 2WZNA 1SE2A 2BE5C 1Q86C 2LS01 3AYHB 3D3QA 1HDJA 2M6YA 3BVZA 3WYAA 3JD0A 3ZZTA 2EIJC 1Q3EA 4B3RB 2EIMB 1KTVA 3S1QH 4PI0A 1XL6A 4J1MA 4DV5B 1E1QG 1N33O 4DR7L 4A3KB 3W7XA 2R7ZH 4Z4YA 3DTUB 2CRVA 4JBKA 1ZYRD 4KHPL 2QW7A 4YJ3A 3BDLA 4YCWA 2AWNA 1EFRG 3VNUA 1CA5A 4X1YA 4HNAA 4M1UB 1SJHD 5CBGA 1A6XA 5C3WA 3HOVG 1KUQA 3G6EB 2M5SA 4G4KA 2RSNA 3ABTA 2WLLB 2B5OA 3TS0A 2F0IA 4B08A 4BIUA 2YEVA 5JAVA 2A8VA 5C4HA 1SBBB 1US6A 3W2HA 3OTOO 3A5UA 1D1KA 3E5SA 4IN3A 3J81L 3ZHSA 3SJAC 2EINB 1PRTB 1PH4A 3QO2A 1SFOH 2ZNIA 1JFFA 3S1RH 3J7ZC 1KQSU 1EU4A 4YIPA 3RNUA 2A68C 4DV2Q 5DSZA 3RBZA 4FLZA 2NYZD 2EXZA 3P26A 1VQ9B 3N2KB 4PQXA 5C4ZA 5FJ8G 3L72H 4ICGA 2JJQA 2DJFC 3UT5A 4DR7Q 5C4JB 1C8CA 4RJLA 2F4IA 2ZIMA 4KHPQ 4DR2L 4RD3A 3E6ZX 3GWOA 4JI6B 3KLRA 1F23A 1X32A 3ML0A 4J15A 1V1PA 4JI5B 2X85A 2ADPA 1KK3A 4PC1A 2O5JC 4FFBB 4CJ0B 4LBWA 1ILQA 3S3XA 4JMQA 4JAVA 5EBMC 5B1AB 2P3MA 3CX5F 2WP8J 5F4MA 1HZEA 4YAUA 3CE2A 3MMPA 3RLFA 2DETA 2JEXA 3OZWA 2MGSA 3W1GA 1BQEA 1TWCH 1IX9A 1VQLA 3SGIA 1S72B 4LF9Q 3SLNA 1JB3A 3SYOA 1WLEA 4JI3Q 4U3FH 3C3SA 2CBXA 1TU2B 1SQPH 3VYSA 4X66L 3T4AC 3V76A 4LF7B 1MI2A 1Q82C 2JSOA 1TUIA 1K8AC 1TWGB 3KZIZ 2NN6G 1ELOA 2IPKD 4O2BB 1X3GA 4BS9A 5LOVA 1D8LA 1QVFB 4MTFA 1NBWA 5C8YB 4JG2A 1EIFA 3ASQA 4BIOA 2QM8A 1HZCA 5IIFA 4OWWB 2RVLA 5IP9G 3Q6RA 4PDVA 4DU9A 3CC2V 3CXCA 4ASUA 1XL4A 3CP8A 3JAME 4DR1B 2RDGA 2FVGA 1HZ9A 4KFMA 2ZXWB 2ZXHA 3BC9A 3MA2B 1ICWA 4ZYSA 1RKNA 5JJZA 3RLNA 3CD6V 3AVUA 3DC5A 4CZZA 3C90A 4K2LA 1A2TA 4B3TL 2XRQD 3B82A 4DAVA 2ETNA 5IP7H 5LXTA 3JSNA 3J81c 4JK1C 4FDBA 3GTKH 3HKDB 4LFBO 1FNWA 4RM0A 1F2YA 3JALB 4A3MG 1ORQC 2XSCA 2OT2A 3NEMA 1ESRA 5CV8A 5IYDO 5I6YA 5T1GA 4ZI7A 4HTHA 3AEVA 3A8IA 4PDLA 1N36L 1FJGL 4P2CB 1VQOV 4X66Q 3VMFA 2M9VA 2WKDA 4NW2A 1L1OA 1W0KA 4O4LA 1CQVA 2JS3A 4L87A 4YXWG 2F0OA 1KMHA 4JASA 4GN5A 4TN1A 2QJ1A 4C1NI 5B1NA 2PZSA 1KQSB 2DWDC 3W7TA 4DYLA 3W2FA 3CEIA 1E1OA 2HDLA 4IJLA 4WZEA 3BDCA 4Y9RA 3OAAA 3ZZ0A 1GUOA 5FNZA 1YJ9V 2F95B 3FKIH 4FMTA 2QE7A 4I4TB 3L75H 2E1RA 1JJGA 3E9HA 2IJIA 4B3TQ 4JI2L 2IT1A 1I18A 4HCSA 1J8IA 4BBSG 3K8AA 3U10A 3EA6A 3HOUH 3HOYG 5H6QA 4TRDA 3CP1A 2CWPA 4A3DB 1R3IC 2PW7A 4A3BH 4RMFA 2QKCA 2VS1A 1WOCA 1TIID 3GTPB 2CW0C 2D3LA 1RTNA 4RA8A 3X3MA 4GS3A 2DJGC 2EYFA 1CXZB 1N36Q 1FJGQ 1D2EA 1MD2D 2DMXA 2PI2A 4R50A 3DWAA 3KL9A 4OHJA 4WORA 2CQAA 2SEBD 5IGEA 2E2DC 3H3VC 1G8ZD 2UXDL 1ZUQA 3LDCA 4GKKO 3G6EA 3GTJB 1FKAO 4UAIA 4A3IH 3MTSA 4RPDA 2LJ2A 2WLLA 1YJNB 2E76C 1EN6A 3SYQA 2O57A 4A4IA 1CP9A 3OZVA 4GOPC 2KOLA 5H59A 1GUWA 5KNDA 3VQXA 3DSQA 4MW3A 5JCOA 2YUAA 3IGAC 4YY3L 2DYRC 4GNXB 4JI2Q 1Y67A 2EQSA 2MK3A 4V190 4BA1I 5FNVB 3FX7A 5TSSA 4B44A 3BHPA 3CCEV 4DV3Q 4KKTA 1B4OA 4WZKA 2JA6B 2UXBO 3MXUA 3EFFK 4WFGA 4RQFA 1VQIA 4DK6C 5CR3A 3J7AV 1BHAA 3D6CA 3N2KA 4LBEC 5F4JA 1HFNA 4LFAL 2OTLV 1HPCA 4B3RQ 1D6EC 1BMFA 4F6RA 3AG1C 3D0FA 4DV5Q 1VQ7V 1EY7A 1XPRA 1GN3A 1L0LH 3KJPA 1FXKA 2JJ1G 1KIXA 1Y1WG 3ZMTA 1RD9D 1GO2A 2Q6IA 4WRDA 2WAQG 2QKSA 4LF5B 1YJWB 1QOHA 2VNUD 4E2LA 4NVPA 4TT3G 4FFBA 3W1BA 2RJZA 4Y7NB 2CH4W 4DV4O 3PO2B 1TVCA 2ZTNA 1N32O 1STYA 3G4SA 3VO2A 4K8XA 5KNBA 1MA1A 3OT7A 3TSSA 4I55B 1DOMA 2VQEO 2GJRA 1BCPC 1EYDA 5GTIZ 2OTJV 2ARHA 4PV1B 1BE3H 2YI8A 4FM0A 3ZHQA 2P90A 2NZHA 2Q2TA 3RYFB 5M5YB 4XXEA 1QJOA 5G3LD 4QVJA 3CPFA 1PL0A 1DDGA 1GJXA 3T1CA 1QUFA 1K73D 4LFAQ 3K0DA 5C8YA 3D26A 4BXXG 5GW7A 3PO3H 4LF4Q 1PTOH 4A76A 3PV0A 4JI0Q 3AVXA 3EHBB 4LUZA 3AFPA 4RCNA 2XGTA 1WOPA 2B8FA 2RMKB 1L0NH 1VDZA 4XIGS 1IBLB 3KF8A 3BY1A 1A8PA 1AEXA 3QG1A 1MG1A 1JB7A 3WQZA 1N33L 5EZYB 3GSIA 2B63B 5FLXN 3JAKB 1XHZA 4XN3A 1GO3E 2PI2E 2A6ED 3RN5A 1D2DA 5LBQA 5C4XB 1EWIA 2P4VA 4GZYC 1H2GA 3IAYA 2F0WA 5FLMH 3AG4B 2X0KA 1KC8D 1VF5C 4IUPA 4B7KA 4JYBA 1WTPA 1VEWA 1GTOA 3JALA 1EP1B 4X1KA 1JA0A 2GVAA 2N55A 3OTOL 1WCMB 4DV0L 3CCSB 4P9OA 1ZM3A 3DLLA 1A3VA 4FF4A 3QOLA 5LA6A 1COWG 3LSUA 3I4NB 2ZBVA 1NB0A 1FNMA 2BF4A 3OPOA 4NXNB 1EWHA 3FKSG 1PYWD 5K1XA 4H7BA 4WZTA 1IYJB 1JCHA 2UXBB 3D4WA 1KQSA 3CD6B 3NTIA 2GTSA 3UE1A 5IODA 4LF6B 4J42A 1PYBA 4IOCA 3JSLA 4DA2A 1EYAA 3U6KA 4FFKA 1Q8KA 2QGQA 2VUMH 1HNZB 1N33Q 4CQJA 4I4TA 1SQXH 3BEHA 3AMUA 1E2WA 3GVMA 1EYGA 2G9HD 2PYJA 4FLYA 4X89A 2DYSB 1QUQB 4C3HG 3J80i 1SERA 2XNAC 2EX3A 2PNHA 1G91A 5LHY1 1QUEA 2LFNA 2R93B 3CC7A 4LWCA 2CCZA 3J80N 1VQOB 1TWHH 5I2XA 1HXYD 3SYPA 1GM9A 3OTOQ 4DR5B 1N32B 4TWKA 2BCOA 3OJXA 1EFWA 3OGIB 4HR7B 4M2LA 3HKBB 4ZCKA 1NJID 3HEJA 4HJAA 1D5NA 5HKKA 4LAAA 2NN4A 3MEFA 3CW2C 1UWVA 3ICXA 1PD3A 3PF5A 4XYOA 2V7UA 4HJ7A 2JA5G 3ZUGA 2K32A 1YJ9B 3ASTA 1BDOA 1F9QA 1Y74A 2BVNA 2ZTEA 4GOPB 2Q2IA 5HZBA 4BY7H 1UE5A 4TV9B 3K9AA 2Y0SB 3SR1A 4DV6B 1HNXB 5C5LA 3L9DA 5TRDA 1KRTA 5GADC 1RPRA 1DD2A 2R9VA 1JMKC 2EYPA 1LT4D 2R9AA 5ELEA 2QTLA 4XD7A 4GNXA 4G7OC 4AYBE 3QNEA 2KSDA 2UUBB 2AQ1B 2F03A 3F1ZA 2VNKA 3AG1B 3S16H 1VLYA 5IYZB 3SDZA 2ICEC 1K8OA 2N49A 2KHJA 2QTZA 4P75A 4R4QA 3MXNB 3W2IA 1GK9A 1F9SA 4LFBL 1Z2GA 3B77A 5M3MG 3R6JA 3TP8A 1M90D 4IZ8A 3CCUB 1TY2A 1SYCA 2RCVA 1V1QA 4GKJL 1EL0A 1SYGA 1SSOA 3FB7C 5C3EH 4O2AB 3M7NA 1B9MA 5EBDA 1WNSA 3OW2A 3CMMA 3SR2C 1TKWB 1SJED 4TQFA 3L73H 1XYIA 1BCPB 2F66C 3ABKB 3TDQA 2OIGA 4Y52H 2JGDB 3CCEB 1NZ6A 1HFGA 1E7ZA 2F0EA 4BBRB 2EYOA 3NBHB 1CSPA 5M3FB 1PJ6A 2VRZA 1G7CA 5ELFA 2YS8A 4I55A 1E63A 1VQPV 4CC6A 2OTLB 2QTOA 1ZM2A 4WWVA 3RYFA 5EMNA 4IGGA 3O65A 1QWYA 2QM4A 1X9NA 5C0XG 2OCHA 2HIVA 1NS1A 1BGYH 4XLEA 3S9WA 4Z4SA 1N34B 2JEAI 1SMXA 4LFBQ 1HTLD 1WTWA 3EJIA 4MYTA 4LK1C 2B8GA 3W5HA 2EJFC 2K01A 3CCQB 4GKJQ 5IWAO 3RYIA 1VF5B 5EZYA 1H8HA 4WJWA 3SDLA 3JAKA 3CP0A 2A9HA 1BOSA 4YWKA 2ES2A 1SA0B 2K7VA 5NUCA 1R5OA 4GKKL 4ABNA 3L74H 4XDJA 2CE4A 3U6BA 1C7YA 1K4CC 2JA7G 4TQDA 4FIPC 2XNCA 1LTID 1WVLA 3PENA 3RVZA 3FKIB 3KYHC 2FHTA 4C56C 4P3IA 1K73W 2DY8A 4FJCC 2OYNA 1M9NA 1YHAA 5H5NA 4NB5A 3OMNB 4MVZA 2GTAA 3CC2A 4ASUG 5KMGA 5E1FA 2KJXA 5IYBH 4X62O 1EY8A 2BM1A 4D7SA 2X6BA 1HUNA 3CD6A 2C2AA 1Y0YA 4PAAA 4RKLA 2ASBA 1Q82D 2B29A 1K8AD 1B3QA 5DECA 1ZM9A 5JVG3 4BXXH 3I4MG 3HKZB 1CFMA 1KC8W 1RFYA 2MP1A 4P72A 3PIO3 3EIVA 4MW8A 2ZBUA 5IE9A 1M1KC 5I9OA 1I4PA 3M85A 1ENFA 3CMAV 1OB5A 3RW0A 3JCUZ 1KDAA 5M5WB 2K9PA 2X6YA 1TTTA 4GKKQ 1YTFD 2VZAA 3OMAB 1VQOA 1HUMA 1E3PA 2R7FA 1IBMO 1FNBA 4J7JA 3CCMV 1W0KG 3PUVA 4JI1B 5JEAJ 4PI2A 2Z0AA 4DV4L 4QUFA 3F5TA 4X88A 3WWVA 4R9WA 2FMMA 1GUGA 2QWQB 2PI5A 3HKBA 4BY1H 1EY0A 2RBMA 1BR9A 4W4KA 3QB3A 4YJ2A 5E1AC 2OEOA 3DGEA 2VQEL 5IOCA 5K5PA 1YJ9A 2K5HA 4EB6A 1N05A 4YHHL 1C0AA 1AMOA 5IGFA 1AR1B 2RC5A 4GOPA 3GV3A 1SE4A 4XLAA 1PNLA 5ITZB 1IVSA 1FD7D 4MHEA 4QE7A 1RSOA 1H2MA 2ZTCA 5L3CA 3UDFA 3SPHA 2DNEA 3I2ZA 1WJJA 3UQ8A 1X3FA 1SAPA 4RCOA 1VQAA 3FB8C 1M93A 3ZN1A 2ZL7A 4R1JA 1E22A 4DFAA 1XHXA 3I70A 3B8HA 1PA6A 3QFSA 5BN5A 1T5EA 1UD5A 4FM1A 5EC2C 3ZN0A 3ER0A 3M3YH 2N04A 1CT1D 2ZKOA 3BPZA 1SNPA 1NJIW 2BMWA 4AF6A 2Q6AA 3OWFA 1WU8A 3HOVB 2UXCL 4ZUIA 4C2MH 2HDNB 1SZXA 3K59A 1ZXTA 1M56C 4DV4Q 5AJ3L 3MXNA 4OX9O 3HOWH 1NTKH 3P3NA 1Z5WA 3NK9A 1KZLA 3AB9A 1SN8A 4B9XA 4DNIA 5BR8L 1K28D 2JIZA 3UDGA 2ZCEA 5I9PA 1EY9A 4ZIBA 3ZRVA 1QNUA 1AR4A 3GWKC 1D1NA 2VQEQ 1SNMA 1G2TA 2QMUA 3IRBA 1PZJD 1GOZA 4DKAC 4O2AA 3PJSK 2GVBA 2IL8A 4TMWA 1JWSD 2AQ2B 4QQBX 1I4GA 5LMUO 1EYCA 3BS1A 2KQXA 2BV3A 4X62B 1O7ZA 1THZA 3NHHA 3ZHTA 1B2RA 3CCEA 3FVQA 2G38A 1MMMA 3CRQA 4K5XA 4FNFA 3CC4V 2RC6A 2I0QA 1B53A 2WJYA 3LWUA 1WJZA 1STNA 4KUMA 4E6IA 1W3SA 1W35A 1VQ7A 1I6HH 1Q86W 1SESA 3W7UA 2JJ2G 1HR0B 5JBQA 1SMYC 1M90W 1PH5A 4O4HA 3DM3A 1STHA 1V0EA 4C43A 1B44D 2GDSA 3J81j 5AJ3Q 1Y1VG 2J7KA 3UE0A 3S15B 3ZPNA 4IHJA 3CPXA 3D3IA 3HOXH 1L2FA 2C5CA 5EIBD 3C3LA 3FB5C 3H94A 2N74A 3J81k 4RH6A 3NTHA 4HJ9A 1Y66A 5CA3A 1D7QA 1EY5A 2NNUA 2EJMA 1SKYB 5IJ9B 5CA0B 4HSVA 1BL8A 4D6TH 1VQPB 1DZ1A 4B3MB 1H95A 2OTJA 2F23A 5CV9A 2F0LA 1TVXA 3HRZC 4HIDA 2Y0PA 1MGSA 1PH8A 1IZ6A 2GREA 2B1IA 5J3OA 5IYCH 5C44G 1S4ZA 2LGWA 2ZNJA 3O9OA 4D7TA 5D14A 2Y0SE 2JRIA 3CU7A 3GTGB 4QY7A 1S0UA 1JVMA 3S14B 4AYBG 2JEBI 2FB5A 1GM5A 5KHIA 5LGTA 1K97A 4CJ2C 4P22A 4WFAV 3N27A 1AB3A 4R8NA 3HZXA 4DV1O 1J5EB 1Q7YD 2OK8A 2EBOA 2R3ZA 5FOBB 3THOA 2FX3A 3T16A 4X64O 3CCRV 1X3EA 2B7BA 2YC0A 2B2WC 2E2HB 1D8TA 4A3MB 3ZMZA 3MCAA 3OKXA 1CNEA 1UJWB 2CTRA 2ID0A 3CRZA 3I56B 5KAIZ 2RDHA 3TRZA 4CJ1B 5IY0A 1CK1A 4JCVE 1UD3A 3KCYA 1S3OA 4OELB 1LLRD 4IOAA 5D3IB 2JA8G 1TUBA 5LMUB 4RAIA 1VF6C 4M0LA 3CW2A 3SVMA 2CH7B 2W6JA 2GQFA 5H1SE 2BE3A 2JDIG 3QFTA 4G27B 1VCIA 1B2TA 5FL7A 1VS0A 2XRSD 4RGNA 4XTCS 4JI4B 2H3OA 2DY1A 1Q82W 2CF4A 1WPCA 1CSQA 1GVPA 1S5BD 1K8AW 1HH2P 2F4NA 3UDXA 3IFTA 3GP7A 1A32A 1KMIZ 4G7ZC 5JJEB 3E8FA 2N8NA 1AH9A 3E3XA 4X7FA 2GUZA 4BBSB 3KF6A 5HFMA 2CAZC 1IDSA 3CMAB 2EYJA 3HOYB 5EJWA 3WNDA 1XNRO 4ZAIA 1HCZA 3QVNA 4A3FH 2A1AA 4UP8A 1K8MA 3K03A 2EE1A 2VJIA 1R5NA 1BF4A 4YCVA 1MJEA 3CCMB 1EIGA 1E1QA 4JTCB 1U5KA 1X6OA 3BVMA 1QLNA 1P7GA 1SQFA 1GVHA 4DPGA 5IWAL 1TWFH 4ZGQB 1ILPA 3STZC 1D5MC 1U2RA 2UU9O 1FXVA 2ZE6A 3LDDA 5HGTA 1I7PA 1VJSA 4DUZL 5M9OA 4X3TA 2B5UA 3I73A 2X0LA 2RCFA 2PPBC 1YITV 2WB1G 1PVOA 2HJDA 4ZGNB 4XDLA 5KNCA 2Y69C 4RDJA 1BUVT 2JS5A 5HY6A 5LL6X 1JB9A 1EIYB 1AZPA 3GTQB 1WPBA 1FFXB 4WF9V 4HJ5A 1S5JA 2QEXA 4NXMB 1XFOA 4EQ5A 3TCUA 1PFMA 2K03A 1KD1C 3OMIB 1AP6A 5EQ0A 1QVGU 1EZJA 2WYRA 4C3IH 2DN9A 3GB7C 1S3JA 3CRKC 3HB3B 2F0MA 4O42A 5K1PA 4X7EA 5A8AA 2ZR2A 3C1EA 1OCRC 1JX9A 5L46A 5J35A 2K5VA 2KQ3A 2X6CA 3ABLC 3VQVA 1IBKB 5IWAQ 1R1BA 3Q3AA 4MTGA 3PUXA 1Y1WB 4IALA 1XQ8A 1T9HA 4JYAO 1V55C 2WAQB 5HFLA 4P12A 1S5CD 5J9PC 5J3BA 2CVRA 2FMCA 5IYDG 3WNCA 2CGNA 3PUMA 1DM0B 1NB9A 4DUZQ 2BSAA 3MZ5A 4A3KH 1T6YA 1PLFA 1Q12A 4H13B 2ZXPA 2OYQA 1IBML 4HEDA 1R3KC 4DQLA 5C5MA 1I4QA 1AP5A 4TUYB 4N3NA 2F0VA 5JVH3 2YXLA 4KK7A 1P4MA 1XNQO 2FXQA 5IJ9A 5CA0A 4X05A 1IYUA 1DG1G 1RODA 3PIPA 4K0KO 2Q8IB 3F2CA 2BA1A 3E8BA 5CB4A 1YI2V 2QSAA 3CC4B 3ASNC 4LC1A 3AGQA 1XUQA 3D36C 3RT3C 5IYNA 2XAJA 2HHHO 1OHHA 3I1FA 4JAUA 2ZE8A 3SLDA 4NKGB 3NELA 1AILA 5IJ0B 3A35A 4TSFG 4XQFA 4FK8A 4Z2WA 3GDEA 2G9DA 2P06A 4I50B 1XNRB 1NDHA 5GQOA 2JXMB 4QL5A 3M7MX 1SYEA 4PDMA 2K52A 2X7RB 1PH3A 3W2DA 5JH7B 2IJKA 3ERQA 3BAAA 3SYAA 3T1YO 3VQWA 2WV6D 3VA7A 4TV8B 5A2QN 4DR6L 4C7UA 2PY5A 4U68A 3ZRSA 2YU9B 1YEZA 3NWSA 1H2KA 5BXZA 2L5TA 4B3XA 1HNWL 2A73B 5C4JH 3ONYA 5LP6C 2BGJA 3FHWA 2UU9B 2EDGA 4UP9A 4XORA 1IBMQ 1Q90A 2L15A 1VQNV 5C4XG 5DM73 1HA3A 2L4NA 4QJFA 2YV5A 4OX9L 1UEAB 3MHSC 5JQGB 2VQFO 2KCCA 3OWEB 1SNQA 4YWMA 5CV4A 1G8MA 4WFN3 1S5LZ 1Q6UA 2ZM6B 1A62A 4AQYL 4Y7CA 4BW5A 2MNAA 2WA4A 3AK3A 1PTOC 2F4VB 1VQEA 2IX1A 1VQ4V 1WD1A 1IHZA 5J1ZA 4PZ6A 4J7ZA 2Q8RE 3WG7C 4X3SA 1YHQB 3OIQA 2A7WA 2LW7A 1Q7YW 3VO1A 1Q6HA 1QVGB 3KFUA 4DR6Q 1ENAA 4DR2O 1HNWQ 3ULPA 4C3HB 4O4IB 2CTWA 1VQ6V 1I5XA 4OGQB 3AGPA 4RAUC 4DW0A 4JI8L 2D2CB 1NU1H 3CMAA 1FGUA 3QO7A 5L3EA 1P49A 3K7UC 1SDFA 2A06H 1WDTA 4C1NK 2F0KA 4OX9Q 1IL2A 3S17H 5KA6A 3U4VA 4DK0A 3B4SA 3CCMA 1EWYA 4UXNA 4F87A 3CYOA 3ZX6A 2X6LA 2B2UC 1I5FA 2PQEA 2GK6A 2CQOA 1FDRA 2JA5B 4IUUA 1B06A 2WSSA 1CKNA 3OJWA 4A3EG 5LMUQ 1Q90D 4DGZA 2Y69B 4OPSA 5KHGA 3QF7A 4JF3A 4QE9A 2WR8A 1H38A 4RFBA 3L3OC 4IPHA 2OQKA 4DV2B 3CJHA 1K9MD 3VYUA 4YAFA 3HR0A 3SPIA 3V7AA 3A5ZB 4FF3A 1LR1A 2QDXA 5ELOA 3CS5A 1K83B 1FFXA 2BA0A 2H8PC 5L3BA 5GAEC 4MVOA 1O9GA 3K0GA 3A8TA 2ZL5A 1GO3F 4DXGA 4DR7B 1I4XA 4JI8Q 5FLXc 4KHPB 1XOUA 1TY0A 4MS2A 1LNQA 4B3TO 3ABLB 1U4PA 2ZDIA 4B7EA 4IFDI 4DV1L 3A54A 2Q0AA 3W7SA 1DTOA 1V55B 2XASA 1V0FA 1YHBA 3BNWA 1H42A 1B23P 3E8HA 3JAWB 4HSPA 2EZPA 2F43G 5M3MB 4X64L 3TP6A 3HOZG 5CV5A 4U673 4A3DH 2JJ1A 2HP8A 1YITB 2JIZG 1FFTB 4H44B 4KL1A 3GTPH 1RIPA 2L9HA 2VNHA 3GVKA 4J9ZB 1MBYA 3FYEB 2Z0SA 5BZBA 1QZHA 1XI1A 4B4DA 4OWXB 5JJLA 1JWUD 5GV8A 1XMQO 5AN9A 2Q9LA 4KJNA 4LBVA 4LP8A 1K73C 4A3JB 2OK7A 3PUYA 5DM6V 3G80A 1JC7A 2ZQMA 3MDSA 1EQTA 2K14A 4EX5A 2OIEA 2R92G 4FXDA 4TUYA 4OO1G 2VXWA 1GAXA 2PZUA 1R6NA 3JAMi 1L1FA 2BOCC 1QGAA 1N0UA 3UDIA 2KA7A 1JR0D 4F88A 5CBFA 2KG7B 3JAMN 1W0JG 2YIBD 1SE3A 3CC4A 3GVJA 3UT5B 4MIUA 3CCLV 3OEHG 1PFBA 3ZRWB 4DR2B 2KBNA 3OR7C 2DCUA 3CCJV 3KLSA 3KUPA 3I4LA 5IJ0A 3DXRA 4DV1Q 1JA1A 4NTWA 2L0CA 2F0TA 3J80c 1V1PB 4G1BA 1KC8C 3FDTA 2ZT9C 4CBCA 1S76D 4KY7A 5EBLC 2JA6H 4X64Q 1WTOA 5KUMA 1IB0A 1GN4A 3CMEV 1QFZA 1RHPA 1X3QA 3Q39A 2I5HA 3KG2A 1DJRD 3CF5A 2PUSA 2QWRB 1JJ2U 4TV8A 4JZ2A 1PH6A 1AW7A 1WOOA 1EWCA 1IJEA 4X07A 1PFNA 1FRNA 1E62A 2UUAL 2B2WA 2UXDO 3BQJA 1JWMD 3AG2B 4R6ZA 5TY0A 1YI2B 3UO2A 2Z4IA 4GX2A 2C78A 2D9UA 4X66B 2XAHA 5J2TB 1L0YB 4XL9A 2PI4A 4XLHA 2JA7B 2M00A 5JQGA 2WLHA 1ET9A 4Y7NH 3CRAA 2VBSA 1B9NA 4AI8A 5LOVB 2B39A 2EY5A 2I46A 1ESFA 5KW9A 3PO2H 3RN4A 3PA2A 4G6IA 2LFSA 1UE7A 4QNHB 4YY3O 1VQ8V 1YF2A 4LR3A 4R4IA 4HIZA 5KHHA 4LBYA 3WG7B 1BNZA 1NCVA 1WP8A 1H9SB 4CBVA 4LUVA 2CTQA 4RKBA 5KSWB 5M5YH 4B3TB 1XNRQ 1P84F 3I5DA 3NUCA 1VQGA 1KRHA 1QR9A 1FNVA 1K34A 3U4ZA 4JPRA 1KLUD 4LFAO 2K75A 5LXTB 3CHBD 4EEQA 5GROA 3I4MB 2JE6I 1QVGA 1RF2D 2LY7A 1VQNB 1SC5B 4MTNA 3OM3B 2EXDA 3CCRA 1NJIC 1Q1EA 4X1IA 1TWFB 5M5XB 2UUAQ 1EFID 4WCEV 2OXPA 3SK6A 1S5DD 4CDCC 2Q69A 4JYAL 1N36B 1FJGB 1Z9FA 3E0JA 1KL9A 4O4JA 3KDFA 4ZI7B 3H1IH 2C4TA 4EGVA 3S1NB 4JI7L 4X20A 1VQJA 1MZFA 1L1OB 2B63H 1OCZC 1CQXA 5HURA 2CH4A 2C2WA 2N3SA 3G48A 1GUNA 5EYPB 2XWBB 1RP3B 4DO2A 2P6JA 3U0ZA 4O2DA 3OR6C 4RHRA 5C4XH 1VQ4B 3HGBA 2W6JG 4PC6A 3LUTB 4DR3O 1JPXA 4FM2A 1XNQL 4ABMA 2WLJA 3VQYA 1PNKA 4K0KL 3HPLC 1ZAUA 2BM0A 4TMXA 3K6OA 1FPOA 2OWOA 4JI2B 2WLIA 3SPGA 1U96A 2XIWA 3G6BA 2HFEC 4QIWE 2WLMA 1FVIA 1QLEB 1CPYA 3A3GA 3RGBA 4PNYA 1LT3D 3EQLC 1NR1A 1VQKV 4DNTB 3HS0C 4EFEA 1SYBA 1M90C 4AILC 5IT9E 1RQPA 1ZTEA 2CC2A 3PQIA 3TEHB 3X2QB 3T1YL 4JYAQ 3U11A 4L6TB 1BVSA 3ABMC 4EH1A 2AWOA 3VR2A 3Q24A 2C5HA 4XNFA 4U3JB 1YZ6A 2DOSA 4GX1A 4XQNA 1JJ2B 3U58A 3RZOB 3EXAA 3F7VC 2UXDB 1FNCA 1UEBA 1FXHA 1NAPA 5B1BC 5THXA 5D5QA 1M1KW 1PV0A 2CW5A 3JAWA 4KY5A 2R93H 4BWGB 1FS0G 1PP9H 3ETGA 3F8TA 2NVXB 1XNQQ 2M7WA 4DV0O 1YITA 4ZBMA 3CCVV 2VQFL 5F2DA 1WN7A 4K0KQ 4A3GG 4QGPA 4UVCA 1VQDA 3H3VH 1O9HA 3T1HL 4YY3B 2DW4A 5FKAC 3FPUB 1PMRA 2HHHQ 2QKIC 3SJPA 2FMLA 1OJHA 1T6XA 1Q3LA 4PG3A 3PUWA 3M4OB 3NXSA 4A93G 2R70A 1Y8PB 1W6KA 5ISRA 2VNIA 2RHSB 3D36A 1ZUNB 4N8FA 1LTAD 1HP8A 4IFDJ 4LFAB 3I90A 1MSGA 3IC9A 3C2PA 2KG7A 4K2KA 1D1IA 3T1YQ 4LF4B 1VQCA 4F6RB 4JI0B 4KXRA 3I55V 2NBFA 4YELA 2BOSA 1E3ZA 3ZRWA 3K7AH 4X65L 4NTXA 1YVCA 1FXKB 4N21A 4ZOLB 2BOBC 1I5YA 3ONAB 1KD1D 1KKDA 1Y1VB 4XR6A 2NPFA 2QDBA 1UPGA 2ZINA 3WU2Z 4NBSA 2YWFA 2HKOA 5JOBA 3AG7A 3K9SA 2VQFQ 2RDCA 2VS0A 3G4SB 1V43A 2TSSA 3T1HQ 2V1CC 1ZEQX 1BQ0A 4JV5O 4ME3A 2H4OA 2EY2A 2YTXA 1FL0A 2NZ1D 1YI2A 4RCZA 2EIXA 3WB2A 5J2TA 2EIKC 3T2MA 4CHTB 4B47A 4FLXA 2W0FC 1OHHG 3CCJB 3Q6SA 4DUYO 2MUYA 5C44B 3ULLA 5EK0A 4UB8Z 4KKUA 1QE6A 1M4UA 5KUKA 4OO1H 4P26A 2K5DA 1L0WA 4BBRH 4AYBB 2Z6KC 1KDCA 1R4PB 2YWEA 2I5LX 1IXRA 3CMEB 4X65Q 5M3FH 4DR2Q 1II3A 1H9SA 4EQPA 3KF8B 1M57B 3AG3C 2W6IA 1N33B 2PYKA 3N52A 3I3CA 4CKEA 1AJQA 5J39A 4XOPA 3A8JA 1FYCA 2Y48A 3S17B 4QCLA 3TJTA 2NWGA 2XZPA 2DE0X 3OP1A 1I50H 1V9PA 3RMHA 4HYOA 4JW0A 4B3SO 4TVAB 1VQNA 1ZSPA 3ZCCA 4N9PA 4Z4WA 4X1KB 4ZQ3A 3OW2U 1MIUA 2F0SA 3OTOB 2K04A 4GKJO 4L8JA 3J81E 2EY6A 5KHKA 4QV2A 3TETA 1JA8A 5EKLA 1GRJA 5LA6B 4CDFC 1VQ8B 2P67A 2JA8B 1XMQL 4DV7L 1CZGA 1G51A 5F4OA 2B2UA 4NNJA 2BH2A 2EZOA 1G4YB 2V7TA 2CUGA 4K35A 4B3ML 4A3LG 5EYPA 2F0NA 1W9XA 4PA3A 3TGUH 1VQ4A 1HQMC 1KRSA 3B09A 3K5LA 1I94L 5E4WC 3KCXA 4G1VA 4FN5A 3ZMUA 1DOLA 1DLBA 2FYUH 2VBVA 3CQZB 1SETA 5L3FA 1VHEA 1SS3A 1PXUA 1Z6HA 4C3JG 4RO2A 2BTOA 1NQTA 3M8AA 3JYCA 3E35A 3D31A 3K5OA 3WXMA 2EIJB 1PH9A 1PL4A 2QGGA 1VQ6A 3H1LH 1PTOD 2BH8A 3CC7B 4GN4B 2Z1CA 2MPMA 1N0VC 2IH3C 1XMOO 4MN3A 2Q67A 3WFVA 1SQVH 2A69D 2ZR3A 3F2BA 1NH2B 2HVJC 4BR6A 1A63A 4GLVB 1N8RD 3KOJA 5LGNA 4KD3A 4L63B 2AZ2A 4ACBA 4MNOA 1JR9A 2O5IC 2D5DA 5IY5C 1E1TA 4YCUA 4MVMA 4U3JA 1XMQQ 2Z5UA 3MVVA 1JJ2A 3Q23A 1HJPA 1HA6A 1Y74B 2WSSG 3V2TA 4GLXA 1FRQA 3P20A 5CN0A 4WFHA 4P71A 5M5WH 1KU9A 2WB1B 4TQUS 4GUNA 5E3FA 5FPOA 4BIZA 1DGSA 2E74C 1URFA 1WTVA 3BCFA 2F1LA 1VQKB 2BCCH 2IX0A 1U0LA 1I08A 4S3SA 4JI4L 3B40A 4LWSB 5KA5A 3S2DH 1EQRA 2R7ZG 2XAFA 4ZHQA 2MHVA 4HBNA 4JBWA 5EIBC 2VB2X 1MABA 5K36H 4CS2A 4KV6A 3A8JE 3DWQA 2NVTB 1F7YA 2BTQB 1RQRA 1BLIA 4KN4C 3RN2A 2A79B 2AW9A 4DR4O 2RN9A 2QDOA 1DF5A 4LFBB 4DXWA 1H2NA 3TMEA 1VHOA 4MSWC 3FPPA 4MZ9A 3ISXA 2IW3A 3AK1A 2JJ2A 1PV4A 4G7XA 1STEA 4RUEA 4GKJB 1YSCA 3CCVB 4ZOLA 3U9OA 3ASOC 3TN2A 1PHJA 3MXGA 2ZZQA 2UXDQ 2RQ6A 3A1PA 3A55A 2ZZEA 3W3AA 3OW2B 4PMCA 2GA4B 4BWAA 1BCPF 3SJQC 5EPLA 1VQHA 3RD4A 5CBEE 3HOVH 1BHBA 5H2FZ 3ZHRA 1RCVD 1H9RA 2NN6I 2C5BA 2A6HD 2Z6BD 5CYUA 3J7AF 4DR3L 2EIKB 2YSUB 3M9BA 4YY3Q 3QE2A 1N4CA 4H9GA 4P6VF 2ZITA 4YHHO 4XDKA 1CHQD 2SDFA 1QNKA 1E1RG 1JOYA 2Q6KA 3QOJA 3OE7A 3CCLA 1E79A 1JE5A 4KP4A 1Q7YC 4E0FA 1VP7A 2A19A 1ET6A 4B3GA 2EPBA 2D3OW 3CCJA 1VF7A 3LO8A 4QB4A 4QMGA 1XPOA 5GONA 1SM4A 4J0QA 1KD1W 4IUQA 3AG3B 1ZX3A 1YTFB 4RUFA 1VQ9V 1VQMV 3CMEA 4X3KA 5FJ8H 2F0DA 4LF8O 2DOGA 4XT3B 1EBOA 3FMCA 4FK5C 2CHBD 1BKBA 3RYIB 2HJFC 1HTPA 1TS5A 4CC5A 4JPBW 2EJRA 3STBD 4HCEA 1Q5OA 2B1GA 2IJJA 4XN0A 2UXCO 3LGJA 4UFZA 3JQPA 2XN9C 3H91A 4FLUA 1IXBA 1EXMA 3CSXA 4GKKB 3URYA 1NRKA 2R6GA 1QQCA 3SK8A 5BR8O 2K33A 3LNMB 1IW7D 3S15H 4DR3Q 3U2QA 4LFCO 1MJCA 3T4ZA 2KUMA 3I91A 4M8AA 3QO8A 2EINC 1PRTC 2R72A 4XBFA 2AGAA 4NPSA 2WAMA 2YYZA 2RHQB 3TQYA 1WTXA 1VQ8A 3L71H 3CC2B 3BABA 1TLLA 3P3PA 5DAUA 2HVKC 5KMGB 3MEHA 2KB1A 4GCZA 3J7AU 2B2TC 3LSSA 2JDIA 1QCEA 3AEIA 4HE5A 3GTMB 5DEHA 1SR3A 1WOSA 1VMGA 5IP7G 3RR5A 1CKMA 4JGSA 2NN6H 1TXYA 3ZMSA 2E5LO 1H2SB 2UXXA 1G6ZA 5FO7B 1TQOA 1U4LA 1H9JA 2QA4V 2X6GA 5IP9H 2YXHA 4XQJA 2R9IA 3EROA 4X06A 3P32A 3GTGH 1LUVA 4Z1MA 2Q6OA 3S14H 2LGQA 3NTKA 1K0RA 2ATWA 4HAMA 2SOBA 1JE4A 1WD0A 4P1VA 1F51A 1YNXA 3QWNA 2MO0A 4JBJA 4IL6Z 2JK5C 1STBA 5B1AC 2NUCA 4DQKA 4A5UB 4A3CG 2V7XA 3B78A 1TWAB 4GT1A 4WQMA 1B6QA 3AK2A 4A75A 2IX3A 1FNUA 3AVTA 4DV4B 4K3AA 3TP5A 4DV0Q 4FZ0A 4Q20A 4UZFA 2VW9A 2E2HH 1E64A 4A3MH 2E76B 2KCTA 1ONLA 2VQEB 4JV5L 1KYOF 4A3EB 4YJ2B 1BSMA 3A0BZ 3PN1A 2RSOA 1F4NA 1Z7TA 4FLTA 4IQZA 4EB6B 2ZM6L 5A9GA 4WBNA 3G67A 1VIBA 1LACA 2A74C 4MTKA 3ZYYX 1ML0D 1RSOB 2QWPB 2XWJB 2HCJB 2DYRB 2O2LD 2R6HA 4X7CA 1OXUA 2C4UA 1LTTD 4PZ7A 4DUYL 1AI5A 4N9TA 2LP7A 3HOUG 3JD1A 3L0OA 4RGTA 2ZL6A 1N06A 1P16A 3BZKA 1TT2A 2BDNA 3TXQA 2QEXV 3K7AB 5JWPA 3TZDA 4A3BG 1VQKA 1KXLA 3AU7A 2D3NA 2DY7A 4NYKA 5CDFA 4CH3A 3E9IA 4LWSA 2SNSA 1BBXC 3MAQA 1LTLA 2PO4A 2B2VC 1DONA 2WWWA 3UI2A 2UXCB 1PZKD 4JI6O 4BBSH 4U7OA 1LABA 1RJTA 2BTQA 3B2EE 4A3IG 4ZKBB 3IL8A 2PYLA 3HOYH 4P30A 3HOZB 4P6YA 5BR8B 1S4MA 2XZLA 4B3SL 4K5VA 4PDRA 4FF1A 5FO9B 4KN7C 4JV5Q 1JJOA 5A35A 3ZHUA 1E2ZA 3CCVA 3NBIA 5LGUA 1GUTA 3OSOA 1PYSB 5T1IA 5GV7A 4LNUB 1NY4A 1M4VA 1BQQT 2ITDC 1C9OA 3KJOA 4POFA 1Q81C 4ODGA 5CMUA 3NQIA 4DUYQ 4A3JG 2R92B 2X69A 5A89A 2B2YC 1XB2A 3RVYA 3BH4A 1KDBA 1YJNV 4JOIC 2AHYA 1XE1A 1YNND 4LF7O 2HD3A 3CRMA 1S0VA 2NTTA 1A0IA 2L12A 2D0OA 2R7DA 1XEQA 4I9QA 2V7WA 3BCDA 2H5XA 2K50A 4FWTA 4J6HA 3KLSX 1YXBA 3JAML 3I55A 1IJFA 1VQ7B 3F2UA 3GTQH 1FR3A 4TSFA 4YAOA 4DR1O 2Z6KA 3HKSA 1I50B 4KD4A 4M53A 4UCTA 4O4HB 2AUJD 1A2UA 3ZHVA 2E2JB 4Z4VA 2HUGA 2X8KA 2EY1A 1LTBD 1BXTA 4IHJB 3QJYA 4B3SQ 3MFGA 4IPGA 3ASSA 4RD6A 1D5ZC 3K58A 5KYLA 1XMOL 3NP8A 4UB6Z 3B6YA 4FF2A 1QX4A 4Z9CB 3QFRA 1GHJA 3FB6C 3MHPA 1WFQA 1WTHD 1BQZA 2Z9HA 3C46A 4O1NA 2F0UA 1QGZA 1BZKA 4LMQD 3PA1A 1IKLA 2DJVA 2K5NA 1IL8A 1Y6XA 4CH6A 2Q6LA 3ZC3A 4P2NA 3W2EA 1Y1WH 2OTJB 2K1EA 3G05A 4DUZO 2EOTA 1YJWV 2OCEA 1AR5A 1H85A 4LF9L 3P30A 2WLNA 1VQBA 3OUSA 2FFKB 4JI3L 4UV8A 1JCKB 1HA5A 2PZTA 2WB1E 2A3QA 5E79Z 3PO3G 3PMFA 4ALPA 4GNXC 3VYRA 4II2A 3ZJYC 1U97A 1QHTA 4UCOA 1AP0A 1VQMB 4YWLA 3B8NA 4UVBA 5CC4A 4IJHA 3I72A 1NBMG 3T56B 4J11A 2HG5C 3SPJA 3GQBA 2KEEA 2W6IG 2RA4A 2RCNA 5LMNL 4EQOA 1PNMA 4G7HC 2QTSA 2XTAA 1JQYD 3SHLA 1XMOQ 1IURA 1M8AA 1O7LA 5KX5A 2BSKB 3S1MB 2LZJA 5FLMG 5BN4A 3OGCC 4DR4L 1PPJH 4BW9A 3CTAA 3VA5A 1BS3A 4TMZA 1STAA 3EBEA 2GJPA 5B3SC 1AROP 4DAPA 1TGOA 1KKCA 1K28A 3VBBA 1EY6A 1SLJA 3GTOB 3H0GG 3BYTB 1Q1BA 1W59A 1BPLA 2KCNA 4EFBA 5CMDA 2C77A 2F1MA 2YU9H 4RQEA 2EVBA 3ULJA 3UCSC 1K9MC 1TUBB 5CA1B 4I0XA 2VY3A 4WFFA 1UUPA 3SK4A 3ETDA 3PUZA 4XDXA 3H1KH 4OOSA 4TMVA 3JAMc 4PV1C 2UUCL 2OQ0A 2HR3A 3CCSV 3S2DB 4JTDB 1EFUA 1QFJA 1S5FD 5IGGA 3WBJA 2VUMG 2XGJA 2QA4B 5LMNQ 3S2HB 1CTMA 2QN6A 3AFQA 1J9ZA 5DN6A 2GUZB 3KF6B 4HE6A 4X3UA 2NVQB 4TMTA 5DM63 3AVVA 4DR4Q 4Y9UA 4HIMA 4KI0A 4O0AA 1LT6D 3VYTA 2E2IH 1HVXA 1ZKOA 4DR6O 2XUMA 3B8MA 1CKOA 3IC7A 5LMZA 2N05A 1KK2A 4LF8L 1ZWIC 5IWAB 1HNWO 1QILA 2XNDA 2B7CA 1QG0A 1VARA 1Y76B 4RLZA 1V5VA 2QKAA 1K0SA 2PNRC 3NPPA 4C3HH 4LH6A 4J80A 3AG4C 2TMPA 4K8IA 4LF5O 4OIKA 4DUZB 4FZ1A 2ZJQA 2IWHA 2F43A 1EFCA 2YDEA 4BY7G 3R2TA 3TZUA 4A3CH 4TKOB 4F7DA 1NTMH 4KJOA 2UUCQ 4LFCL 1GD7A 5LHIA 4A3GB 5KRUA 5IK2A 3QSYA 3APOA 2DEUA 3ZBHA 4YHHQ 4AQYO 1PKVA 2QCPX 1F9PA 1LUWA 4LNUA 2QEXB 3M7GA 2BPOA 4BA2I 1RM1C 2Q0OC 2JA5H 2RNBA 1YIJV 5C0XI 2MW2B 1YX2A 4A93B 2V4DA 4PD4F 1NMGA 1PH1A 4P25A 2HLDA 4KHZA 5ELBA 2JA9A 5EBCA 3DM1A 5JEAG 2EJGC 3RYCA 1MABG 1R4QB 3FAVB 1H9KA 2R61A 1W0JA 5FPRA 3Q38A 2E8GA 5CV6A 4DV3L 2FJ2A 1O7IA 2E5LL 2Q68A 4M4SA 4YALA 3OEHA 4LF8Q 1GN2A 2DWEC 2MFIA 2DYSC 2LKVA 1K83H 3JASB 2IJHA 2PF4E 2NLJC 4B3RL 4JI8O 1IBLO 2UXCQ 3TBIB 1O80A 1GXDC 4DV5L 4PA9A 1DARA 5C3EG 3LVBA 4X8AA 5BR8Q 2LQTA 1IBMB 4LFCQ 2OBTA 1C4QA 1VQ5V 1WA8B 3SXHA 1I3QB 2LXKA 1DK1A 4UZUA 4DW1A 4FP5D 3Q0AA 1JORA 5FO8B 3P27A 5M3MH 3ZIAG 4MTOA 3A7LA 2E1BA 3HKEB 1PJ7A 2Q8TA 3CCUV 4QIWF 1ICFB 2ZJPA 5CB4B 4ULLA 1O7YA 5DEDA 3QFCA 1N0NA 3OE7G 3PIOA 4K1XA 1E79G 4XM3A 2JN4A 1U4RA 1NVPB 4NXNO 4QHYA 4OIJA 4RWUA 1Q46A 4OXSA 4A3JH 2XEXA 4JYCA 4IPCA 3V05A 2E5LQ 2B2TA 2XAQA 1DDIA 4LF6O 4ZCIA 2D0PA 3OEEG 3OHXC 1VQ9A 1NI8A 5GAHC 1VQMA 4DR6B 4XT1B 5JPNC 1K33A 1F2LA 4LF4L 2JEUA 1HNZO 1HNWB 4JI0L 4J41A 4XKVA 2V7QA 2UXNA 4XLFA 5B3SB 5C0XH 1G7TA 4PMWA 1PM9A 1K7DA 1D5XC 4JI6L 2BSKA 1EN5A 4JI5L 4OX9B 4QJFB 1R3LC 3A8IE 5BMVB 1Q8IA 3ICEA 1EZVH 4GQNA 2Z8LA 3ZRXA 2ZD9A 2K05A 3SJBC 1UMKA 4DR5O 3CCQV 4JVZA 3WDNA 4RD1A 3ND9A 5AFWA 1KB9F 4EKWA 5BY1A 3OOCA 2KVOA 4AQYB 2PQAB 3AVYA 4Z4ZA 1S72A 3E83A 5HZAA 3ABKC 5CA1A 1QCBD 3GVLA 1QVCA 4J8QA 5IYBG 4GYCB 3D4RA 3K81C 4KMUC 1AE3A 2PMZB 4FYDA 1F77A 2FTKA 4BPRA 3DMUA 3HKCB 1WSVA 1NUCA 4NTYA 4DV6O 1HNXO 4LF7L 2ADQB 2JA7H 1JT8A 2KCMA 1EEFD 4O2BA 4EVOA 4C3JB 1PRTD 2GHYA 1QVFA 1KTKA 4OOXA 1OCCC 2QWOB 1WPXA 3TREA 5C3XA 2QA4A 1AIPA 3WOFA 1LO5D 3CP2A 3BJUA 1JQ0A 1WSRA 3HAGA 1K4DC 3KBGA 3J7YW 3JC66 4Z1MG 1XTCD 1TR5A 4QFMA 4DR1L 4JI8B 3MD0A 4P74A 2D62A 4F4LA 3PCOB 1F20A 4JI6Q 2UUBO 4J9YB 3ETQA 1R6KA 1G7SA 3IJ4A 4JI5Q 2NZOA 4CGYB 2ZZGA 1BX0A 2B2VA 3A0HZ 4U9UA 3K0YA 2VBUA 5L3DA 2LO1A 4OPVA 3I4MH 5KHJA 3HKDA 2KHSA 3OZUA 2WA3A 2X6WA 1M56B 4RGOS 4AIMA 3WNBA 3MXPA 1E3XA 2UUAO 4HZ3A 4IIJB 4BY1G 4OPAA 1XWEA 1K3BC 3SK5A 1X56A 1Y76A 1J6QA 2BGIA 4DNRB 5M5XH 4IUNA 3H0GH 3R65A 1CKNB 3H9VA 1Y0RA 2VJJA 2EJ7A 2G5DA 1F2MA 3S1NH 2IW5A 3CJHB 3QR8A 3F2DA 3K79A 4LF7Q 1KBHA 1AI6A 5KNLA 1UAPA 4CDDC 1RM1B 3JD4A 4FLWA 1QB5D 3R3OA 1X55A 4OEMB 4WFEA 5H6RA 2B2YA 3APQA 2Q7EA 3EN2A 4JOIA 3H15A 4R71A 3S1QB 1SZTA 2B3GA 2YWGA 2IHEA 1SNOA 5IGBA 4DR1Q 1H2LA 2R7ZB 3ZZUA 3CRRA 2EYHA 5LMNW 1SEBD 2KHIA 4B9WA 1GN6A 1NNXA 3GD7A 2PLFA 1E43A 2OCCC 4DV1B 2AMCB 2PTMA 3FAVA 3H1HH 3K0XA 4OPHA 4RHSA 1ASZA 1N34O 2OF1A 4X64B 3HOWG 3M4PA 1GM8A 2IU3A 1AFPA 3NSWA 1P8LA 2P7TC 1WB8A 5LL6Y 3JASA 1SFOB 1ASYA 3S1RB 1EY4A 1PH2A 4JI7O 4NB3A 3QTCA 4H02A 3D6WA 4ACAA 1QU7A 2XOKG 3VOUA 3BRCA 1SYFA 4QUZA 5ELNA 5I4DA 4PC7A 2Y4UA 5IYQA 2DUDA 1L8DA 5D3DA 3RZOH 3WOEA 1YIJB 1WA8A 3QO5A 5C0XJ 3K3WA 2ENBA 4LCUC 3W5VA 1TS4A 1YJNA 2GK7A 3BVGA 1FD9A 2YI9A 3RLOA 1OV9A 2ATKC 3HKEA 2NVXH 1N9WA 3X3NA 4IYHA 2PIAA 4FO2A 2GV9A 1UNSA 4QIWB 4FVMA 3FFQA 4FXGC 3JARB 2DYIA 1X54A 1K5QA 2F0JA 5IGCA 4CKCA 3DXRB 2IJ0A 2DGYA 4DAMA 1W6JA 5FNVA 1OTCA 1Q81D 2KKWA 1G291 2Q73A 2HMAA 2M2LA 3M4OH 2E75C 2EZVA 3HOXG 4NDXA 4GN3B 4F6EA 1RDPD 4MT8A 2SNMA 5JEAH 2AXTZ 1D2BA 1OB2A 1VQ5B 4JC0A 2EYLA 4X7DA 4II3A 1TWCB 2BE5D 1Q86D 3K04A 3TXSA 2UUAB 1NR2A 5DNFA 2HCCA 1CNFA 2L35A 1QGYA 1CZWA 1NT2B 5FLXL 2R9RB 2C9OA 3SPCA 1R3JC 1Y1VH 3AQQA 5C93A 1YJWA 2VB3X 4LF5L 5FIUA 1SQQH 4UZEA 3EVKA 1KJZA 1XJVA 2WKCA 1NH2D 2Y0IA 2WJVA 5BMVA 1PTOF 1K92A 1U9RA 5IYCG 4R8IA 4JI1O 3T1HO 4HMIA 2KECA 1G6UA 1DOKA 2FINB 4ZLTF 1SNDA 1DCZA 1EOTA 2PQAA 1LT5D 2GPJA 2K6AA 2NVYH 4G28B 1UFIA 3A0JA 4WJ4A 2RF4A 3SJCC 3KK7A 4AH6A 4WFBV 5FO1A 1OCCB 2VYQA 4UDUC 2Z4HA 1EN4A 3HKCA 4R4CA 2A69C 3BVOA 2E2IB 3Q22A 2A68D 1B04A 1N8RC 4DF7A 3GTKB 2ZTGA 4IUVA 5C44H 2X6AA 5IT9N 4NP5A 3NXWA 1UD8A 1XQBA 5D65A 2OT5A 3I8ZA 3CCRB 2CK3A 4OWTB 2YIAA 2KEDA 1X3PA 5B1OA 4X1IB 3E1YE 4X65O 1SE8A 3PVDA 2I1LA 4JYAB 3NQTA 5LL6S 4P3YA 5BSXA 5FA6A 4O4JB 1A15A 3KDFB 1OXVA 1JMCA 1IBLL 4JI7B 2VL6A 1YBYA 3A8KA 4X20B 4LF5Q 1LTRD 5COYA 2XAGA 1VMPA 3N2GB 4UV9A 1H8EA 3J80L 3GTLH 2XHBA 1GKHA 5KIXA 1YDXA 3D8CA 1YCIA 1G2SA 5J22A 2QILA 1LM0A 3EFXD 2I5MX 1I7FA 2IH1C 3D3RA 2C35B 1Y14B 1TAEA 1XNQB 4IIJA 4AQYQ 3I56V 2W0XA 1F4MA 4K0KB 2YIDA 3CCSA 3PUNA 3ZBUA 2YIBA 3UM7A 2NB0A 2WPDA 2HHHB 2WLIB 3ND8A 2JA8H 5DN6G 3HP3A 2H94A 5IYPA 1I4HA 3SKBA 2BN4A 3HOUB 1HQRD 3OW7A 4NXNL 1XDCA 1A3UA 4A3FG 4A3BB 2UXBL 1XILA 2L55A 4I9WA 4LF6L 2JVDA 2OCCB 4GLAC 5BSYA 2JK8A 1Y8NB 2IM9A 2HT1A 3T1YB 1R9TH 1AI4A 4XQQA 4P9SA 2AUKA 2CKZB 3CQZH 4AVZA 4FPPA 1IBLQ 4Z4RA 1OCRB 1G7RA 2ICIA 4CH5A 1NKDA 1HNZL 2XNDG 3S3WA 1JOKA 3CESA 1HR0O 5LHHA 3F7YC 1QUQA 1I6VC 2QR4A 2DQ3A 4A3IB 1OZ0A 2QF7A 4DRXB 2A6HC 5G3LF 5FLXE 3C1FA 2P5OA 1FGBD 1WI5A 1OGIA 4RG1A 1AJPA 2IHFA 1FX0A 4PHZA 4XOTA 2VQFB 2P4KA 4RPBA 4HIOA 5TISZ 1Y4MA 3SEBA 5CBHA 4WJ3M 3T1HB 4DR5L 1N32L 2QM7A 4L5RC 4DV7O 4FLVA 4L5TA 2J0TD 5IYRA 3OAAG 4B3MO 4IUTA 1SRYA 5IYWA 4NXNQ 1QG7A 1YIJA 1XTDA 4TSSA 3JCZA 4IW3B 2QE7G 3ASNB 3JD3A 4C3IG 4V0BA 2N78A 2HLDG 1QNMA 2EIFA 2UXBQ 1CI3M 1I94O 4TV9A 2PMZE 3RUZA 3AVWA 4LF6Q 2ILMA 4YIOA 4PJ0Z 4MTXA 4CKBA 4GZRB 4DV6L 1HNXL 2Y4TA 1ENCA 1YNJC 3L9AX 1QR8A 1E1RA 4MVSA 1JOQA 1RL2A 1HZAA 4NCNA 3STBC 4X65B 4MVQA 1HNZQ 2E75B 2WACA 3JARA 1BX1A 3ETEA 3BY2A 1EU3A 5EPKA 1RTOA 2AKWB 5LHGA 3LQEA 1FYJA 5DS0A 3BZDB 3CRLC 2AHZA 5HXBA 1Y69U 2UUBL 2P22C 2F93B 1IW7C 4A3KG 5GTHZ 3JATB 1DXMA 1T5XD 5IYZA 5KAFZ 1J5EO 4G2KA 3A8KE 5LP6B 5EBWC 3OFNA 3J81i 2NVTH 1T6ZA 1D5AA 1VQ5A 4H0LC 5I6WA 3J80E 4DR5Q 4RDLA 1N32Q 4HN7A 3J81N 2K5WA 5EKIA 4OP7A 4L5QA 1O78A 2ZZFA 3CXHF 1K5SA 2CW0D 4ME5A 3CCUA 3CKIB 5EGTA 1IHMA 1NR7A 5IYDH 3DUZA 1KAWA 2EULA 1SYDA 3VR3A 2MJ8A 3D4DA 4KKSA 2H1EA 2ZXRA 1I8DA 1OXXK 1KABA 3DHQA 1M5IA 3EVQA 4DV6Q 4F7XA 5J2UB 1HNXQ 3L2PA 1VF6A 2DNCA 2JGDA 3PO3B 4QVAA 3A0RA 1PTOB 3GV6A 1BJKA 1VLOA 1Q81W 1B1ZA 1J95A 3NBHA 2CNDA 2VBTA 3ITPA 2QWNB 4JI4O 3CPWU 2FKXA 1WP7A 3D8GA 3DEOA 2OTLA 1XPUA 4AHCA 4R4OA 3C3TA 1BMFG 4TOIA 2K5QA 1QH0A 2ZDIC 2Q2HA 2UUBQ 1IYVA 1CA6A 1TA8A 1F2ZA 3K5NA 2RKSA 1LYLA 4ILWA 1UD6A 2V7QG 2BDOA 3MHBA 4J10A 1DYQA 5F2VO 3A56A 1UD2A 3FYIB 3W5OA 2WLKA 3BYYB 4N8X1 4OOVA 1GR1A 1SXTA 1WAZA 1N34L 1AN8A 2D9RA 1A8VA 4YIJA 1PFSA 2L1BA 3H3VI 2JGUA 1EM1A 4RCYA 2Q5ZA 4LW1A 3H0GB 1CHPD 1QZGA 2L11A 2LW1A 3CCQA 4UCUA 2LFRA 4X9QA 4I7ZC 4H33A 4H13C 2LSSA 4DK1A 1XMQB 1NTGA 4DV7B 3R8BA 4HMJA 1X59A 2CFMA 3RWRD 4OL7A 3R2IA 4QPJA 4APVA 1YVWA 2IBZH 3JU4A 3N2GA 1SA0A 3ZJZA 4FXUA 1EOVA 2OBRA 4ZUJA 4PC3A 2HCIA 1YZBA 1KLGD 5CORA 4K8JA 1I94B 4J7KA 3ZBTA 4JTAB 4ROXA 1WB7A 3LWEA 4UPAA 2CWAA 3KLWA 2VUMB 3SEJA 1F60A 1LTSD 3Q8DA 2OBSA 5IGDA 1H9MA 1Z5VA 3CB2A 3IFXA 4NXMO 3ES9A 3WBKA 1TUEB 3T53B 1BCPD 1NMFA 4I65A 4EQNA 1VQ6B 4ZKIA 2QEJC 1IZ3A 1TWHB 5H5JA 4H37A 2DQ0A 3CWBH 1N34Q 2V1DA
chains in the Genus database with same CATH topology
1A2UA 2E2JB 1D6EC 1BMFA 2HUGA 4C3HB 4F6RA 3PIP3 4O4IB 2X8KA 2EY1A 4PMBA 1LTBD 1BXTA 4IHJB 1EY7A 3QJYA 4RAUC 3MFGA 1D5ZC 3K58A 5KYLA 3NP8A 3R93A 1P49A 4FF2A 1SDFA 4Z9CB 1RD9D 1GHJA 4C1NK 4WRDA 2F0KA 2KVMA 4LF5B 1WTHD 1VMCA 4DK0A 3C46A 4O1NA 1QOHA 2VNUD 2F0UA 1JOOA 3NWTA 3K5MA 4NVPA 4RWSC 1B3AA 4FFBA 4LMQD 2RJZA 4F87A 4Y7NB 1IKLA 1B50A 1HRJA 4K14A 4DRXA 1IL8A 4CH6A 4BY7B 1NR4A 1YNNC 2X6LA 2XZOA 3PO2B 2B2UC 2EYMA 2E3CA 2ZTNA 2PQEA 2GK6A 1LV9A 1STYA 3G05A 4OO1I 1EQVA 2EOTA 5JJNB 4K8XA 1XXGA 2JA5B 1WTQA 4IUUA 5KNBA 2WSSA 1E0BA 4Q6GA 4UCVA 1PDQA 3TSSA 4DGZA 4I55B 5KHGA 3QF7A 1DOMA 2FFKB 1LTGD 2GJRA 1BCPC 3QG5A 1EYDA 4RFBA 3L3OC 2YI8A 4FM0A 1JCKB 1HA5A 4DV2B 2PZTA 3VYUA 3RYFB 5M5YB 3PMFA 4XXEA 1QJOA 5G3LD 3VYRA 4II2A 1QHTA 3BA8A 4UCOA 4FF3A 1GJXA 1AP0A 3S16B 1ZYRC 2F0GA 4ZHQB 5CC4A 1K83B 1FFXA 5ITZA 3I72A 2BA0A 5C8YA 3T56B 3GQBA 2KEEA 2RA4A 1PTOH 1O9GA 4EQOA 3PV0A 4G7HC 3GO5A 4DXGA 4DR7B 1I4XA 1Q43A 1JQYD 2PCFB 3SHLA 1KNEA 4RCNA 1M8AA 5C6AA 2B8FA 4KHPB 1TY0A 3DDYA 1VDZA 4XIGS 1O7LA 1IBLB 3KF8A 5KX5A 3S1MB 1AEXA 1U4PA 3QG1A 4UCRA 2LZJA 5BN4A 4IFDI 4OGQC 3WQZA 4K6DA 5EZYB 3A54A 2Q0AA 2VWKA 4BW9A 2D2CC 3VA5A 2B63B 4LJZC 3JAKB 1STAA 2GJPA 1V0FA 4DAPA 1TGOA 1XHZA 5C3EB 4XN3A 2A6ED 3JAWB 1EY6A 3GTOB 4HSPA 5M3MB 5C4XB 3BYTB 3TP6A 5CV5A 3JATA 1EFRA 1Q1BA 1BPLA 4GZYC 2KCNA 4EFBA 4U673 3IAYA 1Y8OB 2F0WA 5CMDA 1VF5C 4IUPA 2JJ1A 2F1MA 4KL1A 3P7JA 5LP6A 1WTPA 2L9HA 2EVBA 3GVKA 1MBYA 5EPJA 1TUBB 3JALA 3P1HA 4X1KA 5CA1B 2N55A 1XI1A 2F3WA 4DR3B 1JWUD 1WCMB 2NVYB 3OIPA 1UUPA 1A3VA 3SK4A 4KJNA 4FF4A 3WB1A 4A3JB 3QOLA 5LA6A 1EEID 1YEWA 3PUYA 3PUZA 4XDXA 3I4NB 1JC7A 3LX0A 1EQTA 4PV1C 1JICA 4K5WA 4FXDA 3OPOA 4TUYA 3MC0B 4OO1G 4NXNB 1EWHA 1PYWD 2VXWA 3V96A 3S2DB 2PZUA 5K1XA 4H7BA 1S5FD 5IGGA 2KA7A 2UXBB 2XGJA 3D4WA 1JR0D 4F88A 3RFRA 3NTIA 3K57A 5IODA 3S2HB 4LF6B 1CTMA 5GONB 2YIBD 5DN6A 5J2UA 1SE3A 3GVJA 3UT5B 5KGUA 4MIUA 3JSLA 4DA2A 3E22B 4X3UA 1PFBA 1EYAA 2NVQB 4DR2B 5DM63 4UCSA 3T13A 3KLSA 3ZS8C 3KUPA 3I4LA 5IJ0A 1HNZB 2DN8A 2L0CA 4I4TA 2F0TA 4KI0A 5ELDA 1NBMA 3AMUA 1E2WA 1V1PB 3M4YA 1LT6D 2PYJA 2G9HD 3FDTA 3VYTA 1HVXA 2ZT9C 4FLYA 1ZKOA 4KY7A 4C3HG 2WINB 2XNAC 1WTOA 2EX3A 1G91A 1X3QA 1RHPA 5LHY1 2LFNA 2R93B 5IWAB 1DJRD 3GTLB 1QILA 2PUSA 2XNDA 4TV8A 4IURA 1C48A 1AW7A 5I2XA 1EWCA 1HXYD 2PNRC 3NPPA 4CS3A 5LYJB 4IFDG 4LH6A 1PFNA 4DR5B 2TMPA 3DEPA 1N32B 4K8IA 2BCOA 4H44C 2B2WA 4OIKA 4DUZB 4HR7B 2IWHA 2F43A 3HKBB 1JWMD 4DV0B 3HEJA 3R2TA 2Z4IA 3TZUA 5HKKA 4LAAA 4TKOB 2D9UA 4X66B 4KJOA 3ICXA 5J2TB 4XYOA 1L0YB 4A3GB 2K32A 4XL9A 1BDOA 5KRUA 4XLHA 4QUCA 1F9QA 2JA7B 5IK2A 2M00A 5JQGA 1ET9A 3T51B 2HEPA 1B9NA 1PKVA 5LOVB 2QCPX 2B39A 2J7ZA 1F9PA 2NTSA 2F0QA 2V31A 2EY5A 4LNUA 4TV9B 3M7GA 2I46A 4K6LA 1ESFA 5CBAE 4BA2I 2Y0SB 3SR1A 4G6IA 4DV6B 1HNXB 1E2VA 5C5LA 4LR3A 3L7ZC 3LNNA 4HIZA 5C0XI 5KHHA 5KYIA 4A93B 2V4DA 1BNZA 2RQXA 1NCVA 2HLDA 4KHZA 5ELBA 1R9TB 1H9SB 1DD2A 2R9VA 1JMKC 2EYPA 3DXJC 1LT4D 4CBVA 2R9AA 5EBCA 5ELEA 4XD7A 3DM1A 5JEAG 2EJGC 3RYCA 1R4QB 4G7OC 1H9KA 2DIEA 4RKBA 2R61A 4B3TB 1W0JA 5FPRA 3NUCA 5CV6A 2FJ2A 2UUBB 4XONA 1FNVA 2AQ1B 2F03A 3OEHA 1KLUD 5LXTB 3CHBD 4EEQA 3I4MB 2JE6I 1VLYA 5IYZB 1RF2D 2LY7A 3SDZA 2WZPP 2LKVA 2ICEC 1K8OA 3JASB 3NE5B 2ZXIA 1Q1EA 4X1IA 4XMYA 1TWFB 3TBIB 1O80A 1GXDC 5M5XB 1EFID 4HAEA 2OXPA 3SK6A 1F9SA 1S5DD 1XX8A 1N36B 1FJGB 3E0JA 4O4JA 4ZI7B 3TP8A 4EGVA 3S1NB 3KBXA 1IBMB 4BY1B 2PZWA 4IZ8A 4X20A 1C4QA 1TY2A 3SXHA 1SYCA 1I3QB 4UZUA 4FP5D 4JV5B 3Q0AA 1EL0A 1JORA 1SYGA 5HURA 1EZ6A 1SQGA 1SSOA 5FO8B 1GUNA 4O2AB 5EYPB 3M7NA 1B9MA 2XWBB 5EBDA 1WNSA 3U0ZA 3CMMA 3SR2C 3A7LA 4RHRA 1TKWB 2E1BA 3HGBA 1SJED 3HKEB 4TQFA 2Q8TA 1XYIA 4WBNB 1BCPB 5CB4B 4FM2A 2F66C 3TDQA 4ULLA 3ZEDA 1O7YA 1HFGA 2F0EA 4YXWA 4BBRB 4DUYB 2EYOA 3VQYA 3OMGA 5M3FB 1L0XB 5ELFA 2Q7GA 1ZAUA 4XM3A 1U4MA 1U4RA 3O13A 3IKJA 4I55A 3K6OA 4CC6A 3P75A 4OIJA 2OWOA 4JI2B 2XIWA 3V05A 3G7LA 2B2TA 3RYFA 5CGKA 2PGGA 1CQFA 3A3GA 1QWYA 2QM4A 3OHXC 3RGBA 3M3YB 4PNYA 5C0XG 4K8ZA 1LT3D 4DR6B 3RYHB 2AQ3B 4XT1B 5JPNC 3EQLC 4XLEA 4DNTB 3S9WA 5BN3A 3HS0C 4EFEA 1SYBA 4DXFA 4AILC 1F2LA 1N34B 1HNWB 5IT9E 4C2MB 2JEAI 1HTLD 1STGA 4XKVA 2V7QA 1WTWA 3EJIA 3U11A 4XLFA 3HOWB 2X6XA 3G6JB 5C0XH 4B3SB 4L6TB 4LK1C 4PMWA 3VR2A 2AWOA 3Q24A 3H6MA 4XNFA 2B8GA 2EJFC 1D5XC 4U3JB 2K01A 4XQNA 5JJJB 3RZOB 1EZ8A 2UXDB 3RYIA 4OX9B 5EZYA 1H8HA 4WJWA 1NAPA 2VWJA 3A8IE 5BMVB 1Q8IA 3JAKA 4GQNA 2Z8LA 5D5QA 1UD4A 1SKVA 2XVSA 2K05A 3SJBC 2K1BA 1BOSA 3JAWA 4KY5A 1SA0B 1X4TA 3WDNA 4BWGB 3ND9A 3BA9A 2K7VA 5NUCA 5AFWA 2NVXB 4DN4M 3OOCA 4ABNA 2KVOA 4AQYB 1OB0A 5F2DA 1WN7A 4TQDA 1O9HA 5CA1A 1LTID 1QCBD 4YY3B 3DWPA 1WVLA 3GVLA 4J8QA 4GYCB 3FKIB 3D4RA 1KAAA 1TVKB 2FHTA 5FKAC 4C56C 3ZIAA 3FPUB 4KMUC 2PMZB 4FYDA 1PMRA 1F77A 3A3BA 2QKIC 2DY8A 4XLCA 3DMUA 3HKCB 1Q3LA 5JVDB 1NUCA 3PUWA 3M4OB 5I2YA 3TP7A 5KMGA 5E1FA 1I6HB 1EEFD 2R70A 4O2BA 4NMZA 1I4RA 1Y8PB 5D5PA 4EVOA 1W6KA 4C3JB 1PRTD 2KJXA 3BDOA 5ISRA 1LTAD 1KTKA 1V8QA 5ELCA 5EKKA 1EY8A 3MFYA 4IFDJ 4LFAB 3KEWA 4D7SA 1CM9A 5C3XA 3I90A 1HUNA 3WOFA 1MSGA 3C2PA 1LO5D 3CP2A 1F9RA 4K2KA 1HHVA 3HAGA 1D1IA 3KBGA 3J7YW 1Z47A 4LF4B 5JPMC 4RKLA 4F6RB 4JI0B 1XTCD 1TR5A 2NBFA 4YELA 3HOXB 4JI8B 2LMCB 5JVG3 2BOSA 3E22A 1E3ZA 2D62A 3OEEA 1XMOB 4YJ3B 3HKZB 4LH7A 4X1YB 4HNAB 3ETQA 1CFMA 2HDMA 4ZOLB 2MP1A 2O4XA 3ONAB 3PIO3 4CGYB 1Y1VB 4XR6A 2ZZGA 2B2VA 1YNJD 2F0FA 2QDBA 5I9OA 1I4PA 3FRPB 2ZINA 1ENFA 4NKLA 3M85A 3K0YA 5A2QL 1PRTF 5KHJA 3HKDA 1KDAA 2KHSA 5M5WB 2X6YA 3CHXA 5KEEA 2X6WA 4CH4A 4FXKC 4RGOS 5JOBA 1WTRA 3MXPA 4ZKCB 1E3XA 1JFFB 4IIJB 1HUMA 1XWEA 3SK5A 4ID6A 1GUSA 4DNRB 1V43A 4LF9B 4TT3A 2TSSA 4IUNA 1ZEQX 4KTAA 3PUVA 5LYJA 4JI1B 5JEAJ 4PI2A 3QIAA 4JI3B 4QUFA 2H4OA 2EY2A 2VJJA 4R9WA 1TS3A 2FMMA 1F2MA 1GUGA 3HKBA 2NZ1D 1EY0A 2RBMA 1BR9A 5JCOC 5KNLA 1UAPA 3QB3A 3WB2A 4YJ2A 5J2TA 2OEOA 5IOCA 5K5PA 4RGMA