2V4MA

The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
352
structure length
352
Chain Sequence
KGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Isomerase Domain of Human Gfpt1 in Complex with Fructose 6-Phosphate
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE [ISOMERIZ
total genus 133
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2v4mA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2v4mA02
2UXDB 4OX9B 3Q88A 3Q7IA 1ZZGA 4B3MB 2VQEB 2UXBB 2J6HA 3T1HB 2O2CA 4AQYB 2UXCB 1VI6A 4NXMB 1IBMB 4DV5B 5A2QA 4LF5B 1C7QA 1X94A 2UUCB 3KNZA 1U0FA 3TBFA 1TZBA 1JXAA 1Q50A 4EM6A 4B3SB 1HNWB 1VIMA 3JAMA 1XMOB 2PUVA 2VF5X 1NUHA 4DUYB 4DV0B 2CB0A 4JI5B 3BCHA 1X9HA 2CXOA 4S1WA 2V4MA 2CXRA 5I01A 4NXNB 1KOJA 4GKKB 4X65B 1XNRB 1GZVA 3G68A 1IBLB 2F4VB 4DR6B 4JI6B 4KHPB 2CXPA 5LMNB 4LF9B 2HHHB 4S12A 1XMQB 1XNQB 4GKJB 2UU9B 2CVPA 1N36B 4AMVA 1GZDA 1MOQA 4X62B 2X3YA 4DV4B 4DR3B 1JEOA 5BY2A 3M5PA 2DECA 1N8TA 4JI1B 3TRJA 2VF4X 1I94B 4TOIA 4YY3B 1VIVA 4K0KB 2I2WA 1M3SA 1MOSA 1WIWA 2DF8A 2O2DA 1VI5A 2CXSA 1NRIA 2POCA 4DV1B 1XTBA 3OTOB 4JYAB 1N32B 3IFSA 2A3NA 1TK9A 1HR0B 4LFBB 4X66B 3JX9A 2PUWA 3HBAA 2E5LB 2CXUA 1X92A 4JI2B 1J5XA 2VQFB 4JI8B 4JI4B 2CXQA 3I0ZA 3LJKA 3C3JA 3HJBA 1HOXA 3CVJA 2CXNA 3FXAA 2CXTA 4DR7B 4LFCB 4DR4B 1J5EB 4B3RB 4JI0B 1JLHA 3J7AC 1JIQA 3OOJA 1HM5A 1N34B 4U6NA 4JI3B 1C7RA 1B0ZA 4LF7B 3QKIA 3FJ1A 4DV2B 2UUAB 2XHZA 1FJGB 4DV7B 4DR5B 3FKJA 4IVNA 1HNXB 4LFAB 4DUZB 3BJZA 5IWAB 3ETNA 4LF4B 2XBLA 2UUBB 3EUAA 4DR2B 3PR3A 2ZM6B 4YHHB 4JV5B 1U0GA 2I22A 3UJHA 5LL6P 4DV3B 4LF6B 5BR8B 1N33B 1U0EA 2Q8NA 2YVAA 4LZJA 3SHOA 3J80A 2PGIA 2E5FA 1X9IA 3NBUA 4M0DA 4DR1B 4LF8B 1G98A 3J81A 4B3TB 5IT9A 1IRIA 1MORA 3T1YB 4X64B 2ZJ4A 3ODPA 1IATA 5LMUB 2AMLA 2WU8A 3FF1A 5FLXA 2ZJ3A 4DV6B 1IBKB 4JI7B 1DQRA 2PUTA 1T10A 1HNZB 1TZCA
chains in the Genus database with same CATH superfamily
1O89A 3A1FA 5LCXA 3L8MA 4FFVA 4UBNA 1VSQA 2O5EA 1GKIA 1XTJA 2FWIA 3DWGA 2PD4A 4EJSB 2BR5A 2F1HA 4ZI3A 1NR5A 1M2OB 3OPNA 4L4UA 2XCOA 4Z9YA 4AJHA 3LZCA 2NUPB 1IVSA 1NXTA 2LCFA 3N0VA 4MGHA 2IPAB 1GCIA 2OORA 2ZT8A 3RC1A 2J33A 2EW1A 4H4CA 3ABOB 4RYDA 1XTTA 2QMYA 1X39A 2KW5A 1FPMA 4EG5A 3BE6A 1FTWA 4UZSA 4MW2A 5E4YA 2OTCA 4YMUA 1DARA 2H0RA 2XWPA 3KVOA 4FS8A 5ALKA 4KZKA 3NTUA 4DG9A 1QTQA 1C9EA 3GLIA 1X19A 4RLHA 2A0XA 3S7TA 2RE8A 4Q24A 1FXUA 3GJ4A 3IGFA 4V0ME 1WQ1R 4AJ9A 2BMFA 4NK4A 3G68A 2Q1SA 2GFIA 5T57A 1NA5A 1Z4OA 3KYIB 4IMRA 4REOA 5EKSA 3OEYA 1M83A 2GCIA 2Y1CA 5GVSA 2GZ3A 2Y77A 3T95A 1OH6A 3KXIA 1QRRA 3MTIA 4RJ2A 5J3JA 3I72A 5C8DA 1XROA 4ABTA 4MYTA 1JEAA 1HZJA 1FSZA 1H0SA 2JAXA 3DTYA 3C43A 5HMLA 5IXJA 5EPUA 1RRGA 1RABA 1Y8AA 5DSZA 5ALXA 1DC7A 4L2IA 1RZRA 2W37A 4IWXA 1K27A 2H16A 3AUSA 1YASA 2ZRKA 4RL6A 2IZ0A 3R7DA 3GDHA 1P7YA 1XHLA 4GUDA 1P72A 1BTOA 3NTVA 4RMHA 1RHRA 1JHQA 1UZMA 1ZJZA 2O2DA 2P4QA 2WD9A 3O83A 3DH0A 2ZUVA 4PV7A 4XX1A 4EYOA 3A2KA 1G64A 1QM5A 1V35A 4QM6A 3CH5A 3FPSA 3ET4A 3G8AA 1WZNA 5JTTA 3KPWA 1KBQA 2A6PA 1BFKA 1I9GA 1G4AE 2VDWB 1X1SA 5DLEA 1JDUA 4E2XA 5FAKA 1J07A 2IZ6A 2ZRAA 1XD9A 2OZKA 1JSZA 4B40A 3BAFA 1AK9A 5K8LA 1YAJA 2Q0QA 1KBZA 3LDUA 2JIMA 3EARA 5H0IA 4ITUA 1FDVA 3I9LA 1N5DA 4IIYA 2O3SA 2D59A 4L15A 5FBKA 1E18A 2EXXA 5F35A 1Z7GA 1FUUA 2CL6X 2JHPA 3QEOA 1B76A 2QP3A 2UYHA 2G71A 4ECAA 4HQ6A 4BO6A 1PJCA 3K9HA 3G9TA 2XTNA 1ZMXA 3NDBB 3E61A 5KQSA 2B1GA 2YS7A 2NPOA 5F3DA 4B83A 3K6SA 1GL6A 4KH1A 5J9FA 1PX2A 1D6SA 2E6UX 1IJBA 3PV0A 5REQB 4KOEC 3BT7A 4EB3A 1XZIA 3UMBA 2C57A 2I7CA 1YS2X 5B37A 4E15A 4P7JA 2JJ1A 5JJCA 3CLHA 3U9TA 3QBEA 3TTXA 4MNTA 4CT4B 2X8JB 4NAUA 1MORA 3UNXA 4DNOA 3U61B 3ZNPA 1T9BA 1TM4E 1UFRA 2QSUA 4E08A 4Q02A 1IBKB 4CF5A 1ZOIA 2RCYA 1Z5NA 3TR5A 2AMVA 3N0WA 4N0DA 3VZBA 1Q3TA 4UCWA 4LJ4A 1CR1A 5TQ2B 3A6LA 3M1YA 2YH2A 3CC8A 3HKBB 4FBMA 4H16A 1H0RA 1R6AA 1ZRMA 1GITA 1XN4A 4X6UA 4EFDA 3ZDBA 2ISSD 2FU5C 3DO6A 1KU6A 1Z0FA 3VDMA 3JQFC 4NYJR 3T6KA 3U6KA 2YZKA 3NBXX 2L19A 3U37A 1RMYA 2CD9A 2C58A 1Y1TA 3A9UA 4BX0A 4KNWA 3TE7A 1BEUB 3FVQA 9GPBA 2OT3B 2R5NA 2K87A 2ZTMA 3NOXA 5EKDA 4N7MA 2PUVA 4D8WA 1YKSA 1I36A 2HCBA 5A1TA 2VHQA 1UINA 4ZJUA 3GNTA 5TIIA 1G7TA 2QV0A 4JB3A 3A4YA 5F5XA 5JHHB 3EIEA 5K8CA 2H2FA 3JVEA 3V6MA 1Z2EA 1AUXA 3HYRA 3F78A 4XVCA 4MJ3A 1I0ZA 4OFXA 4M0EA 4D26A 3ZDYB 3T3GA 1GLGA 1EQUA 2QVBA 3A7EA 1Y4SA 3LPCA 3QPBA 3NHYA 1KI4A 4AJ4A 2Z4SA 2GCNA 1TA4A 1EX7A 4GOLD 5AH0A 5H81A 3T7EA 1E1DA 5HZHA 2RIPA 4P84A 2YHSA 4BP1A 3NHRA 2QJWA 1VKHA 5DI3B 1QV7A 4ENQA 2H18A 2UVQA 3IIMA 4J7AA 2PLFA 2GHQA 1V8BA 2O0KA 3MCTA 3SHWA 2A1TS 2RJNA 4JEMA 2HI0A 1UK9A 2G25A 4RMGA 2G1UA 2HPVA 2QQ0A 2P8SA 4ZVLA 3L82B 1J39A 1W5AA 5AXAA 1G2QA 2DJIA 2POQX 1L7XA 2Y05A 1F2DA 3PHHA 2RHMA 4MDHA 2DWUA 4NPCA 2O54A 1QFMA 1RJ9A 2E6KA 4FJ1A 3CF4A 2AZTA 4QU0A 1V7PC 2W11A 3U0VA 1AX9A 1PD1A 1XN1A 1J33A 3UJBA 3HACA 5M3BA 1PFKA 1PQWA 3B1KA 3FFXA 4KIWA 5DM60 4DC0A 3H5TA 5IT0A 1S0UA 3WMFA 1E60A 1L5NA 2WDZA 2DBVO 1VHJA 5K8UA 4WINA 5I4BA 2ADMA 1UC9A 1Z2NX 1BJTA 2JA1A 1NUSA 2F00A 3CLSD 4PZPA 1KE1A 3G02A 5JDCA 4R9UC 1QHGA 3IS3A 4DXDA 2W8ZA 2VNHA 1GQ2A 1D7OA 3LS2A 5TX7A 2WIKA 2QTHA 3W8FA 1N6NA 4B0OA 1L4GA 4NBKA 4DNXA 1E9FA 4GBED 3ROQA 3W3AH 1ACLA 1KKMA 4NQRA 1UDXA 2QVGA 2FCRA 1S8FA 3HWX1 5DDIP 3RYIA 1QWOA 4N3BA 1UR5A 5AP9A 1U0GA 2XMSA 3N2GA 4YIKA 3PGXA 4I3HA 1P77A 2BHTA 2CL5A 1F17A 2QSYA 2WFLA 3ONNA 3DE1X 4LOAA 4YR7A 1QQBA 1UM8A 3DEAA 3OT4A 6PFKA 2OAEA 4IHKA 2BGNA 3C4QA 1GA4A 4CQLB 4CQNA 4LDZA 2NV6A 3U48A 2CCKA 2D5AA 2L18A 4B3TB 2O1SA 1LK5A 2CKDA 1DEXA 1F1BA 4BB9A 3C6BA 5DNVA 1U3GA 2I80A 3ANNA 1E2PA 3JQGB 2MSWA 4ZFNA 4X8LA 3KQKA 1RQ7A 1ZISA 2C2BA 1CQXA 1Y4UA 2O2IA 2WQZA 3F9RA 1X3SA 1SUIA 2K2QB 4N01A 5K6TA 3I0MA 2IEBA 2OO7A 1EU1A 2PIDA 3TLYA 3WSVA 3LTEA 4L9WA 2EKBA 2XRFA 3A70A 2V7BA 4KQMA 1EG2A 1AD2A 2H54A 2XDQA 4FOSA 3NHBA 4P0QB 2PQMA 1IBSA 4U9IS 2G82A 4FZ3A 3NG1A 1ENOA 1VZ3A 4GSLA 3U56A 2QMZA 3NIGB 2PPVA 4HDKA 1GDHA 3A1TA 5AHOA 5AW7A 3SBDA 1H9BA 4GP9A 1CJSA 3EVBA 3EWSA 3ZTWA 2GHIA 4F4DA 1NPTO 5TPWB 2O8BB 1OBVA 4YRAA 1SVNA 4JMLA 2BDEA 3QQPA 4R5MA 4Q4CA 1FJXA 1P17A 3CLTD 5BW4A 3VHXA 5JSZA 2HM7A 1U7UA 5LZ5A 1H1LB 4AY2A 4FLFA 3F73A 1XXHB 1I7QB 2GLXA 1WXEA 4IGEA 3GU3A 5JD6A 1UJMA 4L6CA 2BFNA 3K4QA 3LMKA 1DCKA 3QNMA 2V5VA 4GKJB 1WQ3A 3QMPA 4V0NA 3PI7A 1WSDA 1RJDA 4TL8A 1O5OA 3D4LA 4YJFA 4LY9A 5HBRA 3F97A 2RK3A 3MWLA 2CMFA 4FJ0A 4ZO8A 3WRYC 3CLTC 2FCAA 1PJSA 1I94B 2BWJA 5JLJA 1VCOA 3OLYA 1L2TA 5LXTB 3R7LA 4I4LA 3FGNA 3KUDA 4PY2A 4IHJF 5IUNC 4B35A 1TAGA 2NSHA 3QNWA 3SJCA 1XZQA 1G5FA 2WHPA 3QU2A 4BVHA 3CUEF 4YJ3A 1WPXA 2F3UA 4RPCA 4N41A 1OH8A 4U2DA 4MZDA 4WFQA 1W2WB 1P61B 1DHRA 1GU7A 1ZXLA 3GFTA 1KVTA 3O9ZA 1G20B 3HA7A 3FPBA 3HHPA 4P4LA 3JTEA 1DEHA 2OYSA 1P2VA 4F86A 4IDOA 5K6AC 3RC8A 1W4BA 2QMOA 3SM9A 1NJ2A 1RXWA 4E5YA 1ECJA 9ABPA 2VTKA 4YV2A 3U44A 1NBWB 4PG6A 2NZYA 1BKDR 1Q7RA 5KWSA 4UC0A 2YVUA 3PEFA 1UDWA 1U0NA 4MHOA 2C3OA 1A04A 1RS0A 3GRPA 3L43A 3AUTA 2WFMA 3NV7A 3OQ6A 3WLEA 1E2JA 4JI0B 1CKEA 2P75A 2FSSA 2OE2A 1T6YA 2XXJA 3PG5A 2FUCA 3VDXA 1HYGA 1NX6A 2M32A 2B1JA 3MD0A 1FB5A 2VCHA 3PXXA 4LECA 4PHCA 3IX7A 4DPLA 5AVSA 1AXEA 4QJ3A 4UBIA 5ALRA 4JELA 1PDOA 2OZLB 5EIWA 3RTAA 1MF7A 1I4LD 2AFHE 2LCIA 2PJDA 4PGAA 5E2IA 3WRXC 2ODPA 1MR3F 4J6FA 5DYGA 3RJZA 4C43A 5LDDC 4OGFA 3QA3E 5JEDA 1KQFA 2W6QA 1G7CA 1QKIA 3FMIA 2V6JA 4H7JA 2WI8A 3TW0A 1B6RA 3W5UA 3ZR4B 2FWMX 4IGFA 5CP8A 1RM5A 1ZVQA 2PAFA 3AEKB 3QVVA 4UJ3A 1BMTA 1VLHA 4CV1A 4YMHA 1F8FA 2Y93A 4OYHA 3E9EA 4WBNF 1XVAA 3PUXA 1VSVA 2ODTX 4HAXA 3USZA 2AOUB 2PS0A 1Z63A 2IEGA 1J1IA 2VK4A 3H4TA 4CM7A 2XUPA 4ZI7F 2QVLA 3SD7A 2OD2A 1D9XA 1RHMA 3WL3A 2WKPA 2RI0A 1X8XA 5KYUA 4DY6A 1X38A 3CPSA 3LIPA 3MTJA 4D9CA 1SOAA 1OVGA 4HQLA 1EFKA 3SBXA 5I47A 2O8FA 2OZVA 3O3MB 4I2NA 2C4UA 3IIEA 3FPEA 2IF2A 1JEYA 5F1PA 5F5NA 1KDZA 1OFGA 4FFBA 4LYYA 3I2HA 5G1PA 4WKBA 1YUMA 1E2MA 1JWLA 1ZZEA 3OIFA 3C3EA 2X42A 1WG8A 3NVMB 3SY8A 2WKSA 1I1NA 1PT7A 4HEA1 3BDVA 2PD3A 3BXXA 4LNUB 4YCAA 1KI7A 1M66A 4B6GA 2PQ2A 3NS7A 3RJ5A 3RSGA 4CKXA 1NQ5A 2VHJA 4LAFA 4TZKA 4ZJYA 2BY4A 2C9CA 1Y6QA 5BMVF 1DUSA 4XWOA 3FPHA 2BFPA 1DBRA 3NOQA 3JD4A 3RVJA 1X1QA 2AWNA 4M0LA 3DBLA 3RHFA 4FGSA 3SEAA 1GRVA 1WS6A 5EKXA 3CURA 5DHQA 5A5FA 2H7VA 1NBMA 3NYWA 2G1JA 1A1SA 5IJ0A 1QK3A 4ZZ2A 1XNJA 3KQLA 5E9WA 4HYQA 4Z0NA 2DHEA 4CPDA 1J1ZA 2QJRA 2ZBDA 3TSCA 2WYVA 1ISRA 4XPIA 5FPSA 4JC0A 3T1OA 5CDGA 1CY2A 1VB5A 2BCGY 1JXQA 4MR7B 4R69A 1K2VN 2RGBA 4JSTA 5AK5A 3FY4A 4C0WA 4J0JA 2PYIA 3IURA 4HLNA 3TRJA 1E3TA 4Q7JB 2E4AA 1XZJA 5TNXA 2AHRA 5CH5A 4KUGA 3F6YA 1SHLA 1C0IA 2O7SA 1DCMA 5T6MA 1VPLA 5DN6D 1GNVA 2WMNB 4O59O 4OP2A 4R81A 4OHPA 1AHIA 1G4HA 4YT4A 4KO2S 2NUTA 2ZRHA 1E4EB 3WLLA 3ADBA 2A35A 1C3XA 1C8BA 3IAM1 3L18A 4BY9E 3ZJTA 1N0HA 2XODA 3KAKA 1VJ0A 3DZGA 2GN1A 1EQ2A 2PUWA 3UJ8A 1CNMA 5FNVA 2ZK7A 4C03A 3SF8A 3T8YA 2I6GA 1U0HC 5CLGA 1CP3A 3EH1A 1VA4A 2BE9A 4NCHA 4LYGA 3HL0A 2YFQA 2RHLA 4OF4A 4RFSA 4ZKEA 4GI2A 3PCXA 4QC2A 3C70A 1UMBA 3K35A 3TLMA 4Z1MA 3V1KA 4CMJA 5JASA 2FZEA 3B6EA 3N0RA 4ES6A 4AJPA 2OMEA 4C4TA 1IDN1 1DINA 2H2HA 2ZQZA 2ZIUB 4R0MA 1II8B 3ZOKA 2DWCA 3NXSA 3OZIA 4M87A 2I4OA 3B1FA 4BGEA 5LPNA 2VHEA 4FR5A 2YRWA 1PRYA 1M34A 1X1BA 3EDOA 5BUSA 5K0ZA 1JEDA 3E3AA 1OI3A 1GGEA 2SNIE 4BUCA 1XTZA 3ZZ1A 3IOEA 4KSYA 3MBOA 3SXUB 1RI3A 3FWYA 4LY6A 1AKTA 4Q9HA 4Z0HO 4YDQA 2IH5A 2P67A 3DMHA 2QRVB 4UFNA 1SK8A 1QH8A 4FGLA 1BRTA 3QP9A 1HDXA 2FW1A 5ALQA 1AHPA 2Y0CA 3C8ZA 3R3UA 2NSYA 2FE4A 4TYNA 2NQ8A 1Y6GA 3HSYA 1C0PA 1T29A 4NCXA 3DTVA 2XNSA 2DM6A 3ODPA 4IFTA 2AJBA 4TXLA 4CTMA 1F6DA 1T5BA 2JBHA 3N8DA 3G1UA 4C0LA 3NBAA 5FDFA 2XXAA 4NHOA 1JALA 3O3CA 3Q87B 4RVDA 2J5KA 2RSLA 1KSFX 3DOCA 1SR8A 3R6DA 4QDZA 3T0FA 3F7TA 2B5VA 3QXGA 4H3VA 4PBRA 3UC5A 3IUBA 1G2OA 3OIYA 5LP6F 1CZHA 1OOEA 1VJDA 1Y63A 1P5RA 2C31A 3B48A 4INAA 5D6NA 2L0XA 5C32A 3HMKA 1YGYA 1A9RA 2IU4A 2PBFA 1Y7TA 2FSVA 2WZQA 3COPA 4EO7A 1SG6A 3VPSA 2PCLA 1H42A 3MWGA 5CFRA 1B8OA 4EI8A 4F9TA 4RIEA 1BMFD 5GZ3A 2NUAA 4JVSB 5K5EA 5DNCA 4O1MA 4DOMA 2TSYB 3A14A 4MS3A 3UT0A 2AEFA 4S1WA 3TUIC 3TLGB 4E31A 4OJKA 4LWZA 4GKKB 5JSKA 1Z0JA 3K1TA 2GBGA 4HWTA 4ZDIA 4C04A 3E3OA 4NNJA 4C08A 3EPKA 3CX8A 4TT8A 4KHPB 4IRMA 5JXHA 4ISCA 2NTNA 4LZNA 3IMCA 4PYIA 4RLQA 1V16B 3FYUB 2GK4A 3R6TA 4WZAB 1KYVA 2ZYWX 3GJXC 1XBTA 4RY2A 3THXB 4KC0A 4IJ5A 3SZGA 3T3OA 3HXPA 2DECA 1OXKB 3KJXA 4I4IA 4R05A 4ROSA 1VE5A 2PPLA 4WBXC 3ZQ4A 5BUZA 5DXFA 1H3NA 1I7DA 2EF1A 2GPJA 1BW9B 2G5CA 1WRBA 4FHGA 1E2NA 2NXWA 1G8YA 4M4SA 4CM4A 3D0KA 1DRJA 4OJMX 3W34A 1IG0A 2BRUA 1A3CA 1JV2B 4GLJA 3KYJB 3K2QA 4BKMA 4F5WA 1NLZA 1NU8A 4IIJB 4NZPA 1L5OA 4J0HA 3QE4A 2E37A 4MS1A 1XLTC 1KI2A 3CWCA 3RE1A 3B1WA 4B71A 3BA6A 3H84A 4BO1A 1HNNA 4MQFA 3UUWA 1BXGA 3VU9A 2W2KA 5FF9A 3M9XA 5K4HA 2IQIA 2MSDB 5T3UA 5F7OA 2C5AA 4Q4JB 1PR6A 4ZQGA 4DJ5X 1DXHA 4BBPA 4L75A 1YR2A 4MQMA 4G5XA 5A9SA 1S7GA 2FUG6 1G6KA 2QXTA 1WL8A 4RKEA 2D54A 3PNSA 1NRJB 1S2OA 1UK7A 3F46A 1FSPA 2KJQA 1YBHA 2VQ6A 2GZ2A 2VL7A 1V5GA 1GTG1 4JAVC 2WVAA 2WSYB 1DG9A 3HP4A 3EPHA 3O38A 3U39A 1TJYA 3QPAA 1N7HA 1GGHA 2CLHB 3U9LA 2LPMA 2V6FA 3R6WA 4OQQA 5ALYA 5I4KA 3MPOA 4JJFA 3KOUA 2H2AA 3E6AA 5ICFA 4DBZA 2JLAA 1U8UA 1PYDA 2WD7B 3UO8B 3CVWA 4ER3A 3BQNB 3QLUA 3R74A 3IO3A 1ZSYA 1BD4A 4QIHA 4Q7MB 4DJFC 1QZXA 4KSCA 2NXEA 4C3ZA 3FCOA 5AUNB 1SKBA 4CUJA 5IVKA 3CHYA 1D0IA 4I1RA 4DV6B 4JT4A 3F2IA 3PDJA 1YJ5A 4H60A 4YJ2A 3WB9A 3GPBA 5JQGF 1NW7A 4FFOA 16PKA 2Q3LA 1L5GB 3S2ZA 3FDJA 1WF3A 2NO9A 3DEKA 5ALIA 4FNOA 4JLDA 3DTNA 4EHBA 5JW6A 1IIRA 3VYUB 3VXKA 3VU0A 3WA7A 3ADDA 2BCEA 2VNJA 4I4TB 1S96A 3BIJA 3OWHA 4E3WA 3HJFA 3IKJA 1L1EA 3WB1A 2ZT5A 2ETXA 4C6TB 5ENZA 4AURA 3HADA 4L27A 3LW8A 5E4TA 2YJGA 3JQ9C 4QPCA 5EJ7A 3DL7A 1A97A 3AJAA 3F9IA 4L6AA 4F1WA 4DMHA 2F8LA 3DO8A 4GQBA 4HNUA 3HDTA 1F6BA 5TT1A 3LHIA 2AUTA 1E2BA 2NXNA 4X1IB 2YJ3A 4O4JA 1XTUA 3NBYC 2Q4OA 1C81A 2Z30A 4HWRA 4OD0A 2PA0A 4NH4A 3FCUB 3C48A 4CXMA 1NURA 4OYLA 3WJ7A 2QTMA 1T26A 4KMOA 4L0DA 1U90A 1MRNA 4S0XA 3TLBA 4NZZA 2IS6A 4HDSB 5JS8A 5BWBA 5BR7A 4B32A 5EJ4A 1R8SA 1VJCA 1DRKA 3IBTA 1O87A 5A06A 3NH6A 4QG7A 1LUAA 1SHUX 3KV3O 2I1VB 4CL0A 1K1EA 2JDIA 4KO1S 3HA5A 3V8NA 1PFQA 2X13A 1X7ZB 3BH6A 4HAOA 1UKAA 4NFSA 2WV7A 3DE0X 4ILKA 4BO7A 1TVKB 1KU0A 1TMOA 4U7GA 3TPCA 4DDVA 1T6ZA 1K7FB 4BMYA 3AKZA 4MVJD 2YV3A 4Y1GA 2A5JA 5JNVA 3R09A 2XQKA 1GTVA 3AR7A 2IP4A 3ILSA 3N2IA 5GQSA 2HDWA 3CMMA 5KNDA 3ZWDA 3U2QA 1B41A 1ZG3A 1OY1A 3L0ZA 4OHZA 3UHOA 2I1WA 3R23A 2OLJA 3AILA 4UBMA 4DDWA 3IPCA 4M9ZA 4HFJA 3U7FB 2GS9A 2G5GX 5FHQA 2H1LA 3LD9A 3SQXA 3D2LA 2GAJA 2GKGA 3EIWA 1GAEO 3AY7A 2QGFA 1UQRA 1T0JB 3WWOA 3D8UA 4DSAA 1CXZA 4ND2A 1DWUA 5I4CA 5IS2A 1N34B 3W0LB 3KB8A 3OX2A 4DNFA 4GR4A 4ZARA 1XOIA 2M1ZA 1WLYA 4ZEXA 3H2YA 2V3VA 3C98A 3L93A 1Y8QA 4G86A 4KE8A 5CA0B 5JCPA 2NO4A 1DKLA 1HF3A 2DE0X 3MHPA 3RS0A 3ZLVA 3LK6A 1GV0A 3RO7A 2YWHA 3EG5A 2Q5CA 2PUAA 3EDQA 5DHAA 2LDBA 4UEJA 3V8PA 2JFZA 4QEKA 3TJRA 3AVQA 3TSZA 1F2UB 1G21E 2VUTA 2O0JA 2VAPA 3TVDA 4IMPA 5KJFA 1G38A 1D5WA 3O1HB 5LP6B 2VDNB 4OV6B 3PYMA 4B5LA 1M5UA 2BSXA 5EWMA 4YUZA 4FQ8A 5KNBA 1BROA 1K7XB 2ZE6A 3MWKA 4KGDA 3GLTA 2TMDA 4BVAA 4BN4A 1VECA 3KQQA 5CA1F 4J75A 1GFZA 4KBGA 4YRFA 3WNDA 2PLNA 5CXQA 2COEA 1CLEA 1XJQA 1RKUA 5LZ7A 1QIJA 1WA5A 3HKCB 1YI8A 3G9ZA 3EBOA 1G9SA 4Y3UA 1FX0A 3LDAA 5HF6A 2P9EA 3COVA 2J9FB 4IV8A 1VRWA 3WWEA 3EY4A 2X8WA 3KKEA 4KI7A 2ZBGA 4DV5B 1HDIA 4E6PA 4QUEA 2GXSA 1AB6A 2OENG 3CF2A 2R8EA 3LECA 4WNAB 4LBVA 4LKOA 5TVGA 4DCSA 4HEJA 2M9MA 2Q3BA 2VBFA 3OZWA 4FGUA 1E1YA 4HVCA 4LXTA 1VJ5A 4ZOCA 4B6SA 1U8TA 1YFKA 5C8YA 1BD3A 3N28A 2DPLA 4DCNA 5HIKA 3OTWA 4FXOA 1RYFA 4TTTS 5IZCA 3FG9A 2OUIA 4CR8A 1DAMA 5CFPA 1NSFA 4CIXA 4D4JA 2NTVA 3BB1A 4KB5A 1XTVA 4O08A 1BYUA 1U8ZA 4X94A 1GHTA 3C1TA 4JUIA 2O19A 4EG6A 4MQ6A 3D3WB 3Q3JB 4FE7A 4HNAB 2BP7B 1YZLA 1WBJB 3P19A 3NC0C 4AZ3B 1BDMA 1RJWA 1W0KD 3MLEA 5JAPA 4O2BF 3TX2A 4QPPA 4JNCA 3ER9A 4HAVA 2OAQ1 5LOVA 3I53A 5J47A 3VC7A 1QBKC 3BJMA 4BB0A 1UBKS 4JJEA 1WX1A 5B58C 1EFPA 1S8NA 3VTKA 3FKQA 1JMKC 1NIJA 2CUZA 3DNMA 1Y7IA 4HTFA 1OFUA 3NHMA 4UXJA 1ZVMA 4WW0A 1PZFA 3W8DA 2A58A 2UYGA 4B3IA 4NFLA 2FHPA 3NHJA 4EJ2A 4MVCA 3B6JA 3FOAA 2ZE5A 4HH4A 1PKXA 1UXOA 1LX6A 1JLMA 2W2NA 4NHEA 4CCYA 5LQJA 1A5BB 1YHZA 2I33A 2IODA 5EL0A 4BEWA 5K51A 5C2JB 3ZXXA 2SBTA 1F8UA 4YP0A 5B2ZA 5IFKA 3RVDA 4YAGA 1Y3IA 1IYZA 1F51E 3VKGA 5J4LA 2PWBA 3V8VA 3F3YA 4RZHA 4C1NA 1K6JA 2HF9A 4FMCF 3P9YA 1W47A 4JITA 4NULA 1JAXA 4NVRA 5BSRA 3T4UA 3ZLBA 5JH7B 4YHBA 2QX6A 4MYHA 3AERB 1QE3A 4G8JA 3LX8A 3TZCA 3BREA 5C8YF 1NN3A 2QVCA 4MP3A 1SB8A 3G2MA 4MW0A 1CNEA 4Y2GA 3U3ZA 3WR5A 1C29B 4B8WA 1KFJB 4BO2A 1VL6A 2ZWPA 3QWHA 5HM6A 4N49A 3OLQA 5FYDA 4TLLB 2XTAA 2J0UA 5F1KA 4XWGA 3L06A 1GV1A 1OXTA 2GKOA 2V8OA 4DMFA 1V41E 2PHZA 3VR6A 3PJRA 1F3LA 3KPJA 4UCQA 1Z88A 4UFOA 3D6MA 4G1BA 1MD9A 5F51A 1W2GA 4BMZA 4RPLA 4DSUA 1PVDA 1CVIA 2V4UA 4I50B 4EI2A 5HX7A 3R9KA 1KMMA 4ND4A 5FAXA 1YQ9A 2QM8A 1SULA 3H6GA 3PFHA 1XKTA 4YN3A 2RH8A 1SCUA 2OCKA 1T10A 4MJXA 5IARA 3H3FA 1QR6A 2Y3IA 1Z3IX 3SBOA 1QUEA 2P5TB 3A4MA 3KHKA 5E6UB 5FR1A 2PX5A 4H4DA 3ZCRA 4JBLA 2VTDA 4DEVA 5HDQA 1B0AA 4MR8A 2QU8A 3ICCA 2IV7A 2QW8A 1C8VB 4JX8A 2PT6A 4W9NC 2R8BA 4XVUA 4OLAA 1K92A 1W2HA 3L01A 3GGJA 3GPCA 4DB4A 3U4DA 4LNHA 1D6NA 1TZJA 4RETA 6GPBA 4RTJA 1XCGB 4FKZA 3T5BA 4R2WA 1M2KA 2Q6TA 1MJGM 1H9CA 1RHJA 4CDRA 1JFFA 1YQGA 1HDCA 3HJRA 4U7TB 5BSWA 1NXOA 2Q4DA 1Z47A 1R64A 3UTDA 5JY1A 1C9KA 1X7XB 2ID7A 2VZLA 3ORYA 2ACWA 3VU1A 3TIGA 4F8EA 5JI3E 2UZIR 1LEHA 4LMPA 5DIZA 5GONA 3IUQA 5CYGA 2C5LA 5CLQA 5A4FS 1BCRA 4EL5A 4OXXA 2A0WA 5CYOA 5BQ5A 3ZK9A 4LZOA 4M1ZA 3R7BA 1GFSA 3DT8A 4E5UA 2Y4OA 1AKWA 1I6MA 1DG1G 1WU7A 3MUNA 4J90A 4B80A 4ZVQA 5IJAA 1V0JA 2VP3A 1TLLA 1M2VB 2I3DA 5DCUA 2SKDA 3DNPA 3JPYA 3N39C 5HZMA 2DEUA 2XTZA 4YT2A 4RZ2A 4E4RA 4MMYB 2Y67A 1UBMS 4W1QA 5HF5A 4FGJA 2NU8B 2CWWA 4L28A 2OCYC 3OFND 5MGBA 4PQYA 1Z5UA 1EVKA 1GZUA 1V5IA 3FFAA 3R0XA 5FWAA 2PS9A 3ZGLA 1WY5A 3RS4A 4OGWA 4Q6BA 5EXPA 3ZKWA 3IT1A 1BEEA 4QDJA 5IFLA 1AMNA 3HBFA 4J7XA 3UG7A 1SA0B 3PYLA 1NI5A 3A2LA 3ZHCA 4DLBA 1P7WA 2P6MA 2PU7A 1MT0A 1Z6ZA 3IP3A 1G59A 4B9AA 3G2KA 4QUIA 3PEYA 4IDPA 4OBBA 3BZBA 2CHVA 3F47A 1YFJA 4KVFA 4OAOA 4CU2A 1GT91 2Z57A 1AN0A 1GPYA 1N5KA 1MIHA 2V54A 2Q29A 2JGFA 4P58A 5CT4A 1JVNA 4MUFA 1X70A 2ZDGA 3NM5A 3W5HA 1PAUA 3MJDA 2GBCA 4RD6A 2ZKIA 2Z98A 4EP1A 3TLJA 3TRDA 4TMKA 3P52A 1PR4A 1DJOA 1H2WA 2GKSA 3GHHA 2ZZKA 2ZYVX 5G40A 3W3ZB 5H3LA 1IN7A 1PZMA 4DJAA 1XDDA 2W6ID 4JT2A 3C8MA 4GMGA 4HXGA 3PKZA 4BEJA 4EYQA 4EFLA 4PLTA 2IZ7A 2YZGA 1KZ4A 3IO5A 1JX6A 2ZJFA 4LVNA 2ZJZA 1VLVA 1XVVA 2H4FA 2NYAA 4OVKA 4DT1B 1MAHA 1RWMA 4DCPA 1C2YA 1NMEA 1KO8A 1NJFA 2ZETA 3KKNA 1QK5A 2YOFA 3PFGA 3FDFA 1W6UA 3Q9SA 3ZCUA 1NNLA 3KFVA 5ELLA 6CHYA 5DK6A 4ER6A 3REOA 3DV0A 1V8PA 4OGKA 3AEUA 4IHAA 4XUDA 1EX6A 2ZIWB 4ESOA 2G1AA 3UJPA 1N2EA 3JALB 4KACA 5H68A 1RKVA 2BHRA 2YICA 4EHFA 4K9OA 4MO9A 2C4WA 3F96A 1FFXA 4FEAA 2VF7A 3LA6A 3N6RA 4H7HA 4MGZR 1VKZA 2P0EA 4MV6A 3I5XA 1MX1A 2R1TB 3F6EX 4LVUA 1ZH6A 3KC2A 3ECSA 4O4IB 1M76A 5AQEA 1FJ2A 2HRBA 3DNFA 3T1TA 5LQSA 1QP8A 3VR3D 3ETGA 3WFZA 1XYGA 3IDQA 1W52X 3O4FA 3TOCA 1E2DA 1HQKA 3AR5A 4X91A 1SQGA 1J0XO 2X6RA 1U5BA 2V7WA 2DP4E 3K8QA 1XZAA 3BA1A 3KPYA 4KR0A 3W6UA 2EEZA 3N0TA 3WK5A 4EARA 1Q0PA 3BSSA 3KOMA 3UICA 3JAMA 3EOBI 2IBMA 4AKTA 4YDSA 4DIFA 1QQAA 4D0GA 1WD5A 2P5SA 5DYTA 3SGLA 3ER6A 2G36A 2QN1A 3PD1A 2YWXA 2FR8A 1K2WA 1AIPA 1OAAA 4KXLA 3SFZA 4UEQA 2P41A 2PBLA 1I2BA 4ZAWA 3F8WA 3ZHSA 4JCCA 2OPHA 1KEUA 3BD7A 4RVOA 5KTYA 1TUGA 1JIXA 2WE7A 3G5AA 4FONA 1WXQA 4H31A 1DDOA 4MUBA 4PHHA 5AICA 5CD9A 1Y4ZA 2VNAA 2PTGA 4F1JA 3AL0C 5B36A 3IQDB 3QWBA 4N0MA 1UXJA 4FZVA 1JEYB 1L7MA 1AQIA 4MUKA 3B3GA 4JVOA 4B6RA 3S55A 3GVHA 3WZLA 2VAVA 5BO5A 1U5CA 3UZUA 3EVFA 1B6SA 3LLMA 3LPAA 4CKCB 2QGNA 2X2FA 5CDTA 2OCGA 1T24A 5A03A 2ZBUA 1FOEB 2G07A 2IQ5A 2O2SA 1M1UA 3MINB 1N2CE 3O8NA 4PWYA 2R8YA 4MWGA 2VPYA 1OKKD 4M7PA 2BMWA 1G41A 1KORA 3IR5A 2H00A 2YN2A 3RSZA 4QO7A 2W70A 4B47A 4BMVA 3RJ9A 4E2WA 1AKUA 2G8NA 1XPUA 4F6LA 4N5DA 2E5LB 3O92A 4MWSA 5JYDA 2QLFA 2FYTA 3RAPR 2O8CB 1DQSA 3PLNA 2XB9A 2OILA 2WIAA 3CNBA 5IDVA 5A3QA 4LRYA 1I01A 2IE8A 5HK9A 1VKJA 5DGHA 3CG4A 2KSQA 1MN6A 4MQBA 4Y9DA 5K3OA 2C1EA 2VZEA 3M9WA 4NK5A 3QEMA 3P0RA 1I7SB 3ETLA 3PC4A 2JHGA 4XIYA 1NUTA 2RAPA 2C4HA 2X1MA 1I3KA 4QRIA 5JFOA 5ALFA 1ADYA 1VRVA 3MRVA 4MR7A 3DE5X 4YPVA 4DM7A 4EYGA 1W0JD 1TQ4A 3LUFA 1P0FA 3ADKA 4X6LA 2C92A 1VHLA 2FPLA 4JGBA 2QS9A 3GHYA 2W6MA 5HA5A 2D7JA 3WLJA 1H2EA 4WXYB 1P3Y1 4KN6A 4AUEA 1IQUA 4P32A 4OB6A 3OOWA 1YCGA 5DK4A 1QIKA 2IUEA 1Y4DE 2ZS9A 1E4EA 4P83A 5KTTA 2N75A 4GMFA 2EZ8A 3HE3A 2VOEA 5C1IA 3BXZA 1VBNA 5LLDA 4KQHA 3PZBA 2CLIB 3U5ZB 4GLOA 1UZNA 4CT5A 1K4YA 1ORTA 1S7CA 1WKVA 1YR6A 3DFIA 4NJMA 2X23A 2I29A 4Z86A 1B0PA 5IYZA 2ZUBA 3BEOA 5B1YA 1IATA 4EVQA 1AK2A 3V2UA 3H7AA 1QYCA 2WB2A 2Q46A 5B12A 1XF9A 3GT7A 3PITA 1AUVA 2VRCD 1V6CA 2QE7A 4UASA 3R8XA 3SPXA 3A6DA 3WGTA 5BYJA 4O1IA 2F64A 1CCWA 4TSFD 3VR5A 4O63O 1QXSA 1K0FA 2J7PD 3ESZA 3FPJA 5AVKA 2WVGA 5ALTA 1SJ9A 2WLTA 1VI6A 4PXAA 2EJTA 1FSSA 5BXYA 3OU7A 3QXXA 4Z3OA 2X5NA 4D9NA 4AMBA 2PQ6A 3QE2A 1Z3CA 4F56A 3NM6B 3LO5A 3M83A 3EISA 5K7SA 3IERA 4Q19A 3CLUC 5BSEA 5IVPA 2EJUA 4A1FA 2VF5X 4DHWA 4DLRA 2Q49A 2WWTA 3LUGA 3NX4A 4DXAA 4HI0E 1DUIA 3AQ4A 1ZN9A 2HHCA 4P7KA 1QH8B 2J4CA 4GOND 4Q3BA 2V7XA 4UVHA 1EEXB 1QV9A 2DXIA 2J3QA 1I1QB 2ECFA 1EI9A 2G28A 5KYYA 3O9MA 3A06A 2D1TA 4ZT6A 3S2FA 4BMCA 4ZYWA 4G67A 1E89A 1RZRD 3AR2A 4UATA 1TF7A 1D04A 1JU4A 4TQAA 1YQTA 1TMGE 2JHFA 5MHTA 5AXDA 5A3RA 4BEVA 1YK1A 1DEKA 1PT8A 3ONWA 4R1TA 1N4AA 4LVCA 1KJZA 2VR1A 4DSTA 5J1SB 5EHXA 5DBEX 1Z38A 4INZA 2VJPA 2VF4X 3RVOA 1O6CA 2CLSA 2DTDA 1FFYA 3D7KA 1EGHA 1VQ1A 3CXUA 3HDVA 1ZK3A 2QXYA 2YOHA 3X2EA 2WABA 4KR2A 4YI3A 4PC1A 2ID8A 2JCBA 4IX9A 4NMLA 3SYKA 2G9QA 1ZN7A 4AJIA 3D4NA 4ZZ1A 3SQOA 4M9CA 2P2ZA 4GMKA 4X8MA 2NUAB 3HGTA 4CTKA 2XCLA 4L4SA 1OWPA 3ELWA 4RVGA 4MS3B 4CKBB 2NTEA 3PRJA 5BW8A 3H7IA 1LDNA 1JG2A 2OHFA 3K09A 2IP2A 1U9JA 4DPMA 1BH6A 1YL6A 2EHJA 2TMKA 5BVHB 5I7WA 2BMVA 4HAUA 2X0KA 3KKZA 4C89A 1SU4A 4UUMA 1G8HA 2NOAA 1MV5A 3ROZA 4ZZIA 2P7HA 3AP2A 5EIBC 1E8NA 4DLSA 1YBVA 5GJBA 3VYTB 3FNBA 3TNDA 3QENA 2BD0A 4J29A 4M6WA 3RAEC 3CUVA 4F5EA 1XD8A 2B82A 1J0DA 3UOWA 2A0FA 3KSAC 1SC3A 1ND6A 3OLCX 1UM9B 2DFVA 2DR3A 1BWQA 5L6LB 3QUTA 1JQAA 2ZXEA 3HU3A 4AIRA 1KP3A 1WZUA 4BO4A 1F38A 2CJWB 3LCMA 3BEDA 4QOHA 1KEEA 1G3UA 3BH0A 4KTTE 4WLVA 5CCEA 2CDCA 1F4VA 3OIWA 4Z53A 5G0UA 1B16A 4IQGA 4K5QA 3JCZA 3VX3A 4PPQA 4RPKA 3STVA 2VYCA 1J8QA 1SB9A 1IJKA 3WADA 1UOOA 5IYZF 3RNOA 3BDAA 1CEYA 5J23A 5F1OA 3UHPA 2HNAA 3UW1A 5KQPA 2IELA 4GT1A 1MQSA 4M46A 2YN0A 1SNYA 4C0AC 4DQKA 5AJWA 2WAAA 3NDRA 4WKNA 1FDOA 4BLUA 2QLMA 1QYXA 1ZN2A 2JLYA 4EJ6A 3L92A 5EGNA 2PH7A 1Z18A 4DBLE 1UMCB 1RJGA 4G8CA 3OD5A 2DPXA 3WNQA 2PXCA 4LY0A 3KL2A 4JYZA 2MU1A 1LLUA 1A7AA 5FQNA 1P2GA 5JNUA 2K4MA 2OVFA 1NT4A 3UAZA 5AVTA 5FJIA 1PJ3A 4TWJA 2DUNA 5DSTA 1XP8A 2BFDA 1ZW6A 3BGIA 3AR3A 3IP5A 3WHKA 4I4TF 2AZXA 4HDRB 4Q9NA 2VRNA 3TUJC 1NJGA 2FI1A 2C3YA 3GUHA 4MKIA 4PO9A 4DLTA 3EVNA 1J42A 1KJIA 4NEQA 4JI5B 121PA 3ND6A 5EFOA 3K4HA 2WTUA 1GRCA 2W2QA 4YAWA 1JG6A 2LWIA 1PTKA 1SRRA 2W6JD 3I73A 1E7WA 4BB6A 2BGMA 4BNVA 1RJEA 1GY8A 1XCBA 2JHCA 2WNSA 3TTWA 3AVVA 4Y2HA 1RZ3A 3SI7A 2CXPA 1KBOA 3SHQA 3AETB 3G0BA 4KPGA 1P2UA 5C35A 3DZCA 4JLUA 1VL1A 2Q0HA 4X62B 4X63A 4BWVA 2R8OA 1K3UB 1XL1A 2FMTA 2DJ5A 4NABA 3I6MA 2XOKA 2QM0A 3KTFA 1IN1A 2AT1A 3QXJA 3HJAA 2PTHA 5KX5B 1QPZA 1JAIA 1KA9H 5ALMA 4IVQA 3VMFA 2F8SA 3FDZB 4O0MA 1J2YA 1YS9A 2IC5A 1CZNA 4NMMA 3REFA 3SKXA 1DC6A 4BVJA 4R7TA 4GOJA 4W82A 2Z58A 1CVLA 3M6LA 4BFSA 4F9EA 2XUZA 4CIYA 3WWZA 4UE2A 3V3KA 2C2WA 3X1XA 2GM3A 3PFKA 4NECA 2SHKA 5L3QB 4FINA 2QUIA 4BV8A 1UPTA 5T4EA 1YIAA 4CI0B 4DCGA 1QNFA 1IB6A 4GPZA 1BO6A 2A1UA 2CXUA 1J21A 3RUHA 3RUDA 5AM2A 1ZD8A 1IEQA 2PKYX 3D3JA 1II9A 2XAUA 3T54A 4YWJA 2P9TA 3LT2A 1QDLB 2XNDA 2P9QA 3BZUA 4J49A 3VR2D 1NAHA 2BV3A 3RADC 3H5VA 5AW1A 4LFCB 2FZLA 4ID9A 5FFMA 4CUZA 4TWIA 3J7AC 4EQ6B 1T3GA 4E5NA 1PFYA 4MH0R 4QUJA 3OETA 4PZLA 1JDZA 1Z0ZA 3D8TA 1T9AA 2BKUA 3QY0A 9LDBA 3UAOA 1EK5A 4HMQA 1GCAA 1E7RA 1P1BA 3FKJA 4YLEA 1CIPA 3QKTA 4J0KA 3LKZA 3KQMA 4MCHA 1WMEA 1WHSA 1X8JA 4FDLA 4CM9A 2I2AA 4NBLA 9LDTA 1NWHA 4ZEWA 3DMYA 1OMOA 2B94A 1Z5ZA 1OLUA 3JR3A 2QPAA 1LPSA 3QA9A 3RS7A 2RH9B 3P97A 2FLVA 3FCCA 2HNBA 3DFZA 4G5FA 2PSEA 1H5QA 5A3SA 3HUDA 3ZU2A 5F7ZA 2XMZA 3WHIA 3WV4A 4RE6A 2OZEA 2AA3A 3B51X 3LUBA 1Z2AA 3IVGA 1YOBA 4YS6A 4D3XA 1OIVA 1UOPA 2C5SA 3IQFA 3H9JA 1DQRA 4CIDA 4E70A 3AO0B 3NKLA 4KXWA 4D8XA 1RYNA 2FW6A 2QTAA 5JIBA 4HZUA 1E7QA 3DLAA 4GNRA 3TTVA 3PT5A 2ZU0C 1QQ5A 3BXFA 3LFHA 4JBNA 3IB6A 3SVZA 2H51A 2J5BA 1YU6A 1HE1C 1LBTA 3ISJA 1DIAA 3UMSA 5KYTA 3TIFA 1ZMOA 2FFQA 1OLXA 3P71T 5JXJA 4FGWA 4YDHB 2XDWA 4K1LA 5CB4F 2R1VB 1IOWA 3BVPA 1K97A 1Q1ZA 2HDHA 2ZIEA 3GNLA 3O03A 4NXMB 1PKEA 1Z5WA 1MNAA 1T9ZA 1LV8A 1MW8X 2GXUA 4C21A 3H17A 4RCZA 1O95D 2FSPA 1RXIA 4JUCA 2FZCA 5CCXA 3I2JA 1ZA1A 2I0FA 4BCDA 3GAFA 4K28A 1E98A 2VJQA 3CH7A 1K0UA 1UDAA 3L7OA 1SHKA 3ZDEA 4NOKA 5KPDA 2AD5A 4ZV4A 4Q1AA 5ECDA 2GX6A 1XLUA 1IXSB 1ICEA 3OQVA 3SIWA 4MAFA 3WLRA 1LBEA 3EULA 1IM5A 4XH9B 1WUYA 4OHRA 2REBA 4BN0A 3F8SA 3PP8A 2N3ZA 2WSSD 1V9CA 2OYRA 3AUKA 2XWBF 4HXYA 2B61A 4OJTA 1H2RS 3HXKA 1TEVA 2I6XA 1RQPA 2FR8C 3K6RA 2HCFA 3FB4A 2LKCA 1KRHA 3EW9A 4IIVA 4PCLA 5E0KB 2BEKA 5E3HA 1WBBA 2Z5GA 4U7WA 1XKXA 4R51A 1CUSA 3ESQA 4G8DA 1E0SA 4QPZA 5SV2A 2TMYA 1HWYA 2J9FA 5FD8A 4D3ZA 2G9VA 5BP7A 2I78A 5H5JA 4D44A 4L3WA 3IJEB 3AIKA 3W5CA 1MOZA 5F4ZA 1L5HB 1NKVA 1OD6A 1U3CA 4G9EA 4GOXA 4KQCA 5EXSA 2O8VA 3SFVA 4WNAA 3DL0A 2I8AA 3IFSA 1RBZA 1OILA 4O6VA 4XLTA 4CM8A 5FWXA 2QNIA 3GI1A 4AMZA 3FVRA 2HMUA 2VIIA 3ANLA 3R3JA 4GC5A 4IHQA 2JGAA 4MYSA 4BNIA 4FOTA 2NWQA 1LDYA 2VF8A 4RK5A 3F49S 3MMPA 5JANA 1TTPB 4O29A 4JC8A 4ZYYA 3AVYA 3QBDA 2UDPA 1FRFS 1G4UR 2R7AA 2FDCA 4HD8A 2EWWA 1EHYA 4QBHA 3D3WA 2WUWE 4JLMA 3BE4A 3KZNA 5AVRA 1ZQ9A 4FFSA 1P3JA 4NMWA 1RP1A 3TB4A 1H2HA 3RIGA 2IS1A 3SHTA 3EGCA 2HLPA 4FUTA 4DC1A 4LF7B 4GU5A 4XGRA 3NAQA 1JNXX 3SWWA 3FHCB 3FETA 1G5HA 5B1IA 1RXCA 2HRRA 2G9NA 3PVSA 4DVJA 1VIDA 3K92A 4G41A 2F3TA 5EJEA 2PMFA 1V6AA 4U63A 4RAQA 2V45A 3PGMA 1AU9A 1Q3HA 5LLTA 2X5OA 1FS6A 3HPRA 4XWWA 4EA7A 1EUYA 1A7JA 3HUEA 3JQ6A 4KG7A 2UZ3A 1LVGA 1KO1A 2BVNA 5AHKA 3WX0A 3JARA 1T25A 4J0EA 1TJ4A 1O4VA 3VR5D 4E07A 1EUCB 1EZ4A 2LTAA 2VSQA 2H63A 1UUFA 1C7ZA 5AM4A 1Q15A 4HXEB 4ZVOA 1U28A 4MWCA 3VOTA 2IUSA 3W7BA 4N65A 2DLDA 1ZHHA 3CBQA 1W9HA 2VJOA 1BGVA 1XDUA 4DDHA 1FBTA 2WYIA 2H11A 3OZSA 4TLCA 4DABA 3DOOA 4CLDA 2ARKA 2YNMC 4NR0A 3PR1A 4ZHQF 2HJ9A 2JIPA 1SD5A 4U9UA 3UC9A 2O20A 4MKFA 2MWMA 3MWEA 4NYMQ 4TUYA 1C9NA 1YQWA 3I12A 3IDAA 1EX9A 1IWBB 3ZU5A 4HGZA 3SG0A 1DNPA 2XWQA 3AHEA 4I6GA 1WBDA 1KDOA 1ZGZA 4NBTA 1FDIA 2D2VA 3KSDO 1TTHA 1PT5A 1FUIA 4HWGA 2ONKA 3C6XA 3ZDXB 3U4GA 1VLZA 4WFJA 3UWPA 4DMCA 3G5TA 3WHPA 3FPFA 1B3BA 3OBBA 3RPEA 2EL7A 4FR0A 3OLZA 1WDKA 2QQGA 4ZZ3A 3ANSA 1LQ2A 3H5LA 3QV1A 2IGTA 3I9MA 3IAS6 3SSMA 2B3TA 5E6SB 1WHTB 1I3CA 5KU7A 1ZIPA 1USIA 2REQA 4DV3B 3R4CA 1OWMA 1SCUB 2EX4A 4KO3S 4OQPA 4PX9A 1KMQA 3MHTA 2IYVA 2Z3ZA 3EXFA 1P2DA 3I9KA 3MJ4A 2VP6A 5AKEA 1SCBA 1N5MA 4ETIA 5E6UA 4ZC8A 3KLNA 5CU7A 4M99A 2P9HA 4BKRA 3HFRA 3B1ZA 1YOVB 1MPTA 5FULA 1RRCA 3HZOA 4CKYA 3WLPA 1CDDA 4ZHQB 5BOSA 3EFHA 3A4VA 1GR0A 1QVRA 1L5QA 1JDBC 2POCA 4WDQA 4FWTA 2RGUA 4FI3C 1PYGA 1L7EA 1SPXA 1R15A 3V80A 5A4DA 5DM2A 1PI3A 1KOGA 1SFRA 3GVXA 2QYHA 4AYWA 3HUTA 1C3VA 2REXB 4YUYA 1V2HE 2XIQA 3SYMA 3E23A 5CB8A 1T0PA 2JI9A 2H31A 4KODA 3VZRA 2I55A 5KOHB 1BXRA 1QORA 3B5EA 1PD0A 2BEJA 4HDMA 4IDEA 5J5CA 3NNNA 3E7WA 3PQ5A 3UMCA 4A82A 4CFYA 3ZI4A 4RIIA 1HM5A 4YRZA 1M1XB 4ZEMA 2I7TA 1G8PA 1GAQA 2XB8A 4N12A 1NQVA 2ZIAA 3R0QA 5GM2A 2WWWA 1EK1A 4I6EA 3UT5A 5HKOA 2QV7A 3AF0A 4HB2A 4IV5A 3CF4G 3CRMA 2PE5A 4XGIA 4CEIB 4C7BA 3LKVA 5A1JA 3GAZA 1EE9A 3QYPA 4FPXA 4BLTA 4E4YA 1K4MA 3JQBC 2H0AA 3QVTA 1P2SA 4L76A 3JSXA 4RCVA 5CVEA 5DB4A 3EGDA 1P44A 3HFGA 4QU5A 1Q20A 1T2DA 3DR5A 1W46A 1ZGCA 2EKPA 3PKIA 2W4IA 5TQJA 1E2GA 1PSZA 2IY9A 1N75A 2W0MA 4R3WA 2C07A 1Q7TA 3NYRA 4YP7A 1QWSA 2YWJA 1O7JA 5DTJA 3ZDZB 4TM7A 2HF8A 4YMVA 2XAAA 4FQ7A 4Z7JA 1XCMA 4BO9A 1U0RA 4GHWA 4J1SA 4AMGA 1ZM3A 2HQ1A 3OZVA 4E1VA 2C8KA 4FB4A 4EG0A 2MIIA 1QHSA 3NXKA 1Q7BA 2YIVX 1OU0A 3GEPA 1V11B 4NBRA 4S1PA 5AKJA 2NTYC 3IKLA 2OXCA 3OQJA 4KXVA 5J43A 4CEJA 1CRZA 1ZK4A 4CL3A 4JBIA 1WE2A 5HIJA 2ZSKA 1VJTA 1RXVA 4IIEA 3REQB 3HEBA 1HT3A 3FNQA 4AG3A 1SELA 3X1JA 2ZCJA 4AKEA 4WD3A 3GRAA 4BE4A 1FVOA 3J81k 3G88A 3N59A 2JLUA 5IK2D 3KWMA 1N3IA 1CD5A 3OE7A 1R9GA 4QODA 5HE8A 2OC4A 5I8PA 3L8HA 2CZQA 4MWZA 1UP4A 2PKWA 1GNTA 4Z2YA 1B2RA 3QSYA 1RKBA 2E5WA 2I71A 4FHZA 4PZZA 3FUTA 3U7EB 4DT1A 2Y68A 4BLSA 3CRW1 1XU4A 1E1NA 1P7VA 3TD2A 1AGNA 1M67A 4RSHA 2XOXA 4GPIB 3HN6A 4RHCA 3E2PA 4ARSA 1ZA2A 5ES3A 2NACA 821PA 4RIFA 4UNSA 5MN6A 4B3DA 1JYFA 3HCCA 5AMXA 2F4VB 2QJTA 4A2PA 4EW2A 3RS9A 2H4HA 5KYUB 1ZGJA 1LDGA 2CLDX 2Y2UA 3UMGA 4QRHA 1KNXA 2IK8A 2VDMB 2VUUA 2XMDA 3F4KA 3H1AA 2RDMA 4NKRA 2NSJA 2W6CX 5BV8A 3ZVRA 2ZVPX 2JCSA 4AMVA 1MOQA 2X3YA 2PKQO 3INGA 2FUNB 4KXMA 3PF8A 4FIDA 4LJKA 2MCFA 4K03A 4URVR 2DQYA 3HY4A 5HIAA 3UMMA 2RIRA 4HV4A 3K5PA 2FG7C 3F71A 1XPRA 1JJBA 2NZUG 4YREA 3WE7A 4EX7A 1ZD3A 3JYLA 4ZOBA 3MD9A 2YIJA 4YMTA 1LRJA 2AZMA 1QFSA 4XFKA 4URYR 1M7HA 2WHXA 4XVRA 5K0EA 2O8BA 2XNDD 1UWKA 3P0HA 4E09A 1WOYA 1ZM9A 1ETHA 1D1QA 1JL3A 2QB5A 1L8LA 3JX9A 3PXGA 2ZTLA 3EC1A 1NXWA 1WDWB 2VYVD 4XUCA 3OCYA 3KSRA 3UIEA 3NB0A 1HUQA 4G5YA 4WXRA 4EL0A 4GPBA 2G0AA 5JDIC 3HBMA 4F6RB 2VPPA 4XE5A 2ZM5A 1GNRA 1T9GR 3CO0S 3GNSA 4IJ6A 2DWQA 4CMBA 2AK3A 3FI0A 1WZ2A 1D4ZA 4JC4A 3E84A 3LBYA 4OREX 3WMGA 2OY0A 3FGZA 4V1CB 4U9HS 4KGVA 2AX3A 2H9AA 3MJTA 4N8EA 4Y2RA 2JFVA 3OQIA 3BXGA 3GRZA 3GJ6A 1C7EA 2XUQA 4LJSA 1E6MA 5AOAA 2IHBA 3NBQA 5DGCA 3CNQS 3WK6A 1A8HA 1NQWA 2CDAA 1NJ8A 3HB0A 4U02A 4RDCA 2R25B 4TZTA 3VVLA 4FHDA 3WGNA 4QG3A 2Q28A 1US8A 3BYZA 3PNLA 1V6SA 4GZ5A 2GMWA 3G13A 4L8WB 4PXSA 1ZOPA 1XQWA 3JQAB 4IG9A 2NPFA 3OJFA 2YYZA 1A50B 1Z0IA 2OBLA 4II7A 1YTUA 3ZXIA 3LHFA 4RJTA 3U26A 2FFBA 1BCSA 2P0YA 1AA6A 1R0ZA 2WWGA 4XUGB 1P7PA 1QGUA 3KAPA 3GN1A 5EIBD 4KLNA 4O3MA 2HRQA 3T34A 3ZJ4A 1EVIA 5FPPA 7MDHA 3S5JA 1B6GA 3C41J 2COUA 2I7VA 3TK1A 3K9WA 3RROA 4R1NA 1F0NA 2YHUA 2RHBA 3KJFA 1SZJG 4GMHA 3UOGA 4D99A 1F7UA 3ZWPA 3Q88A 3ABRB 2ONYA 4JKIA 4TKZA 1WR8A 2QOEA 5AKZA 5AFSA 3K0CA 4RUKA 2A33A 2EHDA 1KF0A 4EKNB 4QU9A 1DAGA 1P45A 4FSXA 4TLEA 1DWOA 3HGQA 1GFWA 4IO0A 1W59A 5TMEA 3P9CA 2BHSA 4D9BA 5L4LA 4K26A 2PX4A 3V2IA 1IJFA 1X94A 4B4OA 2J8ZA 3JPWA 3TBFA 4L9AA 3V2GA 4D9JA 2RHHA 3S81A 3GT4A 4EF5A 1LNZA 4MPJA 1XR3A 4EKEA 5LA6F 3DLBA 1FK8A 4EUFA 1L4NA 3L7YA 2GPYA 3OOSA 1ZAKA 1G5RA 3DBHB 3QJ5A 2CNDA 2OB2A 3UBTA 4NJOA 4C30A 3EOZA 1DRVA 3JQEA 4IG4A 5CEFA 4WLOA 5TARA 1NNEA 1P6QA 2BZ1A 3WDLA 5GAJA 2OPBA 4DB2A 3KB6A 5AUOB 3TRFA 5H4HA 4M9RA 1KQNA 5ED4A 4NCKA 1YB1A 2H3HA 2TYSB 1WB4A 3R77A 4PSVA 3PJGA 1M54A 1MNQA 1HXHA 1XZEA 4YCBA 4EGQA 2QTTA 4L4ZA 2I7DA 1V5EA 4WE3A 3CRZA 1KMHA 4QBKA 1V3VA 5AQ1A 1LLDA 1AQUA 1JLLB 3LL7A 4P3XA 4HQOA 3ZK8A 1U2EA 3I04A 3N58A 5EMLA 1P4SA 4CODB 4DFDA 4HVTA 3U4CA 1EGQA 4JIMA 3WNBA 2Z2XA 4NU6A 4ANFA 1A9OA 2IHUA 2PYZA 1JBQA 2WKQA 1BOOA 2ZJ5A 4HH1A 4LOJA 4UU7A 1YZGA 4TWAA 3T3HA 3TR6A 3EODA 1X13A 5YASA 3UA3A 2PLWA 3AY0A 3WSWA 2FDXA 3DBRA 4L73A 5EMNA 3ZWNA 2AE2A 3ZW8A 4MIKA 5LA6A 3TX6A 2PVCA 2PKCA 4RV5A 2IEDA 2HU2A 2IZOA 4MZXA 4YAEA 3VYWA 5IASA 2BKLA 1EWVA 2IYZA 2OHGA 3LX5A 4LHWA 1Q1EA 2A0YA 3M1AA 1FFEA 4MOWA 4MUMA 4G0XA 3VDQA 1K5DA 1JR2A 4WBNA 3ZZTA 4KL8S 3WGQA 4B2LA 3WMWA 5JSYA 3NW9A 3RS8A 1W49A 1F8YA 4PLVA 4TWBA 2WU4A 3MN1A 5U4QA 5KSYA 1P0PA 4ZOLA 4KYVA 4I1YA 1WW3A 4FLMA 1P1JA 1IG3A 1SVSA 1Z26A 4K46A 1QTIA 4MV5A 5GM1A 3KM0A 1FDRA 1T2UA 3DTTA 2H1HA 4FDTA 3RYCB 2VZ0A 2MINA 2CV0A 3LOPA 4MB2A 4YPFA 4AO8A 1G3MA 2JD0A 3S8EA 1AF4A 2QD3A 3LKDA 2ZITA 4MDYA 4PZ0A 5AKXA 3RAFC 1BGWA 4KK3A 4TV9F 3B2NA 5DCWA 1GEGA 1DTWB 4IFIA 1QLHA 3KZKA 3OUZA 4J7CA 4OHMA 3T5MA 2UVPA 2Y66A 3TCXB 2OV2A 2BMJA 2D1FA 3V34A 1P0CA 3VPCA 1CRPA 2QRLA 1RM0A 1OAOA 5TEVA 4UAVA 2AOXA 4OQ4A 2VSFA 3MZ0A 3E22A 5DH9A 2GBIA 4PCUA 3H0CA 1KI3A 3HVUA 5HIMA 5K01A 1AURA 3L7LA 3NT2A 3C1UA 5EHGA 7ADHA 2VOJA 3RANA 3WMRA 2BMEA 3TUZC 4C01A 1DV2A 3EQ9A 5JJKA 1IMJA 3ASZA 3IIIA 3WYCA 4JJGA 2YVKA 1G5PA 4ZQFA 2AUMA 1GGFA 3RSCA 2PUHA 4JQZA 5IM5A 2VDWA 2ZSUA 4YJHB 3CZ4A 2ZJYA 2ZUWA 4GP6A 1ZSNA 2O05A 4LWOA 2UKDA 3WQRA 4JYMA 4MUNA 2R60A 3DAGA 1HK7A 4HP8A 1UKBA 2IYNA 2JAUA 3LPLA 4RSRA 1H0KA 2CE2X 1ZIYA 1LNQA 4HNRA 3KEFA 3MAGA 2BH9A 1FZTA 3L7MA 4FCWA 2JGJA 2KMLA 3VTZA 4PG5A 3R40A 5HF8A 3NGXA 2AR7A 3I34X 4BFYA 1BRMA 3HY3A 3QF7A 3L1KA 4AC9A 1NYRA 1O0SA 3INYA 1GZDA 1LNSA 2XVZA 3DEZA 3HRKA 5D3MB 1PJ8A 2R87A 4URFA 5B3JC 1QIEA 1YJXA 1NW5A 2VT6A 1LXCA 1NR7A 4KZPA 3QWIA 1G17A 3ROGA 1USGA 2FHSA 3VR6H 3ZBQA 4LPKA 4A2WA 1U2GC 4ARVA 1IRXA 5BVGB 2VJCA 2PA3A 1AS3A 1KZYC 3LU1A 2BFDB 3NNDA 3EQ6A 4MYDA 3NIBA 2CFOA 3VI3B 2P9ZA 2Q9UA 1YUBA 5T3YA 3X44A 3A8TA 1QPBA 2VK8A 1G42A 2DERA 1KXZA 2IOQA 1E9RA 2G7ZA 2JLSA 4CYMA 2VH5R 2HXSA 4IL5A 4MCIA 3VVCA 4EMBA 5BV2P 2OCXA 3PTZA 1GUBA 5WRFA 5J59A 3V4VB 3NEJA 5FOTA 3GJ3A 1MB3A 5EIXA 1DCTA 2IYEA 2CB9A 2WUGA 5IAOA 2IIPA 1QV6A 1LLFA 3RYCA 2E1PA 2IFTA 3IVCA 1UBRS 5BR4A 4EPXA 2XQGA 2HPHA 3U7HB 1TM3E 2YBDA 1M8JA 3PNKA 3E3LA 4GPD1 3G2LA 5HGJA 3ZN2A 5JAUA 3QTTA 1YMUA 2QL9A 4ALIA 1YQQA 1R16A 1UAYA 4ZTUB 4ZO7A 2PUJA 4UCXA 1VMAA 4WI1A 4WL0A 1Z2PX 2PLAA 3SDZA 1XEXB 2FN8A 4TSRA 4MI6A 3L1IA 4O5OA 1WUIS 1XEWY 4GUAA 3LAWA 5BSMA 4DMUB 4FKBA 1U0LA 3ORFA 3RTGA 2FLKA 3MA0A 4MV9A 2OFWA 4UNNA 3ZHUA 3R0JA 5F23A 1TOAA 1IE3A 1LDEA 2YASA 4G5QA 1CRQA 5CVCA 3D54D 1EA7A 2C7BA 4JLWA 1J24A 1E94E 2HLDA 3QU4A 4LRQA 5KVAA 3C3AA 4RU1A 4F9GA 4HY3A 4J9VA 1RDFA 3FRIA 5IXSA 5IAEA 4BMSA 3BCRA 2GQ0A 1DG3A 3HJGA 2C2MA 1OKKA 5DGTA 3A4TA 3BE8A 1L7PA 3CUTA 4K0RA 1PJ2A 2G77B 1V3QE 3SC6A 1JXOA 1K8QA 5K3CA 3WXBA 1PT6A 3MTEA 4BVGA 2XBMA 4HSGA 3ZCXA 4FOOA 1C1YA 1ZD9A 3DA8A 3FTCA 5IF9A 2PRIA 4J9UE 4B7CA 4LQ4A 1LS1A 1E79A 2VCEA 5ESWA 2FN9A 2ZBPA 1WHSB 4RZIA 3HVHA 4Y2JA 2KM1A 1OI2A 1AUQA 3WK8A 5HZGA 5AVZA 4XIJA 1C5KA 4BNZA 1M6VA 1NUHA 2O0LA 2JH9A 2B0JA 1CUBA 3N7UA 5ENVA 1W0JA 3IHKA 2FEOA 1GYPA 1ODTC 3FW1A 2A30A 3ILHA 1C9JA 5FADA 1ONNA 1RRFA 5EQJB 3HLYA 2P35A 3AFOA 2HWXA 3Q10A 1MJ5A 4JI6B 5CD1A 2I1LA 1Z29A 3EFOB 4QTXA 4TXMA 2O59A 2QN3A 2WFAA 4CZ2A 2ZIXB 2JPDA 1UBSB 3NHPA 2Q3FA 5CYPA 2HTEA 1KFKB 1UEIA 2Q1UA 1BWSA 3EDRA 4HRXA 4BNGA 2J41A 1IY0A 2CHQA 2IU3A 1P33A 4D45A 1KVSA 1H8EA 1KZ9A 4FC7A 4MGYR 5F76A 1ISIA 3O8RA 2A0KA 4M1YA 3EMDA 1KETA 4PC2A 3MAAC 4OM7A 2GN8A 4LV8B 1W34A 1E1MA 3AHIA 3LWBA 1EFVA 4DCTA 4CTJA 1U2DA 2O8DB 1H8HA 1CJTC 2J6CA 4TM8A 1F2VA 1Y89A 3KR2A 2ZIZA 4L85A 1DX9A 2OHXA 4HOYA 1R18A 1MVLA 1UKZA 1IAVA 2YQ4A 4YXWA 3PIRA 4IXTA 4BNDB 5LDHA 3D02A 3DUWA 3GO4A 4G65A 5D1HA 5EXXA 3ZWCA 3ICWA 4JIGA 5KINB 1G20E 1L1QA 2EVWX 2PKEA 4XCXA 1I14A 4EY8A 3PFFA 3H0EA 3QJGA 4YUWA 1JWBB 1KI1A 4WXHA 4AJEA 1QAQA 4WK0B 4OQLA 2EQBA 1YA8A 1O6FA 5EWJB 4K8OA 3RNLA 4NBSA 2JIDA 4LYJA 3AH8A 3VC2A 4E33A 1C3JA 3EAGA 4WOKA 4F2GA 5EC8A 2OQIA 2QT0A 2XHZA 3O75A 2WJHA 2NYRA 1KTIA 3MMXA 1WJGA 1JEQA 5JZ9A 4EI9A 5IWAB 2Q5OA 3QVGB 5FPQA 1TVKA 2CK3A 1N0UA 1Z4MA 1ZGAA 2QN7A 2VXBA 1ZESA 2WY2D 2CL0X 2Z3WA 1B8PA 3FHLA 4E1BA 3Q9NA 3KHSA 2XE4A 2BFOA 5MFZA 1A9XA 4KGXA 4LF8B 1O9HA 1N2SA 4PZYA 5KKCA 1Z15A 4DA0A 3WGUA 3JVUA 1P0QA 4CM8B 4BECA 3U1BA 4YT8A 2K7ZA 1Y9AA 3RLIA 2ISCA 1PG0A 4NZNA 2HLDD 3S68A 4CV3A 1U8XX 3A9VA 5K0NA 1SKUA 3EUEA 2RHCA 2YXPX 1HTBA 3FFTA 5DI9A 3WLKX 4RESA 4JI7B 2B6NA 4AQ7A 1ZK0A 3MILA 3LFTA 2EYQA 3R6GA 3D6VA 2PS1A 5CVUA 5L7YA 1MB4A 1THTA 1QIMA 4TQGA 2PK3A 4LBWA 1BYIA 1SXJB 2XMRA 2AWOA 4DMGA 5JZOA 2RC6A 5FI5A 4A8JC 1I4WA 1H2BA 3SHVA 1S1MA 2QX7A 4XCVA 4E3ZA 1M5RA 5ALWA 2QHXA 3O2SB 1N6LA 4D9IA 2UXCB 4MW6A 1CUYA 2WJVA 2ANCA 1E79D 2QY9A 3AKCA 1FRQA 4RADA 1SHZA 3LIIA 2OG1A 3TRKA 1JG1A 1V1MA 4K3VA 4B87A 3LX6A 1VBMA 5GOZA 3IXMA 5KTKA 5C9ZA 2CJYA 3MCVA 1KC1A 4H1VA 4U2GA 1PIWA 4PNEA 1P60A 2YINC 2X4LA 3U1VA 1NJ5A 1JJ7A 4J1NA 3NFRA 5TB5A 1ZUD1 4E2YA 5HUJA 2PLRA 2WINI 1U2DC 1CG6A 1DXQA 5ALLA 2J3LA 1WVIA 4CLOB 1HE2A 3PPVA 3W77A 4YDRA 1WKBA 4DLPA 2OK8A 2JJMA 1LV7A 2Q1WA 2YZ7A 3KEMA 1YZTA 1FXWA 1I30A 1PR9A 2ETVA 1FQJA 2JANA 2O52A 1EDBA 3STTA 2GFHA 4A3SA 1E69A 1MBZA 3AEKA 1U28C 3HCRA 3AG5A 3ASVA 4ZAFA 4LQCA 1HMYA 2EOAA 3SZ3A 4BTLA 4DJTA 1AZWA 3ILYA 4GM0A 1V3TA 4AS3A 4CM4B 3I2GA 1Y8CA 3U4AA 2ERCA 3RBAA 2W6ZA 2G09A 2WU1A 3KT0A 3FHTA 3C87A 4GVLA 1N92A 4MYCA 4S3MA 1UP7A 3SJAA 4ZCSA 1QANA 1X86B 1XTIA 4GXRA 3HCBA 2I5PO 3Q1LA 4PYLA 1PVOA 5FKJA 4AN0A 4JI4B 3UJ6A 3IJ5A 3KE8A 1J99A 2IGBA 5BORA 3EB9A 3JYQA 3TDMA 3PWZA 2REQB 2ZPTX 4FW8A 1XIVA 1FYDA 2I4NA 1MRSA 4XDZA 3LP8A 1H5UA 4CNBA 1B0ZA 4HC4A 4P4GA 2Q3MA 4YC7A 4YRCA 1UDBA 5LOVB 1R4MA 3PHGA 2Z8YA 4GFDA 3TPFA 4CTNA 2AIRA 2J3EA 4D2IA 1ZMTA 2DGDA 3GUYA 3AOEC 3V8BA 3GEBA 1TQ6A 3QOFA 2XYQA 4HTFB 4ZT7A 2HB6A 1UZAA 1ZL0A 2OAP1 1V47A 3DSRA 3LBIA 4O4HF 5EVJA 3TEMA 4JZKA 4W5QA 3L1UA 1UP6A 5DMHA 2I8LA 2D0DA 1Y6ZA 4LZPA 3QX7A 1MA0A 1N7IA 4JR0A 5JV5A 4YJDA 3VISA 5LQRA 4KI0A 2BFAA 2ZS7A 4WLUA 1O4WA 4LIPD 4O1HA 1RU3A 1WO8A 2P68A 1HTTA 2IYQA 4XX0A 4D43A 1AGPA 1NYTA 2X7HA 1R3DA 5E6RB 4JLKA 4TXNA 1YO6A 2JS7A 4ARUA 1T36B 2XD9A 2E18A 3DB1A 3TMAA 4R1OA 1XU7A 2GI4A 1WDLA 2QORA 3H19A 3K1AA 3QRWA 4C5AA 3STUA 4F9FA 3ZVKA 1E5DA 2RKOA 4H7KA 1YSCA 3ELUA 4P80A 1YZFA 3K4PA 5J40A 4BJ6A 4BO3A 3T1HB 4CEIA 3VAYA 2JZOA 3ES9A 3O8CA 5JSUA 5FEMA 4BJHB 3GC6A 2N47A 2JLZA 4V02A 1E3WA 4ER5A 2VTVA 3O8QB 3UWDA 3R3ZA 1DOAA 4DA4A 4Y6QA 4ALNA 4R2XA 1SY7A 1I2MA 2FF5A 4HYEA 1J20A 2B20A 5MGNA 1G8AA 3D4PA 3L4KA 1P1CA 2OQ2A 2D5LA 1G66A 2V58A 4GR5A 4ZC1A 4B3BA 3QYAA 1YS6A 4D8YA 3WRVA 2JFOA 4ZCPA 1D4FA 2GTIA 2WTEA 3Q8WA 4DSZA 4IH9A 2OMKA 4I50A 1MP0A 1SEPA 1TKCA 2JB9A 1MO4A 1YCFA 2WKWA 1AKYA 1RE1A 1LSUA 1U2GA 5AJYA 3RDPA 3UQYS 3V7FA 3R7SA 1T8UA 1PWYE 1FP7A 4G0UA 2HW8A 2H1RA 1AQ6A 1HG0A 4ENTA 4IP0A 1O58A 1XMVA 2RG7A 3QE3A 3QE9Y 1DPGA 1ZN8A 2WM2A 2VSYA 3I6IA 4FCTA 3REQA 4NZMA 4DMRA 4MR9A 3GDGA 3HWWA 4IDNA 1G63A 3NC1C 4HADA 1JMYA 5DVZA 4IDQA 1KSGA 1K63A 1JDBB 3IEIA 1HL7A 4JVMA 4YQZA 4DIUA 3HSKA 1O96A 4M54A 4JQSA 2CDBA 4RX1A 2GJ9A 3SQNA 5EJ8A 4MA4A 1TU4A 2R6CA 1OTYA 4ZI2A 4AWXA 4Y6GB 1DKUA 1D9ZA 1W48A 3MOIA 3H2HA 2Y9PB 3WICA 3U4QB 2O3JA 3CKYA 4GM1A 1O94D 3VPHA 2WF5A 4F91B 1AV6A 5HIIA 2WLSA 4PX2A 2Q6VA 3CE6A 3NIDB 4A9AA 1SIWA 4BTVA 3F67A 4DA7A 4RDXA 1K8ZB 4C3VA 3IE2A 3OT5A 4UFPA 3C6YA 1K5HA 3OE5A 3DB2A 2Q4RA 5CB4B 5AVVA 3CVJA 3BD9A 5JNWA 3K20A 3NALA 5FWDA 3R20A 1AT1A 1JBKA 1NXQA 4PRZA 4X3OA 1U81A 4XJTA 3BB4A 4B3RB 1TYBE 1EFUA 4KR6A 1HT0A 2H65A 3W78A 1IHPA 3PD7A 2WVJA 4NENB 2FSHA 3EDMA 4YRNA 4I99A 3OQPA 5BPFA 5K0JA 2VN8A 4XSHA 4BO8A 1OUMA 4YYEA 1BQ3A 1YRLA 2Q9BA 2WJZB 5CK4A 5F78A 1T2CA 2ORWA 3PE4A 4I55B 1RCFA 2CD7A 1EGMB 2CVQA 2ROQA 3FWZA 4HQRA 3V46A 5KYWA 2EGUA 3OOEA 1CQIA 1RWVA 2QUHA 3BCUA 3M4YA 3RJTA 3OWXA 4NU0A 5LL6P 1YS7A 1SZPA 1W29A 1ZGGA 4LRSB 421PA 2GNAA 4ND7A 1NMSA 1V48A 1UXIA 3T4EA 4CBVA 3K73O 1KQOA 1P9WA 2QJOA 3H2JA 3KVRA 3Q2IA 4QLOA 2AEEA 4XJXA 4CETA 5IF3A 5EZ6B 3UGJA 3UATA 3GFVA 1CJBA 4MVWA 4LC1A 4QUHA 2IRWA 1CK4A 5C4GB 3MXOA 4OMFG 3I4LA 1PK7A 2FEMA 3C5VA 1KEEB 1MRZA 3KVVA 4FUQA 1M8KA 3FPCA 4MQLA 3C5WP 1FXSA 4X41A 1IUNA 4YECA 1O77A 3BMXA 3ZLTA 4QX6A 3HZHA 1RBYA 5BW5A 5FI3A 1W88B 4GBMA 3AM1A 4MUXA 4MUAA 1WXGA 2HXYA 3A3PA 2C7OA 2V6MA 3I8XA 2ZANA 3BMQB 1IBMB 1R0RE 1C7QA 1JF8A 3F6CA 1EP2B 1S1CA 3GT0A 3OCWA 4LJRA 4JJ6A 3V7WA 4CJXA 1ML4A 3RVBA 3OM1A 3PNOA 2VH1A 2YDXA 2PRZA 4WKGA 4BLOA 5AJUA 1NOIA 3LVRE 2G1KA 2V96A 2J67A 4HN2A 4G4SP 1Z7WA 3NHWA 4URUR 3ZLUA 4DEYA 1QGUB 3M6XA 4UTPA 3WYGA 5K8JB 3AEUB 1A8PA 4TV8A 4MWDA 3F7OA 5MF6A 2OV3A 4IZHA 5FA6A 2R8PA 3LHKA 2GAFA 5DU2A 3RK0A 4UZFA 3CO5A 5ABPA 3WGKA 5T4BA 3ZWBA 5JBIA 1AGRA 4F3CA 2DHQA 4FT2A 1XPJA 5CDHA 4S05A 1X7YA 4R2JA 5CW1A 4HVAA 4EABA 2V8BA 3U16A 2GPAA 2GB4A 4KIJA 1QX3A 2V98A 4YB8A 1KEKA 1P73A 3DVLA 1LBHA 2GK6A 3LUHA 4OA8A 4QJBA 4QYIA 3TQOA 1XLTA 4BVEA 1JH8A 3DGFC 4H7PA 1ODSA 3VKVA 4U2BA 4BAZA 2QE6A 3ZC3A 3KAQA 1IZYA 1MB0A 2MTBA 1P5HA 4G5GA 1DFIA 2IX9A 3KXDA 4ARBA 3KQHA 3PSAA 3SC4A 2X4GA 4BKOA 3ENNA 3P9XA 4WJKB 3HI4A 3N2YA 5B55A 4H18A 621PA 1EP1B 1QHFA 2JRCA 2YBEA 2F43B 1DIOB 1J0CA 3I83A 4RK1A 4RQUA 3OX3A 4Z99A 2ZI7A 2WWVD 3TKAA 3BK1A 2VDJA 1OLSB 4LX8A 4YGXB 1ZJYA 2G6TA 4YRPA 3ZIAD 5IDXA 3DEYX 4FBLA 3FI9A 4EG8A 3TLEA 1ESEA 4GS5A 4UNRA 3WLTA 3DBHA 3ORRA 4RZXA 3BBPA 1BMDA 3I62A 3WK4A 1P9RA 4NBWA 4YJ2F 3TFOA 3O84A 1X8LA 4LDAA 2JVKA 5TPZD 3CIFA 1PUJA 1W35A 4O2RA 2JVJA 1SXGA 2O7RA 1HT1E 4FDAA 4OOEA 1X1TA 3WS7A 2AR0A 5T4FA 3KQSA 1I80A 1ZH2A 1JLHA 4CF7A 2CK3D 2FZ5A 3E9CA 3U4HA 4GWKA 2WA2A 3IELA 2EFDB 3DAYA 4RFLA 5AK6A 4ZRDA 1OXBB 3CZMA 4TMZA 3IH5A 1KTVA 1TUBA 4HATA 3RD5A 2J48A 1KXJA 4AF8A 4IVNA 3CUWA 2O2EA 3O4IA 5GJCA 5KSPA 5CLFA 1UANA 3LXRA 1A9SA 1Z82A 1GN8A 2X86A 3D4OA 3HCNA 4P81A 2X5XA 4X1IA 4CV2A 2ZAIA 3O4VA 2H8KA 3FGPA 4P36A 5D87A 3W2EA 1POXA 3WQBA 1LI4A 3STHA 3HXTA 5EJ2A 1XELA 4IIUA 4CKEB 3J80A 5LMCA 5CH3A 4E1AA 4MWBA 2R2AA 3ZH9B 3F6RA 3KQUA 1Y6JA 3K0FA 1UPAA 1W44A 3FVWA 3KLPX 3ESCA 1DPFA 1T1EA 4HDSA 1UK6A 3QOYA 2NZJA 4JJ8A 4UU8A 4ZDKA 1JG4A 3RFVA 3HU5A 3H1GA 3W1WA 2GN6A 2XB2A 4B84A 3PS9A 1ST2A 3P32A 3PUHA 1YHYA 3UB4A 1MVOA 1WZCA 4N3GA 3GGDA 1CUAA 1SRQA 2H4YA 1T2NA 3D3QA 2FK8A 3WLFA 4B3HA 5B5SA 4F46A 2YL2A 1FDTA 1QCDA 4INOA 5BNWA 4O2AA 3FR8A 3KUCA 3RBXA 5CFNA 4YCCA 4IJMA 3VYSB 5DHTA 1LQUA 2ZYHA 1MFZA 2FZWA 1H6CA 2I2FA 4PBTA 4B31A 5AVUA 3D31A 3GPLA 3LSYA 5ILOA 3NU1A 4BBJA 4PHGA 2C94A 3MTDA 1YJAA 1GXSB 2FSGA 4UNQA 1XAJA 3VAAA 4S1NA 1CF2O 3GFRA 4WQMA 3VHLB 1E20A 4JB2A 2WWRA 2V59A 3MW8A 3Q9UA 2IP1A 3V8EA 1HGXA 3WG9A 2HCRA 2HNKA 4I0WB 4TRMA 3GNQA 3RH0A 1YZHA 1ZI9A 2AW3A 3NEYA 1UOQA 1KAGA 4GH5A 4U2CA 2PGXA 3FTEA 4Z1OA 4TLBA 4HDAA 3KUXA 5MDHA 3PGKA 1VGRA 2CLFB 4PIVA 2EDAA 4UHFA 3MRXA 2IUTA 2NYVA 3TQHA 4C7KA 3DQZA 2WIBA 2XX3A 3JQBA 5LMZA 2A9VA 3IXQA 2WYOA 3N2LA 4JOBA 5KPJA 4Y6LA 3L8FA 1JR6A 1SEVA 3KFXA 5IU6A 2YZ2A 5HUQA 3T7CA 1QGED 5LP6A 4ZRMA 2PZLA 3NTXA 2MT9A 4OUDB 1CC1S 4XWYA 1DWQA 2GVDC 3UFXB 3W05A 5CIQA 3THYB 3B8HA 1GZ3A 4DIDA 2Y27A 3VFDA 2IKSA 1CR0A 4IUDS 3ZHZA 1N0IA 4D6XA 3B6IA 4RH1A 5K45A 5JJ5A 3WFIA 1Z6TA 4LEIA 1IM8A 1TF5A 1CUZA 4IINA 4E11A 3WAKA 4G07A 3WDKA 3QKRB 1YK0A 4DANA 1IUPA 3RAJA 2IPOA 4GLLA 2GWHA 2XADA 2AQIA 1COWA 2O4UX 1S02A 3SQLA 3RARA 4KFCA 4H35A 4N7RA 3ZVNA 3UFBA 4RD4A 1RZVA 1LF0A 2ECOA 4TYPA 1RYHA 3FIJA 1JQKA 4PZCA 5D3MA 4AYXA 2HQSA 3WY9A 3GQVA 3FOEC 3CX7A 4KWTA 5CBPB 4DR5B 1JQBA 2VAWA 1J9GA 4Q1VA 1G16A 3BL6A 5L9AA 2IH4A 3MUFA 3GLIB 2FXVA 4Q12A 1M9NA 4DRXA 5HVNA 1D2GA 4FNAA 4PAQA 4R1SA 2W6OA 2XUOA 1PLKA 3NANA 4OJQA 1GAJA 2YW2A 1MAAA 3LT1A 4YRBA 4Y0NA 4UBJA 2NSDA 1CYDA 3HCFA 2YXEA 4FEGA 1GLNA 3EZ2A 4CU5A 1NBAA 3ZCQA 1NBHA 2JH3A 3ITDA 1M0TA 3OEED 4US2R 5CHYA 5DHFA 5KYGA 4JB8A 4EF6A 2PGNA 3FYDA 1IZ8A 5IULC 3IPRA