2V4XA

Crystal structure of jaagsiekte sheep retrovirus capsid n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
131
structure length
131
Chain Sequence
PVFENNNQRYYESLPFKQLKELKIACSQYGPTAPFTIAMIENLGTQALPPNDWKQTARACLSGGDYLLWKSEFFEQCARIADVNRQQGIQTSYEMLIGEGPYQATDTQLNFLPGAYAQISNAARQAWKRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Capsid Amino-Terminal Domain from the Betaretrovirus, Jaagsiekte Sheep Retrovirus.
pubmed doi rcsb
source organism Jaagsiekte sheep retrovirus
molecule tags Viral protein
molecule keywords CAPSID PROTEIN P27
total genus 46
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2v4xA00
4PH3A 1U7KA 4U0FA 4B4NA 4J93A 1G03A 4QNBA 4E91A 1EM9A 4PH0A 5JPAA 2JPRA 1P7NA 1AK4C 3H47A 4INBA 1EIAA 4U0BA 2XDEA 4XFZA 4DGEC 1M9YC 5HGMA 1M9XC 5HGNA 1D1DA 3H4EA 2M8LA 1M9EC 2EIAA 2LF4A 2PWMA 2WLVA 2X2DD 4DGAC 2XGVA 1L6NA 1M9CC 4LQWC 4XFXA 4U0CA 2GOLB 2M8NA 4U0EA 1QRJA 4U0DA 1E6JP 2Y4ZA 3NTEA 2PXRC 4XRQA 4E92A 5HGKA 3MGEA 2X82A 2X83A 2GONA 2XGYA 2KGFA 2XGUA 4U0AA 4XROA 3P05A 5HGLA 5HGOA 4NX4C 1M9DC 2V4XA 4PH2A 4XFYA 4HTWA 1AFVA 2PWOA 3BP9A 1M9FC 1GWPA 2WLVB 4WYMA 2M8PA
chains in the Genus database with same CATH superfamily
4PH3A 1U7KA 4U0FA 4B4NA 4J93A 1G03A 4QNBA 4E91A 1EM9A 4PH0A 5JPAA 2JPRA 1P7NA 1AK4C 3H47A 4INBA 1EIAA 4U0BA 2XDEA 4XFZA 4DGEC 1M9YC 5HGMA 1M9XC 5HGNA 1D1DA 3H4EA 2M8LA 1M9EC 2EIAA 2LF4A 2PWMA 2WLVA 2X2DD 4DGAC 2XGVA 1L6NA 1M9CC 4LQWC 4XFXA 4U0CA 2GOLB 2M8NA 4U0EA 1QRJA 4U0DA 1E6JP 2Y4ZA 3NTEA 2PXRC 4XRQA 4E92A 5HGKA 3MGEA 2X82A 2X83A 2GONA 2XGYA 2KGFA 2XGUA 4U0AA 4XROA 3P05A 5HGLA 5HGOA 4NX4C 1M9DC 2V4XA 4PH2A 4XFYA 4HTWA 1AFVA 2PWOA 3BP9A 1M9FC 1GWPA 2WLVB 4WYMA 2M8PA
chains in the Genus database with same CATH topology
4PH3A 1U7KA 4U0FA 4B4NA 4J93A 1G03A 4QNBA 4E91A 1EM9A 4PH0A 5JPAA 2JPRA 1P7NA 1AK4C 3H47A 4INBA 1EIAA 4U0BA 2XDEA 4XFZA 4DGEC 1M9YC 5HGMA 1M9XC 5HGNA 1D1DA 3H4EA 2M8LA 1M9EC 2EIAA 2LF4A 2PWMA 2WLVA 2X2DD 4DGAC 2XGVA 1L6NA 1M9CC 4LQWC 4XFXA 4U0CA 2GOLB 2M8NA 4U0EA 1QRJA 4U0DA 1E6JP 2Y4ZA 3NTEA 2PXRC 4XRQA 4E92A 5HGKA 3MGEA 2X82A 2X83A 2GONA 2XGYA 2KGFA 2XGUA 4U0AA 4XROA 3P05A 5HGLA 5HGOA 4NX4C 1M9DC 2V4XA 4PH2A 4XFYA 4HTWA 1AFVA 2PWOA 3BP9A 1M9FC 1GWPA 2WLVB 4WYMA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH3 A;  1U7K A;  4U0F A;  4B4N A;  4J93 A;  1G03 A;  4QNB A;  4E91 A;  1EM9 A;  4PH0 A;  5JPA A;  2JPR A;  1P7N A;  1AK4 C;  3H47 A;  4INB A;  1EIA A;  4U0B A;  2XDE A;  4XFZ A;  4DGE C;  1M9Y C;  5HGM A;  1M9X C;  5HGN A;  1D1D A;  3H4E A;  2M8L A;  1M9E C;  2EIA A;  2LF4 A;  2PWM A;  2WLV A;  2X2D D;  4DGA C;  2XGV A;  1L6N A;  1M9C C;  4LQW C;  4XFX A;  4U0C A;  2GOL B;  2M8N A;  4U0E A;  1QRJ A;  4U0D A;  1E6J P;  2Y4Z A;  3NTE A;  2PXR C;  4XRQ A;  4E92 A;  5HGK A;  3MGE A;  2X82 A;  2X83 A;  2GON A;  2XGY A;  2KGF A;  2XGU A;  4U0A A;  4XRO A;  3P05 A;  5HGL A;  5HGO A;  4NX4 C;  1M9D C;  2V4X A;  4PH2 A;  4XFY A;  4HTW A;  1AFV A;  2PWO A;  3BP9 A;  1M9F C;  1GWP A;  2WLV B;  4WYM A;  2M8P A; 
#chains in the Genus database with same CATH topology
 4PH3 A;  1U7K A;  4U0F A;  4B4N A;  4J93 A;  1G03 A;  4QNB A;  4E91 A;  1EM9 A;  4PH0 A;  5JPA A;  2JPR A;  1P7N A;  1AK4 C;  3H47 A;  4INB A;  1EIA A;  4U0B A;  2XDE A;  4XFZ A;  4DGE C;  1M9Y C;  5HGM A;  1M9X C;  5HGN A;  1D1D A;  3H4E A;  2M8L A;  1M9E C;  2EIA A;  2LF4 A;  2PWM A;  2WLV A;  2X2D D;  4DGA C;  2XGV A;  1L6N A;  1M9C C;  4LQW C;  4XFX A;  4U0C A;  2GOL B;  2M8N A;  4U0E A;  1QRJ A;  4U0D A;  1E6J P;  2Y4Z A;  3NTE A;  2PXR C;  4XRQ A;  4E92 A;  5HGK A;  3MGE A;  2X82 A;  2X83 A;  2GON A;  2XGY A;  2KGF A;  2XGU A;  4U0A A;  4XRO A;  3P05 A;  5HGL A;  5HGO A;  4NX4 C;  1M9D C;  2V4X A;  4PH2 A;  4XFY A;  4HTW A;  1AFV A;  2PWO A;  3BP9 A;  1M9F C;  1GWP A;  2WLV B;  4WYM A;  2M8P A; 
#chains in the Genus database with same CATH homology
 4PH3 A;  1U7K A;  4U0F A;  4B4N A;  4J93 A;  1G03 A;  4QNB A;  4E91 A;  1EM9 A;  4PH0 A;  5JPA A;  2JPR A;  1P7N A;  1AK4 C;  3H47 A;  4INB A;  1EIA A;  4U0B A;  2XDE A;  4XFZ A;  4DGE C;  1M9Y C;  5HGM A;  1M9X C;  5HGN A;  1D1D A;  3H4E A;  2M8L A;  1M9E C;  2EIA A;  2LF4 A;  2PWM A;  2WLV A;  2X2D D;  4DGA C;  2XGV A;  1L6N A;  1M9C C;  4LQW C;  4XFX A;  4U0C A;  2GOL B;  2M8N A;  4U0E A;  1QRJ A;  4U0D A;  1E6J P;  2Y4Z A;  3NTE A;  2PXR C;  4XRQ A;  4E92 A;  5HGK A;  3MGE A;  2X82 A;  2X83 A;  2GON A;  2XGY A;  2KGF A;  2XGU A;  4U0A A;  4XRO A;  3P05 A;  5HGL A;  5HGO A;  4NX4 C;  1M9D C;  2V4X A;  4PH2 A;  4XFY A;  4HTW A;  1AFV A;  2PWO A;  3BP9 A;  1M9F C;  1GWP A;  2WLV B;  4WYM A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...