2V4XA

Crystal structure of jaagsiekte sheep retrovirus capsid n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
131
structure length
131
Chain Sequence
PVFENNNQRYYESLPFKQLKELKIACSQYGPTAPFTIAMIENLGTQALPPNDWKQTARACLSGGDYLLWKSEFFEQCARIADVNRQQGIQTSYEMLIGEGPYQATDTQLNFLPGAYAQISNAARQAWKRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN P27
publication title Structure of the Capsid Amino-Terminal Domain from the Betaretrovirus, Jaagsiekte Sheep Retrovirus.
pubmed doi rcsb
source organism Jaagsiekte sheep retrovirus
molecule tags Viral protein
total genus 46
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2v4xA00
1U7KA 4XFZA 4PH0A 1AFVA 4QNBA 2XGUA 1M9FC 3H47A 4PH3A 2LF4A 5JPAA 2GONA 2XGVA 4XFYA 2X82A 1M9CC 4XROA 2GOLB 2WLVA 5HGMA 5HGOA 4NX4C 4E92A 2JPRA 4U0DA 4WYMA 2KGFA 1AK4C 1GWPA 3MGEA 2M8LA 4DGAC 1EM9A 4E91A 2M8PA 5HGKA 4DGEC 4HTWA 4LQWC 3NTEA 2XDEA 1EIAA 4U0EA 4U0CA 2X2DD 2PWMA 1E6JP 2PWOA 1P7NA 2Y4ZA 2M8NA 4XFXA 5HGNA 2X83A 1L6NA 4B4NA 4U0FA 2V4XA 2WLVB 5HGLA 4XRQA 4PH2A 4J93A 4U0AA 2EIAA 3P05A 3BP9A 1M9XC 1M9DC 3H4EA 1M9YC 1D1DA 2PXRC 1G03A 4U0BA 1QRJA 4INBA 2XGYA 1M9EC
chains in the Genus database with same CATH superfamily
1U7KA 4XFZA 4PH0A 1AFVA 4QNBA 2XGUA 1M9FC 3H47A 4PH3A 2LF4A 5JPAA 2GONA 2XGVA 4XFYA 2X82A 1M9CC 4XROA 2GOLB 2WLVA 5HGMA 5HGOA 4NX4C 4E92A 2JPRA 4U0DA 4WYMA 2KGFA 1AK4C 1GWPA 3MGEA 2M8LA 4DGAC 1EM9A 4E91A 2M8PA 5HGKA 4DGEC 4HTWA 4LQWC 3NTEA 2XDEA 1EIAA 4U0EA 4U0CA 2X2DD 2PWMA 1E6JP 2PWOA 1P7NA 2Y4ZA 2M8NA 4XFXA 5HGNA 2X83A 1L6NA 4B4NA 4U0FA 2V4XA 2WLVB 5HGLA 4XRQA 4PH2A 4J93A 4U0AA 2EIAA 3P05A 3BP9A 1M9XC 1M9DC 3H4EA 1M9YC 1D1DA 2PXRC 1G03A 4U0BA 1QRJA 4INBA 2XGYA 1M9EC
chains in the Genus database with same CATH topology
1U7KA 4XFZA 4PH0A 1AFVA 4QNBA 2XGUA 1M9FC 3H47A 4PH3A 2LF4A 5JPAA 2GONA 2XGVA 4XFYA 2X82A 1M9CC 4XROA 2GOLB 2WLVA 5HGMA 5HGOA 4NX4C 4E92A 2JPRA 4U0DA 4WYMA 2KGFA 1AK4C 1GWPA 3MGEA 2M8LA 4DGAC 1EM9A 4E91A 2M8PA 5HGKA 4DGEC 4HTWA 4LQWC 3NTEA 2XDEA 1EIAA 4U0EA 4U0CA 2X2DD 2PWMA 1E6JP 2PWOA 1P7NA 2Y4ZA 2M8NA 4XFXA 5HGNA 2X83A 1L6NA 4B4NA 4U0FA 2V4XA 2WLVB 5HGLA 4XRQA 4PH2A 4J93A 4U0AA 2EIAA 3P05A 3BP9A 1M9XC 1M9DC 3H4EA 1M9YC 1D1DA 2PXRC 1G03A 4U0BA 1QRJA 4INBA 2XGYA 1M9EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7K A;  4XFZ A;  4PH0 A;  1AFV A;  4QNB A;  2XGU A;  1M9F C;  3H47 A;  4PH3 A;  2LF4 A;  5JPA A;  2GON A;  2XGV A;  4XFY A;  2X82 A;  1M9C C;  4XRO A;  2GOL B;  2WLV A;  5HGM A;  5HGO A;  4NX4 C;  4E92 A;  2JPR A;  4U0D A;  4WYM A;  2KGF A;  1AK4 C;  1GWP A;  3MGE A;  2M8L A;  4DGA C;  1EM9 A;  4E91 A;  2M8P A;  5HGK A;  4DGE C;  4HTW A;  4LQW C;  3NTE A;  2XDE A;  1EIA A;  4U0E A;  4U0C A;  2X2D D;  2PWM A;  1E6J P;  2PWO A;  1P7N A;  2Y4Z A;  2M8N A;  4XFX A;  5HGN A;  2X83 A;  1L6N A;  4B4N A;  4U0F A;  2V4X A;  2WLV B;  5HGL A;  4XRQ A;  4PH2 A;  4J93 A;  4U0A A;  2EIA A;  3P05 A;  3BP9 A;  1M9X C;  1M9D C;  3H4E A;  1M9Y C;  1D1D A;  2PXR C;  1G03 A;  4U0B A;  1QRJ A;  4INB A;  2XGY A;  1M9E C; 
#chains in the Genus database with same CATH topology
 1U7K A;  4XFZ A;  4PH0 A;  1AFV A;  4QNB A;  2XGU A;  1M9F C;  3H47 A;  4PH3 A;  2LF4 A;  5JPA A;  2GON A;  2XGV A;  4XFY A;  2X82 A;  1M9C C;  4XRO A;  2GOL B;  2WLV A;  5HGM A;  5HGO A;  4NX4 C;  4E92 A;  2JPR A;  4U0D A;  4WYM A;  2KGF A;  1AK4 C;  1GWP A;  3MGE A;  2M8L A;  4DGA C;  1EM9 A;  4E91 A;  2M8P A;  5HGK A;  4DGE C;  4HTW A;  4LQW C;  3NTE A;  2XDE A;  1EIA A;  4U0E A;  4U0C A;  2X2D D;  2PWM A;  1E6J P;  2PWO A;  1P7N A;  2Y4Z A;  2M8N A;  4XFX A;  5HGN A;  2X83 A;  1L6N A;  4B4N A;  4U0F A;  2V4X A;  2WLV B;  5HGL A;  4XRQ A;  4PH2 A;  4J93 A;  4U0A A;  2EIA A;  3P05 A;  3BP9 A;  1M9X C;  1M9D C;  3H4E A;  1M9Y C;  1D1D A;  2PXR C;  1G03 A;  4U0B A;  1QRJ A;  4INB A;  2XGY A;  1M9E C; 
#chains in the Genus database with same CATH homology
 1U7K A;  4XFZ A;  4PH0 A;  1AFV A;  4QNB A;  2XGU A;  1M9F C;  3H47 A;  4PH3 A;  2LF4 A;  5JPA A;  2GON A;  2XGV A;  4XFY A;  2X82 A;  1M9C C;  4XRO A;  2GOL B;  2WLV A;  5HGM A;  5HGO A;  4NX4 C;  4E92 A;  2JPR A;  4U0D A;  4WYM A;  2KGF A;  1AK4 C;  1GWP A;  3MGE A;  2M8L A;  4DGA C;  1EM9 A;  4E91 A;  2M8P A;  5HGK A;  4DGE C;  4HTW A;  4LQW C;  3NTE A;  2XDE A;  1EIA A;  4U0E A;  4U0C A;  2X2D D;  2PWM A;  1E6J P;  2PWO A;  1P7N A;  2Y4Z A;  2M8N A;  4XFX A;  5HGN A;  2X83 A;  1L6N A;  4B4N A;  4U0F A;  2V4X A;  2WLV B;  5HGL A;  4XRQ A;  4PH2 A;  4J93 A;  4U0A A;  2EIA A;  3P05 A;  3BP9 A;  1M9X C;  1M9D C;  3H4E A;  1M9Y C;  1D1D A;  2PXR C;  1G03 A;  4U0B A;  1QRJ A;  4INB A;  2XGY A;  1M9E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...