2V5SA

Structural basis for dscam isoform specificity
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
388
structure length
388
Chain Sequence
b'QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENYFPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPISSSAPRTPALVQKPLELMVAHTISLLCPAQGFPAPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSESVLRIESVKKEDKGMYQCFVRNDRESAEASAELKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DSCAM
publication title Structural Basis of Dscam Isoform Specificity
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 84
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5sA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5sA04
4M3KB 3C2SA 2YPLE 4NNPL 4ZUWB 5D7JC 5EBMA 3W0WB 5FYJD 1U91B 2H3NA 5T3XD 3P4OA 3A6BL 1C7SA 4G9FE 1H3GA 3W39A 1WBZA 5D9SA 1K8DA 1ZANH 2CLRA 1ORQA 1NUDA 4K7PH 3DSFL 3IVKA 2OM5A 5ALBL 4HF5L 2XQBH 3GMOA 5I1HH 4LASL 4NBZB 3K8MA 5F7DA 3O2WL 4RGMC 4UQ2B 3GB7A 1DANU 1NC2B 4UBDD 3VRIB 3D39B 3VXSE 3IS0X 3H7BA 4CMHB 3O81A 1PDKA 1VDGA 5J11C 5FOJA 2O5YH 3B9AA 4J3OC 1CDBA 4GMSL 3PGCB 2C4FU 2ARWA 1FL3A 1B4JH 2PW2B 2E9IA 1T83A 1G9NC 5BXFA 1EO5A 2E8ZA 2A9NL 3SGKC 5L88L 1NCCH 1V5JA 1T7WA 2WWKT 4AIZB 3CLFH 1EERB 1M6OA 1BZ7A 4D9QE 1V3KA 3O2VH 2JB6B 2I9TA 3KPTA 2P49B 4FA8A 1C5BL 3VFPB 1Y6KR 3BP6A 4U6XB 4NKIH 5JW5A 4XHQA 4U1MA 5TF0A 4NC1C 3VXRA 4MAYD 2X40A 1F4HA 5SWSD 1BREA 4MB3A 2ZCHL 1CD8A 1MJ8L 1MF2H 5CJXC 2BXZA 4X5LA 1GVIA 1SEBB 2R2BA 3BIAX 1HOCA 5CIPH 3ZE0E 4L3AA 4XAWL 2FCBA 2PXYB 1AKJD 5LWYH 5CCKL 1ONQB 1K2DA 4YLQT 2FO4B 4OZIE 3S8WA 4WHYG 1XGQA 1P2CB 2AJVL 5EU7E 1NBYA 5K9QG 2YPVH 3FT3B 5HBBA 2ESVA 5D71L 1S5IH 4WWKB 1RZKH 4IRSB 4FP8L 1X5LA 5IB3B 4Q6YA 3WBDA 2GJ6E 3NPZB 3NCBB 4O4YL 3OXRB 1QSEB 2PETA 2CJUL 2DIBA 3WN5C 1Z3GH 1UEMA 1QR1B 1L7TL 3L3GA 1KJ3L 1LK3L 3HZYA 4JGJA 5B38A 1S7TA 1P7KA 4RMVA 4FXLA 1BWMA 1I1FA 3CFDA 5DEGA 5CEYA 3QP3A 5SV3A 5EA0L 1X5GA 4UDUA 4MA7L 3WS3B 1I1AD 3G5XB 5E24E 1YEDB 3TYGL 1T2QL 3ARFC 1V3JA 1U8QA 4G6ML 2HWZL 4GBXA 4J3SA 1A3LL 2WUCL 2X4SB 4F2MA 1BJMA 1AXIB 4JO3L 1IFHL 2VXVH 1G1CA 2O5XH 3ECBA 2QEJA 3BH9B 3H9SB 5ICYB 3UEZA 1UYWH 3PGFL 3S9DB 4WW2B 3HTLX 2HH0H 5J12B 1FN4A 1XF2A 1FFNA 4APQD 1R3LB 3KDMA 2MHAA 4PJ8B 3AGVA 4XC3L 1A6VL 1I7TB 4XHJC 1FNEB 2PYFA 5JDSB 2APBA 2X4OA 1WV7T 4P3CH 1NFDB 5ADPH 4NHUA 1EJOL 2BVOB 3HZKA 1KIPB 5E08L 1KCRH 3D0VB 5KSAB 3E8UH 3H3PH 5MERA 4M9PA 4NQXA 5HHXH 4GKOA 5FUOH 1CXIA 1EDQA 4M48H 3QB7C 1BD2A 4PGDA 2M2DA 3HB3C 4PRPD 4OFVA 4YBQD 3GHBL 5ESVB 4E0RA 2GITB 4F7TA 1N4XL 4HKBB 4XNXH 2LU4A 4QRRA 4LGRB 1WF5A 1I7UB 3G04A 4Y5YB 5C0CB 3VFGL 4HS8L 1G7HA 2XY2A 3QWRA 1RK1A 3GNMH 2VTFA 4MQ7A 2MSPA 1FCGA 4U0RB 4J4PD 1CD0A 4GKZA 2CKNA 2V5SA 3G6JA 4OJFH 3ARDB 4AG4L 5CEXB 4DUWA 4ELMA 3KYKL 4M1GH 5F1IA 4OFYD 3RHWK 3IF1B 1HCFX 4OLZH 4P2QB 2FJGA 2A73B 1GOGA 1CDHA 3VXUB 1T5XB 4KU1A 3TN0B 5HYQB 1ZANL 2HT3D 3MRJB 3VFOA 2ORBH 4NC1E 4K7PL 3MA9H 3K2MC 3L3OB 1JN6B 5INCA 4AIOA 5DSCB 1T89A 5I1HL 4W81A 5MP6H 2CDGA 1HHHB 4KUCF 3RL2A 3PWNB 3C6SA 2XWTA 3LD8C 2BSRA 1N3NA 5EN2A 1B0RA 2HA1A 3ZKND 4OKVA 5I18H 1MCCA 2O5YL 2FR4A 3SDCD 4ENEC 1B4JL 1IAKA 2D7PA 5C0BD 4PJGE 3H0TB 4Q6IA 3RWIA 3U7YH 4L3EE 4ODUA 5I1IH 5HPMA 1NCCL 1P7HL 1G6RH 2YRZA 1S8DB 3IDGA 2D3VA 4PJXF 3V6ZA 1DR9A 4X7DC 5HYEA 43C9A 1NAKH 3O2VL 1T83C 2AJZB 4KJWD 4PJ5B 3DROA 5DRXB 3OF6D 1UM4H 1ZV5A 3S4SG 4YC2C 2A0LD 4NKIL 4HLZH 1RHFA 2PTTB 3BWUC 1MCDA 3AS3A 4UNTA 1MF2L 3IS1X 4TUOA 1Q9LB 4K3JH 4OCNC 1EEQA 2B2XH 3QEGH 1AD9B 5LWYL 3S6CA 4IOIA 3RDTD 3C5SA 1G0DA 3VD9A 4I9WD 1K9TA 2YPVL 5HHME 3DECA 3CH1B 3QULB 3DGGB 3K74B 1S5IL 4LIQL 3BISA 3FB6B 2EDFA 2OMBA 1RZKL 5F9AC 1WJ3A 4ZNEE 1A21A 4YWGL 4TQEH 4WHTB 2Y1VA 3Q48A 5H94B 3VXOA 4KK9D 2CMRH 3EGSB 5TJWK 4MQXD 5HHVH 3HRPA 1X4XA 1HDMA 1Z3GL 2GT9B 2WW8A 3W9DA 3B5HA 3KPPA 2Q6WB 5B8CB 1HQRA 1XGUA 4O5LH 5JW4N 1EEUA 1CFNA 4OIBA 3LAFA 4LL9A 1FJ1B 5EUKA 3Q3GB 3ZDYE 4N8CH 3RPIB 2ZKHH 4OF3A 2BY2A 2VLME 1ZLVH 5TE7H 4RQQA 2X1QA 2X70A 5GQBA 3D1MC 3T0ED 4U2ZA 1DVFA 1UB5A 2MFNA 3F7YB 5MI0C 2VXVL 2X1OA 3O6FA 2O5XL 5IK3A 5D2LF 4NRYA 4GXUM 1UYWL 4GBXC 2HH0L 3C5ZD 4OM0H 3D6GA 4I77H 4Q9CA 5BV7C 1RZIB 1R6VA 2DJSA 1DUYB 3L5HA 3D25A 2B4CC 3R06A 2EH7H 1Q0YH 4O2EB 4UV4H 5JLZA 2EKSA 1JRHL 3HNVH 1I4FA 1HEZB 2HJFB 3X3GH 3BZEB 4KTDH 3QSKB 3D9AH 1ZT7A 2HFFA 3KPLA 3QDAA 4P3CL 2NLJB 1FNSH 2ID5A 2EDWA 5ADPL 5KANI 3JV0A 1CGVA 1OAQH 1KCRL 4MAYB 3E8UL 5SWSB 3H3PL 2FB4L 2EIDA 1WWCA 3CDGB 4HIIA 4CDHA 5HHXL 5L2JB 3EDDA 4EQ2A 5FUOL 1ZTXH 4M48L 5H35A 3LQAC 2LABA 3EW3B 3KWWA 3LKNB 3MFFB 4B0MM 1AKJB 1VKXB 1BQLH 5SX5K 3STZB 1KXTB 4RX4D 4GMTH 1O0VA 1MHCA 2XYCA 1AGDA 1DN0B 1UH2A 2IADB 3P3YA 4CN1A 4JAMA 1F8TL 1S5HB 3CC5B 2BVPB 3GJFK 3N9GH 3QUMH 4PRAA 4JPIA 1JWSB 4EXKA 3O6KH 1SYSB 4NYLB 1IARB 5E2WL 3L3DA 4NO2A 5J6GB 1ZHKA 3OG4B 4ZODA 4M1GL 4PRNA 5KN5B 1XCQB 2NYYD 4EIZC 4OLZL 4DJMA 5I73C 3VA2C 1MCIA 1FV1A 4WFHD 3RY5A 3GMPB 1U8LB 1HXYB 2NY5H 5DGRA 1FGVH 5FF6A 1P4BH 5CHNB 2J88H 3QFDA 1Q9OA 4UZGA 3MA9L 3HPLA 1PD6A 5D2NA 2EDNA 1JPFB 4Z7WE 5MP6L 2HVJA 1I1AB 4C56D 4HS3B 3SKUD 4FQQA 4JRXD 5C0JA 2GFBA 4CNIA 1UJ3B 4PJFB 3P4NB 1J10A 3F58H 3VXRE 4QRPD 1KPUB 1WCBB 2XN9A 1T89C 4MXVE 5I18L 3QBTB 3RVTD 5AAMA 3M1BA 3BP5B 1U3HD 4MLSA 4YGVB 1ZA3B 4NQDD 3LPWA 4XAKD 5HHQB 3DVGB 2G75B 5I1IL 2C4FT 3AFLA 3X12A 4APQB 2ESVE 4LRNH 2WLYA 1TCRA 1M05A 1NAKL 1IC1A 4Q6IC 4WW1B 5D8JH 1S9XA 3KYMA 4JY6A 5HDBE 3TH3T 5MEOB 4P2RD 1QLEL 5DI8A 5ESQB 5KVDH 4HFWB 4ORGB 4P23A 3CU1A 1CXHA 4U3XA 1GGBH 4Y16B 4JGUA 2MJWA 3MO1B 3VRLE 4PBVC 4XVJH 2WWMD 4K3JL 2B2XL 4S1SH 2NW3B 4JFED 3EFDH 1OP5H 3QEGL 1J87A 5IVZA 3DXAD 3LDBB 3ARBD 4OZ4B 3OX8B 2MWCA 5GS1B 2MCG1 1AD0B 3KYNB 4HCRH 2Y6SD 1OLZA 4FN0A 4F57H 5GSRB 3SDXB 3LCYA 1IQWH 3MCLH 5BO1H 1S9VA 3V6FA 3NOIA 2COQA 5E8PB 4TQEL 3N06B 4G8FA 3BVNB 4XBEH 2YEZB 3KPOA 2X9WA 3MREB 4MD0B 2VR4A 4FQXD 1MI5B 1SJHA 5TGBB 3GSWA 2PW1B 2CR3A 2AERT 4LDLB 3IAGC 4DGVH 5DJ0A 3ARZA 3UTSA 4O5LL 3O6MH 2NY7H 3FFDB 3E6FA 1OM3L 3RWGB 4PRBB 4P57A 4X9HA 5C07D 5DHXB 4X99A 1KELL 1DE4B 3PXHA 1U8HB 4N8CL 2ZNXA 4CADA 2ZKHL 4JN2A 3KPRA 4L8BB 5TE7L 1S3KH 5KS9A 2BMKB 1T22A 1JZ4A 1A1MA 3TP4A 4HZLB 4BFEA 2HFEA 4LVNC 4JFOB 5DJ6A 3HUJB 3SEPA 2AJYH 2BX5A 2XNAB 4OM0L 1L0XA 1DVFC 4I77L 4D8PA 1G7LA 1RJLB 3SDCB 3SE3A 1BD2E 3HNSH 5CKAA 2VLKD 3KS0J 1GZQA 3O6FC 1F4YH 5C0BB 3U36A 12E8H 3MLTA 1BOYA 2EH7L 4MJ2A 1Q0YL 2E3VA 4LF3A 4YXKH 3JTSA 4QRRE 1FO0A 1I1CA 4P49A 1FNFA 5DJYB 1XGPB 3NFNA 2CKBA 2AEIT 4NKQB 4UV4L 3HNVL 3U0PA 4L4TA 1XF1A 5ANMA 4KTDL 3CU7A 4KKNA 3D9AL 1NAMB 3G6JE 3WKMH 2K3TA 1JNJA 2Q76A 3IAQA 1FNSL 4U7MA 4ELME 4O9HH 5I1GH 1OAQL 3TH2T 1V05A 2KQMA 1EGJH 2FX8H 4RSVA 3D0LB 4L8DA 3MR9B 5F1SA 3TBVA 1ORSB 4GG8A 1G7IB 3LKSA 1ZTXL 3LS4H 5KSBB 4XH2A 3ARPA 1M71A 3OHXA 5C0IB 2NZ9C 2C7UA 5T1MA 1BQLL 1NLBH 3ESUF 4B50A 5IMMB 3MRKB 1F4XH 3RDTB 4ODHH 3TO2A 4X9IA 5DQ9B 4JO2H 3CXHK 1KSRA 5C0GB 5ERWB 3FB8A 4XPAH 5H2BA 4YEFA 3N9GL 3QUML 1GZPB 4U6YB 1JGDB 3UTTA 3O6KL 3NPSB 1MOEA 2QKIB 4YDLB 1IKNA 1JZ7A 5JA8B 4K8RD 4I0CC 1F97A 5EH1A 3TBTB 4N9OB 3BIKB 3SY0B 2KH2B 4LKXA 5AZ2L 1WAAA 4I48A 2NY5L 4QXWA 1FGVL 5E8EB 5GZNC 5LGKA 3VD7A 5MEPB 1P4BL 3ES6A 5ESAB 4KROD 3AXLA 2J88L 3K46A 5B38G 3VH8B 4ZUTB 1LE9A 4X7TB 2ZSVB 4X4XA 4PJCF 3MRMA 1PKQA 3JTTB 4QHNA 1QTYT 5INDB 4OLYH 5HY9B 3H6JA 3QNXA 3OKMB 2P8PA 1NLDH 4Y1AD 5DO2D 3U2SB 3F58L 4P5MB 2VABA 4JREB 4UAOB 1A9BA 4GW4A 1TVHB 5SWZA 3T0EB 1QQDB 3EDKA 5D2NC 4QWWD 1J05A 3HMWH 1IGJB 1N5AA 3QAZC 2FX7H 3FCTA 3N0PB 3UBXA 1DDHA 1AGCB 5E8NA 3C5ZB 3EDFA 3CFKA 1OP3K 1GC1C 3PWJA 2X4NB 4P48A 3VXPB 1QHOA 4LRNL 4WI7A 2BOBA 5ENWB 3WLBB 5FECB 1I8KA 1SJEB 5D8JL 3O2DA 5IOPA 1YQVH 2OXGA 3EKCA 1TMCB 5KVDL 4P5TA 1BJ8A 3BI9X 4RAUB 5JUEH 1GGBL 1CFVH 5LGJB 3KG5A 3F8UB 5CJ8A 3VFTA 3HS0B 2ZOLB 4XVJL 3GIVB 4XPGH 5JZ7D 3W0WA 3BUTA 1U91A 4P23C 5D5MB 5CJOH 3P0VH 5EBWB 2VIRB 3MYJB 4HCRL 3DIFA 3LZFH 2N1KA 4F57L 1HCVA 5JDJA 4LK4A 3CPLB 3ZL4H 3MCLL 4S2SA 2W9DH 1N6UA 3H9ZA 4XBEL 4HEPG 5C9KA 4QOKD 1NC2A 4I18B 3VRIA 3DUUB 1FVEB 1HNGA 4GAFB 2XXCB 1HXMB 4DGVL 1WEJH 3GI9H 4OUUB 4P4KD 1VA9A 3O6ML 3BEVB 4GRWE 2NY7L 1NCBH 4JEGB 1YYMH 4OLXH 1TVBB 4P4RB 3U7AA 3RVUD 4ZAKB 2JB6A 1YDPB 4RWYH 4NOFA 35C8H 4YZFF 1J0JA 5IMKB 3VFPA 1S3KL 2F5AH 3CCHB 2Z31A 5HI4C 3AUVA 4PGEB 1BBDH 3ALWA 4C56B 3FN0H 4JRXB 3C08L 5TE4L 5EU5A 1J9CT 2OTUA 2ZUVA 2HT4C 5F71A 1S7UA 4MJ4A 4X98B 4HWEH 1W8NA 3SGDI 4QRPB 1SEBA 2AJYL 3I9GH 3WL9B 3UBXI 4RGNC 4OGXH 1XFPA 4XTRD 2B1HH 1KYOK 3UAJC 5CKGA 1ONQA 1U3HB 4I4WB 3DUHA 1KTRL 1P2CA 4Q58C 1R5IB 2VISB 4NQDB 1F4YL 5DYOB 12E8L 3JXAA 4NSKB 3FT3A 3DARA 3KVQA 5D1XD 4DFHA 4YXHH 2VZOA 2K9UA 4PP1C 4YXKL 1OQXA 4MA8H 4IRSA 3SE3C 2FBJH 1JIBA 4EUPB 4CKVX 2L7JA 5IB3A 3WKML 4P2RB 4O9HL 3UTPD 5I1GL 1WWBX 3OXRA 1EGJL 1QSEA 2EYRB 5DRZB 5JHDD 2FX8L 5ISZD 1QR4A 4QRUB 4LPUA 1OSPH 4R2GD 3BXNB 3BT2L 4ZG1A 3LS4L 4JFYB 2X4QA 3BRDA 4K3EH 1F58H 5F9JB 4JFEB 4O2FA 4BM7A 2Q7YB 1NGPH 4KRMB 3DXAB 4LOUD 1NLBL 3ARBB 4HWZB 3CH8A 1JF6A 3BKJH 1F4XL 3ARTA 4ODHL 3G5XA 4JO2L 4YFLI 1YEDA 5D2NE 3U4EB 1JYXA 2W0KA 4XPAL 4WJ5B 3RNKB 2OYPA 5M95B 2X4SA 4ZFGL 4NQVB 5HHPA 4NN7C 5EC2B 3GO1H 3EYFA 2J5LB 1ETZA 1A8JH 3VFNA 1MHHB 2XN9E 5EZJB 3BH9A 3H9SA 5LBSH 4WW2A 5IW3A 4J1UA 2VKWA 4FQ2H 2DI8A 1R3LA 5IVXF 4L8SB 3D3VD 1DBJH 2ARJQ 5BV7H 1IKNC 4PJ8A 1WFOA 3NIGF 1LO2H 4D9RD 1TQCB 4WGVB 5C07B 1KLGA 4OLYL 5TH2B 3KLSA 4ZUVB 3I75A 1NLDL 1V7NL 5HI3D 5TFSH 2DMBA 4GT7A 1NFDA 4S1DD 1F3DJ 2BVOA 1AQDA 1MIEH 3D0VA 3ULUC 4G9DB 3LSOB 4L4VD 3HMWL 2C26A 5KSAA 3K3QA 1XIWD 3DTXB 1YEHH 4GJTB 2FX7L 1J0HA 4HBQA 4NO5B 1KCKA 3O4OB 3LQAH 3TBWB 5ESVA 5HGBA 2VLKB 5F9WC 3ARRA 2EYTB 4F15C 2ZUUA 4HKBA 1QPPA 4H20L 2GIYA 4PJDA 1I7UA 4Y5YA 5C0CA 4HXAL 1UACH 4A2LA 4N0CC 1U8NB 2BVUA 1YQVL 1NDGB 5J13C 5D7IF 2VDKH 2XG4A 4NO0A 1KF9B 5JUEL 1CFVL 1D9KD 5I6XB 2Y23A 3EYVB 3FQRA 2IPKB 3IF1A 1PQZB 2HKFH 3NCFB 2A73A 4P5TC 3UTSE 1T5XA 5EWIH 5CJOL 3P0VL 4ZS7H 3T0XA 3TN0A 5HYQA 3MRJA 4NCDA 3LZFL 5JOFB 1QFWM 2NW2B 2Z9TA 4ETYA 3L3OA 5HVGB 3ZL4L 3EJYD 2NTFB 5DSCA 3TNNB 2W9DL 3KPRE 4UU9B 1MCWW 5HYJD 4NDMB 4RGNE 4MJID 4XBPB 5KS9E 1KJVB 3NA9H 4PJEA 1T0PB 3PWNA 2Q86B 4N0UA 5F7UA 4O51B 2QR0A 4ZUSB 1MFAH 4XP5H 2UVFA 4I5BB 1KPRA 1SYVB 4G6AD 2R2EB 4YHOH 4WFED 3BO8B 3REVB 3VD3A 1WEJL 4NHCH 3GI9L 4JVWA 3MLVH 1FGNH 2BRRH 4CMHC 1NCBL 1S8DA 5IEKA 3ULVC 3H9YA 3GSXB 3S35X 3RQ3A 1AP2B 1YYML 4OLXL 4KROB 4PJ5A 1TENA 3ROLA 2Y4SA 4RWYL 35C8L 5DRXA 1UWGH 3LMJL 4L4TE 2XG5A 5DMGC 2F5AL 5ANME 1NCWH 2UWEF 3CSPA 1JVKA 1BBDL 3S3SA 1N8ZA 2PTTA 3FN0L 4Y1AB 4DZ8B 3VFSA 4HWEL 4MDIB 2D31A 1Q9LA 3I9GL 4UQ3A 4JPKH 1W2KT 4YHNB 4OGXL 4WI5A 2Z31C 1AD9A 3BOVA 2B1HL 3G9AB 1RK0B 1AHWB 3T2PA 3AROA 1T0NB 4K94H 1YNTB 5J1AA 3NFPB 1IGMH 2NZIA 3CH1A 3QULA 3DGGA 5EU4B 4YXHL 3OAZK 3OKOA 3FB6A 3I2CH 2X89A 4MA8L 2FBJL 5DC0A 4H8WC 3FZUD 4HH9B 4I13B 5DQDH 1ZHBB 5H94A 4FRWA 3UTTE 1ZLUH 4G6JH 3OQ3B 5DVMA 3EGSA 4NM4H 5T5FH 2P43B 3JWNC 1H8NA 4IRSC 4X6DA 4R90H 2UZYB 2GT9A 1OSPL 4MJ6A 4LCYB 3VG9B 3HC3H 1ZHNB 2Q6WA 1WAAE 2EDRA 4K3EL 1F58L 4RISH 2GAZB 1Q8MA 2C1OB 1NGPL 3OB0H 3C5JB 5FYLE 1IQDB 1GL4B 1NGXA 1U58B 4JQIH 3B6SB 3Q3GA 2DWEB 3ULUE 3RPIA 1DCLA 1PKQE 3H2WA 2D7NA 3BGFB 1BGXH 5DJAB 1T03L 1MWAA 3RZCD 2XQYK 2EDTA 3B9KD 2VXTH 3F7YA 3GO1L 2APWA 4OV5B 5SWZE 1TZGH 4XVUC 3HI1A 2VQ1A 4QOKB 4K7FB 4JM2F 5LBSL 4X6CA 4FQ2L 2Q3AA 5IGXH 1PYWB 3PF2A 4WNQA 1QRND 3GM0A 4GAJH 4GRMB 1RZIA 1DBJL 4P4KB 5BV7L 4D3CH 1ZGLB 1DUYA 1XF5A 1LO2L 5FDWA 2R9HC 4RZCB 3RNQB 4Y4HD 3ARSA 1HEZA 1TJIH 2HJFA 4GAYB 4IEFB 4GRWH 3EDEA 4L29B 4PJ8C 1ZLWH 3J8F7 3W11D 5TFSL 4MXQD 1JZ3A 5ICZB 1REIA 1MIEL 1V3LA 1MY7A 3B43A 4MAYA 4CVZB 2EIZB 5SWSA 1YEHL 3CDGA 5L2JA 4PJHF 1W0VB 4OF6A 3W0WE 1VB9A 1FYTD 3LKNA 3MFFA 3LQAL 1AKJA 3STZA 3QO1B 5KSAC 4XCEA 4UNVA 4FQLH 5HDOA 1DN0A 2F8VA 3H8NA 1K5NA 2HKHH 5CGYD 2IADA 5D1XB 5E2TH 3V6OA 1CDYA 1UACL 2PNDA 3VDBA 1A7NH 1S5HA 3CC5A 5C0ND 1OP9A 3F7VB 1JPSH 2G60H 2VDKL 1JWSA 1D5MB 2J8UF 3FOMB 3MZTA 2X4TB 3QJFA 1SYSA 4NYLA 4Y5YC 3ULVE 2H6PB 1XCQA 3OZ9H 4U0RC 2HKFL 5JHDB 5CGMA 5ISZB 2HG5A 5GRUH 1BVLB 3UC0H 1U8LA 2KPNA 4WWID 5EWIL 4W6WB 1HXYA 4R2GB 3FO1B 4X0KA 2YXMA 4ZS7L 1XZ0B 5B39A 2WUBH 4PREB 3IJYB 3ZDXF 3PP4H 2MKLC 3UYOD 2Y07L 1JPFA 2V2XB 1I1AA 4HS3A 4L9LB 5F1KC 4AY0A 3OKDB 5DK3A 3TN0C 1UJ3A 2WP3T 3NA9L 3P4NA 4PJFA 3IXAB 1KPUA 3ILPB 3ZDZE 1MFAL 4XP5L 1AI1L 1UXSA 2A6DB 3BP5A 4YHOL 4ODSH 4YGVA 1T1WB 2NY6D 1ZA3A 4NHCL 1CQKA 5HHQA 1CG9B 4OD2B 3MLVL 2SEBA 1FGNL 2G75A 3V7AE 2BRRL 1NEUA 4QHLA 2DF3A 4APQA 3NA4A 1YPZF 5CD5D 3KS0H 3D3VB 4EI5D 5D7LD 4HS6B 1U8MB 4WW1A 3RVWC 5JHLH 1UWGL 1JNLH 5MEOA 1NCWL 4HWUA 2J4WH 4W6XB 2CDEA 1H3VA 2BNRD 4H1LG 4ORGA 5F21B 4H5SB 4BH7B 1ZT1B 4Y16A 2ZUWA 4MS8C 1QSEE 2UV3A 3MO1A 4IIQB 5DDHA 1T7VA 2NTSP 2OXHA 4JPKL 4K7PX 25C8H 3QIWA 4L4VB 1XIWB 3PGDB 5KZCD 4K94L 2A6JB 3OX8A 4HJ0D 5JPNB 5GS1A 4ZOEA 3WNOA 5IBLD 1AD0A 4UT7H 3KYNA 3ZSSA 4DTGH 4Y2OA 2IH3B 1IGML 4Y88A 5IW6B 4P2OA 1JTTA 5GSRA 1ZHLB 4YH6A 5CIPB 4NKDB 5KVFH 4KDTA 1PW3A 3SDXA 2OSLB 3I2CL 5D1ZD 4XI5C 5FO9A 1W72B 5E8PA 4JPVH 5CSZB 4KK5D 4YR6A 3MREA 1A7BA 4RA0C 3FB7B 4G6JL 4TNVK 4J4PA 4NM4L 5T5FL 3N50A 5CSBA 1EAPB 1MI5A 5I15H 2GK0B 5TGBA 2VB5A 1IMHC 3H9SE 2PW1A 4R90L 1D9KB 1GAFH 3CSBA 2NY4D 4UNUA 1TJGH 1Z9SA 4J7RA 4OFYA 4RISL 2IPTH 3MBXL 3FFDA 4LLVB 1X9QA 5FO7B 2IAMD 3RWGA 4PRBA 1R3JB 4P9MH 1S7SB 4JQIL 1DE4A 2GJ6D 1U8HA 1KTLB 3AC0A 3MCG1 4YUEH 3TJHD 3GSOB 2A9MH 3WD5H 4JN1H 1YMMD 4NN6B 1BGXL 4L8BA 3MGOB 3P11H 2XWJA 3PDDA 5DEFB 2VXTL 2GTWA 5A2FA 2BMKA 1K6QH 3T65B 1NFDE 5HYJB 4MJIB 1TZGL 1XGRA 4LLUB 4HZLA 2YN3A 4JFOA 5C1MB 4DK6A 1CT8B 2W91A 2XNAA 2YUZA 4KI5F 4EVNA 5IGXL 3QH3B 5DRNA 2IH1B 3SDCA 2E7HA 4GAJL 2XY1A 2IPUK 1X5JA 2N7BA 5C0BA 4UBDC 1T7YA 4D3CL 5K9JH 4GSDH 2VXSH 3QEQD 5DA0B 2EEBA 1S9YB 3NIFF 4PJBF 5DJYA 4PJDE 4C55A 1XGPA 5C0CE 2R8SH 1TJIL 3LB6D 4DZBA 3CSYB 2NR6D 4KMLB 5DJZB 2MQ3A 3AS0A 2IQ9H 3DVFA 3WXWH 1QYGH 1PBYA 3P9MB 3KJ6H 2CRMA 3HPJB 1CK0H 3LHPH 3UX9B 3WSQH 1FO0H 3PDOB 3D2UD 2CR6A 2CKBH 3D0LA 3MR9A 2FO1A 3I6LD 1G7IA 1A22B 4MA3B 4Y89A 4JG1H 5C0IA 2V5RA 1TVDA 4QGYA 4TSCH 3N1QC 4MAYC 2FATH 2IC2A 4RA3A 5IMMA 1JK8B 3MRKA 3RDTA 4WV1A 5D7JD 4TPRH 4FQLL 3V7AG 5DQ9A 5I74B 4Z7UF 2HKHL 5E2TL 1A7NL 1QSFA 2X7LB 3RUGA 4FQIH 1JPSL 2G60L 4PJEE 3HC4H 4W68A 4U6YA 2VUYA 3LEVH 4XBGB 4N0UE 1RQ5A 3GK8H 3O45A 2QKIA 2Y5TB 3V6OC 2X1WL 3U9UB 1ZGLP 1C1EH 1P7QD 3OZ9L 5DUMH 4RFEB 3RAJL 3BIKA 4NUGL 1UZ8B 1BQUA 3QR2A 4OUOA 5GRUL 3UC0L 4QY8A 5E8EA 5JIHA 4JANB 5ESAA 2WUBL 3KLDA 3PP4L 3NMEA 3VH8A 4G3YH 4RDQF 1KXQE 3OB8A 1ZA6A 2GJZB 2ZSVA 3QQ4A 4PJ5E 1IRAY 2YPKA 1KIRB 3JTTA 3RKDD 3RWDB 5INDA 3GRWL 5EC1B 1XEDA 5HY9A 3G08B 3OKMA 3U2SA 2AS5M 4G8IA 4P5MA 1EH9A 5EZOH 5FYLH 3MLWH 2DLIA 3B9KB 3RZCB 1QQDA 3T0EA 2UZIH 1I1AC 5IWLA 4ODSL 3ULUH 2C9AA 3MYZA 3I6KB 1UJ3C 3IKKA 2CGRH 3LY6A 1AFVH 3A6CH 1CDUA 2GI7A 1AGCA 3P30H 2X9XA 3C5ZA 4WHDA 5C7XH 3TPKA 1QRNB 1U8PB 2X4NA 3D69B 5E56A 1I75A 3VXPA 4PGZA 3PNWB 1L4IA 5ENWA 5FECA 3SGDH 5JHLL 1JNLL 2A83B 2J4WL 3HAEA 1CFQB 4APQC 1KV3A 2E8YA 4Y4HB 1FG2B 3B5TA 1KUMA 4H0HB 4RAUA 4J6RH 4XNMB 4JPWH 5LGJA 6FABH 3K8LA 1FIGH 2R1XB 2ZOLA 3HS0A 4N5ED 4X6DE 3GIVA 4R96B 1U8IB 25C8L 2OR7A 4XZUB 3O2DH 1G7QB 4XWGH 1A64A 5BOPA 4Y16C 3JV6A 4NWUH 5EBWA 3IKCA 4ZS6C 3MYJA 4UT7L 2AJUH 5FYJE 4DTGL 1FYTB 3VGDA 1ZSDA 1X3DA 5KVFL 3CPLA 4EEEA 2MTPA 3QIWC 4RX4A 3CVHA 3R0NA 1MCQA 2K1MA 3GMRB 5GS1C 4JPVL 3PDGA 4M03A 4I18A 4P2OC 5FM5M 3DUUA 4YBQC 3ARFD 4KDTC 5IBTL 3I02B 5I15L 4LDOB 4WDIA 1HXMA 5HHMD 4X6CE 3DHJA 1YEKH 1GAFL 4OGZA 1TJGL 3B83A 1GJIA 4LLAA 2IPTL 3BEVA 4JJHA 4J4PC 1MFEH 4N8VG 4NKOB 4X7FC 3JV5A 4UV7H 4JDTH 4P9ML 4Z78B 3BGAA 1TVBA 4P4RA 2CUHA 4YUEL 4ZAKA 3MUJA 1YDPA 3WD5L 4CL7A 4JN1L 4BELD 2EXYD 2IBZY 5IMKA 4J3UA 1JZ2A 3P11L 4K71B 3CCHA 1NDMB 1QKZH 4LHQB 5CUSH 1K6QL 4JRXA 3CDYA 1HHGA 2HT3C 3QG6B 1AE6H 3WYRA 4X98A 2V7HB 5SWSE 3WL9A 3CFBA 3EO0A 3ISWA 1F3DH 3LKPB 3ZLQC 5I1DB 1QFPA 1U3HA 1WIPA 1EO8H 2NY6B 1J88A 2ZUSA 1JF1B 1R5IA 2VISA 2VLMD 4NQDA 2QHRH 4O00A 3QXAB 3V8OA 4CN4A 5K9JL 2VXSL 1KBGH 3ZKNC 3CFCH 3HB3D 4KZEH 3V6OE 3SDCC 3C60D 5C0FB 3QO0B 3G6AB 3SO5A 5DZNA 2R8SL 4DN3H 4EI5B 5D7LB 1AIFB 3BHBB 2C3GA 2IQ9L 4P2RA 3WXWL 1QYGL 3F5WA 4HH8A 1YQ2A 3KJ6L 2BNRB 5DRZA 2EYRA 3LHPL 1CK0L 2X44D 4H25A 1GGTA 1FO0L 1LO3H 3WSQL 3MC0A 1CXFA 2CKBL 4QRUA 4JZOB 4WENB 3BXNA 4KJWC 3OSKA 4NJ9H 4PIRF 4Z7OE 4JFYA 1JNHB 1FFOB 4JG1L 5HTSA 1J1XH 5E5UB 2A0LC 4LNRB 3NVQA 4TSCL 3KGRA 3DXAA 1BFVH 3ARBA 2FATL 5I16B 4HWZA 1UM5H 5KZCB 3ET9F 5SV4A 1CVSC 5DVKA 2EE9A 4DKFH 1RY7B 3U4EA 5GPRA 4ZO8A 4WJ5A 4C59B 4WFFD 5HYSB 4FQIL 2E7BA 4PJFE 3SCMA 3HC4L 5EC2A 3SKJH 3LEVL 3RDTC 4WV1C 4ZSOA 3QUXD 2DBLH 2R29H 2ZCKL 3GK8L 4P59H 5GRJH 1OD7A 4NO3B 1C1EL 5DUML 4OZIB 1S7VB 3QUZD 3ZT6A 1P4LB 2XTJD 2ARJA 2FWOB 2NY4B 4L8SA 2R23B 3QPQD 4YDLC 2E9BA 5DK2B 4JCLA 4G3YL 4KKCC 4IBLT 2VDRH 2IAMB 4OCMC 2Z92B 5F44A 5GHWH 2GJ6B 5TH2A 4ZUVA 4W70A 4B53A 1YMMB 1BBJB 1JPST 4ONGH 5EZOL 3BZ4B 5FYLL 3WEXB 4CN6A 1CFSB 1MCSA 2XI9A 2UZIL 3GZKA 4HC1A 3ULUL 3DTXA 1AJ7H 2C3VB 2CGRL 1AFVL 5T1KD 3A6CL 3QHFH 4NO5A 4JREC 4UAOC 4KHTH 5J06A 3P30L 3DO7B 3T0EC 5C7XL 3MUHL 3TO4D 3TBWA 5IVXB 4AEHH 5IWLC 5JXEA 1F90H 5IHBA 3B2VH 3SDXE 1OAUL 2D0GA 4P0DA 3GBNH 3QEQB 1U8NA 2X41A 3C5ZC 5DQJB 3IFPB 4AM0B 2I5YL 1H0DB 4J6RL 3ZKSD 4JPWL 3MNVB 1MI5E 6FABL 1FIGL 4LU5H 4HG4K 3EYVA 3F7QA 3C8KB 1F6AB 2IPKA 1OT2A 1PQZA 1R3KB 4FS0A 4MHHG 2O61B 3O2DL 3MJ7B 4XWGL 4X4MA 3LPFA 3KXFB 4NWUL 2BERA 2AJUL 3MRPB 4AZ8A 2HTKD 5JOFA 1GOFA 2NW2A 2NTFA 1D5BB 1EA9C 1ZWIA 3TNNA 3IRPX 2IFFH 2YD1A 1H8SA 5D7JB 4YDVB 1MAMH 2OLDA 4JHWH 4NDMA 4XBPA 2XA8H 4S10A 4KKLD 1KJVA 1RVFH 3RVVC 1WC7B 4ZUSA 1JHTA 4I5BA 1JFQH 3H7LA 1SYVA 4KTEH 2R2EA 5D96C 3HZVB 2D7MA 3BO8A 3REVA 1YEKL 4QF1B 4I18C 4XCCH 4U4BA 5EZLB 1P7QB 1WK0A 1SY6H 3EFFB 1JYWA 3MUY1 3QA3B 4MX7B 1MFEL 3SE9H 5C0BE 5DD0H 4YXLH 5TDOB 3GSXA 4UV7L 2X4PB 5J11B 4JDTL 5CS7A 2YRPA 4K07A 1AP2A 5C9JB 3MZGB 2OMNA 4D2NA 3HG1B 1T7XA 4G8EB 1YNKH 2ATKB 2RQ8A 3P73B 5E9DA 5GGSY 4DVBB 1QKZL 5CUSL 4NC0B 5FA3B 1AE6L 4DZ8A 4ZAKC 4MDIA 2FJFB 4OBRA 2JLLA 1OPGL 1NCNA 4RNRB 4D0DA 4HIJB 1RK0A 4FXGA 1AHWA 5J4MA 1T0NA 1EO8L 3RPKA 1YNTA 3NFPA 2QHRL 3QDHA 1AH1A 5EU4A 2PR4H 4Z0BH 4PJXA 1KBGL 1IC7H 1LGVA 4ETQA 4I9WE 3CFCL 4LCCB 3RVTC 4KZEL 4LLQB 1U3HC 2P7TB 2ENSA 1QSFE 3RUGE 4DN3L 4HH9A 1YEGH 1ZHBA 4Q9BA 2UWEB 2IGFH 3ARYA 2HYMA 4Y19A 1LO3L 1F3JB 1Y18B 3BDXA 3MFGB 5BVJA 2DLEA 1VFUA 4PD4J 1EHNA 2CO6B 4LCYA 4NJ9L 4HW6A 4TSBH 1ZHNA 5A43C 1KEGH 4X8XA 3VG0H 1J1XL 4POUB 2GAZA 2C1OA 3OAYH 3C5JA 1R5VB 1BFVL 4JO1H 1U58A 1UM5L 1IGFH 1HNFA 4IDJH 1UVQB 4DKFL 4LPCA 2DWEA 4GXUN 4U1NA 2QL1A 2WWMC 4LQFH 2BK8A 3VMNA 3DURB 1BQHA 2GYSA 1FVCB 4D9LH 3ARBC 4FABH 3SKJL 4OV5A 2ADFL 3QHZH 4U6VH 2OZ4H 2DBLL 2Y6SC 3T0EE 2R29L 1BWWA 4QOKA 4K7FA 4P59L 4M7JH 5GRJL 2LVEA 5GGQH 3ARFB 1KC5H 4FFWC 5C0AD 1UZ6F 3KPSA 1OF2B 3SCMC 1PYWA 2O93L 1MWAH 5HHMB 2Z91B 1J8HA 2J5LC 5BZWB 4D0BB 4JFXA 3GSQB 4GRMA 1ZGLA 3STBA 4RMSA 2VQUA 3PIQB 4HEME 3FO0H 3C9NB 3AS2A 5CAYB 1CFTA 2WQRA 1ZLVK 1N64H 1MELA 2IWGA 4RZCA 3ROOB 2VDRL 3RNQA 3PP3H 3EDJA 5GHWL 4L8SC 3DJ9A 4L29A 1KIQB 4ONGL 2CLVB 5IB1B 4JHBA 1NUFA 1TQCC 3B9DA 4CVZA 3T08A 2VR5A 1OW0A 2X4RA 4U1SB 4PBXA 2XZCH 1AJ7L 1W0VA 4JM2B 4M4PA 4NQSB 4QYOB 4FZEH 1K8IB 2E6QA 2Y25A 2XRAH 4KHTL 3QO1A 5AG9A 4AEHL 4NN5C 1F90L 1CGXA 3B2VL 1T4KA 3NCCB 3CIQA 3WFHB 5D1XA 3GBNL 2HN7A 3F7VA 1YUHB 3C60B 2VXUH 5CJQH 5JXEC 1WZLA 4EXPX 3FOMA 1MVUA 2JJWA 2X4TA 4F9PA 4Z7VF 4LU5L 2H6PA 5T5NG 1EHAA 2K7QA 2DI9A 5F89B 5ISZA 3BJLA 1WFUA 3C6LD 3FO1A 1XZ0A 1RFDH 2Y72A 4WFHE 5CBEB 5I6XC 3SE8H 4PREA 3IJYA 4OCWH 1HE7A 4AQOA 2JK5B 4LLYB 4QNPF 2IFFL 4DOHE 3ZYZA 1MAML 3BP4B 3OKDA 4JHWL 5IT2H 2XA8L 1JJUA 3KLHC 1RVFL 1RZFH 3IXAA 1NGZB 1JI2A 4JRXE 3ILPA 1GRWA 3QEHB 3ZTJG 1MJ7H 2P24B 5L6YH 1TXKA 2GUOA 1JFQL 1ZLSH 2V7NB 4KTEL 2AV7B 3L1OH 3QUXB 3R1GH 2H3NB 1T1WA 3P9WB 2YA2A 4U6TA 3VXQB 2QLVB 4LMQE 1CG9A 4OD2A 4XCCL 1K8DB 4IRJD 5CP7B 1ORQB 1SY6L 3SE9L 4NQDE 5HHNB 3QUZB 4X7SH 5DD0L 4YXLL 5JW4R 2F8OA 2X6MA 3LD8B 4GAGH 2XTJB 1INDH 1MRCH 3D3VA 3FJTA 4K2UH 1DUZA 4HS6A 3GB7B 4K8RC 1JF5A 2RBLA 3O6FD 1LVEA 1YNKL 4GKNA 3VH8G 2E6JA 3H7BB 2ICWI 4H5SA 4P2RE 2ZUXA 4JFQB 2AJSH 1AO7D 4KROC 1FL3B 2DKUA 4JFHD 1JHKH 1NMBH 4QHKI 3KLAB 2AGJH 3MOQA 3T2NH 3TT1H 5DRWA 4L4VA 4YC2B 4GUPB 1XIWA 2ICWJ 2A6JA 5HDLA 5JPNA 5DURD 3MRQB 5IUSA 5DO2C 1U8OB 3DXAE 5T1KB 2IH3A 1AC6A 2V17H 5IW6A 2PR4L 1B90A 1CDJA 4Z0BL 5CIPA 4NKDA 5GSVA 3DX9A 1IC7L 1CGYA 3TO4B 1YPZB 4Z7WB 2DL2A 2OSLA 4QWWC 3BP6B 3PUCA 1I9IH 1AHWC 5JW5B 4U1MB 1W72A 2NZ9D 1ODAA 2YRLA 5CSZA 2M26A 1YEIH 1YEGL 1PG7W 2DLHA 4IM8A 5ECJE 1EV2E 3T8XA 2IGFL 4ZSOE 5LVEA 2R2BB 1HOCB 1X6NA 1EAPA 1OP5K 2GK0A 5DMIH 3TCXA 2IEPA 5I0ZA 1R24B 1D9KA 2D9QB 1K2DB 5DVLA 4HUWB 1WZMA 3ZSTA 1HH9B 4KKAD 4TSBL 1KEGL 1FHGA 3VG0L 2WAHA 1KLUA 3A6OA 4JO1L 1IAII 2H26B 5FO7A 1IGFL 2C4XA 4IDJL 1R3JA 5FYKU 5KTEH 3TIEB 1S7SA 5E5MB 5F7HA 3GSOA 2QV2A 1H3TA 4LQFL 5JZ7C 4KTYA 1W8OA 1NANI 5IG7B 3ZKMD 3MGOA 5GGRY 3UZEA 5CFHA 4D9LL 3O3DA 4FABL 4J3WA 3FQNB 2ZG3A 4PBWD 2FLRT 5HYJA 3QHZL 4MJIA 1I8IB 2OZ4L 4LLUA 4O02H 3SGJA 1MCBA 3P0GB 4DKEH 4M7JL 3PV6A 5GGQL 5D93C 1YY9C 1KC5L 3P4MB 2J3SA 4JY5L 1S7TB 1JZ8A 1P7KB 3QH3A 2IH1A 1MWAL 1CR9H 5DEGB 3GSRB 1GOHA 3FO0L 2X1XR 1I1RA 2P45B 2EE3A 1N5YH 1N64L 2XQYG 2AQ1A 4M5YH 3W81A 2AJXH 4F2MB 3CSYA 1KIUA 5DJZA 5BV7B 2F9BT 3DYOA 3ECBB 4PYHA 4HX1A 3RI5F 1NBQA 4LCWB 1UH3A 3P9MA 3VMOA 3X13B 5IJVA 3HPJA 4MCZB 3LEYH 1MAJA 1ZEAH 2XZCL 3U1SH 3KDMB 3DO3A 4MA3A 4FZEL 3ABZA 4X4ME 5DEZA 2XRAL 1DQDH 4R3SB 3IDJB 1NBVH 1QBAA 1OW0C 1JK8A 1KEMH 4OM1H 4P23D 5L8KB 2X4OB 4PJBB 2EXWD 3UPCA 1J18A 2VXUL 5CJQL 5IFAH 3HZKB 4ZYKB 4XBGA 4KDVA 3WHXA 5MERB 4EUPG 5D1XC 2Y5TA 1I9EA 5I76A 2VZVA 3U9UA 4FZ8H 4RFEA 1JE6A 4PGDB 2UY6A 4DN4H 2AAVA 4E0RB 4F9PC 2ZUYA 1RFDL 4JANA 1IL1B 2VSDA 3SE8L 3WFZA 4OCWL 3MNWA 3EOBB 1G7HB 2GJZA 3MLRH 5L7XH 4Z7UB 1T5WB 3RWDA 3G6JB 5EC1A 4LSUH 3GMQA 5IT2L 3G08A 5E9DE 4CW1B 1RZFL 2ITDB 5BS0B 3RZCA 3B9KA 1WWAX 1MJ7L 5L6YL 3E6HB 1ZLSL 4J2XA 3VI4F 2FJGB 3L1OL 3ZDYF 3R1GL 3WLWC 2X5PA 4JG0H 4KV5E 3BPLB 2HT4D 5KSVA 5C0AB 3UCRA 3KPRD 3CLEH 4X7SL 4ELKB 1QRNA 4HMDA 2EDXA 4RGND 3D69A 4GAGL 1DEEB 1INDL 4PJXE 3PNWA 1MRCL 5K59F 1LNUB 4M7LH 4K2UL 2JELH 4G6FD 4JR9H 4V2CB 3UXFA 4PJCA 2A83A 3QPXH 3WCYA 1CFQA 2BSRB 5ID0B 2C3XA 1FG2A 4PP1D 1B0RB 1I3RB 5TQ2H 3KYAA 2EDKA 2FR4B 2AJSL 3WJLA 4Y19E 5F7KC 2R1XA 1IAKB 4WTZA 1JHKL 1NMBL 4R96A 3V52L 2AGJL 4Q6IB 1U8IA 4RGOH 4ODUB 3B9EA 3T2NL 4XZUA 3TT1L 5I9QC 1G7QA 3HAEH 4IRZH 1FYTA 2VR9A 2V17L 5DVNA 1BJ1J 3W9EA 3BD4A 3NACH 2DTSA 4YIQA 5I0DA 1XIWC 5E00B 1I9IL 3K81A 2NY2D 5BMFL 3VMPA 3GMRA 2IMNA 3OKLB 4PTTA 1DJSA 3GUTB 5I2IA 1YEIL 3VXMA 3Q5YA 2WINB 1EHXA 4HV8B 3I02A 2RAMA 4QOKE 5DMIL 1XCTA 1MRFH 3CVHH 3CXHJ 3KPSE 4CVUA 3C5SB 1J8HE 2EEAA 2V6HA 1N6VA 4KGLA 3C6LB 1HN1A 5DTFA 5DZLA 1D9KC 5DUPH 3IFNH 5KTEL 4Z78A 4X6FB 3GSNH 5BQ7A 4BQ8A 2XV6B 4GQPH 5HYFA 3VU2A 5K9KB 3ZZ1A 3IDIB 4O02L 3QG6A 1HDMB 3W9DB 2VN4A 4DKEL 4NN6C 4FFYH 7CGTA 1BX2B 5FYLD 3V5HB 3EJYC 1XGUB 3L3HB 3LKPA 4F7MB 5KVMC 4WEUD 5I1DA 4XP6H 5CINH 3M8OH 4MAUL 4TNWF 3ULUD 1JF1A 5JW4Q 3SGJC 1L9MA 4R8WH 5EUKB 3QXAA 4IRJB 4MZ3A 4LVNB 2IALB 1A7PH 4RQQB 4M5YL 1GGIH 2AJXL 1B2WH 3QO0A 3G6AA 3WUZA 4EI5A 1KJ2H 1MLCB 3BZDA 1AIFA 1RI8A 5D7LA 3BHBA 3PHOB 4PR5B 2N4IA 3O6FB 5IK3B 1KPVB 1XF4B 1L0QA 4Z7NE 2YC1A 3AMKA 1LP9F 2BNRA 4N0CD 4N0FB 2X05A 3LEYL 4NKMB 1ZEAL 3UTPE 5CLWA 5ITFA 3U1SL 1AO7B 2IPUG 3JSSA 2M8XA 1HHJA 5ISZE 1JNHA 1KG0B 1DQDL 5ID1B 1NBVL 1WCQA 2YWYA 5I16A 1N2RA 5DURB 2DQDH 1KEML 2EKSB 4OM1L 2MQCA 4P5TD 1JTPA 4P2YA 1RJCA 1OQOA 2APVA 4KRPC 1A02N 2HFFB 1T2JA 5HYSA 3U0WH 5HPOA 4FQPA 2AXJA 1R3IH 5IFAL 3O6LH 1FZJB 4XXDB 1NBZB 3W0WD 1FLRH 3G6DH 5CP3H 1LO5A 4KAQH 3DX6B 5BJTB 2Y7QB 4FZ8L 2YBRA 3DUSA 3DV6A 1UG9A 4GLRI 1UCTA 3P0YH 4DN4L 1P4LA 5F1NB 2FWOA 3FZUC 2R23A 3LKOB 5DK2A 1VEMA 4XC1H 4D94A 3TF7C 3D3VE 4JAMB 4L1HA 1YEFH 3MLRL 5L7XL 2Z92A 1T6VN 2MCPH 3U83A 4LSUL 4D9RE 2AW2A 1T0MB 5FA4A 3DX8B 4LGPB 5ELIA 1YMMA 2E6PA 3WEXA 4LFHD 4UDTA 2XTLA 1CFSA 1RU9H 3SDYH 1B88A 1KJMB 2V2TB 5DMGD 3VCLB 1DBAH 1INQB 3PV7A 3CMOH 2C3VA 4JG0L 4L4VE 5KVGH 4HUVB 5LKNA 3DO7A 3QFDB 3B9KC 3RZCC 3ZYIA 3CLEL 5KAQG 3OJMB 5IVXA 4YHKH 1JGEA 4YHLH 2Z31D 3X11A 4HC1H 4M7LL 2ADJB 4X8JB 1E28A 1NFIB 2GFBB 5H37H 3WUWA 3VFMB 3QEQA 1HH6B 5DQJA 4NNYB 2ZG2A 3QPXL 3IGAB 4I3RH 4HGWB 4AM0A 4L8CB 4LIQE 5TQ2L 5KSUB 3MNVA 5DS8B 4M3JA 1FG9C 1W0WA 3A0OA 1F6AA 4RGOL 5E8OA 3I85A 1WZ1H 1VSCA 3OKKB 3MJ7A 3EZJB 1FAKT 3MCKB 3KXFA 4WVRA 1Q0XH 3WJLC 4PGBA 4IRZL 3TGXA 1TCRB 3MRPA 1TZIA 1CL7I 4ORZC 5EIQA 1XT5A 1S9XB 3KYMB 1D5BA 3NACL 4PS4H 4YDVA 3KAAA 4P23B 4HCRA 3LIZH 2G5RA 1MFCH 3HFMH 5D7IA 1WC7A 3ZHDA 5HYJE 3OGCB 4MJIE 4HPYH 1Z5LA 2AXFA 4NNPH 2NY3B 2I07B 1MRFL 3HZVA 1IEAB 3CVHL 4PJAB 3A6BH 5CGYC 1EUTA 4QF1A 1XGYH 4X83A 4WFEE 3NAAH 5EZLA 4QTHB 4MX7A 5TDOA 2X4UB 1S9VB 4LASH 5DUPL 3IFNL 3V6FB 5GXBB 2DM7A 5D7KD 5C9JA 4G8FB 3GSNL 2F19H 1P6FA 3KPOB 3HG1A 4K8RH 1LE5B 3H9SD 2WBKA 2ATKA 3P73A 4DVBA 4AH2A 3IXTA 5FA3A 3C87A 4UT9H 3X3FH 1I7RB 4IOSD 2Y06H 3V5KA 2B0SH 2FJFA 4FFYL 4K71C 2XOTA 4HIJA 3GSUB 4NPYA 4XP6L 5CINL 4U49A 3M8OL 2QJDA 4M1DH 4LHJB 1TFHA 3DVIA 3H42H 3ARED 1XR9B 2BOCB 3KPRB 1A7PL 1T21B 4LCCA 2DD8H 1GGIL 4KDWA 1CE1H 2R15A 4LLQA 4TYUA 1B2WL 1VGKB 2NY6C 5D6DA 1KJ2L 4G6FB 4CU6A 4PUBH 3VWKD 2UWEA 1TJHH 2BVEA 3E3QC 3IYLW 5DJ6B 1QFWI 3CAFA 3WFEL 3OJVC 1Q9WB 4HQQH 4XAWH 1NEZA 1Y18A 1G7LB 4EI5C 4RMWA 4WUUB 2ATPB 5FAAA 1INEH 2DYPB 3U36B 3MLTB 3BMVA 1J12A 5D71H 2NCMA 4MD5B 2VDLH 3L6FB 1UWEH 2HP4A 4G8GD 1BFOA 2CKBB 2DQDL 1UVQA 1E4XI 4NO0D 2MOVA 5ANMB 1GYAA 5FGBA 1ZLUK 5FKAA 1IE5A 4KPHH 3IETB 3U0WL 1FVCA 1R3IL 2NY2B 3O6LL 4HJ0C 3ARQA 1FLRL 2CJUH 3G6DL 5IBLC 2D4DA 3DI2B 4L8DB 2BNUB 4KAQL 2ICEA 3LKSB 3TN0D 2ENYA 4U31A 2R0WH 2AXHA 2VSCA 3VDCA 3OB0K 3P0YL 3EOTH 5SWQB 5GGUB 3UP1A 2Z91A 3WV0A 3PABA 5BZWA 4D0BA 4KK5C 3TO2B 1ND0B 2NXZD 2WM0A 1QRNE 2A1WH 3FT2B 3PIQA 3C9NA 4XC1L 5JTWA 1T66D 4G6MH 3DX7B 1A1NA 1YEFL 4YPJA 1F11B 2D7TH 2MCPL 1A3QA 4PJCE 2NY4C 4JM4H 5CZKA 2XKNA 1KIQA 5IB1A 3FHAA 1AGBB 2ERJC 4HULB 1RU9L 1HINH 3SDYL 3T4AA 3ZMRA 2B5IB 1NMAH 3PJSB 1DBAL 4LKXB 4TVPE 4U1SA 4XPHH 3TJHC 3CMOL 4JM2A 3SQOH 5KVGL 4KVCH 4QYOA 1C12B 1QZ1A 1K8IA 5CZXD 1A6VH 2DQCL 4Q2ZB 4YHKL 2P48B 1LE9B 4YHLL 1WBXA 2WV3A 3RP1A 3MRMB 1PKQB 5F6HI 4HC1L 2JJVA 4WTXA 3WFHA 1ZLWK 1YMHB 3QNXB 4NC2B 5IIEB 1A9BB 1YUHA 3VXME 4I3RL 3C60A 1LEGA 4PRID 3ESVF 1ED3B 5F6HJ 5F9WB 3FCTB 4F15B 2OQJA 4GQ9H 4FTVD 5DMKA 1WZ1L 2FGZA 1EBPA 5F89A 2LFGA 5J13B 1N0LA 2NR6C 2L0DA 1Q0XL 3BKYH 4XGZB 2BOBB 2GJJA 2YD6A 2VLLA 1I85A 2YR3A 4LLYA 5IOPB 4PS4L 3HI6H 4P5TB 3BP4A 4WU5B 2RCSH 1PVHA 1QACA 1KCUH 2PN5A 3FQXB 1MFCL 3HFML 1KN4H 3FOLA 2PUQT 3QEHA 2J8UA 2LU7A 1FNGB 2P24A 4HPYL 2W07A 1MUJB 2FLBT 4PJIB 2V7NA 1DEDA 2AV7A 1IAIH 1P5VA 4WI6A 3QUXA 1EBAA 4M43H 1XGYL 3VXQA 3NAAL 3DIFB 4GFTB 5CP7A 3T2OA 3V79C 1NANH 4JHAL 4KHXH 5HHNA 3QUZA 3MRNB 5F1OB 2WANA 4S2SB 4TN9A 1T1XA 3E3QE 1WVZA 4ESKA 4H0IA 2F19L 3VD5A 1XAUA 4K8RL 1B0GB 3UYRH 4YZFE 5D7LE 3MQIA 2GQHA 5HVHC 3BSZH 2B20A 1AY1H 4JFQA 1ZVHA 1U8JA 3L3IB 4P46A 2J7LA 4LSTH 4UT9L 3X3FL 2BNRE 2Y06L 4W4OA 4NZDA 4PLKD 2ZZUT 2B0SL 4OZHF 3KLAA 2A77H 2P5EB 5IKCB 5H8DA 3RKDC 4LSVH 3GBLA 4GUPA 2DQGH 4DUXA 2AJ3A 5FCUH 4AQ1B 4R4BB 3MRQA 1U8OA 4M1DL 2B39A 1S7WB 1HI6B 2APXA 2V2WB 3H42L 2NXYC 5E8DH 5T1KA 1MQKH 2FRGP 4Z7WA 4URTB 5FUZH 3TO4A 4Z5RB 1YPZA 1A1OB 3ULSB 1NC4D 2DD8L 1CE1L 2Z31B 2ZOKA 1P84J 4PUBL 5EU5B 2OTUB 1S7UB 3D87B 1TJHL 2I26N 2B7DT 3UJTH 4YAQA 4LCCC 3QQNA 4HQQL 1R24A 1VERA 3ZE2F 5D6DC 2G2RB 2YD4A 4R97C 5DJ2B 1W72H 2N7AA 4HUWA 1HH9A 1INEL 3ETBF 1A9EB 4WTZG 3QYCA 2HFTA 2DLFH 4L9DA 1OAYH 2VDLL 4LIQH 5EO9A 1G7MB 3VGEA 3WJJA 2H26A 4HLZG 1UWEL 4XMLH 3TIEA 5E5MA 4YWGH 4N5EC 5IG7A 4GW1B 4HJGB 4KPHL 3K1KC 3QDGD 5JA9A 4NFDA 1YMME 4ODVH 3FQNA 4BQCA 1YC8A 2P42B 5DC4B 3RX7A 3SO3C 1I8IA 5FGBC 5DMJB 2R0WL 5F88B 3P4MA 2X4QB 1A4JB 4X6BB 4O2FB 3EOTL 3T3PF 4QHUA 3GSRA 5C6WH 3JWDC 2A1WL 5IVXE 2E27H 2NY1D 5ICXA 1CE6B 5LAXB 3FFCA 3LN4B 2D7TL 3TLRA 3QEQE 5HHPB 4M61A 4GG6F 3EYFB 3RWJB 1DP0A 1ETZB 4IMKA 4JM4L 3VFNB 3MV7A 4Z7QF 2DQIL 4LCWA 1HINL 3X13A 4MCZA 4J1UB 1MIMH 4FQCH 5C6PB 4XPHL 1NMAL 5CBAA 1MCHA 3SQOL 3MV11 1Z9LA 4KVCL 2EXYC 4XNYH 3PE9A 3IFOA 4LPWA 3V4UH 3KXFE 3I6LE 1F6FB 4R3SA 2GCYB 3IDJA 5HGAB 2AKRA 1QA9A 4OIIH 4JM2C 1JRHH 1PG7H 1KLGB 2OTWA 3NIDF 3WO4C 2R56H 2VH5H 3AREB 4Y16D 3I75B 4PJBA 4ZS6D 5D1QD 4LHUD 1N0XH 4ZYKA 1AQDB 2AEQH 5D7IE 3QIWD 2XWBB 5DD1L 2P4AB 2FB4H 3TT3H 3I6GB 3VWKB 4ZOBA 3ZE1E 4GQ9L 3KNBB 2A74B 5ITBH 4P2OD 3RHWF 1P9MA 3C60C 4OSUH 2NY0D 5HGBB 1UH4A 3OL2A 5C3LD 3BKYL 5LCVH 1IL1A 4HKZB 5JR1H 4PJDB 3BX7C 3EOBA 5A2LH 1F8TH 1LHZA 2YUXA 5LQBH 4Z7UA 3HI6L 4G8GB 1T5WA 3HG1E 1MI5D 4NO0B 4N0RA 1WAAF 1OT1A 3W2DL 4XPFL 3TFKD 2RCSL 1KCUL 4OZGF 2V5TA 5F97E 4CW1A 5E2WH 3SGEI 1KN4L 4ZUUA 2ITDA 3BH8A 3IDMA 3UO1H 5BS0A 4XP1H 1I85C 3FQRB 2XICA 3MV9A 3E6HA 2BY1A 1IAIL 1X7QB 5GGVY 4M43L 1U2HA 4QGTA 2RB8A 2WLZA 2JJSA 1C08A 5C0AA 4PB0H 4KHXL 4ELKA 2I25N 1DEEA 1E27B 2VL5A 3QUXC 4R4FL 1LNUA 5JOEA 2NXZB 1RUAH 1RIUH 1FIEA 4PJEB 1UT9A 3SQBA 3UYRL 4N0UB 3QUZC 3STLB 3UMTA 2QR0B 5ID0A 3NZHH 2XTJC 1I3RA 2UWEE 3JUZA 1KPRB 3BSZL 2W60B 1AY1L 3QPQC 2W9LA 4LSTL 3IT8D 1DTUA 3PWUB 3VFWB 4BFBD 3DSNA 4YDIH 2A77L 4OAWB 4LSVL 1H3WM 2DQGL 3MRCB 4I3SH 2CLZB 5FCUL 5IEKB 4P46C 4QEGA 3MLSH 2LAGB 4W4OC 4OQTA 5E8DL 1MQKL 4HKJB 4MNQA 3ROLB 3ZHKA 1BP3B 5FUZL 4YHMH 5GS2H 4TVPH 1QLEH 5E00A 3KYOB 2EE2A 3OKLA 3GUTA 1N8ZB 3HR5B 3AB0C 5FDYA 5DA4A 2GY5A 2JF1A 5F9OH 2WINA 3VFSB 3TO4C 2D31B 3BDYL 3UJTL 3OGOE 5IB4B 4HV8A 5LJYH 4UQ3B 3J7HA 1LK2A 4PRIB 3O3UN 1WFTA 4XNQB 2EH8H 1W72L 5F7WC 1CS6A 5J1AB 4QXGH 4BQ9A 1IZKA 1MJUH 2ZJSH 4FTVB 2DLFL 1OAYL 4RFOH 3OKOB 1QSFD 3C6LA 4UILH 2JIXD 4XMLL 1OY3B 3ZYOA 4MCYB 1U95B 4WI4A 4X6FA 3SDDD 4I8DA 3QCUH 1FL5A 2EDJA 3QNZB 4GLRH 3I84A 3WJJC 5K9KA 4ODVL 5ABDE 4KKCD 2L7UA 4X6DB 3IDIA 4LBEA 4MJ6B 2HTKC 3OG6B 1BX2A 4X80H 3V5HA 4OV6F 5HVWA 5KOVC 3V4PH 3L3HA 4F7MA 4LP5A 5D4QA 2PCPB 3T0DA 1NGXB 4KKLC 1OM3H 5F72S 1PX4A 1KELH 3MJ9H 4JDVB 4IRJA 2E27L 2IALA 4HBCH 2YOCA 1MWAB 2W0FB 3LV3A 2AV1B 2M1KA 3MA7B 1MLCA 5T1DH 4PR5A 3PHOA 3HI1B 2VQ1B 1KPVA 1XF4A 4JQVA 2R1WB 4X6CB 1H15A 1QEWB 4N0FA 1IZJA 1MIML 4FQCL 4NKMA 2HTLD 2EYSA 1A4KB 4WNQB 4HUNB 4MWFB 1AO7A 4G5ZH 5IV2B 4IMKC 1KG0A 4XNYL 3GGWB 3SE4A 3V4UL 4OCRH 5ID1A 4X7EC 1XF5B 4R4ND 5FDWB 1A6ZA 2W0LA 2NQCA 2CK2A 5J0BA 2UUDK 4OIIL 3WIFB 1P6AB 1PG7L 1QBLH 3TH4T 4AT6A 2P8MB 4BSVB 2R56L 2VH5L 1KTDA 4OF5A 3NCMA 4QKXB 1TZHB 5E70A 1QSVA 3PWVA 3QG7H 5B22A 1NC4B 1N0XL 4XXDA 1FZJA 2H45A 2VO5A 1NBZA 2AEQL 4WFFE 1NUNB 2J8UE 3R8BB 1X5ZA 5K93A 4GKSB 4LLWB 3TT3L 3DX6A 5BJTA 1CL7H 2Y7QA 2PYEA 5ITBL 1TETH 5GRZA 3RVVD 5K9OB 4U7SA 3L5XH 4OSUL 3MGTB 5F1NA 2VZTA 3MX0A 3FONB 5FOBA 2FD6L 5F7EH 4XCEB 3K4AA 5LCVL 5JR1L 2CIKB 1K5NB 3LKOA 2XTJE 2HT2C 2ICCA 4ZO6A 2GW5A 1P9MC 5LQBL 3GKWH 4HK3N 4WW2F 2HVKB 3U48A 3IDYB 1T0MA 3QJFB 3QI9A 3DX8A 1JP5A 3UO1L 5JOPD 4XP1L 3QDGB 3RBSA 1KJMA 4DKDC 4KK6C 2V2TA 3VCLA 2HG5B 3GRWA 1H3UA 3D48R 5AZ2H 1INQA 4XNUH 4X0KB 5T1LD 1J1PH 2P5WA 5MEQA 1RAMA 5B39B 4NRXA 4BZ1H 4HUVA 4ZAKD 1DBMH 4PB0L 3GMMB 4NCC1 5DHVB 3B5GA 1YPZE 2ADJA 2W1NA 3CFEA 4X8JA 4CUCA 3EIFA 1RUAL 2OP4H 1NFIA 5IBUB 3BPLC 2NY1B 1RIUL 2JJSC 3O9WA 4OLVH 3SJVA 3VFMA 1HH6A 4OGYH 4NNYA 2DQEH 3GM8A 3IGAA 1JTOA 1VENA 3P4LA 1A14H 4HGWA 4ONHB 3NZHL 1NL0H 1U92B 4L8CA 1UXSB 5KSUA 3FAXA 4JY4A 5DS8A 3VGAB 1G9EA 4LSSH 1KB9K 4RIRB 4YDIL 2SEBB 4PJ9A 5C09B 3OKKA 4QHLB 5E4EB 2XZZA 4I3SL 3MCKA 1RD6A 3MLSL 2EZ0C 4YHML 1QFWH 2J8OA 4TVPL 4POYA 4YO0B 4YE4H 2CDEB 3N85H 1QLFB 4Q9RH 5A40E 1A0QH 5D1QB 4OQ1A 5F9OL 5IW1B 1U8KB 5DDHB 1UM6H 4LHUB 2QHLA 3FQUB 3OGCA 1HWGB 2I07A 3QIWB 4K94C 1IEAA 3GKZA 4PJAA 3ZYJA 4K3HA 2EH8L 1E4XH 4QXGL 1XF3A 3DRQB 4K55A 1MJUL 2ZJSL 4QTHA 4X9FA 4QRQB 3HKFA 4P2OB 1IILE 4M7ZB 4RFOL 2E9WA 2NY0B 3GDBA 4UILL 4FFWD 1A6PA 2X4UA 2YA0A 4XRCB 3SCMD 5FO9B 5EU6D 3NTCH 5IVNA 3FFCE 3OKYA 1Q94A 1U93B 1D5ZB 4YR6B 3QCUL 4WY7H 1LE5A 1J0ZA 5ETUB 3TBSB 3C6LC 4F8QA 2YSSA 3MV7E 1DQQA 3RU8H 1FNAA 2APFA 4LCWE 1I7RA 2YD8A 1Y0LA 5IEHB 4PJ7F 4X80L 3AVEA 5AZEH 3V4PL 3S36H 3M17B 3GSUA 2FNBA 3RFZC 4FMKA 1FC1A 2AEWA 4PFEA 3MJ9L 1C7TA 1U3ZA 1MCKA 1IGIH 1XR9A 3MRIB 1BF2A 2BOCA 4HBCL 5AD0B 1T21A 5BOZG 1K3ZA 1CICD 2CQVA 2XWJB 3NIFE 4PJBE 4E42B 2GTWB 1VGKA 4S0TD 4HIEB 4HZAA 3C08H 4OI8A 5T1DL 2VMFA 5TE4H 4PV8B 3V0AC 4IRJC 1XGRB 3PWPD 2MKWA 4O58L 1F00I 1Q9WA 4X7CC 1L9NA 4EVNB 5DZOA 5DRNB 2P44B 3AMLA 3KPMA 3TA3D 4G5ZL 4WUUA 5JXED 2ATPA 3BQUC 5IR1A 3TZVD 3VXNB 4A6YB 2DYPA 1LMKA 1YJDC 2DDQH 4OCRL 4JQVC 5TE6H 4MD5A 3L6FA 2LVCA 3RJDA 4OD1L 1QBLL 3FB5B 5IJKA 4HWNA 3MMEB 4DZBB 4Z7UE 5EUOB 3SE4C 3IETA 4NRZA 3QG7L 4C83B 5I1KH 4PLJD 4CGTA 5BS0E 3CDFA 4XCYB 3TYFB 1G7PA 4P3DA 3MV9E 3WNMA 2BNUA 4KZDH 3BT2H 3K8KA 3KLHD 1CL7L 2I27N 1S7XB 2Q8BH 4H0GA 3VGHA 5ADOH 1TETL 5IESL 3L5XL 2F58H 5SWQA 5GGUA 4BSJA 4PRDB 2BHYA 5C0AE 2Z8SA 5F7EL 4XNZB 4WV1B 1ADQA 1ND0A 1DLFH 1YN6B 3FT2A 3BAEH 2OL3B 2PTUA 1GH7A 2KL6A 3JWDH 3VD4A 1A7QH 3DX7A 2CSPA 1QSFB 2F5BH 3GKWL 3RUGB 1F11A 4MA1B 4ZFGH 2JIXB 4HLJA 5I75B 4NUJA 3QRFM 4LNVA 4KKAC 2RR3A 4I0KA 2EKJA 3SDDB 4X4YB 2JCCF 2NPLX 3O45B 3OKEB 4X4ZA 1T1YA 4HGKC 2FEDC 1AGBA 1MCWM 5FGRA 1EZVX 3CGTA 1CGTA 1RV6X 4KQ4H 3GMNB 3PJSA 5CGTA 1UFUA 4QY8B 4XNUL 5EORH 4KFZC 1C5DB 3QI9C 1J1PL 3GSVB 1C12A 2E7LA 3ZKMC 4BZ1L 4NOBA 1DBML 1YN7A 4DWHA 4Q2ZA 1DFBH 1F42A 1ZA6B 5E9DD 4MNQE 3QQ4B 2YPKB 3QEUA 3PP3K 5K9QI 1Q1JH 4KUCD 2OP4L 1YMHA 4QRSB 4RMTA 4OLVL 3MRBA 1JUFB 1V7NH 4G8IB 4OGYL 3CSGA 5IIEA 2DQEL 1A14L 1BIIA 1NL0L 1ED3A 4KJQD 5E2JA 1VFMA 3QUYD 4HIXL 3O9WC 4LSSL 3BWAB 1GXEA 1GPOH 3P40A 3ELAT 5EG6C 4ZXBA 3JBG7 4EQ3A 3E0GA 5LXGH 1MQ8A 1JL8A 4XGZA 1RPQA 4H20H 4HXAH 4NIKB 5CEZH 1QFWL 4PJ9C 3BRGC 1X6LA 3HAEB 3G5YB 3N85L 4JKPH 4YE4L 4Y19D 4Q9RL 3CD4A 4WU5A 3FQXA 1A0QL 2YZ8A 2QQNL 4QRTA 1UM6L 3TM6A 1FNGA 2IBBA 1UEYA 4JRYD 1LO4H 1MUJA 4PJIA 4W6YB 4MQSB 3G5ZB 4Z7VA 1EHLH 5F3HB 2W9EH 1E4XL 3JV6B 3IKCB 4GW5B 2EXWC 4AMKH 4TRPH 1ZSDB 3FRPA 1E0OB 3MRNA 1YY9D 2NY3C 3MRDA 4JCMA 3CVHB 4JFDB 3DYMA 5D96B 4PTUB 3NTCL 3TNMB 4PV9B 2ZUQB 3EOYG 4J12A 3OJ2C 4LGSB 4PRHA 4WY7L 1B0GA 4WO4A 3S3JA 3MUGA 4WDIB 3KPSD 4MXWH 3RU8L 3KPQB 3L3IA 1OARH 2GTZA 3WE6B 1J8HD 2OJZH 5I66B 1MCRA 3GSNB 1UKTA 5F8RC 3S4SA 4X5WB 5AZEL 1AO7E 2P5EA 5IKCA 3QISA 3S36L 2WMPA 4JFHE 4IS6B 2R0LH 3KHQA 4R4BA 5T1LB 4LARH 2VDNH 1S7WA 1HI6A 2V2WA 4F33B 1G6VK 1G7JB 3WIIL 1IGIL 2EIBA 4Z5RA 4DOHB 1A1OA 3LMJH 1D5XB 3ULSA 2GHWB 2F53D 2Z93A 3RBGA 32C2A 1TQBB 1HHGB 3VGBA 5CMAB 3CFBB 3EO0B 4HD9A 2PYEE 2G2RA 5DJ2A 4N90E 1KJ2B 4OZHB 4RAVB 4Z9KB 1A9EA 1R5WB 2ED9A 2DDQL 5TE6L 3T04D 1G7MA 2H8PB 1HHKA 4E5XA 1UB6B 4J8RB 1AGFA 1QBBA 2WK2A 4B7LA 1IC4H 4GW1A 3FN3A 4HJGA 5F9DC 2XPGB 5I1KL 3F5WB 4U0QB 1CDGA 3MRFB 4H25B 3RIFK 5IJKC 1K3IA 1V3MA 4M1CD 4NZRH 2VWEC 4KZDL 4U6HB 3LKQA 1U36A 1A6WH 2RJMA 5F88A 4M6NH 3NGBB 2Q8BL 1A4JA 4X6BA 5KANG 3LN5A 1L6ZA 2LE9A 3BESR 5ADOL 2NY2C 2P5WE 2F58L 3ARGA 1DLFL 3BAEL 3WLWD 3SGEH 3JWDL 3HUJF 1CE6A 1A7QL 2YD5A 1H8OA 1M7IB 2F5BL 2NX5A 3HMXA 4OLWL 5LAXA 3TCLB 1ITCA 3LN4A 1T03H 3SJVE 3SCMB 2DM2A 4GRLB 5EU6B 4M8VA 2EEDA 3RWJA 4ZSOB 5CD3B 3V0WH 3ZKQD 4LPVA 2W65B 3QCVH 2H2SC 4ZOAA 4KQ4L 4FQ1H 3F6LA 2BRQA 3K0WA 2GY7B 5EORL 2ARJB 3MJ6A 1OLLA 3V5DA 2QSVA 4BUGA 4ZD3L 2OBGA 1DFBL 1SHMA 2GCYA 1ROWA 5T5NF 5E94B 2PF6A 5HGAA 2YA1A 2B5IC 5CJ5A 1Q1JL 1ZS8B 7FABH 3AREA 4ZFZA 2E7LC 1SBBA 2F8XC 5KSBF 2D4FA 4TVSa 3OBAA 1CICB 4NQTA 5D6CB 3HI5H 2XWBA 4NN5B 1MJJB 2J6EH 1EZVY 3PWPB 3ME0A 4U1LB 3I6GA 5C0EA 3VWKA 4ZPVB 5HJ3A 1GPOL 4FQJH 4PJAE 3KNBA 1AGEB 1FAIH 2A74A 4CRPA 2X42A 5I8CA 1XH3B 3TA3B 5LXGL 3TZVB 4HKZA 1QVOB 3MBEC 3TJEH 1J86A 5CEZL 5HVFB 2DMCA 4ZXBC 4YX2H 2JTDA 3EJJX 4JKPL 4RAHA 4G8GA 4JKMA 1D6VH 4OZFH 5C2UB 1GCFA 2DQTH 2VZ3A 1LO4L 3VGFA 1UC6A 4XXCC 1BAFH 1X7QA 1EHLL 1KCVH 1MLBB 1X5YA 3L3JA 3PHQB 2W9EL 2PO6D 1DZBA 4LQ1A 1OTSD 4QTIH 3O8XB 4AMKL 4TRPL 1XR8B 2PKDA 3U4BH 2Y07H 3WNNA 1ZWIB 1E27A 4IDLA 1TNNA 4YFDB 4M6MH 2NMSA 1T2XA 5BCAA 1WIOA 5DVOA 1SY6A 4N1CA 3STLA 4TUKH 3RX8A 1DBKH 1AI1H 1JHTB 3PHSA 3T77B 4OZGB 1ZMYA 4MXWL 2W60A 1OARL 1MCLA 3FO2B 2OJZL 3PWUA 4EN3B 3VFWA 5GJSH 3L5WB 4WUUE 4H1LB 4H26B 4OAWA 4WO4C 4AENB 1WIUA 5FEBA 3MRCA 2R0LL 2CLZA 3DRTB 1VHPA 2H41A 4HUUA 4LARL 1DSFH 2VDNL 2LV4A 4EDXB 4HKJA 2UYLB 2CK0H 1BHGA 2EC9T 2GSGA 3N1PC 1ZVYA 5E9DB 2VWEE 3KYOA 5D5MF 2AVGA 4JO4H 3HR5A 3IU4H 4PB9H 5IQ7H 3EBAA 3VWJD 4M00A 1CFBA 5FCSH 5TDPB 4OQTH 1DLHA 5KG9B 5IB4A 2IMMA 4KRPD 1V7ML 1Z9MA 4YHZH 4PRIA 4D0DB 1QLRB 5EB9A 3CX5J 4WRLA 4R26H 4XNQA 3ARVA 4FXGB 3QUYB 1HYRC 3VE0A 5I1LA 3MPCA 3LRSB 4FTVA 4G43B 1RSFA 4I2XB 5M94B 1CGUA 2F54D 4PJXB 4ETQB 5B3JF 4DQOH 3VI3F 4ZTOH 1CF8H 1IC4L 4MCYA 2KKQA 1U95A 5E2VH 4NQUA 1S78C 1VPOH 3HZMB 3QNZA 4RMQA 2DWDB 1JNNL 4N0YH 4Y19B 4JQXA 5TF1H 1KN2H 2W59A 4NZRL 5BVJB 1VGEH 5GIRB 3UTOA 3G5VA 1A6WL 3RIAK 4JRYB 4M6NL 3LQZB 4OF7A 1RZJH 2MPAH 3MRGA 1JI1A 2PCPA 1UZ6E 3KJ4B 1WSST 3MBXH 5J56B 2OZ4A 4ONFH 5FKPA 3PL6B 4JDVA 2R2CA 4U1NB 3GJEB 1BQHB 5D93B 1RHHB 3ARGC 3S5LB 2G9HB 1NKRA 2W0FA 4R0LB 2AV1A 3TC9A 3MA7A 1UQSA 3B3IA 3O3AB 3V0WL 1NGYB 2D0HA 1J0KA 2R1WA 2V5MA 4Y7MA 3QCVL 1QEWA 4BUHA 4FQ1L 3KPSB 1D7FA 4JVUA 1A4KA 1M1SA 3MACH 5E6IA 4MWFA 3L3KB 5IV2A 1J8HB 4QT5B 3RX5A 3VFUB 4JFXB 2F15A 3IB4A 3IDXH 3GGWA 1U6AH 1BQSA 1YJDH 1CFTB 1CXKA 4JJ5B 4JFFA 4HAGA 3WIFA 4MDJB 3MSPA 1CYGA 7FABL 2P8MA 4BSVA 4EBQH 4HHAB 3HR6A 1TZHA 5GRWA 1NUGA 5GS2D 1NC4A 2F53B 4TVPD 3HI5L 4BK4A 2W92A 2ICWB 2X4RB 4JFZH 2BFVH 3SDAD 2J6EL 4GKSA 4BZ2H 3GHEH 4LLWA 3AREC 4PJIE 5D2LB 3TWCH 1J8KA 1LP9A 2OI9B 2ZWLT 4Z7VE 4FQJL 5GRXG 1FAIL 3FQTB 4JVPA 3HN3A 4X6EA 5K9OA 1CTOA 3CNKA 3MGTA 1PEWA 3VA6A 3FONA 2YD9A 3AS1A 1T4KB 2CIKA 3VWKC 4Z8FH 4AEEA 2QADB 3CK0H 3VXMD 3TJEL 4OT1H 4R6UA 5F3BB 4YX2L 2HVKA 2HN7B 4QNPE 5GISH 4PRHE 5L0QB 1I9JH 1MVUB 1P1ZA 1D6VL 1OGTB 2FJHA 3GJFB 2DQTL 4ODBD 4PGCA 5FV1L 3QDGA 4AEIH 5GJTH 3D18A 3RAJH 3OAUH 3LEXB 4NUGH 1BAFL 1KCVL 2P5EE 3O4LD 3MRRB 4K9EC 4B5EA 8FABB 4QTIL 2KQNA 3HNTH 3H3KA 2DQFA 2DQHH 4ONOA 3GMMA 3U4BL 3DETC 3SBWA 5DHVA 4M6ML 4KC3B 4MMZC 5IHUH 3GRWH 5F6IC 3SKOB 4RMUA 5I1CH 2AQ3A 1UXWB 4ONHA 4TUKL 1DBKL 1FNLA 4J3TA 2YMXH 2GUOB 1U92A 1WICA 1E4KA 4TTDC 3IDNB 2NXZC 3JUYA 1G9MC 5GJSL 1T66C 1P5UA 2HMID 4RIRA 2W38A 5C09A 3EJZC 2WBWB 4F58H 4FXKB 1DSFL 3MGAA 1DUZB 3QRGL 4Z77A 4DVRL 4TULH 1J0IA 2CK0L 1TPXC 4PP2B 5FYKD 5IM7B 2EDLA 4YO0A 5IMLB 1LEKB 4GKNB 5HGDB 1T3FB 4KUZH 5I9QB 1QLFA 1HSBB 2R1YA 5IHLB 4BKLB 4JO4L 3IU4L 4PB9L 5IQ7L 2EIEA 5CZXC 3WXVL 5D1QA 5A3ID 1YNLH 1U8KA 4GOSA 5IW1A 4LHUA 1M7DA 3P9LB 4OQTL 3FQUA 3U46A 5EO1A 4TNVF 4XPTH 5DK0B 4YHZL 1K4DB 4OB5H 2YD7A 5DRWB 4R26L 3DMMD 3I50H 4JDZA 4PD4K 4Z95H 3DRQA 5DGQA 4QRQA 3JZ7A 5HHOD 1UWXH 4L3CB 3UBXG 5GSVB 3DX9B 4HUXB 1YEEH 5I1EH 4XRCA 4DQOL 4ZTOL 1FC2D 1CF8L 3THMH 3RTQA 2NX5E 5E2VL 1UKQA 1VPOL 1U93A 1D5ZA 4N8VB 1A7OH 3T8XB 1I7ZB 5D7KE 5ETUA 3TBSA 5IBTH 4FHBD 4LAJH 4N0YL 4LLMB 4YQXH 5TF1L 1KN2L 1A47A 3QWOA 3RWHA 1EFXD 1VGEL 3NCYP 5IEHA 5CSGA 3NFSH 3K1DA 2XQBL 1Y6MR 3ALXA 1KLUB 1RZJL 1K85A 3VRJB 1CGWA 3M17A 5JORA 2MPAL 4ALAH 3B9VA 4JQXC 2XIDA 2J1KA 4ONFL 2PO6B 3FQWB 1HIMH 3MRIA 1QRKA 4Y0GA 3MV8E 5AD0A 4C4KO 3FRPG 4S0SD 5JO5A 1KT2B 4E42A 3O3DB 4WI3A 1KENH 2Z4QB 3S34H 4CU8A 4HIEA 4FG6D 5I1AA 3RRQA 4KV5F 3NZ8B 1H3XA 1ZOXA 2GEEA 4PV8A 1AXSA 4HWBH 3BDBA 4R7DA 5HYIA 5DD6B 3PV6B 4H88H 1U3JA 3CLFL 1ZT4B 3EO9H 4F7CB 3MACL 4WHYH 3CVIH 4PJ7B 1F2QA 5CZVH 1Q9KB 3IDXL 3MJ8A 1Z2KA 4NT6A 3VXNA 4Y8DC 4A6YA 2FIKB 4LFHG 3LRHA 1U6AL 2CDFB 1YJDL 4DGYH 4G80B 5MEND 4HK0A 1EAJA 5E6IC 1MSPA 3FB5A 4PLKC 4EBQL 3MMEA 4G8GE 5EUOA 4UUJA 1UGNA 4C83A 4HX1B 5IJVB 4EZMA 4XCYA 3TYFA 4JFZL 2BFVL 3VWJB 4FOMA 4BZ2L 1ES0B 3GHEL 3KXFD 3TWCL 1CD9B 3PQYD 3S37H 3LRGA 1S7XA 4KRPB 2H2PD 5BRZA 3NCEB 1CU4H 4PRDA 3SHSA 4P9HH 1MH5B 3WNKA 5JNYA 1YN6A 2VITB 4Z8FL 5CWSB 3UPAA 2OL3A 2KBGA 3BN9D 1VCAA 3CK0L 4OT1L 2F54B 5HSFA 2P8LB 5KAQF 1FE8H 1MHPH 2JIXA 5GISL 2G5BA 4YPGA 1I9JL 3RGVA 4OGAC 5DFVC 5JPMB 3WHXB 1ADQH 2ZCKH 3BEWB 2DLGA 3SDDA 3OKEA 4X4YA 4DAGH 5C2BH 5I76B 1WWWX 3V7MA 4AEIL 5GJTL 1WT5A 3OAUL 1VFBA 5JW3H 3GMNA 1IGYB 3Q6GH 4CBPA 3VI4E 5F96H 3IDYC 1C5DA 1PG7X 5DHYA 3GSVA 5D7SH 1L7IH 3HNTL 1LO0H 1SEQH 3MNWB 2DQHL 3HG1D 3TVMD 4IOFC 1FBIH 2MQ0A 5I19H 4UOW0 5IHUL 1TCMA 2QSQA 1FCCA 3C8DA 3GMQB 5I8EA 5K59E 2FHFA 5I1CL 4QRSA 1UJTA 4RBPH 3O11B 1JUFA 2NXYD 3SBWC 2YMXL 2Q7NA 1QFUH 2JCCB 4CJ0A 3ILQD 4PRIE 2NY1C 3BWAA 1BZQK 4C54A 1JZ6A 3SKNB 1X5XA 1W0YT 5KSVB 4YNYB 5AYUH 3M07A 4FTVE 4F58L 1E4KC 1ZGLM 3VGAC 1RJZA 4Z7NF 4YBLC 1OAUH 4KMTH 4TULL 5D70H 4S1QH 3C09B 4PJCB 5MHSE 4HDIB 1L0YA 1QG3A 1F4AA 5E4EC 3G5YA 1EX0A 4KUZL 2QQQA 2YXFA 2I5YH 4J3XA 3QUKB 1LEIA 1YNLL 2BHZA 5EFIA 3HCVA 4XPTL 1ZAGA 1MVFA 4OB5L 1U42A 3G5ZA 1OGAD 4XNXL 5FXCH 5F3HA 3SDAB 4JKLA 3I50L 1Z0NA 4Z95L 4GW5A 5D1QC 3U9PH 3GNML 4U1GB 1QNZH 1JHLH 4XMPH 4OJFL 3W9EB 1YEEL 4NP4H 4EI6B 5I1EL 4YIQB 3QT2A 1HHIB 1JCKA 2R69H 3DV4B 4JFDA 4G7YH 5FIEA 3THML 4PTUA 5DFWH 3TNMA 1NMCB 4PTTB 4PV9A 1VFOA 5I2IB 3VXMB 1JWMB 1K4CB 1A7OL