2V65A

Apo ldh from the psychrophile c. gunnari
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
330
structure length
326
Chain Sequence
STKEKLISHVMKEEPVGSRSKVTVVGVGMVGMASAISILLKDLCDELAMVDVMEDKLKGEVMDLQHGSLFLKTKIVGDKDYSVTANSKVVVVTAGAGESRLNLVQRNVNIFKFIIPNIVKYSPNCILMVVSNPVDILTYVAWKLSGFPRHRVIGSGTNLDSARFRHLIGEKLHLHPSSCHAWIVGEHGDSSVPVWSGVNVAGVSLQGLNPQMGTEGDGENWKAIHKEVVDGAYEVIKLKGYTSWAIGMSVADLVESIIKNMHKVHPVSTLVQGMHGVKDEVFLSVPCVLGNSGLTDVIHMTLKAEEEKQLQKSAETLWGVQKELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity, Stability and Structural Studies of Lactate Dehydrogenases Adapted to Extreme Thermal Environments.
pubmed doi rcsb
source organism Champsocephalus gunnari
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 101
structure length 326
sequence length 330
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2v65A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2v65A02
4R54A 2GN4A 1FDVA 3K92A 2O3UA 4CMIB 1I30A 5B12A 3EVTA 3MJTA 2H6EA 5ES3A 2Q3EA 3HZZA 4N5LA 5ENVA 2OHXA 3LC1O 2P91A 3E6AA 2BFAA 2YQ4A 3JQ6A 3SVTA 2PGJA 3OJOA 3M1LA 4NBUA 3OJLA 2E4AA 3QWBA 4FFPA 4CUZA 3LF1A 5AVOA 2NUAA 5ER9A 1DJNA 2B36A 2J5KA 3JD4A 2BGKA 3VPFA 4B4WA 1DIHA 3H5RA 3VH1A 3ZWBA 5KCZA 5CFZA 3OECA 2X0RA 3KLMX 2OOSA 3OICA 3ROKA 3EW7A 2C5EA 2I5PO 1EQUA 4D0RA 3Q0EA 4ZA2A 1GU7A 4MVJD 3QV1A 2B83A 3AU8A 4FJ0A 3WXBA 5TF4A 4EGFA 4GPD1 2PGDA 4A03A 4RV9A 1DRUA 1GZ3A 1F8FA 3ZU4A 1C0IA 4AG3A 4FC7A 3VH3A 2NM0A 1ADFA 2GDZA 2VYVD 3I9MA 2I76A 5A04A 5CDYA 2OO5A 1CETA 4FGSA 4YEDA 2YHIA 3IDSA 2JJYA 2W8ZA 3H9QA 4GBJA 1GADO 3KVOA 3WGIA 5FEUA 4CV1A 1R0SA 4L8VA 4BNKA 2DU8A 4D42A 4QX6A 4D0SA 5G0TA 3RCBA 4YAKA 1GQYA 4MVJA 4J1NA 5K0ZA 4IDEA 2A4KA 4BO1A 3EVNA 1XDWA 3G79A 3OIGA 4FFMA 1R12A 2FPGA 3AJRA 3DOCA 5CEEA 3WR5A 1YDWA 2YQ5A 4JX8A 1ENYA 1NQAO 1TI7A 4MDHA 1K5HA 1NBOA 3AI3A 4WCDA 3UKOA 2VQ3A 4OO3A 4TRRA 3CMCO 3ZV6A 3JQ7B 4R68A 4U0KA 3E9QA 2Q50A 4R1SA 4WLFA 4R16A 1Z7EA 4NDNE 2VYNA 4WLVA 1AUPA 4YVFA 2GZ3A 1YQDA 4WEQA 5EQFA 4D79A 3ITDA 4D46A 5L3ZA 4W9NA 2VT3A 5B4UA 4RF2A 1XYGA 1LLCA 1R37A 2GRAA 4IINA 3ROQA 3AFNA 2C54A 5A05A 5BNFA 1GEEA 2J3JA 4DGSA 3HSKA 2NWQA 3IKTA 3NJ8A 1U4SA 4S3MA 4IUYA 3RBZA 3ADPA 5EINA 4HXYA 1ISIA 2OP0A 1GCUA 1EDZA 1LXCA 4EZBA 1LI4A 5EERA 1LDYA 1HE2A 3PHHA 3LT4A 3GK3A 3R0IA 5TIIA 5L7WA 2B5VA 3BMNA 1NX6A 1NWHA 3OBBA 4O1MA 3DHNA 3AUTA 4XD2A 3X2EA 4Q3CA 1V8BA 3I9JA 3NEPX 5IJZA 3HB4X 5BQFA 3CIFA 2QHXA 1VM6A 2EWMA 1DAPA 2DBVO 1KERA 3JYPA 4YAIA 4PG4A 1DFGA 1EBUA 4E5NA 4JBHA 2WD7A 3ZWOA 4QECA 3OH8A 1MLDA 3T7EA 4BS9A 1M75A 1G6KA 3OEWA 1F17A 4JIGA 1K6JA 1CEQA 1XCBA 4GGPA 1DC6A 1KIFA 3DBVO 2ZQZA 5G0SA 3VHRA 1PGJA 1Y1PA 4INAA 4Q9NA 5G0UA 1DOHA 1YB1A 3ANMA 4DMLA 3IP3A 1AE1A 1MG5A 3TL2A 4BGVA 5BNTA 5DBFA 1PGNA 2WM3A 1EVJA 4GMFA 2DVMA 3P2YA 3UOGA 1PGOA 2F00A 3UVEA 1P1IA 1N1EA 1YWGO 2ZJ1A 1J6UA 4XDZA 4BGUA 3MJEA 3S2EA 4CLOA 2P9GA 2WE8A 3HN2A 1YB4A 2UUOA 2VRBA 4OSPA 4GMGA 4TVBA 4YXFA 5BSEA 3E5RA 1GEGA 1Y8QB 1ADCA 1E3JA 4UUOA 1IHXA 4PLFA 1PTJA 4UUPA 4GSLA 1ZJYA 5U1PA 3L4BC 2QZZA 2GN8A 1SB8A 2UAGA 3L07A 4TRMA 4MP3A 4XQ9A 2DBQA 4YT2A 1P9LA 1U9JA 3C1OA 4PVCA 4U5QA 2Z95A 4MVJF 3UN1A 4RDHA 1RKXA 1V3UA 4B79A 2X5KO 5L4LA 1UDAA 4P38A 4ZN6A 2Z1NA 5JBIA 2OUIA 5KJCA 5ILOA 1BVRA 5I9NA 1Z82A 3H5AA 4RVDA 4Q3AA 2ZQYA 3GN2A 1YKFA 2E6UX 2JFHA 4Z6KA 3AOEC 3E82A 4HKTA 1E5QA 5G4KB 2HK8A 3KBOA 1TEHA 3MEQA 1TT5B 3ZHXA 1WMAA 3H3FA 4GH5A 3BTVA 2YV1A 4AJKA 1ML3A 1NP3A 1VL0A 5JE8A 4YPOA 1TB4A 5B1YA 1O8CA 5JDCA 2IYOA 1QR6A 4EW6A 3V2UA 3ICCA 3H65A 2HRZA 4IDDA 4DRYA 2P5YA 2D5CA 1B8PA 1H6CA 1PS8A 2XPCA 1KEUA 3NT5A 5IZCA 5DBGA 4WOJA 1XKQA 1CF2O 1X1TA 2B35A 2VZ0A 1DHRA 2BRUA 3H9GA 3KZVA 4J9VA 2JFFA 4FD3A 4LMRA 4HV4A 4PLTA 3PGXA 2CMDA 4IMRA 2Z1MA 3OQBA 1YQXA 3KV3O 3DR3A 3IQDB 3VVCA 1BTOA 1I5RA 1YL7A 4EUHA 4DUPA 4H15A 3CZMA 3TZ6A 1UZNA 2P5UA 1XHLA 1N9GB 2PZKA 1UXJA 5EN4A 1K6IA 3WQRA 4NNJA 3QWHA 2H1SA 4ALJA 4B4UA 3ZWNA 1C14A 1PZEA 3GDOA 3JTMA 1VKOA 3O9ZA 3GN1A 4J90A 5F3RA 2PD6A 4LVUA 4RVHA 5G0WA 3F9IA 5JPIA 5AXBA 1WDLA 1YXMA 4E5YA 4CQMD 2W2KB 1GYPA 1U3TA 1H2BA 3V1UA 2X0NA 3K2EA 4E5MA 2CVZA 2YFQA 2X1HA 4MOWA 4BNHA 3MOIA 4G81A 2PA3A 3H4VA 3RWBA 3EMKA 4BV8A 4Y6RA 2C7GA 4RZHA 2GN6A 2PLAA 2ZYAA 3D4OA 1PX0A 3B1FA 1I3LA 3A14A 3RIHA 1EVIA 2B37A 3UCXA 4GAEA 4EI2A 1ZMTA 2X4GA 5T57A 4CQMB 2IE0A 3U4DA 3WGGA 4OXKA 3TRIA 4CUKA 3Q3CA 1P74A 1YH3A 2F1KA 1BVUA 3GVIA 4Q39A 2OL4A 1HKUA 1ISJA 4XEHA 4BL5A 3K2BA 4GWGA 1CJCA 8ADHA 1HSOA 1K2WA 3WYBA 3VAZA 2J3IA 3WDSA 3EHEA 4YRAA 2CF5A 2JCXA 5JFOA 4FGWA 2BH9A 3PLNA 1R4MB 4WJZA 3E48A 1YOVA 3IUSA 4R3WA 4M89A 3RC9A 3JYQA 1M76A 1T2CA 4ND2A 4DXHA 3AW9A 4HBGA 4CJXA 4RCVA 2WE7A 3KHUA 2IZ0A 4E0BA 4DQXA 4KUHA 3BIOA 1OAAA 5JW6A 2I67A 3T4EA 3N74A 2ZTUA 1DRWA 2NTJA 5JAMA 1DAOA 1E1NA 1HYEA 1JW9B 4YT8A 1O0SA 1ZK4A 4I5EA 4L75A 2HLPA 3E8XA 3BMCB 3OEYA 4AJHA 1HTBA 2ZYGA 3OJFA 4Z3KA 2VHYA 3ZV5A 4QO8A 1YDEA 3NTQA 5AOVA 4L74A 2FR0A 3KB6A 5FF9A 1N1GA 2IYPA 1AHHA 2O7SA 2VT2A 3EZLA 4K6FA 4LN1A 2IZZA 4R01A 3CH6A 3GAFA 4NJMB 1A4UA 4U6QA 4A5OA 3JQCA 2G1UA 4CR6A 4J6FA 2RCYA 3FSRA 3OIFA 3DOOA 3G1TA 4LCJA 5L7TA 1C1XB 4XRGA 1G0NA 4CMEA 3P7MA 2UVDA 4ZQGA 4WNCA 4B8WA 4UVEA 3MJVA 3ZH2A 1LU9A 1YONA 3E5MA 3IUPA 3JQBA 4BMNA 2ZJ0A 4XDYA 5KVVA 2JFGA 2WD8A 3GDFA 4IZIA 1U5AA 3QVXA 1EUZA 4WECA 4Y67A 1R15A 4CLRB 3Q6IA 3JYNA 3R3JA 5IN5A 2HJSA 4G65A 3UHAA 2AXQA 2JD2A 5CPFA 1GD1O 1F0YA 4L9RA 1Y9EA 3D1LA 3I6IA 4DIFA 5IZ4A 4RL6A 4MJLA 3G3EA 3C3XA 4PRKA 3ZU2A 4BNIA 1HE4A 1KEVA 4I1IA 2WD7B 4NBRA 4DL9A 2VUTA 2XAAA 1Y81A 1E0DA 1XGKA 3H6KA 1TT7A 5F5LA 3OF2A 3ETGA 2C7VA 3FBGA 4CM3A 4XYEA 3HJAA 4JBGA 4XYBA 4PZCA 3H7AA 4IMPA 5JO9A 3D0OA 1ZO8A 3PJGA 4WOKA 3GT0A 4JXKA 4XGNA 2A94A 1Q7BA 1Z73A 5DNAA 4R9RA 4QTZA 3SXPA 3NTOA 3U4IA 4UVGA 2D1YA 1W6UA 1LDEA 1VPDA 3GMDA 4J16A 4WCFC 5CG1A 2CD9A 3WNQA 4BO8A 4BNFA 4Y9DA 4DWVA 3RKUA 1HETA 3ZNOA 1BW9A 4YJGB 1LRJA 2B0JA 4EJMA 4OKNA 3BHJA 1IE3A 5ICSA 1EFKA 2ILTA 3JQGB 4NI5A 1JU9A 3GLQA 4WEOA 2J5RA 3HFGA 3WLFA 4AJJA 1VL6A 1N7GA 3KYCA 2A92A 4YJDA 4JBIA 4WE3A 1YB5A 3H8VA 1SOWA 1H9AA 1P44A 2QRLA 2RHRA 4IDBA 4J0EA 4GL4A 4DQUA 4IDAA 1E7QA 4ND3A 1IL0A 2CY0A 3DONA 3QY9A 3UGKA 4X54A 4CLOB 2QG4A 4CR8A 1Z7BA 5DCUA 4OSOA 3GVXA 4MP6A 1X0XA 1J5PA 1X0VA 1T4BA 1L7DA 4QUKA 4AJ4A 3VH2A 1E92A 4J1QA 5ILGA 3ZNNA 1PZGA 3T4XA 4FC6A 1B2LA 2P9CA 1JVSA 1UH5A 2QIOA 1MFPA 3W4IA 4WASA 5L40A 2JAHA 3NJ4A 5ENDA 2VZ9A 2O50A 4IY1A 1ZK1A 2DBZA 3AK4A 1XWFA 5CHEA 3BZUA 2X0IA 1XQ1A 3IIEA 3DMTC 1NNUA 2VN8A 1BRMA 3ZWWA 1UUFA 4RLHA 4CV0A 1I8TA 3FPLA 3NGLA 3R3SA 4AJ2A 4D7AA 4Q3NA 4CQLB 2ZKLA 3N58A 1Y8RB 5KVQA 3TJRA 4I9NA 2BHLA 2Y1DA 2I3AA 4GLOA 2Y0EA 9LDBA 3SC4A 1ENPA 1E7RA 1KS9A 5JO0A 3QWFA 3WYEA 1E3WB 4PLVA 1XU9A 1NHWA 5JAZA 4DLLA 1LLUA 2DTXA 4YCAA 4QFCA 3PJEA 1JKFA 1I36A 4DC0A 4XQEA 3VPGA 4J3FA 4BKRA 1YS4A 1VLLA 1Z74A 3GNQA 4GVLA 1JAYA 1EE2A 4ZHSA 4C4OA 1ZSNA 5JSFA 3CTMA 3NT2A 4B4VA 1MA0A 3HQ4O 1DXYA 1PL6A 2ZTVA 3CMMA 1U7HA 2R6JA 5BT9A 3DHYA 2PV7A 3DO5A 1NFRA 1XA0A 1D7OA 1SBYA 3GEGA 1ONOA 3WQSB 3KSDO 2AEFA 2VYVA 2X22A 1ZK0A 2AMFA 1C1XA 3ICPA 4O6VA 2VWGA 1EDOA 1O89A 2X9GA 2BFOA 4PLYA 5KKAA 4ALIA 3PQEA 5L9AA 2YUTA 1I33A 5C7IO 1U28A 1KC1A 3OJEA 4KOAA 4FDAA 3VH4A 1NFFA 4XJSA 3GFGA 1L1FA 3K31A 5DDIP 3RUCA 3Q9UA 1OMOA 3CPSA 2AE2A 4TWRA 4E32A 5AQ1A 1P1RA 3VC7A 3VOSA 5CAEA 4MIOA 2AQIA 3ZU3A 3UF0A 3VKUA 1R16A 3R6DA 1T2FA 1KY5A 5A9SB 2XXBA 4W82A 1HRDA 1A5ZA 5F21A 1ENZA 4IDGA 4ALLA 3ASUA 1YVEI 2PTGA 4ND5A 4QFDA 1Y7TA 4K1LA 4N54A 2H63A 2Q46A 2AEMA 4IDCA 5COAA 5BSFA 4EDFA 1H6DA 3PXXA 3RU7A 3LC7O 2PWZA 4E13A 4CM4B 1KVQA 3WNVA 2C82A 3ANLA 4E30A 3WWZA 3AOEA 4XA8A 5DULA 1A72A 1B26A 1SCUA 3MCVA 4WK6A 2CNBA 4YT5A 2CVQA 3ZV4A 1I32A 4M55A 4YJFA 1Y6JA 1OFGA 3LT1A 4IS2A 1QYCA 5DF1A 1O95A 1U3VA 1P45A 1HT0A 3TZKA 4FW8A 4MINA 4IQGA 1LEHA 1H2HA 1E3LA 3V1YA 3DHEA 2GN9A 4AFNA 1HDZA 3KXDA 4B3HA 5T8KA 2E37A 3OQ6A 1Y5RA 3GVHA 4P8RA 4GQAA 4B3IA 4TRNA 5JXWA 4BNNA 3WJAA 4I5GA 1Q0QA 3EDMA 2HUNA 4ZVVA 3RROA 4F3YA 4AVYA 4FR5A 1XSEA 3EAGA 3V1TC 3S1LA 4AICA 3ADOA 4WLNA 3HDHA 4UVDA 4BNTA 1E7WA 5GZ3A 3A4VA 3JQ9C 2QRKA 2CDBA 1KEPA 5HTOA 4IDFA 4BHTA 2PR2A 2QYSA 1FDUA 4R69A 1NPYA 4XYMA 3GG9A 1A9YA 1X1EA 4JP3A 2RAFA 4NFHA 3VVBA 2POQX 1LNQA 2HAEA 3FNEA 3A28A 3JQAD 4WLOA 1BHSA 3JD2A 4XWYA 4BNMA 2YY7A 1J4AA 2AE1A 4RPHA 5I9LA 3OHSX 1FDTA 4H7PA 3NV9A 5GZ6A 3QHAA 1F14A 1I10A 3ZWXA 2IODA 4J2HA 4D44A 3E9NA 3DZKA 2NADA 4CLDA 1R0KA 3VTZA 4RPGA 1Z6ZA 4BNWA 1NPDA 3OJ0A 2J3KA 1Y8RA 4ZRNA 5G0VA 4AJLA 2Y05A 3KUXA 1QSGA 1NWCA 2O4CA 3GNSA 5KVCA 2IZ1A 1AXEA 5CDGA 1PZHA 4XJTA 4CM1A 1WP4A 1U3UA 1C3VA 3U09A 2VOJA 3CEAA 2Q2QA 1DIAA 2CDCA 3UCEA 4AL4A 1MXFA 4RLSA 3IOYA 3DBHB 1YBAA 4IGFA 2GZ1A 4J9UE 4PZDA 4WPGA 2D2IA 3GG2A 3HE3A 4NBWA 3RUEA 5IAAA 4GSKA 4KQWA 4IIUA 3VPHA 1VRWA 2EJWA 4TVOA 3HHPA 4XQCA 1EFLA 2JD0A 5I7VA 1Q2XA 5CP8A 4LCEA 3NDJA 3WX0A 4NPCA 5H81A 1NXQA 2EP7A 2HQ1A 3A1NA 4M49A 1ISGA 4JJIA 3OETA 3RBXA 4ONEA 4PLGA 1B8VA 1LQUA 1DPGA 3EY4A 1JDJA 1WZIA 4FFRA 1NR1A 2AQ8A 1PL8A 2P2SA 2ZB3A 4MVJM 4F6CA 1J49A 1GYRA 3ZWYA 1HLDA 1UXIA 1M6WA 2EKQA 3LC2O 3O03A 3SJUA 5A3JA 1P1FA 3S2GA 1YQGA 1YO6A 3INGA 3MTJA 3GUCA 2FR8A 2J8ZA 5THKA 1Q7GA 3U5TA 4JLWA 2Y68A 2RBEA 4J7UA 3RUDA 4DBVO 1U2DA 5A9SA 2PKQP 5C7OO 1UAYA 5L4SA 4BNVA 2IDZA 2WDZA 3AUUA 4RZIA 4C7KA 2CSUA 3JQ8A 5KJ6A 3WBFA 4CM8B 4CLXA 1I0ZA 1NHGA 1BDMA 2ZB4A 3JD0A 4NK5A 1JAXA 1T1SA 1I2CA 3KSZO 3VZPA 2YV3A 5IDWA 3U9LA 3COSA 1QKIA 3DEYX 5A4DA 3EK2A 1MP0A 3GUYA 3IMFA 3D3WA 2HSDA 3RU9A 4BGIA 1R4NA 1XIVA 1DIGA 2I99A 4J91A 1GZ4A 3FR8A 1H0KA 2ET6A 1WNTA 4Y6SA 5KJ1A 1N7HA 4BKPA 4BO4A 1NR7A 4J4HA 2EKLA 5KWEA 4E33A 1ZFNA 1QORA 3DXFA 3OP4A 3LU1A 3PP8A 5KOIA 3F47A 4QEDA 3QVWA 4O0LA 2YHIB 1DRVA 2FP4A 3KYCB 1GYQA 1WVGA 2EHDA 4H3VA 1D1TA 1X14A 1PEDA 4NH4A 3K96A 1R66A 4BNLA 1W8DA 1I2ZA 4A7PA 1I3NA 4FOOA 3KRTA 1JLLA 1RPNA 5TJHA 2X6TA 2ZCUA 3B20A 1KBZA 4B3JA 2UYYA 3NUGA 4OQZA 1TA4A 3TL3A 1PJ2A 1JWAB 3DZJA 3GZNA 1V6AA 4PGFA 1E3IA 4FB5A 3F6YA 1BWSA 2Y1FA 2UDPA 3JQBC 4NMHA 4NJMA 4OOFA 4ZD6A 4B7CA 4GLLA 4NR0A 3JQFA 2NVBA 1G1AA 2NV6A 3M2TA 3LT0A 3GY0A 2BI8A 2GD1O 2VTDA 4YT4A 5A9TA 4PIVA 4CMGA 1KY4A 4IJUA 1ZSVA 3GA0A 3M1AA 4BIIA 5CEFA 4ID9A 3JQEA 3PWKA 5A5EA 3UICA 3DQPA 4II2A 4NU6A 1LDBA 1V3VA 3PHIA 4GI2A 4GX5A 1PIWA 1YL6A 2Q99A 4W9NC 3S2IA 2FRDA 4ND4A 4MKXA 3GAZA 4XGKA 2B5WA 3ENNA 2VZ8A 3PYLA 4CLRA 1XR3A 2BI7A 3AUSA 4C7JA 3GHYA 2Y66A 3W8DA 5J23A 3BTOA 1XELA 2Y1OA 3RD5A 3RFTA 4HX5A 4OGWA 4CPDA 3JYLA 3PZBA 3TPCA 5BNIA 1OC4A 3GMSA 3K73O 4I5FA 4E21A 3PJDA 2EGHA 4ZRMA 4OM8A 1WW8A 3RJ5A 4QSMA 1LDNA 3UFXA 1BXZA 3U4CA 4FPXA 1ZIDA 3NYWA 3EGOA 4QQRA 4URFA 2GZ2A 2TMDA 3PWSA 1I2BA 2GO1A 7ADHA 3GRPA 3I1JA 4GVXA 2JD1A 1DLJA 4R41A 3NT4A 2JCYA 3JQFC 3ZW8A 3QWAA 4XB1A 5T6BA 1IHYA 5JYEA 1I24A 4FFNA 4RPKA 4MO2A 3K30A 3DBRB 3H9EO 2DUWA 3PHGA 3DZBA 3D4PA 1P1HA 4K26A 4BO0A 1M66A 4WUVA 2EGGA 3V2HA 4K6CA 3DAGA 4AJEA 4G2NA 3DB2A 4A26A 4YAEA 3ZWVA 1QV6A 2HMUA 1WLYA 3RJ9A 2OBYA 3DTTA 3HDQA 4FQ8A 1PJ4A 3FWZA 4D41A 2X86A 4EUFA 3VPSA 3WIDA 1CDOA 4KUGA 3PDUA 1PSDA 4HP8A 3GNTA 3ONDA 3QSGA 2DFVA 2OGUA 1JQBA 3AWDA 5JLAA 4CLEA 1XEAA 2V7PA 1JTVA 4AJIA 5AXAA 3WBBA 1K0UA 3LK7A 2PH5A 5TT0A 3B1JA 1B14A 1U3WA 4OXYA 3ZI0A 2A35A 3OM9A 3AY7A 4IXTA 3NGXA 1SOVA 3R1IA 1IZ9A 2X9VA 4EEXA 1A27A 4PG8A 2O3SA 1ONNA 4WCFA 1UP7A 5T64A 1GPDG 1SMKA 3P2OA 4P22A 4U7WA 5U4QA 2EXXA 2HDHA 2BGLA 4L73A 4BO9A 4EYEA 5JNLA 3DL2A 1U4OA 3U49A 3D5TA 4K9DA 5TSDA 1DIBA 5TLSA 1LSOA 1FK8A 3DMTA 3RC7A 2PH3A 2VOEA 1LRLA 2QW8A 3FNGA 3OQ1A 6LDHA 1UJMA 2Q2WA 3TOZA 4EUEA 2Y1GA 3FR7A 1C0PA 1XQ6A 4E4YA 2DAPA 2D5AA 3FHLA 1ONPA 4MVJE 2X23A 5A1TA 3D5QA 4XR4A 1GL3A 1O94A 3HADA 5L4NA 4CMAA 4NZ9A 3QIVA 2VWQA 4YJGA 4CM5A 4GX0A 1GY8A 1A71A 1YL5A 2V6GA 3UXYA 1VJ1A 3WG9A 2HK7A 2EW2A 5KJFA 1T2AA 1EE9A 4XX0A 4Y8VA 4PN3A 1SB9A 5HS6A 2AA3A 2C29D 4L4RA 2A9FA 2FWMX 5IXYA 2Y99A 3SLKA 1IPEA 5A5FA 4NIMA 1VI2A 5EPOA 4ALMA 4DQVA 2W90A 2FSSA 4J1SA 3BMCA 4M86A 1A7KA 3DC2A 4YTEA 2HMVA 1PJCA 2O4UX 4RF3A 1F06A 1H94A 5TQVA 2D8AA 1GQ2A 3KEQA 3RQSA 3B70A 4CMCA 4XYGA 1BG6A 2EF1A 4I5DA 4QT0A 1GUFA 1IPFA 1KVRA 1LSUA 5G4KA 5FFFA 2CZCA 1X7HA 3BMQB 1P77A 4YACA 3V2GA 4EITA 1CQIA 4CMEC 3OA0A 5AXDA 3ZW9A 5LCXA 4LVCA 4XIYA 4BGEA 4MKRA 4S1VA 4CUJA 1QG6A 4FJ2A 1MFZA 1RJWA 4JP2A 3FTNA 1J0XO 2P4HX 4KDEA 3L6DA 4HWKA 3EZYA 5EESA 3ZNQA 3GQVA 1EQ2A 4MP8A 5GY7A 3RAJA 5FI3A 2VYND 4KMSA 3D4NA 1GV0A 1IZ0A 3NTRA 1PU2A 2BF7A 1B8UA 3ULKA 5JMWA 1HDRA 2UV8A 1C0LA 2E48A 2O23A 2J3HA 3GPDG 1E3SA 2EV9A 4BO6A 4YAGA 1A4IA 3UH1A 3CZRA 3DAPA 4TROA 2HJRA 4MVJG 5JMPA 3QWIA 1O6ZA 3PJFA 4Z9XA 1EVYA 1JN0A 3PIIA 2PD4A 3PTZA 3HNPA 4WNIA 1DC4A 1P1JA 1D1SA 1GV1A 1SO8A 1BW9B 1ZXBA 3JQGA 1NFQA 1IYZA 1I3KA 1PJTA 8LDHA 4J2OA 4JJFA 1PJ3A 1GCOA 4XGIA 2W2KA 1OC2A 2NU9A 5IDQA 4CMHA 4DPKA 2EG9A 2Y0CA 1UDBA 1RWBA 4KZPA 2LDXA 2VRCA 3I9OA 5IF3A 1O9BA 4W4TA 2FY8A 3I4CA 3S55A 1MGOA 3JV7A 2GF2A 1EBFA 3EUWA 4ROSA 3KO8A 4NHEA 3DZFA 4NK4A 3CKYA 1GZ6A 4GGOA 3PDJA 3PIDA 1E6EA 1K6XA 4BKUA 3GEMA 2SCUA 3K6JA 1BSVA 4AJOA 2BLLA 1A9ZA 2PY6A 4UEKA 3E03A 3PLRA 1E1KA 1OI7A 4M1QA 1QLHA 2R00C 5CDUA 4F6LA 3GHHA 1NVTA 4HY3A 1ULSA 4RO0A 6ADHA 3AY3A 4UUMA 1YBVA 1RM3A 2D3TA 3TOXA 3IC5A 2C07A 4CM4A 2WYWA 4Z0PA 1R0LA 4FSHA 3ZWCA 1WWKA 1LC3A 3ZV3A 2Y1EA 3FNFA 3G17A 4FFLA 4ZQEA 4RORA 4NG5A 2JKVA 4YAJA 4YJHB 4FOSA 2ZB8A 4DVJA 4YBZA 1U8FO 1UZMA 1R4MA 5K6AA 5BR7A 5I8WA 2Q1UA 4NBTA 2VUSA 5B4VA 3F4LA 4FBGA 3F5SA 2P4QA 4OL9A 5H82A 1FDSA 1ZBQA 1CRWG 3PHJA 5FI5A 2J5QA 3KM0A 4BNUA 1E3WA 1CERA 5LC1A 3GFBA 2AQKA 4DYDA 1GUZA 1EUCA 3F3SA 1Q0HA 3Q2KA 1AXGA 4NU5A 5EL0A 4BV9A 2WTBA 2Y67A 1NAIA 1QYWA 4CLHA 3FPCA 5ICMA 2NU6A 1MUUA 3ZU5A 2JL1A 4CM6A 2DC1A 5JDCC 4BQPA 3ENKA 2PZJA 4Z9YA 1UDCA 1PWXA 1CIVA 1VJTA 3MJCA 4YQYA 3QE3A 5KNLA 2H5LA 1E3EA 5ER6A 3UUWA 5C3MA 3F46A 2WSBA 1N9GA 1HL3A 2NU8A 1QP8A 4BO3A 1VSVA 2AG8A 2GYYA 5GMOA 2EIHA 1ZW1A 1NTOA 3ITKA 1T2EA 3HDJA 3G49A 1IB6A 1ZNQO 3ONFA 4J1TA 4YYZA 1PWZA 2P68A 4P4LA 1CWUA 5L95A 1NVGA 2AHRA 5CEJA 1TVEA 4B7XA 3KEOA 4IM7A 2FN7A 1HSZA 1E6UA 1VC2A 1ZK2A 2B4TO 2HCTA 4II3A 4LK3A 3IJRA 5TC4A 3ABIA 1H5QA 3QVSA 2UUPA 1HE3A 3I4FA 2GSDA 3Q1LA 3DBRA 3AM5A 2W98A 2XXJA 3WFJA 4DIOA 1R6DA 4M54A 4ZJUA 2DLDA 2NQ8A 4KP7A 1DB3A 1D3AA 1X13A 3B6ZA 5DBIA 3OFSA 4OJNA 3ZWPA 5JYDA 1JWBB 3JCZA 1QYDA 1I01A 1M2WA 3C1AA 4R51A 3TWOA 4ZICA 5DOZA 5DZSA 4AJ1A 4CM7A 5CG2A 3Q2IA 1MG0A 4ZQFA 2C20A 5KIAA 3GGPA 1GUYA 4A2CA 2Y93A 4RF4A 2HMWA 3RFVA 2PGLA 5G4LA 1ADBA 2HO5A 2I3GA 1F12A 3L77A 5F1KA 3B1KA 2Q1SA 5K6AC 4IXWA 5JY6A 3CXRA 1HDOA 1IY8A 1MC5A 1ZK3A 2FOIA 1KVSA 2DTEA 1JKIA 2IEDA 1LDMA 3AI2A 4U6SA 3ZHYA 3MZ0A 4W7IA 4RVUA 2ZATA 4IJVA 1P31A 2VHZA 3KSUA 3WLEA 3O26A 3QW2A 3WMXA 4DPMA 4RDIA 4LSWA 1DC5A 3MWEB 1Z45A 3M2PA 1E1MA 3LQFA 4GX2A 4IPTA 3V5NA 5KJEA 4FIZA 2X7HA 3HUDA 4JQCA 4WGGA 1LBEA 2GLXA 4CM9D 5IFLA 4I9HA 1SNYA 4OQYA 3GF4A 4YA6A 1PR3A 5DN9A 1NQOA 1DDOA 3MTGA 3ORFA 5HS4A 4W99A 2DBRA 2GGSA 3O4RA 1Y8QA 4R4JA 2CUKA 1XG5A 1QRRA 3EC7A 2GERA 3JQAB 3RSHA 4F46A 3PQDA 3QVTA 4OKIA 2IXBA 5K9ZA 2V6FA 3DZGA 4ALNA 5AYVA 4FS3A 1DC3A 2OBNA 5ITWA 2Q45A 1PR9A 3FWNA 3WICA 2PFGA 1GPJA 1V9LA 2I6TA 3GDGA 4Z0TA 2X8LA 4HNHA 3TDKA 1DBVO 3TN7A 3E9MA 3DFZA 4MIYA 3NKLA 4HFNA 4JCOA 2NVUA 4CODB 3NAQA 3DOJA 4XQGA 4J4TA 1LLDA 2FHSA 2G82A 1NQTA 1UAGA 4XRRA 3MWDB 1IUKA 4OAQA 4L4SA 2YW9A 3QLJA 3A06A 5F1OA 4DLBA 2ZK7A 4OIMA 3O8QB 1B0AA 3H2ZA 4H16A 3E18A 2VCYA 2O7QA 3KYBA 4EJ6A 4LSMA 3BMOB 3JQ8B 4ZQHA 1KVTA 3QVOA 1V35A 4I08A 1PS9A 1QYVA 3A9WA 2HMSA 3GGGA 1B3RA 4YRBA 3C7DB 2YDYA 3TZCA 5HBRA 3KTDA 1IOLA 1DEHA 5T5QA 1GAEO 1ZJZA 4L4XA 3JQAA 4MIEA 1E7MA 1EEHA 1LTHR 3WGYA 1LA2A 5EMHA 3D7LA 5IXSA 3W6UA 1DHTA 2RIRA 1ZCJA 2GASA 3TSCA 5HM8A 4GKVA 1NQ5A 2I65A 3AU9A 1LUAA 5JCJA 3ZHZA 1N8KA 2Q4EA 3AOGA 5DCWA 3K8ZA 3KETA 1U8XX 5JC8A 1U2GA 1UR5A 3JYOA 4JK3A 3WSVA 4HADA 2FSVA 1LSJA 2NACA 4A10A 1LSSA 5I7FA 2YZ7A 5LDHA 2B69A 2H9IA 4Y6PA 4CMIA 3LLSA 3F1KA 1SEPA 4DBZA 1MB4A 3WMWA 4RVFA 3ZGYA 4ESOA 1ZEMA 3V8BA 3U62A 2Y1CA 4PG6A 1FXSA 2IEBA 4PZEA 4CQLA 4PLCA 5JDIC 2O3RA 3TFOA 3RUAA 3I9NA 4PLZA 4BB5A 1T25A 3L6OO 4RQUA 3GGOA 1JKJA 2ZTMA 3FNHA 3WGQA 2CDAA 1ISMA 3F1LA 2GR9A 4FFOA 1Q7CA 1ZKMA 3C85A 3NDIA 5C37A 1UP6A 4E5PA 5A06A 5IZCC 3GR6A 5DP2A 2D4AA 4EBFA 1LQTA 3WGTA 3TNLA 4BMSA 4E6PA 4U8GA 3PPIA 7MDHA 4MVJP 4E2ZA 3L6EA 4BOYA 1ORRA 3W8EA 3WFIA 3QA9A 3HG7A 3PHLA 3BMNB 2YJZA 1HLPA 4UVHA 2DPHA 2X58A 1D8AA 2EW8A 1BXKA 2WMDA 3CSDA 4KTVE 5DP1A 3BA1A 2FMUA 1RYDA 3ETEA 1E6WA 1ARZA 1GR0A 1C0KA 3I3OA 3HFSA 3PEFA 3IS3A 4WCFB 3U0BA 4YJHA 3UCFA 1PGPA 3TF5A 2C2XA 2YV2A 2E82A 4Q3BA 1LRKA 1YOVB 3H9JA 5L7YA 1KEWA 4BKQA 1GFSA 5FYDA 3WB9A 3DFUA 5U9CA 3DZHA 1ZXLA 3WYCA 1VKNA 3SBOA 1P0FA 2PNFA 4BB6A 3KYDA 3ONEA 3PGJA 4K28A 4JGBA 4KQXA 4NFSA 4M87A 4IQ0A 3C24A 3DBLA 3I52A 1AN9A 2VHXA 3H2SA 4RVSA 5ITVA 1MX3A 5EJ2A 2ZB7A 2ZIZA 4WKGA 3DZIA 1HXHA 5IG2A 4O59O 3QQPA 1MXHA 4TMFA 4CV2A 4YB8A 3IAHA 2J6IA 3I5MA 3WGZA 3H3JA 1ISHA 2W2LD 2DUUA 4JJGA 1EUDA 3TZHA 3WS7A 1W73A 4LMPA 2QX7A 1ZSYA 4CM9A 3RBVA 3D64A 4E5KA 1RM0A 5FWNA 2DFDA 1SAYA 2JHGA 3W4JA 5KTKA 1I3MA 5TRTA 2BGMA 1KVUA 1RYEA 4IIVA 1HWYA 1M6HA 2NVUB 1E7SA 3BHIA 5DOVA 4UULA 1QXSA 1PQWA 1Y5MA 5A02A 3VTFA 3U3XA 2EJVA 5B37A 4PLWA 4BMVA 1PJSA 4QXMA 1NYTA 2W4QA 1B7GO 4CR7A 2O2YA 1YGYA 1H9BA 2NU7A 3O8QA 1HDCA 1Y9AA 2AG5A 5JDIA 1HEUA 4OYRA 3INRA 4DREA 3FI9A 5KKCA 1NM5A 1W0CA 4Z0HO 4MVJI 2DQ4A 1JVBA 2VWPA 4W6ZA 3W4KA 3C1TA 1BXGA 1BXGB 2Q1TA 2HK9A 4MVJH 3BMOA 1ISFA 3D3EA 5HWSA 3FCOA 2YDXA 4KUEA 4R9SA 3RVDA 2VRCD 5IDXA 3IL2A 3BAZA 1HDXA 1B16A 3DBHA 3FRJA 4EEZA 4J7CA 1QMGA 1S7CA 3LDHA 3MJSA 5MGBA 1M67A 1HZZA 3JQ9A 1K3TA 3RASA 3WTBA 4OH1A 3AM4A 1SEVA 2IXAA 3GH3A 1P0CA 4Q3EA 4XB2A 1WDMA 1YE3A 2XOXA 4HUJA 5LDGA 5HRUA 1BGVA 3JD3A 3JD1A 4IS3A 2CVOA 3ZWMA 3FTPA 3BTUA 4NFYA 3FD8A 4TSKA 3ZWAA 5KVSA 3UAGA 1DSSG 2G0TA 4R3NA 4BNXA 3H5NA 4DC1A 4ZGWA 3I83A 4A0SA 4PG5A 2G5CA 3UW3A 4E2XA 2B4RO 2VTEA 4RF5A 2VUUA 4QO7A 5JC1A 2O3TA 4YQZA 3STHA 4A27A 2NLOA 2Q2VA 2YHUA 3ON5A 3INTA 2VHWA 4TKLA 4BO5A 1TT5A 3W1VA 4PLHA 1NVMB 3PQFA 3VKVA 3ZZNA 1XLTA 5L45A 4N5NA 2HRBA 3L4BA 4BNZA 5TNXA 4XZ3A 4OHUA 2GCGA 4G5HA 5HA5A 4ITUA 3DDNA 1YBMA 3IKVA 1H6AA 4TZTA 4MPDA 3ASVA 5TS3A 4J7XA 1EZ4A 4J4BA 2NTNA 4BNJA 1F8GA 1NAHA 3GOHA 3EYWA 1TXGA 3DMYA 3F5QA 1FDWA 4HFMA 3VPXA 3VZQA 2QYTA 3SLGA 4E31A 2DT5A 2JCVA 4PRLA 3C7CB 1EVZA 1LJ8A 5JAIA 1U1IA 3P5SA 1XU7A 3MOGA 3RKRA 4D3DA 4L0QA 1Q1NA 2GUGA 2R2GA 1ZMOA 4D3FA 2BFMA 3I9LA 4XCVA 3AUAA 4TZKA 1UP4A 2X5JO 3H9UA 1ADGA 5A9RA 2XF8A 3K9QO 4E2YA 2V6BA 1PZFA 1U7TA 4R1UA 4UAGA 3L0DA 1T24A 4P4GA 2NQTA 2W2LA 1NPTO 2BFPA 5A03A 3KYDB 1AGNA 3LYLA 5JY1A 3O38A 4YDRA 3ROPA 3KLPX 1B15A 1WAMA 4DA9A 3OIDA 4HFJA 4OOEA 5COBA 1GDHA 2HMTA 1OZAA 1HE5A 2V65A 2ZYDA 4E3ZA 1QV7A 3TQHA 1KETA 4LISA 4ALKA 5BSHA 2Q4BA 3ZHBA 1YRLA 3NRCA 5DCYA 1PQPA 4GWKA 4PCVA 4YR9A 4PLPA 2JHFA 3WJ7A 4DYVA 3I9KA 1T4DA 3GZNB 4ILKA 3I6QA 3HB5X 4BVAA 3BTSA 1KC3A 4NQZA 3MJ4A 2GNAA 2EEZA 4PG7A 1VL8A 4BO2A 1WPQA 1LLQA 2OMEA 4YRDA 1GTMA 3ROMA 1UXKA 1SC6A 1MV8A 1SPXA 3KOUA 1EK5A 1N92A 3W6ZA 4R5HA 3AM3A 2DTDA 2PZMA 3F4BA 4FN4A 2Q1WA 4CL8A 3PFWO 4KDFA 3I23A 3U4HA 4NJOA 1T26A 3X2FA 4B8ZA 3WSWA 1EK6A 3FN4A 2TMGA 1K89A 4R5MA 1L7EA 2WYUA 1X15A 4HFRA 2C2YA 3S8MA 2P9EA 4LGVA 1VE9A 3AY6A 1V3TA 4UEJA 4Q3DA 2AQHA 1KOLA 1PL7A 5C5IA 4YJFB 1PQUA 3WOHA 1VSUA 4DIBA 2I66A 4RGBA 4IQ8A 4IBOA 3K5PA 5ADHA 2ZTLA 2DM6A 4BQRA 1DFHA 2NSDA 2PK3A 1O5IA 1HZJA 1BMDA 4GX1A 1Q0LA 4FCCA 2PKRA 3SX2A 1BDBA 3CUKA 4R1TA 3JQDA 4HNGA 1T2DA 2B4QA 3PYMA 4R1NA 1EMDA 4JROA 3RUFA 1N5DA 1Z75A 2O3QA 4U0JA 4CL3A 2VNSA 1ZUD1 3T7CA 4JN6B 1DJQA 5G2OA 1LX6A 5GZ1A 3PZRA 3L9WA 4FJ1A 1FMCA 4J43A 2PZLA 4CMJA 4AJPA 2Q49A 2X5OA 4M8SA 2WEKA 3N7UA 1V0JA 2WYVA 4AJNA 1NASA 5EQDA 3PFFA 3RI3A 3IP1A 4E12A 2C59A 4KWHA 3Q11A 5I7SA 3WQQA 4CQMA 2OFPA 1PGQA 1GQQA 1P1KA 3DBLB 4UUNA 4DLAA 4ZU3A 1N2SA 2X0JA 2QZ9A 1HYGA 4J49A 4YWJA 1OOEA 3BYZA 2BKAA 2G76A 3Q9NA 1LDGA 3ZN2A 2PD3A 3FF4A 4Z3DA 2O48X 4TKMA 4XR9A 2BELA 2ZCVA 2IRWA 2LDBA 1C1DA 4RPJA 1P3DA 4PFJA 3WGHA 4BKOA 2DPGA 4B7UA 2EERA 4EJ0A 4N5MA 3BMQA 3JSAA 3C8MA 3GRKA 4RQTA 4J0FA 4CV3A 5I8ZA 5IN4A 2FPIA 1RM4A 5JCXA 2FZWA 4E2WA 1X7DA 1ZH8A 4CMKA 4DTIA 3RFXA 4TRJA 2OP1A 3BHMA 3GVPA 4UVIA 1JA9A 5COQA 4WLEA 5F5NA 3QRWA 1DIRA 3HDYA 2V6MA 4IZHA 3RUHA 2RHCA 3WGOA 2EKPA 4D43A 5TGDA 1A7AA 4N7RA 3GC6A 3P19A 4IGEA 3RC1A 1WMBA 1WDKA 1DO8A 4RPLA 1G0OA 1FJHA 2HU2A 3ST7A 3WIEA 2QRJA 2R00A 5L51A 4O63O 2D59A 5I9MA 1QLJA 2X9NA 1SZJG 1HDGO 1QYXA 2OZPA 4D3SA 1AHIA 2NVWA 1YJQA 4A73A 5CPBA 3TFQA 1CQJA 1LC0A 3TZQA 1ENOA 1B3BA 1WZEA 3QJ5A 5H83A 4LW8A 2QQ5A 4O5OA 4MKZA 1E5LA 1HYHA 2I9PA 4UREA 3ZNPA 5CDTA 4Z9FA 4F45A 3GVCA 1P33A 1E77A 1T1RA 2Y0DA 3PYXA 1C1DB 3E1KA 3PWZA 3VDQA 4DMMA 2C5AA 3JQ7A 3ZCXA 4D45A 4XIJA 1E1LA 2VWHA 4N18A 4ZQBA 1WXDA 3BXXA 1FF9A 2CF6A 4WLUA 5L53A 4B4OA 1HDYA 2OXIA 3ANNA 1DFIA 3SJ7A 5BSGA 3FBTA 2JAPA 5A3VA 4I9UA 2RH8A 3LLVA 2VHVA 4OMUA 4P4NA 2O2SA 1E7YA 4LRTB 4RJTA 2E49A 2OORA 4BUCA 5JAQA 4KTTE 1HF3A 1PJLA 4BO7A 1OBFO 4TQGA 1MC4A 1UZLA 2GPTA 3L9XA 4JNKA 3LT2A 4CMBA 1S6YA 3IJPA 4IJWA 3LSYA 3VZSA 1TLTA 3OA2A 1IULA 1PJBA 5T67A 2WWRA 4DPLA 1ZEJA 3G0OA 3VZRA 2BD0A 3OMLA 5JCJD 4Y98A 4XYLA 2CFCA 4I8XA 3S2FA 5B4TA 1ZVMA 2AW5A 4IJKA 5F1PA 3ETDA 3HWRA 1VJ0A 4NBVA 5MDHA 3SEFA 4LRSB 3LF2A 3QP9A 3CE6A 3WTCA 5C7LO 2HKIA 4CM8A 1D4FA 2C0CA 3VDRA 2FPPA 2YYYA 5I7EA 5CDSA 2WJPA 1H6BA 3PRJA 3PI7A 3OSUA 4BNGA 2PKQO 3AI1A 1UXHA 1W4ZA 2EP5A 3G1UA 5EIOA 2G17A 1R4NB 2FR1A 3GPIA 1H93A 5TT1A 3D3WB 3CINA 3L4SO 3GEDA 1KYQA 1ZZEA 4W7HA 1CYDA 3DAFA 3NDRA 5AXCA 1ID1A 3RUIA 2D0IA 2VNAA 3LZ6A 4XKJA 3WWYA 2AEJA 1YJ8A 5JS6A 2BMAA 3PVZA 3M6IA 1PJQA 3HN7A 3NX4A 4KWIA 5IDYA 2Z5LA 9LDTA 3ZDFA 4PVDA 4BNYA 2DKNA 1RM5A 4UEOA 3SC6A 4OXNA 3DTYA 3GZ4A 4ND1A 2YFHA 5DT9A 3C7AA 3DWFA 4RVGA 5TJ9A 3PK0A 2NTVA 1PS0A 2O3JA 1UXGA 3AFMA 5T8KC 5THQA 4GKBA 4L76A 5TX7A 3W8FA 1DLIA 2RH4A 1U5CA 1X7GA 2FZEA 1ULUA 3LVFO 3RC2A 2NNLD
chains in the Genus database with same CATH superfamily
3GCWA 3FLMA 3U4GA 2O3UA 1NVEA 1I30A 1LBIA 2RE8A 2ZI7A 3T9AA 2R1TA 4S1WA 3BSWA 3X3HA 2HZBA 3HZZA 4N5LA 2R62A 5FBKA 1J8VA 1GILA 1NYQA 2FEPA 2PGJA 3F6EX 2F55A 4NBUA 3OJLA 2E4AA 5LUBA 4CUZA 4LFBB 4OHWA 5C9ZA 5LZ2A 3JZFA 5TGZA 2JAOA 5IASA 2P90A 2B36A 4U6NA 5FIUA 3RS0A 4KQCA 3SSOA 1CR6A 2IUYA 3DEAA 7AT1A 3H5RA 3VH1A 1Q12A 2YVAA 5JXIA 4KFUA 4B2IA 3ACDA 2DFNA 2OOSA 2JPDA 3KAJA 4L5JA 3ROKA 4L3OA 5HXAA 1PT7A 3WSTA 4NCJA 3Q0EA 4H7DA 4EIWA 3LKDA 4MVJD 3S99A 3DEFA 2JGJA 3L5KA 5TF4A 2OCYC 3COZA 3PSHA 4K9PA 4RV9A 3SQLA 5LM3A 1GZ3A 2CJPA 4UUQA 1F8FA 2A5DA 2PGOA 4ZU6X 1I7LA 2NPFA 2K7FA 3B48A 1X1CA 5TVGA 3CB4A 1FBTA 1QDEA 2BSAA 1EZ1A 2GDZA 3H9BA 4BDTA 4B3TB 2AN9A 2PDAA 2WFAA 3I9MA 5HIMA 4QJBA 5MF6A 1CETA 1QGUA 4FGSA 3WVNA 4B2PA 8AT1A 2WTEA 4RZXA 1GADO 3KVOA 3HKEA 2BBTA 2IV3A 2DPXA 1R0SA 3Q7TA 4OXXA 5BRAA 3M6XA 3DAOA 3R3UA 4TQ9A 4NZNA 1SCIA 2V7UA 5CNIA 1Z5WA 4PQFA 5KU1A 4MVJA 4J1NA 5TARA 3IBTA 5HUJA 4BO1A 2P6OA 4I1VA 4L9WA 1R6VA 4FFMA 1G5IA 2FPGA 3DOCA 4V39A 3VR1A 1PT9A 1CK4A 3RG2A 3A8TA 1V9CA 1VP3A 5CW1A 4QU0A 4B09A 2RKOA 2FMFA 3AERB 4UMEA 2GHQA 1X7ZA 1W4RA 3ZW7A 5J58A 4QRDA 2FPOA 2VLBA 3QFSA 4BFWA 1VJ5A 3UKOA 4D9CA 2VQ3A 2RAPA 4URHA 3WIOA 2OK8A 2EATA 3DQQA 4BCCA 4B0OA 1IBLB 3PXEA 3Q6NA 3BB3A 5ICEA 2OCGA 4G1EB 1KZYC 2VDJA 4HVTA 2RGCA 2GTIA 2Q50A 2HDNB 1G8KA 4R16A 4LBYA 5K0EA 2AWNA 1AY0A 3V6LA 3IQFA 2PKWA 2IF0A 4C5BA 2XYHA 3AVUA 1QVAA 2CL5A 2INGX 5DHTA 4DLVA 1ZQ9A 4F9TA 1HNNA 1XYGA 1H2EA 2O2GA 1NLZA 3O6VA 1R6BX 3QK7A 1RYHA 4IINA 4XIIA 2DHCA 3D8SA 3ROQA 1OT5A 1GEEA 1WKBA 4KSCA 4RL4A 3HSKA 2LVBA 3PITA 2CMFA 4JSTA 2KM1A 4S3MA 3RBZA 3V4SA 3WV5A 4B4DA 4LYFA 1XRJA 4OLJA 1EDZA 1ND5A 1Y3BE 2MYTA 3ANYB 1CBUA 1Q1BA 1VCHA 4MXDA 4JJ6A 1QG2A 4AD8A 1QGUB 1QQBA 1VPTA 4HWRA 4Q9HA 4M2LA 5EHGA 4BEBA 4ETIA 3BMNA 3PFBA 3R8XA 2J85A 2JIOA 1DV1A 3LX5A 1C4KA 3OBBA 4O1MA 3S70A 4A6DA 4AY4A 1V8BA 4QU9A 3NEPX 2QQFA 2GPAA 2AK3A 4RABA 5IJZA 3MD9A 3ZTTA 4N48A 3TTTA 1GNVA 1XZFA 1NMYA 4JI3B 1KERA 2ATIA 1N6HA 4YAIA 2BHRA 1DFGA 5I45A 4IXMA 5HF6A 4AI6A 2ECPA 3UUGA 4HB3A 4E5NA 2F43A 2HDWA 3ZWOA 5FB3A 3UMFA 2EBWA 2WU3A 4BS9A 3MGKA 3HXQA 3UO8B 3LXMA 4MV1A 1FU8A 2HO4A 4EHFA 5J3JA 4JIGA 1K6JA 4REMA 4GGPA 4LKOA 3UY4A 1FLVA 2DUNA 4Q9NA 5G0UA 2QLTA 2FWNA 4K0KB 4MW1A 1BCRB 2Y2UA 3TL2A 4BGVA 1VPEA 5GM1A 5BNTA 1T0IA 5DBFA 1PGNA 4WSOA 2QSYA 3T3DA 2WM3A 3IXLA 2Q7OE 2EWWA 4YFVA 1QUEA 3UOGA 2F00A 3DL4A 3CKKA 2A14A 3UVEA 5JADA 5G1NA 5L6MB 1YWGO 1ZM9A 1DUVG 4LJ9A 4OF4A 2ZTSA 2UUOA 2Y76A 2QZPA 3EVDA 3KBBA 4TVBA 1SD5A 3Q5EA 1K0FA 4DCTA 2P0YA 4Y9UA 1E3JA 1DL5A 4K46A 4NZOA 4PLFA 4AIIA 1AK9A 4GSLA 2IOHA 4Q1FA 3L4BC 4KQGA 3FXAA 4MWOA 3DJFA 2Z2XA 4TRMA 5U1PA 5AVVA 5HJ7A 3F4KA 1KRWA 4MP3A 1FDIA 1EBBA 4HLQB 4IW3B 4KE9A 4LJRA 2EFJA 1P4GA 4I14A 3QBDA 4H35A 4PVCA 3VBEA 1D2GA 4K9OA 1JHYA 3P9KA 4UE6A 3K05A 1XJWA 4QG7A 1V3UA 2X5KO 4RZUA 1M54A 1UDAA 4GYJA 3W90A 4AS2A 4KAAA 2Z1NA 4MV5A 4DAOA 5JSUA 5KUTA 1GPNA 1Z5OA 5ILOA 3HY6A 5AK0A 5HFAA 5I9NA 4X1KA 4FBLA 4B46A 2E5LB 4NZMA 3CUEF 3FZGA 2ZQYA 2RI1A 5MHTA 2X0EA 4DR5B 1YKFA 2IUSA 3ASZA 1SKYE 2QLFA 3HYNA 3N7TA 4JYAB 4KXWA 1E5QA 1L5VA 3HJCA 4F7WA 1DO0A 4PZLA 5G4KB 5TMEA 4DDHA 2VF8A 4ZI3A 1Z6TA 1TT5B 2W6OA 3RRNA 2D2VA 1WMAA 5BYAA 3ZE0B 1XD2B 1O7JA 3BTVA 5C1IA 4AJKA 1Q0RA 1VL0A 5D3KA 1B8NA 4MYHA 1QIHA 4XGQA 3KWMA 1EPUA 3LW8A 4F3TA 3IIIA 1LPNA 3KTFA 1TX4B 1WXXA 3H65A 2RHHA 3N8KA 4IDDA 4RHYA 4YI3A 1FNNA 4R2XA 3AZQA 1H6CA 3D6NB 3NT5A 3RS7A 3PFKA 5AM5A 3EGEA 3FYCA 3T5BA 3URMA 2P5TB 3THRA 4YJKA 1XKQA 4M9QA 1CF2O 3IOEA 1EXWA 5FUWA 3H9GA 4EVSA 1OFIA 3EPLA 2FSPA 3GCDA 2CYAA 4FD3A 5BORA 5B6IA 2PUBA 5FA6A 3DFIA 3L0CA 3QJYA 4YLEA 3OFND 4IMRA 3BAFA 4YLGA 1N6NA 2GESA 2I3BA 3CTPA 4XVCA 2BV3A 4DA4A 4NOJA 4QDOA 4EUHA 4EL0A 3B5IA 4HDNA 3H5LA 5B58T 4LWZA 4IOJA 4QJ3A 1L5QA 3AI7A 3IURA 4HEHA 2KI5A 1K6IA 1NI4A 3QWHA 4RFSB 1NJ8A 2H1SA 3LK6A 3N2KA 1SGWA 3ZWNA 1ZRNA 1C14A 4ZZ3A 1VCMA 3H8SA 1PZEA 3ESZA 4QNMA 4RH3A 4YI5A 5A3RA 3OOEA 2FMHA 1N77A 1TRHA 4LI3X 2E4UA 4HWSA 4ENPA 1VKOA 5F3RA 1SIUA 2ZI4A 4UNNA 3DDZX 3DVQX 3NM4A 2WKQA 3F9IA 1HL7A 3D02A 5AXBA 1WDLA 4URUR 5FUYA 4B32A 4CQMD 4LYEA 5DHQA 2AV6A 3L79A 5D00A 1H2BA 1ECLA 4G1MB 1EUCB 1XOIA 4OUKX 5CH3A 3LGXA 3T0FA 3V1UA 5IJWA 3K2EA 1Z0AA 2Q2NA 3IJ5A 1H2FA 3ZU6A 2OM6A 4B2LA 4E5MA 2PGXA 2YFQA 1X1SA 2EQ5A 5H9WA 1QGAA 2R6CA 3RWBA 2GT1A 3KUUA 5IC5A 1ABEA 2OG2A 5JAUA 1XA4A 3AUFA 3WYAA 3UHOA 2I1QA 2GN6A 5BN4B 1D9XA 2PLAA 2ZYAA 1OX4B 1RJ9A 3B1FA 1IUPA 3A14A 3RIHA 2B37A 4K03A 2P9QA 2W6JD 3F49S 1PBNA 1ZMTA 1DADA 1D0VA 1XZGA 4PHCA 1S2OA 4ZV9A 3MMNA 4M8IA 5SYMA 1JA0A 1NVKA 3S7ZA 3U4DA 4KRYA 3TRIA 1KZ1A 2ZXFA 2QPAA 4IF4A 4BVGA 1KF0A 4CUKA 3THYB 2REXB 2QN8A 1N7IA 2GJAA 3ZC3A 3ORRA 1N0WA 2D7DA 3W7BA 4MV7A 1U65A 4YK7A 1ISJA 2FETA 3R5TA 1U7OA 1CJCA 1Q0UA 1Y80A 3BCUA 3R09A 1HSOA 1K2WA 4P7GA 3HCOA 1G1MA 1ZWLA 2YMQA 1TQDA 3IKLA 3S1SA 3WDSA 4YRAA 1DUIA 2CHVA 2AN1A 4PO3X 2LWIA 4H1UA 1F6DA 5TGTA 4G86A 1R4MB 4WJZA 4D57A 1YOVA 2R8BA 3IUSA 3JPYA 3WWPA 3EFOB 1LBSA 1M76A 1T2CA 1YR2A 1Z7WA 2HIAA 3AW9A 3AR8A 3NRBA 1RMYA 1M34B 1E2FA 2X40A 4RCVA 5GOZA 2BJHA 3O0DA 3VR3A 3BFXA 1AQ6A 2C9MA 2CFOA 3DVAB 5CLIA 1JQKA 2GEKA 1EYZA 3TEFA 1JALA 4YCNA 1EGVB 2EFGA 3T4EA 2NTJA 2X6RA 5FQOA 4TZ0A 1GNQA 2ZRJA 1CEEA 3BE4A 5CFMA 3G5LA 1E1NA 2ZWPA 5JD3A 4YT8A 4PRYA 2HHLA 4MAMA 3AKZA 2ATVA 3VNSA 3E8XA 3A2LA 2RIPA 3BMCB 5EAIA 4N3NA 1U8YA 2ZYGA 4QEZA 3CLUC 4D9BA 3FOFC 3AF2A 2XBUA 4BRSA 2A0YA 1ADYA 2NP6A 4N47A 1K4KA 3EH2A 4DJEC 2FR0A 4TMXA 4RHUA 1AHHA 2O7SA 3EZLA 5BYBA 3VKFA 2RHLA 3MT7A 5IS2A 2R6GA 5IYZB 1KJYA 3B13B 3KFXA 3NGMA 5FP0A 4D8XA 1NATA 3UAVA 4DNPA 1K3FA 4H0NA 1UKBA 2R8EA 1AZTA 3L6RA 3QUBA 2PUWA 1KFJB 3IHLA 3LUHA 1R0XA 3ZCSA 4URWR 1N5RA 1KKMA 3SSNA 4LY0A 2WICA 1C1XB 5I8PA 4IDHA 1X1RA 1H1DA 1OFUX 2GTHA 4MR9B 4YRKA 1DBPA 4RVOA 4CMEA 3I9FA 2UVDA 4M98A 1SH7A 4TUYA 1EFPA 1PHRA 4KG7A 4UNPA 4RTJA 3H5OA 2HH9A 3MJVA 4BGDA 4I1YA 1C9EA 2R6FA 4QYTA 3L05A 4ZVLA 4DLZA 2V96A 2Q27A 5TQ0A 1FDRA 1Y1KE 3L92A 2JFGA 3GDFA 4BX9A 5HDBB 3JALA 1U5AA 3LDFA 1EUZA 1SQ5A 3QVXA 3MT8A 1R15A 3WYFA 3LOUA 4M0UA 3Q6IA 3BDVA 1ZDMA 2BUAA 1EA5A 3JYNA 4G65A 3SZGA 1PLJA 2H1FA 3U5TA 4WNYA 3TAUA 1LD3A 5CPFA 2CJWB 3JZMA 4FMCF 5LBUA 3FPEA 1Y9EA 3FOAA 3I2FA 5J9FA 4IO0A 4Y2UA 2QLMA 2ZS8A 3GRAA 4RL6A 3ROZA 4E4TA 4PRKA 4PTYA 3NC0C 3CZAA 3X1ZA 2C4KA 1C8VB 1JQ5A 4O4IF 1CZHA 3HKBB 2CE2X 2Z5VA 1QM5A 1XHEA 4O4JB 1TT7A 1CXZA 2Z3VA 2BEWA 4CM3A 2H9AA 2NYAA 3EVBA 5K0CA 1XVAA 3K9CA 4XYBA 2OCBA 5KQLA 1J0BA 1XNQB 5JO9A 2A1TS 4JJ4A 1JS1X 1ZO8A 3KNZA 3PJGA 4WOKA 3GLIA 3B5EA 1PFVA 4PX2A 3VSEA 4DZTA 3F73A 1Z73A 4B6GA 5HX7A 4BMPB 4R9RA 2BMDA 3IE1A 3NRJA 3NTOA 3ZGZA 3U4IA 1UOPA 2XUPA 2D1YA 4W1PA 4XM2A 2RBKA 3MCUA 4QQFA 5CG1A 3URKA 4LF9B 2JFBA 3VR6D 5AVZA 1YC2A 4DLPA 5J2UF 3HJRA 4U39A 1U0GA 3RKUA 1HETA 1JJAA 3ZNOA 3GEEA 4R2MA 3B3QA 1LRJA 3OM1A 4YJGB 1Z25A 2PWYA 4OKNA 5E6SA 4NS1A 3PLAE 5ICSA 1EFKA 2ZSFA 3HK2A 1G18A 3GLQA 3GT3A 1KI6A 3KUCA 2OPBA 3PC8C 2J5RA 3IEPA 3HFGA 3FHTA 3QG1A 2YOHA 3ZWQA 4F12A 4AKGA 3KQSA 2FP4B 5FKJA 1GPH1 2YNMD 3C3KA 5M7EA 2HR1A 1DAIA 4N03A 4YJDA 4AG5A 1JLLB 2ATEA 1YB5A 2CK3D 2HA5A 4IIHA 5E1OA 1XCJA 4Y2RA 1P44A 3CNQS 4LZLA 4N82A 1H4QA 3BE8A 1ZH6A 3KFLA 4WFKA 1AQYA 4H08A 3QUSA 1IEWA 1KO5A 1RABA 4ZALA 1MABB 5KOJB 2WHRA 2BZ0A 1IL0A 3JVVA 3ZDEA 5K8CA 2OKCA 2EBFX 5TEWA 3G2MA 4A2QA 1ZCZA 4CR8A 1QCZA 2QUAA 5LQNA 4MP6A 3V1LA 2Z3ZA 3PUZA 1FNCA 1M5RA 1WTCA 1L7DA 2YNMA 4KQ2A 2I7VA 4N6NA 2NUTA 3V00A 4AJ4A 1P17A 2R68A 3ZNNA 1V8OA 1HT3A 4J1QA 5FCDA 4FEAA 4CF6A 1P3Y1 2HCFA 4IILA 4QTTB 1UH5A 4L02A 2Y92A 4F92B 1BQEA 2Q5LA 3TG2A 1QVRA 4XX1A 3FFAA 3O8OA 3C3YA 3L8DA 4JY7A 2O50A 1S3SA 4X63A 3N8GA 2NGRA 2Z9BA 3AK4A 3Q41A 4NPAA 2PSFA 3V46A 5JEDA 4UBJA 1AKRA 3GCGA 4GPEA 1RI5A 2ZE6A 1K2VN 5A6SB 2VN8A 3OT1B 1BRMA 4RLHA 1I8TA 4MPTA 3FPLA 1E1CA 2X0KA 3NGLA 1ZJ4A 3R3SA 2JGIA 3WLJA 5BN5A 2YS7A 1Y8RB 5KVQA 2WQ7A 3A37A 1TAQA 4E5VA 3K70C 1V5GA 3A4MA 2F3PA 3V8EA 1CUZA 4R7ZA 1E7RA 3H11A 1KS9A 3MIZA 5AIAA 3QWFA 1F20A 1HG0A 1CULC 1OREA 1R8SA 2W2MA 3BQ9A 3CR3C 3PT5A 2DTXA 2H57A 3R9IA 3ZIAA 3ZQUA 4F11A 2O14A 1W0KD 1AGPA 4FYMA 1U5BA 1NV8A 4MGZR 4QUBA 4RHTA 1JKFA 3UJBA 4BE4A 3TG8A 5LL6P 1EGAA 3AJ9A 1PZXA 1ZUHA 3E0QA 3VPGA 2ISSD 1YS4A 3IP6A 3U17A 2MMCA 5D51S 2Q9UA 3GNQA 4V1CA 5JSHA 3SMVA 1LFDB 4XW2A 3V7NA 1CVLA 2WJJA 4MLPA 1V16A 4IX9A 1D04A 3P94A 5K4HA 2WWTA 8OHMA 5HQ3B 4TL6A 3OZXA 1ZA2A 1MA0A 3HQ4O 4G9BA 1DXYA 5B2ZA 4AUMA 1PL6A 4TKUB 2AZ4A 3LA6A 3N0XA 3FF1A 4KDRA 5F77A 5M3BA 3VVMA 4BFZA 2I6GA 3L8GA 2OQIA 1K3UB 1Q20A 2R6JA 2FWPA 2PV7A 3IUJA 3UMVA 3L7KA 4UU0A 3RYCA 4EW3A 4CU2A 4G4GA 4TV8F 3L1UA 5BWCA 3BWYA 2PCJA 1FRVA 2A0XA 2CXPA 3DE4X 3KSDO 3L7NA 2W43A 1RPAA 3PNQA 2R7AA 5JS7A 2X9GA 3DFKA 4WZBA 2V5AA 3ESRA 1H8HA 3Q3JB 1XROA 5AI0A 5ALWA 1NUUA 1WSBA 2PBLA 4PLYA 4XLLA 1LPMA 2ODEA 2OSVA 4KI0A 2XNCA 1XYYA 4B3FX 5B7PA 5C7IO 1Y6FA 3R77A 2C42A 2QR5A 3JALB 1KC1A 2Q3BA 3OJEA 3I04M 1TGVA 5J5CA 1NFFA 4L16A 1RTKA 3ZPXA 1E58A 2ZP1A 3GFGA 5K8JB 2A4MA 3GP3A 4OFBA 5DDIP 2O8BA 1DQYA 3NBQA 2G0NA 2AE2A 2YWGA 3O3MB 1EHIA 2FPSA 4E32A 4EW2A 2PM8A 5CAEA 5HM6A 4MIOA 4X3CA 4XWGA 2FEWB 3UF0A 1QAMA 3VKUA 1GG5A 1QHSA 2WJWA 4PFKA 1C30B 3H16A 5AT1A 1KY5A 2G9RA 5A9SB 3FYDA 5GV7A 3OZDA 1G8FA 4X3PA 5F21A 1E1RA 1ENZA 3BUSA 4K9RA 2JZCA 2HEGA 3ASUA 4OREX 1U3FA 2V6IA 3PHBE 4QFDA 4BWFB 1H66A 2X7XA 1P0PA 4PNZA 4N54A 4TLBA 2Q46A 1TECE 4HB0A 5AW1A 5JJKA 2YOGA 4EDFA 2D2EA 4D5GA 2YN0A 1A2OA 2GAFA 4E13A 4CEJB 4NOKA 4BMYA 4WBNB 2H1VA 3QEJA 4TX1A 1QNFA 1GRQA 2VAPA 3HYRA 2IEYA 3QPCA 4ND2A 3WWZA 4QAQA 2PO7A 5KDOA 1B26A 1ZD9A 4MI3A 5B2FA 4K9KA 3Q8LA 1ZN9A 3PV0A 1F3LA 4MR7B 1SU4A 3LCCA 5AKIA 4OLFA 4R6XA 1JG2A 5DF1A 1NVDA 3HZOA 1QHFA 2G70A 4DDTA 2SKDA 2HBQA 1U3VA 4JBNA 3L0ZA 4M1OA 3NYQA 3L3BA 3AF5A 3KWFA 5FLYA 4E94A 1OY1A 3G9TA 4FW8A 1Z18A 4IG9A 5JQGB 1W9HA 4MV4A 1LVUA 5FQNA 3U3DA 5FLXA 1HDZA 1F0PA 1AJEA 5T8KA 3SF8A 3ZXIA 1L7PA 1CRZA 3GFFA 2X7JA 3V1NA 4GQAA 3STXA 4TRNA 1FMFA 2OO3A 2QD3A 4BNNA 5I47A 2HY7A 3EG5A 1Q0QA 3I09A 4ZVVA 2A1UB 2CB9A 3QF4B 3HEMA 4L28A 4N7JA 1KEKA 1IM5A 4GS5A 3RV3A 3EAGA 3A6FA 1UFKA 2VDWB 1K7XB 4WLNA 3OPXA 4TSRA 4ND6A 5ITZB 4QOGA 4HS4A 2O0MA 3ZS9A 2PX5A 4KLZA 1JG4A 1VMAA 3A4VA 2FEAA 1C3OB 2QRKA 1C7RA 3HCWA 2QTZA 5DNWA 3T5DA 3ZUGA 3ZQJA 2PR2A 3AP1A 2PMKA 4BHTA 3CW2A 4CTNA 3UJ7A 2HU5A 3R7SA 3QBEA 2RAFA 1I14A 4GRAA 3PDWA 1RXVA 3TD6A 3KZ1E 2HAEA 2A7XA 3LKVA 3JQAD 4BV3A 4OK5A 3V4ZA 2YY7A 5I5GA 1IEQA 4K8RB 4ZO4A 1WBBA 1RWVA 3FPBA 4B80A 2WJ3A 4IEIA 3NV9A 5GZ6A 1F14A 1I10A 3UKDA 2XUIA 3FDZA 4J2HA 1LBQA 1U7DA 4D44A 2VJLA 5AUPB 2OEPA 4CLDA 1XVIA 3PF8A 5J2TF 4ZP1A 2AJCA 1KQ3A 6GPBA 2Q1YA 2R4QA 1HH4A 1I1QB 2OQ2A 4YCDA 5E8JA 3V6MA 9GPBA 5TR9A 1C9NA 4ARZA 3VU1A 4TKVA 2WYIA 2J3KA 5LYJA 2C4WA 5IVIA 4ZRNA 3IDAA 2VUHB 1CB7A 1J8DA 1H2AS 1QSGA 4KMMA 3GNSA 1G291 4COOA 3CLSD 2VK2A 2FDRA 2BFCB 2LV8A 2ZB2A 5M2QA 2PL5A 3FPJA 1NXPA 1OFUA 1CS0B 1UM9A 4KKVA 4GMDA 1RKVA 3UT5A 3HUEA 2R25B 3FHCB 2XDQA 4B6RA 3R0VA 1CJSA 3O7WA 4G0NA 4I50A 1A97A 1T5LA 3IX7A 4RLSA 3QLVA 3SPXA 3H2JA 2XBLA 4NBWA 4KLRA 4WPGA 3B1VA 4ZCPA 3UK6A 4DADA 4GSKA 1H85A 4EKYA 1E98A 1X7XB 3OWOA 1UJ6A 5LQSA 4HDOB 4NYMQ 2BFDA 2H65A 1SZPA 3GXOA 1OZHA 3KJXA 4TVOA 5KYKA 1GRRA 1YF3A 4F8JA 4ARIA 3ZDRA 1EFLA 1PYDA 2YBDA 4JBLA 3RJZA 3FJYA 5FNVB 5CP8A 4LXQA 2JANA 2NNLD 4NPCA 4PNHA 2QT9A 2VSNA 5EUBA 1FX0B 1NXQA 4LECA 4L6AA 2HQ1A 2IU4A 1WEKA 3P0FA 3RG8A 1RRCA 1ISGA 1XP5A 3ES9A 3B38A 3FYSA 3RBXA 2KLBA 2WKSA 3IEIA 4J1TC 2X8BA 5FJJA 1OH8A 1DPGA 3Q3EA 5B58C 1ZQ1A 4AZ3A 4CL0A 4I4TF 2UVPA 4UZFA 2XSZD 5AI9A 3O8DA 4FYJA 4IIJA 3R3VA 3RGGA 5H59A 2P2SA 4URZR 4A2PA 1XRLA 1IQUA 1ZGHA 1KAQA 1ZUWA 2JRLA 1S2IA 2I8CA 5BV0A 2NXJA 2Y1LA 1BEUB 2C5GA 3TW4A 5CDFE 4K6MA 5A2GA 1EFVA 3SJBA 1Y8CA 3AEKA 2EX0A 1KAMA 5EY5B 4N3GA 3GUCA 4B75A 1L4NA 3C0KA 1Q7GA 2C5FA 3KDPA 4QUHA 1AKYA 1A4RA 2PXAA 2FW0A 2RBEA 3WK9A 3ICEA 3EUEA 5A9SA 3SFTA 4RTPA 4MPRA 1YJXA 2HJ9A 3FVWA 2IDZA 4V0SA 3ILHA 1USWA 1VSTA 4NESA 5ERXA 4KIUA 2BZGA 2JW5A 3W5DA 4CLXA 1I0ZA 1NLUA 2BMJA 5K8UA 2D7CA 3QU7A 3FCSB 1MMFB 2ZB4A 4P35A 4NK5A 2JJ2D 2X8JA 4JB2A 3M70A 4W63A 5MGNA 5EWMB 1KA9H 2QMEA 4RWEA 3COSA 3J80A 3DEYX 4R6WA 1MP0A 3VUFA 1CT9A 1LW7A 3OI7A 4RIIA 4DSZA 1KI6B 2Y77A 4O4LF 1R4NA 2I99A 1B1CA 4J91A 3MTBA 4GICA 4OYHA 3E4CA 5EE9A 1H0KA 1ACJA 1DWPA 3E58A 4MS1A 5CJPA 5UKDA 3RV4A 3SBXA 1HG1A 1O6BA 3RVMA 3ZBQA 2I4LA 1G8JA 1TW2A 1DKLA 2X77A 4KQFA 5C81A 4F6RB 4JLMA 2R9VA 1TC1A 1QANA 1CHNA 2ADOA 2J9ZB 3U3ZA 3ZJUA 4D8WA 5KDLA 5KU7A 2HNAA 1GCGA 1QORA 1MW9X 1M7GA 1QLWA 5F12A 4A91A 3R8FA 1D2CA 2AC4A 1O96A 2YHIB 4D9GA 3FMGA 2OV1A 5HQ3A 1SVUA 1CZLA 3CCFA 4BQOA 4JI8B 3AVXA 4DZRA 2WTAA 1GHTA 1PEDA 3COYA 1C2YA 1GGEA 4QUGA 1GPKA 3TMYA 4EGJA 1I2ZA 2YWCA 1XTIA 1GZ7A 2A1UA 2YXPX 3KRTA 1RPNA 4NKRA 2CNNA 1CD5A 2QAGC 2X6TA 3ODPA 2ZCUA 1ZI8A 4EVRA 3VR0A 1C2TA 4ID3A 3NUGA 1TK9A 4M3NA 4OQZA 4XOUA 5ESRA 1PJ2A 1I4WA 2DPLA 4J07A 3EIUA 1PX2A 1JWAB 3HWSA 4QPDA 2G9NA 1YI0A 2P0EA 4U5XA 1QQTA 4PPFA 5JYBA 3IYLW 1YUMA 1NRIA 3C6QA 4MLZA 1MNAA 2A5GA 2Y1FA 2UDPA 3F6YA 3MVEA 4N49A 4NCKA 3MGCA 1JHDA 4LOAA 2V0GA 4NJMA 4OOFA 4XXHA 1G8GA 1ZAKA 2QLLA 4NR0A 4ROTA 1Q7EA 1L7XA 3FAZA 4FHGA 1NW6A 1G1AA 2V03A 4X44A 4Y7CA 3IO3A 1NJ1A 3PNKA 3NKFA 3CUTA 4NV1A 3HSSA 4OXIA 4G4SP 4QBTA 3R74A 4Z1OA 5IULC 1AKEA 5K7SA 4OQLA 5IDVA 1X38A 4U8HA 5KINB 3NWPA 4JEMA 4RZ3A 4PV7A 4KQHA 4PIVA 3HJNA 2CBZA 1KY4A 1DKRA 1TVKA 2AC7A 2IP1A 3AIOA 1ZVJA 3W3ZB 4F5DA 3P0JA 5IWAB 3K9HA 4RXMA 4WXRA 4C7BA 2QVCA 5FUQA 1RLJA 4W9MC 3UICA 3DQPA 3OHMA 1XZBA 4NU6A 1LDBA 1M2FA 2J4FA 2Z0MA 5INTA 2QMYA 2QM7A 5ADVA 3WXMA 4F1JA 5DHRA 3RRJA 2GI4A 2Q99A 4W9NC 4EUSA 3S2IA 2GAOA 2GJSA 2G83A 3LRPA 4ND4A 3UMCA 2WF7A 4KK3A 2A9JA 3R4VA 1T5TA 2QTHA 2EC5A 4C7JA 4NX2A 4WHMA 4MQ6A 1XELA 4YH1A 3FTFA 5B7QA 3K0FB 4G84A 4NAHA 4PYQA 3RFTA 4QNRA 1JU3A 2GRJA 4Q4DA 4R98A 4Z9BA 1J33A 4JI5B 3PZBA 2IEAA 1Q74A 4TKUA 3T7DA 5B1EA 2V55B 4CDMA 1DZIA 1ZU4A 2WUEA 3HB0A 1NULA 1GUDA 2WIKA 4OM8A 1KPIA 3LO8A 1E60A 2XVMA 3OT4A 3M5CA 4QSMA 1AGYA 2C8VA 3NG1A 3V1MA 1FTGA 5JQGA 4Q1BA 5U4XA 2X14A 3NYWA 4C0SA 3S81A 4PGHA 3IBYA 4QTXA 1N8SA 4W8HA 2QF7A 7YASA 3PWSA 1I2BA 1U6JA 2AG6A 2PAAA 5B1IA 5F76A 1ZNWA 5JVDB 1VECA 3A0RB 1EB8A 4R41A 5JS2A 3NT4A 3ZE7A 1EXVA 1QDLB 2QJRA 1FYEA 2O7VA 4HAIA 5YASA 1USIA 3PF9A 4BE7B 3QU5A 4WESB 3C39A 1BYIA 1I24A 2PN1A 1R74A 3VJLA 5KNCD 5L3QA 4AMYA 2V1UA 3AGPA 4KFSA 1ODFA 2ZVPX 4BQIA 5IC4A 3D4PA 5DYTA 1P1HA 2C04A 4BO0A 3OKFA 2I3DA 4W8GA 4WUVA 3V2HA 3Q98A 4K6CA 4AJEA 3PXGA 1XMIA 3ZEAA 4A26A 4KN8A 1CDDA 2FB9A 3G7UA 1QV6A 1XFAA 1WLYA 2P2NA 3BWXA 3LPMA 3RJ9A 3DTTA 2QM0A 3GLSA 3KXLA 4D41A 1QGYA 3CBGA 3D3JA 2Q4DA 1AD2A 2IHJA 1M8PA 4BP8A 3CO0S 2HRRA 1PSDA 3LX6A 3AEKB 4XUEA 1EFVB 4N0DA 5B7NA 3AWDA 1JQBA 1M8JA 3G8DA 5JLAA 4LDPA 2JJ2A 4P5PA 1K0UA 3KHSA 3QYAA 4QPPA 4Q9AA 2R87A 3ZY4A 2RKWA 2QPLA 3DV0B 4OXYA 1MAAA 3ZI0A 3BERA 2A35A 3BILA 2QAGB 4BB9A 1EFCA 1SOVA 4R2JA 4Y1FA 2YXLA 1V37A 4UTOA 3VO2A 1HURA 2Z6VA 3WL5A 2MCFA 1VMIA 3ECCA 1A27A 4ZREA 3EXEB 4EEXA 4YRSA 2EL9A 4G0UA 2QSJA 1IWBB 1UP7A 3AHDA 4U7WA 4P22A 3RIXA 3D7SA 2EXXA 2XZDA 3ADDA 4L73A 4EGQA 2A8YA 3B6EA 1G20B 4OVKA 4BO9A 1LW6E 1GG8A 3U49A 1QQ7A 1SIOA 4EMBA 5C8YF 1LSOA 3DMTA 1AS3A 3QOFA 3IOBA 4LHWA 1KEEB 3LBHA 5L6LB 2HRQA 2VNHA 2D54A 2IS6A 3BICA 2CV2A 1NONA 2ZE8A 3AIKA 3FR7A 1Y6RA 1ZM4A 4QYXA 5LLSA 5C7YA 1CU1A 1C0PA 1XTSA 1KYXA 4MDYA 4XPIA 3MT0A 4LGYA 5JNWA 2XGOA 3QXGA 1HPLA 1JL3A 4Q15A 4N76A 3TINA 1KFBB 2O9JA 3K6SB 1TKRA 2C4TA 4A8HA 4CMAA 1YAHA 2FUKA 3A1TA 3QIVA 1W4CA 5TVKA 3QEAZ 4GX0A 4Q3KA 4WFQA 4E1AA 5CDHA 4F2WA 3QOYA 3K1JA 2ODBA 1CJBA 1JFLA 1MDBA 2HK7A 3FUXA 1NBMA 1NUPA 4LPSA 3I30X 1UK8A 2JJQA 4XX0A 1YAJA 3UJ9A 4PN3A 3ENQA 5HS6A 1P18A 4PONA 2FQYA 3AXTA 4EENA 2FWAA 1OA1A 2B8EA 2IIPA 2YWRA 2FZCA 3PUXA 3F7TA 4Y1GA 2OZLA 2OBMA 4ALMA 2VJAA 2CFRA 4DQVA 1ZJ5A 3ZGXA 1DX4A 1XP8A 1JEQB 1WNFA 3T9DA 3MB5A 4OB6A 3UKJA 2B3DA 1F06A 4TWBA 5IYZF 2BONA 1SC9A 2GEUA 2BGJA 3RQSA 3PQ8A 5E1DA 1U8ZA 5HZHA 2C5LA 4A6EA 3BVPA 4QT0A 4PBSA 1K66A 1IPFA 5DBEX 3IQIX 1K63A 3GDWA 2H1LA 5AKZA 2GJ9A 5DHAA 2BEUB 4PGGA 2FPRA 1GPUA 2W00A 4MO9A 4RGVA 2HWYA 1IPHA 5F52A 4WVLA 2JGLA 5DHPA 4F5EA 1ZI9A 2IYRA 2EOAA 1BJTA 1ST3A 2IPOA 4G67A 3G6WA 2UXCB 3Q8MA 1LQ2A 1P7CA 3SHVA 2AG1A 4S1VA 3EE6A 1Z2AA 1K8XB 1QG6A 4FJ2A 1MFZA 3TKLA 2WIFA 1P4RA 2YVKA 6REQA 1Y1RA 2YZ2A 4EHHA 2EBUA 4IIJB 4HWKA 5CB8A 3GQVA 1C4XA 1EQ2A 1ITZA 2COEA 1TJ4A 5A3QA 3DUFB 1GV0A 1SUPA 2IYYA 4CL2A 5IAOA 1PU2A 3TGLA 3FMIA 1NXTA 1B8UA 1OT3A 3G59A 2BBOA 4FTWA 2AF4C 5EEHA 5JMWA 5LLTA 4RTOA 1VG0B 1V5IA 3KLBA 4YASA 5F9HA 1G42A 2DXIA 3FE2A 1E3SA 1FXWF 4PAQA 4EX7A 4YAGA 1W4AA 3CZRA 3DAPA 1V26A 4FW9A 3NIWA 4H60A 4M9UA 2PXCA 2BKEA 2RC6A 3CEHA 4IMIB 2HM7A 4MVJG 1WU8A 5JMPA 3QWIA 3R41A 3VPAA 4M0LA 1O6ZA 3OOSA 4KLAA 4TT8A 2G9UA 2PD4A 3KX2A 1BGXT 3M9XA 4WNIA 3U9TA 1P1JA 3NATA 1U0SY 4Z5XA 3FMOB 4AQ7A 1BW9B 1FJXA 3E3OA 2AI2A 1NFQA 2P6PA 2VZLA 1U8TA 2C9ZA 3U7QB 8LDHA 1FTSA 1XMOB 1MO3A 4X6LA 4ENWA 4GP9A 2OVBA 5IVHA 1M2JA 1HO3A 1H2RS 4HDRA 5CX1A 4ZOEA 5DYWA 4DPKA 4UHJA 1X2EA 1UDBA 5DH9A 1PT8A 1E6KA 1RAHA 3EOZA 4KZPA 1NC1A 1NBME 2YMLA 2BGGA 5IF3A 4UKDA 5DXFA 3I4CA 1Q14A 2RHWA 2PTHA 3JV7A 4K6KA 3TSZA 2P11A 1K9SA 4FZ3A 1PK7A 5CLLA 3T3NA 2PLFA 4BJ5A 4NK4A 2VF7A 3UXEA 3DKVA 1HT2E 1EJ2A 4GI5A 4GGOA 4Q4JA 4C4RA 3FROA 5B55A 1OBCA 2CW5A 3ZVRA 3A26A 5C2JB 1OXSC 1IXKA 2FF7A 2SCUA 3CNNA 3PHCA 1N2EA 2ZDQA 5H3LA 4B0PA 4EAAA 2PY6A 1A9ZA 1YZGA 2YV4A 4FNGA 4M1QA 5KO2A 1CUUA 1DMSA 3KP1A 1QLHA 2C5BA 4KQKA 4P9NA 2JI4A 2B0CA 3GHHA 1NVTA 4HY3A 1D7AA 2P9YA 3EOBI 3AY3A 2IFTA 4HAVA 1RM3A 2FPMA 1RRFA 3TOXA 1YRWA 5GPBA 4HVCA 3IC5A 1TEZA 3QBJA 1R0LA 4JFRA 3ZWCA 3AF1A 4XFJA 5ALPA 4BVEA 2POCA 1YR6A 3QLVC 5AR1A 3K1AB 1N4DA 1JMVA 2Y1EA 4PWYA 4QGAA 4FFLA 5TQ0B 1AK1A 4POOA 1Y7HA 3O1LA 4Z49A 10MHA 5CIQA 3LD9A 2C7OA 1TCAA 4MRMA 5JPCA 4FOSA 2EX1A 4OAPA 2LXNA 1VIDA 1R4MA 4R2KA 4V0QA 1OXKB 3QMVA 5TPZD 1NNEA 2JEOA 2WPDA 4BPRA 1VB5A 2Q1UA 5I8WA 2VUSA 2FG5A 1SU6A 4RIEA 3F4LA 5DI3A 2CHGA 3PXUA 2CHEA 5LZ5A 4YFYA 1QONA 1IK4A 2ZJ7A 3SICE 2E4XA 4OL9A 3ZI7A 5FI5A 5LZ4A 1T6YA 1RIIA 4K9MA 1E3WA 4MNTA 2ANBA 1PI3A 1WO8A 3GFBA 2AQKA 4DYDA 4YV2A 2V3CC 4DWWA 2UZAA 1EIZA 3L43A 2AJ8A 4M6WB 1AXGA 4YDHB 2LCQA 3HL4A 3T5AA 3FH0A 3A2NA 4GBGA 4N7BA 4G4JA 3NHMA 4YO7A 4XOIA 4CLHA 1CUGA 5ICMA 2GN0A 2O07A 4EPTA 3WLSA 3TCKA 5CUQA 4HRAA 4YP7A 2G3YA 1YS7A 1QJCA 5JDCC 5F7XA 1MO5A 1CZUA 4CE6A 4R2WA 3TS1A 3SZ3A 2ADMA 1YZYA 1F2DA 3AEUB 1Y8ZA 1VJTA 2GZDA 3OU7A 5ICCA 2Q5OA 3UUWA 4KPFC 1P2SA 1EGHA 1KJQA 3AHJA 1LX7A 3QEBZ 3DYVA 4FZVA 1J00A 3HJFA 4UU8A 2JAUA 1ZW1A 2E89A 3LUCA 4EM6A 3B78A 3K0SA 4BLVA 1WZCA 3I72A 3AR9A 3IQXA 1LK5A 1VHLA 2NO7A 1M6YA 3TM5A 5HGJA 2Q8PA 3DPUA 3ONFA 5AOCA 4A9AA 4YYZA 1PWZA 4G5GA 4P4LA 1VIAA 4CG2A 1NVGA 2AHRA 4J16C 5I4IA 1HUQA 1N9ZA 3ZQ6A 2FN7A 1XALA 3EZNA 1X7WA 4R8RA 4XEUA 5I5EA 1EE1A 4EJSB 1YDMA 4BMCA 2GNPA 2HCTA 4II3A 3PGVA 2J32A 3PUYA 9ABPA 1Z5GA 3QVSA 1NF8A 1HE3A 3ICVA 4U7FA 3FLBA 1T1JA 4IKPA 3T15A 4OI0A 1KOJA 2JLRA 3D8UA 4ZVNA 2GSDA 3Q1LA 4GNKA 4LHSA 5LOVA 1MC1A 2RB4A 3ET4A 2HQBA 1TIBA 5K03A 5EJFA 3WFJA 2V3WA 5C34B 3AGQA 4QUJA 5AW0A 5JMOA 4KP7A 3W8NA 4CW7A 2JH9A 1X13A 1UXOA 2O2DA 3OFSA 4G5YA 1T5HX 3ZWPA 2OECA 1R1DA 1AB6A 3EW9A 5AKYA 1M2WA 1RE0A 1Z2PX 3RFCA 3LQRA 2J9RA 2X41A 4C4YA 3W3AH 5CG2A 3Q2IA 3BRQA 3IESA 2HT1A 4REQB 4AZVA 2BCGY 2C20A 1JIVA 1AZWA 2DR0A 3G2QA