2V6UA

High resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
total genus 32
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6uA00
3JSTA 3HXAA 2V6UA 2V6TA 4WILA 2V6SA 1USOA 1RU0A 1F93A 1DCPA 1DCOA 2EBBA 4C45A 1USMA 1DCHA 4LOWA
chains in the Genus database with same CATH superfamily
1GE9A 3HKZL 1K83A 1HQMA 3RZOK 1I50A 1I50C 5CHPA 4WILA 1EFWA 1DCOA 2PA8D 4XSZA 3GTJC 5C3EK 3V4GA 3HOXK 4Y52K 3CAGA 3QX3A 4G7HA 1DD5A 3S14K 1BJTA 3G4AA 1VJEA 3AQOA 3ERED 4OIQA 1WQGA 3T01A 3H0GC 4ILDA 3GTPC 1B4BA 2VUMC 1XXAA 3N3YA 4A3JK 2JA5A 2YU9C 3AH5A 4Y7NK 2Y0SD 3AD9C 3GTMC 2WB1L 1BGWA 5HL8A 1WIHA 2WAQD 3GTQC 2GSUA 4QIWL 3HOYC 5M3MK 4BLBA 1V5VA 1XPPA 1XZQB 3HOWC 3TTGA 4GTAA 1SFOC 1O2FB 2XCOA 2R92A 4C3HC 5IYDK 4DDQA 1TWAC 1I6VA 1Y1WC 1ZYRA 4A3MC 3S1MC 4A3EC 3S15K 3T02A 1PJ6A 4QJVA 1EQRA 5C4JC 2JA8K 4A93C 3HOZK 3GTLK 1XXBA 3FKIA 4BY1K 1TWFA 5FLMC 1WOSA 3HOUC 4BY1C 4XLPA 4PABA 3I4NC 3GTLC 5C4JK 2JA8C 3K7AK 1YNNA 4C2MC 4A3EK 4BXXC 1XZPB 5JVOA 1TWHK 2JA7C 3Q3QA 1JQWA 4BBSC 3S0XA 4PAAA 5IYBK 3S1NK 3TFJA 3DXJA 4P5AA 2P5MA 3HOYK 1TWGK 4LQYA 4BY7C 4ZH4A 1WCMA 5L46A 2CFAA 2ZFZA 4LK1A 2PMZD 5C4XC 4GZYA 4GTEA 2NVXK 4GTLA 1WOOA 3OPFA 4A3LC 4P9SA 1Y1VK 1J6VA 4YFNA 3S2HC 4XCHA 3CQZK 1UV7A 3H0GA 1EI6A 5IP9K 1PJ7A 3SZYA 3FHZA 4YFXA 4KN7A 5C44K 1L0WA 1USOA 4Y52C 3CQZC 1DCHA 3GTJA 1Y1VC 4BKWA 2BE5A 1BS2A 1J6XA 2JA5K 4P5BA 1XZQA 4LJZA 2B63A 4A3DK 5IOSA 3PO2K 3MMLB 1WQHA 3VA7A 2PMZL 3A8IA 1VH2A 4OIOA 4OIRA 3H3VL 1TWGC 4GFQA 5EGEA 2NVYC 3GTOA 3S1NC 4X6AC 1JVIA 3L4JA 4BBSK 3S17K 3S16K 2P8TA 4A3FK 1KQ4A 4XLNA 1DCPA 4KB2A 5IORA 1EH1A 4A3BC 2FQTA 1TWFK 1TWCK 2R93A 4OINA 2V6TA 5FLMK 4KM8A 3GTKC 3GEHA 4LK0A 4OIPA 3I4MK 3HOZC 2NVTC 4G0WA 4A93K 3BP3A 5IOQA 1SFOA 3M4OC 4A3GK 1WQFA 1O28A 5IP7K 3G4CA 1TWAK 2A69A 1INNA 4KDDA 4MQ9A 4C3HK 2NVTK 3FOEA 3GTKK 2R7ZK 1I6HK 5TMFA 1IW7A 1YX2A 1F93A 1TWGA 1R9TA 4YG2A 4A3IC 3HXAA 3FOFA 3GTQK 2R92C 4C3JC 4GTBA 4C45A 4A3CK 1O29A 1I3QC 1ZXOA 1YCLA 2R93C 3GTGA 1Y1VA 4GTFA 3GTPK 2A6EA 3CQZA 3H0GK 2NVYA 2GSNA 3JSTA 4LLGA 3RZDC 4KM9A 2E2JK 3S2DK 2WB1D 4GT9A 2YU9A 1RU0A 2Y3PA 3HOVK 4LOWA 1BDFA 5C3EC 3GTJK 3PO2C 1G51A 2ZUEA 2E2HK 4KAWX 3LPXA 4A3DC 2JA5C 3T00A 2O5JA 2VUMA 3LAJA 1HI9A 3M3YC 1VRQC 2E2HC 4KN4A 3HOVC 1J98A 3LAPA 2PA8L 2W7VA 3GTOK 3PO3C 1XXCA 4Q4ZA 1VGXA 2RGRA 4XSXA 1IBAA 2Y0SL 2EBBA 2NVXC 1I3QK 4JK1A 4A3CC 4G7OA 4KMHA 2R92K 4A3KC 2JA6C 4A3IK 1O26A 4AH6A 1ZVUA 3S1RC 1I6HC 1O2AA 2GAHC 3GTLA 2JA7A 4G0UA 1WSRA 1AB4A 1IE0A 2PPBA 1O24A 1IS1A 3N0BA 3K7AC 3GTKA 3HKZD 3HOUK 4MEXA 5IYCC 1R9TC 3GIRA 1R9TK 3S1QK 1TWFC 3L4KA 1TWHA 3GTQA 5M3FK 3FKIK 4G0VA 4A3BK 3S15C 3S1MK 1WOPA 5IYDC 4A3FC 2O5IA 1Y1WA 1WCMK 2XCQA 3S16C 5CJ9A 3WODA 1EK8A 5E68A 3GTPA 2D6FC 2E2IA 3HOWK 3S1RK 1WSVA 2NVYK 2GSOA 2B63C 1YNJA 3EQLA 2A6HA 2JA6A 5EGHA 4Q5SA 3TFHA 1SMYA 1VLOA 2E2HA 3GTMK 4WJ4A 4Y7NC 4A3JC 2VUMK 3GEEA 1K83C 3ADAC 3AD8C 1F7UA 4QJVB 2GAGC 5FJ8K 3PO3K 3SZZA 2NVQC 2NVXA 3S14C 2KWAA 3IPJA 5C44C 4AYBD 4MEYA 3HOXC 5IP9C 3OEPA 2NVQK 3S2HK 5M5WK 4FZBA 3M3YK 1K83K 3GEIA 3NUHA 1I50K 2JH3A 3RZOC 1J6WA 4A3LK 4RMFA 3H3VD 1I3QA 2PHCB 1JOEA 2FQOA 5TJ3A 5C4XK 5M5YK 3GSIA 3GTGC 2CW0A 2E2JC 3S2DC 2B63K 4BY7K 3RZDK 3N0CA 5IYBC 2JA7K 4C3IK 1TWHC 4QIWD 1TWCA 4KASA 1WCMC 2R93K 1ZQ1C 4GTDA 4BXXK 2WAQL 3FKIC 4C3JK 5D4DA 4C2MK 4G7ZA 3AD7C 5JFEA 3GDZA 3I4NK 4GTCA 1USMA 4KATA 3A8KA 3S1QC 1O2BA 2XCRB 5IYCK 5TMCA 2E2IC 2R7ZC 1XZPA 4M1XA 4BBRC 3BUEA 3A8JA 2A68A 2V6SA 1PJ5A 1F9NA 1WORA 3TFIA 5M5XK 4FM9A 5IP7C 1O25A 4A3MK 4A3GC 1Y1WK 5IOTA 3M4OK 3I4MC 4O2DA 1B4AA 4BBRK 2E2IK 1SFOK 4J3NA 2V6UA 2RH6A 1IL2A 4YFKA 1X31C 1TWCC 1TWAA 2JA6K 4A3KK 1C0AA 3OREA 2R7ZA 4KMUA 3GTMA 2CFAB 3BP8C 4KC6A 1ZBSA 4NOIA 2YU9K 4KB4A 4C3IC 3S17C 4KARA 4KMAA 1IQ0A 3AQPA 1F7VA 4X6AK 1O27A 4WJ3M 3GTOC 4LR2A 1ISEA 4KMDA 3GTGK 4BLAA 4AYBL 2ZUFA
chains in the Genus database with same CATH topology
3JSTA 3HXAA 2V6UA 2V6TA 4WILA 2V6SA 1USOA 1RU0A 1F93A 1DCPA 1DCOA 2EBBA 4C45A 1USMA 1DCHA 4LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JST A;  3HXA A;  2V6U A;  2V6T A;  4WIL A;  2V6S A;  1USO A;  1RU0 A;  1F93 A;  1DCP A;  1DCO A;  2EBB A;  4C45 A;  1USM A;  1DCH A;  4LOW A; 
#chains in the Genus database with same CATH topology
 1GE9 A;  3HKZ L;  1K83 A;  1HQM A;  3RZO K;  1I50 A;  1I50 C;  5CHP A;  4WIL A;  1EFW A;  1DCO A;  2PA8 D;  4XSZ A;  3GTJ C;  5C3E K;  3V4G A;  3HOX K;  4Y52 K;  3CAG A;  3QX3 A;  4G7H A;  1DD5 A;  3S14 K;  1BJT A;  3G4A A;  1VJE A;  3AQO A;  3ERE D;  4OIQ A;  1WQG A;  3T01 A;  3H0G C;  4ILD A;  3GTP C;  1B4B A;  2VUM C;  1XXA A;  3N3Y A;  4A3J K;  2JA5 A;  2YU9 C;  3AH5 A;  4Y7N K;  2Y0S D;  3AD9 C;  3GTM C;  2WB1 L;  1BGW A;  5HL8 A;  1WIH A;  2WAQ D;  3GTQ C;  2GSU A;  4QIW L;  3HOY C;  5M3M K;  4BLB A;  1V5V A;  1XPP A;  1XZQ B;  3HOW C;  3TTG A;  4GTA A;  1SFO C;  1O2F B;  2XCO A;  2R92 A;  4C3H C;  5IYD K;  4DDQ A;  1TWA C;  1I6V A;  1Y1W C;  1ZYR A;  4A3M C;  3S1M C;  4A3E C;  3S15 K;  3T02 A;  1PJ6 A;  4QJV A;  1EQR A;  5C4J C;  2JA8 K;  4A93 C;  3HOZ K;  3GTL K;  1XXB A;  3FKI A;  4BY1 K;  1TWF A;  5FLM C;  1WOS A;  3HOU C;  4BY1 C;  4XLP A;  4PAB A;  3I4N C;  3GTL C;  5C4J K;  2JA8 C;  3K7A K;  1YNN A;  4C2M C;  4A3E K;  4BXX C;  1XZP B;  5JVO A;  1TWH K;  2JA7 C;  3Q3Q A;  1JQW A;  4BBS C;  3S0X A;  4PAA A;  5IYB K;  3S1N K;  3TFJ A;  3DXJ A;  4P5A A;  2P5M A;  3HOY K;  1TWG K;  4LQY A;  4BY7 C;  4ZH4 A;  1WCM A;  5L46 A;  2CFA A;  2ZFZ A;  4LK1 A;  2PMZ D;  5C4X C;  4GZY A;  4GTE A;  2NVX K;  4GTL A;  1WOO A;  3OPF A;  4A3L C;  4P9S A;  1Y1V K;  1J6V A;  4YFN A;  3S2H C;  4XCH A;  3CQZ K;  1UV7 A;  3H0G A;  1EI6 A;  5IP9 K;  1PJ7 A;  3SZY A;  3FHZ A;  4YFX A;  4KN7 A;  5C44 K;  1L0W A;  1USO A;  4Y52 C;  3CQZ C;  1DCH A;  3GTJ A;  1Y1V C;  4BKW A;  2BE5 A;  1BS2 A;  1J6X A;  2JA5 K;  4P5B A;  1XZQ A;  4LJZ A;  2B63 A;  4A3D K;  5IOS A;  3PO2 K;  3MML B;  1WQH A;  3VA7 A;  2PMZ L;  3A8I A;  1VH2 A;  4OIO A;  4OIR A;  3H3V L;  1TWG C;  4GFQ A;  5EGE A;  2NVY C;  3GTO A;  3S1N C;  4X6A C;  1JVI A;  3L4J A;  4BBS K;  3S17 K;  3S16 K;  2P8T A;  4A3F K;  1KQ4 A;  4XLN A;  1DCP A;  4KB2 A;  5IOR A;  1EH1 A;  4A3B C;  2FQT A;  1TWF K;  1TWC K;  2R93 A;  4OIN A;  2V6T A;  5FLM K;  4KM8 A;  3GTK C;  3GEH A;  4LK0 A;  4OIP A;  3I4M K;  3HOZ C;  2NVT C;  4G0W A;  4A93 K;  3BP3 A;  5IOQ A;  1SFO A;  3M4O C;  4A3G K;  1WQF A;  1O28 A;  5IP7 K;  3G4C A;  1TWA K;  2A69 A;  1INN A;  4KDD A;  4MQ9 A;  4C3H K;  2NVT K;  3FOE A;  3GTK K;  2R7Z K;  1I6H K;  5TMF A;  1IW7 A;  1YX2 A;  1F93 A;  1TWG A;  1R9T A;  4YG2 A;  4A3I C;  3HXA A;  3FOF A;  3GTQ K;  2R92 C;  4C3J C;  4GTB A;  4C45 A;  4A3C K;  1O29 A;  1I3Q C;  1ZXO A;  1YCL A;  2R93 C;  3GTG A;  1Y1V A;  4GTF A;  3GTP K;  2A6E A;  3CQZ A;  3H0G K;  2NVY A;  2GSN A;  3JST A;  4LLG A;  3RZD C;  4KM9 A;  2E2J K;  3S2D K;  2WB1 D;  4GT9 A;  2YU9 A;  1RU0 A;  2Y3P A;  3HOV K;  4LOW A;  1BDF A;  5C3E C;  3GTJ K;  3PO2 C;  1G51 A;  2ZUE A;  2E2H K;  4KAW X;  3LPX A;  4A3D C;  2JA5 C;  3T00 A;  2O5J A;  2VUM A;  3LAJ A;  1HI9 A;  3M3Y C;  1VRQ C;  2E2H C;  4KN4 A;  3HOV C;  1J98 A;  3LAP A;  2PA8 L;  2W7V A;  3GTO K;  3PO3 C;  1XXC A;  4Q4Z A;  1VGX A;  2RGR A;  4XSX A;  1IBA A;  2Y0S L;  2EBB A;  2NVX C;  1I3Q K;  4JK1 A;  4A3C C;  4G7O A;  4KMH A;  2R92 K;  4A3K C;  2JA6 C;  4A3I K;  1O26 A;  4AH6 A;  1ZVU A;  3S1R C;  1I6H C;  1O2A A;  2GAH C;  3GTL A;  2JA7 A;  4G0U A;  1WSR A;  1AB4 A;  1IE0 A;  2PPB A;  1O24 A;  1IS1 A;  3N0B A;  3K7A C;  3GTK A;  3HKZ D;  3HOU K;  4MEX A;  5IYC C;  1R9T C;  3GIR A;  1R9T K;  3S1Q K;  1TWF C;  3L4K A;  1TWH A;  3GTQ A;  5M3F K;  3FKI K;  4G0V A;  4A3B K;  3S15 C;  3S1M K;  1WOP A;  5IYD C;  4A3F C;  2O5I A;  1Y1W A;  1WCM K;  2XCQ A;  3S16 C;  5CJ9 A;  3WOD A;  1EK8 A;  5E68 A;  3GTP A;  2D6F C;  2E2I A;  3HOW K;  3S1R K;  1WSV A;  2NVY K;  2GSO A;  2B63 C;  1YNJ A;  3EQL A;  2A6H A;  2JA6 A;  5EGH A;  4Q5S A;  3TFH A;  1SMY A;  1VLO A;  2E2H A;  3GTM K;  4WJ4 A;  4Y7N C;  4A3J C;  2VUM K;  3GEE A;  1K83 C;  3ADA C;  3AD8 C;  1F7U A;  4QJV B;  2GAG C;  5FJ8 K;  3PO3 K;  3SZZ A;  2NVQ C;  2NVX A;  3S14 C;  2KWA A;  3IPJ A;  5C44 C;  4AYB D;  4MEY A;  3HOX C;  5IP9 C;  3OEP A;  2NVQ K;  3S2H K;  5M5W K;  4FZB A;  3M3Y K;  1K83 K;  3GEI A;  3NUH A;  1I50 K;  2JH3 A;  3RZO C;  1J6W A;  4A3L K;  4RMF A;  3H3V D;  1I3Q A;  2PHC B;  1JOE A;  2FQO A;  5TJ3 A;  5C4X K;  5M5Y K;  3GSI A;  3GTG C;  2CW0 A;  2E2J C;  3S2D C;  2B63 K;  4BY7 K;  3RZD K;  3N0C A;  5IYB C;  2JA7 K;  4C3I K;  1TWH C;  4QIW D;  1TWC A;  4KAS A;  1WCM C;  2R93 K;  1ZQ1 C;  4GTD A;  4BXX K;  2WAQ L;  3FKI C;  4C3J K;  5D4D A;  4C2M K;  4G7Z A;  3AD7 C;  5JFE A;  3GDZ A;  3I4N K;  4GTC A;  1USM A;  4KAT A;  3A8K A;  3S1Q C;  1O2B A;  2XCR B;  5IYC K;  5TMC A;  2E2I C;  2R7Z C;  1XZP A;  4M1X A;  4BBR C;  3BUE A;  3A8J A;  2A68 A;  2V6S A;  1PJ5 A;  1F9N A;  1WOR A;  3TFI A;  5M5X K;  4FM9 A;  5IP7 C;  1O25 A;  4A3M K;  4A3G C;  1Y1W K;  5IOT A;  3M4O K;  3I4M C;  4O2D A;  1B4A A;  4BBR K;  2E2I K;  1SFO K;  4J3N A;  2V6U A;  2RH6 A;  1IL2 A;  4YFK A;  1X31 C;  1TWC C;  1TWA A;  2JA6 K;  4A3K K;  1C0A A;  3ORE A;  2R7Z A;  4KMU A;  3GTM A;  2CFA B;  3BP8 C;  4KC6 A;  1ZBS A;  4NOI A;  2YU9 K;  4KB4 A;  4C3I C;  3S17 C;  4KAR A;  4KMA A;  1IQ0 A;  3AQP A;  1F7V A;  4X6A K;  1O27 A;  4WJ3 M;  3GTO C;  4LR2 A;  1ISE A;  4KMD A;  3GTG K;  4BLA A;  4AYB L;  2ZUF A; 
#chains in the Genus database with same CATH homology
 3JST A;  3HXA A;  2V6U A;  2V6T A;  4WIL A;  2V6S A;  1USO A;  1RU0 A;  1F93 A;  1DCP A;  1DCO A;  2EBB A;  4C45 A;  1USM A;  1DCH A;  4LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...