2V6UA

High resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 32
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6uA00
1DCHA 1RU0A 1F93A 4LOWA 4C45A 2V6UA 1DCOA 1DCPA 2EBBA 4WILA 3JSTA 1USMA 3HXAA 1USOA 2V6TA 2V6SA
chains in the Genus database with same CATH superfamily
5CJ9A 1TWGC 3T02A 3GTMA 1O2AA 3GTOK 3HOYK 3QX3A 4GZYA 4Y7NC 1EI6A 1IE0A 2ZFZA 4A3LK 4KARA 3L4KA 2RGRA 2R7ZC 3PO3K 1YX2A 3H3VD 3S1NC 1WOOA 2D6FC 2PMZL 2BE5A 2JA5A 3HOXK 2VUMC 1VJEA 5FLMK 1WQHA 4A3MK 1I3QA 2Y0SD 4P9SA 1EQRA 4A3KC 4OIRA 5FJ8K 1VLOA 4A3GC 1B4BA 3AH5A 4LQYA 4BXXC 1F9NA 3A8JA 4C2MC 1DD5A 4BBRK 3BUEA 1JOEA 4RMFA 1YNNA 5C4XK 5IOTA 5EGHA 3FOFA 4OINA 3V4GA 2R7ZK 4XCHA 2GSUA 2GSOA 1J98A 2P8TA 3S1NK 4MEXA 1ZXOA 1PJ6A 1V5VA 1F93A 3N0CA 2VUMK 3GTQA 1USMA 4BLBA 5JFEA 3HOUC 2YU9A 4LLGA 3H3VL 4G7HA 4BXXK 4WJ3M 4BKWA 3GTPC 2O5JA 2R93K 1WSRA 2JA6A 2JA8C 2A6HA 1Y1VA 3PO2C 1X31C 4X6AC 2JH3A 4C3JC 4BBSK 1INNA 2NVQC 4G7OA 3GTQC 1WCMC 3A8KA 2YU9C 1XXAA 1R9TC 5IORA 4KN7A 2NVXK 3GTGK 2ZUEA 4KB2A 4GTLA 2B63C 2R92A 4A3JK 4KAWX 4KDDA 3GSIA 3LPXA 4PABA 4C3HC 3S1MC 3H0GK 5IOQA 2E2JK 3GTPK 3OREA 2CFAB 1I50C 4AH6A 4YFXA 1VH2A 3CQZC 5M3FK 3FKIK 1WIHA 3M4OC 4G0VA 4X6AK 3M3YC 4KMHA 4C3JK 2NVQK 4MQ9A 1WCMK 3G4AA 5E68A 1R9TK 2GAHC 1O2FB 1BJTA 5IP7K 4A3FC 5C4JK 4Y52C 4OIPA 2B63K 3RZDK 1TWHA 2KWAA 2W7VA 4G7ZA 3IPJA 1I6VA 1BGWA 1Y1WK 3K7AC 1WOPA 2NVYA 1I50K 5EGEA 2E2HC 3CQZK 1ZQ1C 1XPPA 4QJVB 3M4OK 3GIRA 2XCQA 4GTDA 1TWAK 4ZH4A 1G51A 3M3YK 1DCHA 2PA8D 3GTMC 3OEPA 4A3CK 5D4DA 3FOEA 3GTLK 4P5AA 4LK0A 2JA7A 1TWGK 4LOWA 4ILDA 3S14C 2NVYC 1TWCA 5M5WK 4PAAA 4Y7NK 5HL8A 5IYBC 1IBAA 3GTKA 4A3BC 3S2HC 1I6HC 1TWFA 3K7AK 1ZBSA 2JA5C 3S15C 3T01A 2NVTC 3AD9C 2E2HK 5L46A 1XXCA 1HQMA 4XLNA 1I3QC 1K83A 2WAQD 1J6VA 4WILA 1SFOA 4O2DA 4Q5SA 1WQGA 4KMUA 3HOZC 3ADAC 3N0BA 4QJVA 5CHPA 3GTMK 4WJ4A 3S1RC 4A3KK 4KM9A 1TWCC 3TFHA 1ZVUA 4A3GK 3HOVC 5M5XK 3GTJA 4GTFA 1XZQB 4C2MK 2E2IA 2CW0A 5IYDC 2PA8L 2Y3PA 4A93C 1PJ7A 2Y0SL 1K83C 4A3BK 3S2HK 1I6HK 4Q4ZA 2JA5K 4KB4A 3TFJA 1UV7A 2NVTK 1I3QK 1B4AA 1WQFA 4J3NA 4GTEA 3GTOA 4XLPA 3HOZK 3T00A 3GTJC 3TFIA 4XSZA 3HOUK 2P5MA 2E2IC 3OPFA 3SZZA 4KM8A 4XSXA 3SZYA 2JA6C 3S16C 4BY7C 5IP9C 3GEHA 2WAQL 1Y1VC 3HKZD 3HOWC 1KQ4A 4BY1C 4AYBD 3RZOC 3TTGA 2JA8K 3GDZA 4NOIA 3PO2K 1SMYA 1JQWA 1IS1A 4GT9A 3S2DC 4KMAA 4MEYA 3GTQK 2PMZD 1WSVA 2R92C 2YU9K 4M1XA 4A3LC 1O24A 3S17C 2PPBA 3PO3C 4A3IC 2PHCB 2JA6K 4A3DC 3S16K 4OIOA 3GEIA 4C3HK 3S1MK 5IOSA 1Y1VK 5M3MK 2R7ZA 2XCOA 2GSNA 5JVOA 5FLMC 1DCPA 4G0WA 4A3MC 1BS2A 1ZYRA 4KASA 4FZBA 4KMDA 1IL2A 3L4JA 1J6XA 2VUMA 5TMFA 2CFAA 2ZUFA 3NUHA 4BBRC 3S2DK 1XZPB 3HKZL 3HXAA 3MMLB 1EK8A 5C4XC 1IQ0A 4AYBL 4YG2A 2R92K 1TWHC 3G4CA 2R93A 1HI9A 1O27A 5TMCA 2V6SA 3I4NC 3S17K 4A3FK 5C44C 3AQOA 4Y52K 1USOA 2XCRB 3ERED 4A3IK 1RU0A 4C3IC 2RH6A 4A3DK 1O26A 3JSTA 1IW7A 1BDFA 1VGXA 1YNJA 1VRQC 3FHZA 3WODA 1AB4A 2NVXA 3Q3QA 1F7UA 3GTGA 2FQOA 2JA7C 2R93C 3I4MC 1J6WA 3S0XA 3H0GA 4GTBA 2V6TA 1TWHK 3GTPA 1XZPA 3I4NK 4JK1A 4BBSC 2WB1D 3GTKC 1F7VA 3FKIA 1O2BA 3S14K 1TWFC 3GEEA 5C44K 2NVYK 1GE9A 4LK1A 1O25A 4C3IK 5IYBK 2NVXC 4QIWD 3GTGC 3AD8C 3EQLA 3BP8C 1SFOC 3S15K 1WCMA 2O5IA 4A3JC 1O29A 4GTCA 1R9TA 5IYCC 4YFNA 1EFWA 5C3EC 4FM9A 3H0GC 1YCLA 2E2JC 2JA7K 2B63A 4GTAA 3I4MK 3S1RK 3FKIC 3AD7C 1Y1WA 1TWCK 2A6EA 3CAGA 4KATA 4YFKA 3HOVK 4A3EC 3S1QC 1PJ5A 1I50A 1XXBA 3GTKK 3CQZA 1TWFK 1DCOA 4LR2A 5IYDK 3AQPA 4A93K 4KC6A 1TWAA 1WOSA 3VA7A 1XZQA 1JVIA 4LJZA 1K83K 4C45A 4DDQA 3DXJA 2EBBA 2FQTA 1SFOK 5IP7C 3A8IA 5C4JC 3GTOC 3GTLA 2WB1L 3RZDC 3HOYC 5IYCK 1TWGA 4GFQA 1Y1WC 5C3EK 4P5BA 5M5YK 3LAJA 2A69A 2GAGC 4BLAA 3GTJK 4QIWL 1ISEA 3N3YA 1WORA 2V6UA 2E2IK 4OIQA 4KN4A 1TWAC 1C0AA 4A3EK 1EH1A 3S1QK 4BY7K 5IP9K 5TJ3A 3LAPA 3HOXC 2E2HA 3HOWK 2A68A 4A3CC 1O28A 4BY1K 3RZOK 3GTLC 3BP3A 1L0WA 4G0UA
chains in the Genus database with same CATH topology
1DCHA 1RU0A 1F93A 4LOWA 4C45A 2V6UA 1DCOA 1DCPA 2EBBA 4WILA 3JSTA 1USMA 3HXAA 1USOA 2V6TA 2V6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  1RU0 A;  1F93 A;  4LOW A;  4C45 A;  2V6U A;  1DCO A;  1DCP A;  2EBB A;  4WIL A;  3JST A;  1USM A;  3HXA A;  1USO A;  2V6T A;  2V6S A; 
#chains in the Genus database with same CATH topology
 5CJ9 A;  1TWG C;  3T02 A;  3GTM A;  1O2A A;  3GTO K;  3HOY K;  3QX3 A;  4GZY A;  4Y7N C;  1EI6 A;  1IE0 A;  2ZFZ A;  4A3L K;  4KAR A;  3L4K A;  2RGR A;  2R7Z C;  3PO3 K;  1YX2 A;  3H3V D;  3S1N C;  1WOO A;  2D6F C;  2PMZ L;  2BE5 A;  2JA5 A;  3HOX K;  2VUM C;  1VJE A;  5FLM K;  1WQH A;  4A3M K;  1I3Q A;  2Y0S D;  4P9S A;  1EQR A;  4A3K C;  4OIR A;  5FJ8 K;  1VLO A;  4A3G C;  1B4B A;  3AH5 A;  4LQY A;  4BXX C;  1F9N A;  3A8J A;  4C2M C;  1DD5 A;  4BBR K;  3BUE A;  1JOE A;  4RMF A;  1YNN A;  5C4X K;  5IOT A;  5EGH A;  3FOF A;  4OIN A;  3V4G A;  2R7Z K;  4XCH A;  2GSU A;  2GSO A;  1J98 A;  2P8T A;  3S1N K;  4MEX A;  1ZXO A;  1PJ6 A;  1V5V A;  1F93 A;  3N0C A;  2VUM K;  3GTQ A;  1USM A;  4BLB A;  5JFE A;  3HOU C;  2YU9 A;  4LLG A;  3H3V L;  4G7H A;  4BXX K;  4WJ3 M;  4BKW A;  3GTP C;  2O5J A;  2R93 K;  1WSR A;  2JA6 A;  2JA8 C;  2A6H A;  1Y1V A;  3PO2 C;  1X31 C;  4X6A C;  2JH3 A;  4C3J C;  4BBS K;  1INN A;  2NVQ C;  4G7O A;  3GTQ C;  1WCM C;  3A8K A;  2YU9 C;  1XXA A;  1R9T C;  5IOR A;  4KN7 A;  2NVX K;  3GTG K;  2ZUE A;  4KB2 A;  4GTL A;  2B63 C;  2R92 A;  4A3J K;  4KAW X;  4KDD A;  3GSI A;  3LPX A;  4PAB A;  4C3H C;  3S1M C;  3H0G K;  5IOQ A;  2E2J K;  3GTP K;  3ORE A;  2CFA B;  1I50 C;  4AH6 A;  4YFX A;  1VH2 A;  3CQZ C;  5M3F K;  3FKI K;  1WIH A;  3M4O C;  4G0V A;  4X6A K;  3M3Y C;  4KMH A;  4C3J K;  2NVQ K;  4MQ9 A;  1WCM K;  3G4A A;  5E68 A;  1R9T K;  2GAH C;  1O2F B;  1BJT A;  5IP7 K;  4A3F C;  5C4J K;  4Y52 C;  4OIP A;  2B63 K;  3RZD K;  1TWH A;  2KWA A;  2W7V A;  4G7Z A;  3IPJ A;  1I6V A;  1BGW A;  1Y1W K;  3K7A C;  1WOP A;  2NVY A;  1I50 K;  5EGE A;  2E2H C;  3CQZ K;  1ZQ1 C;  1XPP A;  4QJV B;  3M4O K;  3GIR A;  2XCQ A;  4GTD A;  1TWA K;  4ZH4 A;  1G51 A;  3M3Y K;  1DCH A;  2PA8 D;  3GTM C;  3OEP A;  4A3C K;  5D4D A;  3FOE A;  3GTL K;  4P5A A;  4LK0 A;  2JA7 A;  1TWG K;  4LOW A;  4ILD A;  3S14 C;  2NVY C;  1TWC A;  5M5W K;  4PAA A;  4Y7N K;  5HL8 A;  5IYB C;  1IBA A;  3GTK A;  4A3B C;  3S2H C;  1I6H C;  1TWF A;  3K7A K;  1ZBS A;  2JA5 C;  3S15 C;  3T01 A;  2NVT C;  3AD9 C;  2E2H K;  5L46 A;  1XXC A;  1HQM A;  4XLN A;  1I3Q C;  1K83 A;  2WAQ D;  1J6V A;  4WIL A;  1SFO A;  4O2D A;  4Q5S A;  1WQG A;  4KMU A;  3HOZ C;  3ADA C;  3N0B A;  4QJV A;  5CHP A;  3GTM K;  4WJ4 A;  3S1R C;  4A3K K;  4KM9 A;  1TWC C;  3TFH A;  1ZVU A;  4A3G K;  3HOV C;  5M5X K;  3GTJ A;  4GTF A;  1XZQ B;  4C2M K;  2E2I A;  2CW0 A;  5IYD C;  2PA8 L;  2Y3P A;  4A93 C;  1PJ7 A;  2Y0S L;  1K83 C;  4A3B K;  3S2H K;  1I6H K;  4Q4Z A;  2JA5 K;  4KB4 A;  3TFJ A;  1UV7 A;  2NVT K;  1I3Q K;  1B4A A;  1WQF A;  4J3N A;  4GTE A;  3GTO A;  4XLP A;  3HOZ K;  3T00 A;  3GTJ C;  3TFI A;  4XSZ A;  3HOU K;  2P5M A;  2E2I C;  3OPF A;  3SZZ A;  4KM8 A;  4XSX A;  3SZY A;  2JA6 C;  3S16 C;  4BY7 C;  5IP9 C;  3GEH A;  2WAQ L;  1Y1V C;  3HKZ D;  3HOW C;  1KQ4 A;  4BY1 C;  4AYB D;  3RZO C;  3TTG A;  2JA8 K;  3GDZ A;  4NOI A;  3PO2 K;  1SMY A;  1JQW A;  1IS1 A;  4GT9 A;  3S2D C;  4KMA A;  4MEY A;  3GTQ K;  2PMZ D;  1WSV A;  2R92 C;  2YU9 K;  4M1X A;  4A3L C;  1O24 A;  3S17 C;  2PPB A;  3PO3 C;  4A3I C;  2PHC B;  2JA6 K;  4A3D C;  3S16 K;  4OIO A;  3GEI A;  4C3H K;  3S1M K;  5IOS A;  1Y1V K;  5M3M K;  2R7Z A;  2XCO A;  2GSN A;  5JVO A;  5FLM C;  1DCP A;  4G0W A;  4A3M C;  1BS2 A;  1ZYR A;  4KAS A;  4FZB A;  4KMD A;  1IL2 A;  3L4J A;  1J6X A;  2VUM A;  5TMF A;  2CFA A;  2ZUF A;  3NUH A;  4BBR C;  3S2D K;  1XZP B;  3HKZ L;  3HXA A;  3MML B;  1EK8 A;  5C4X C;  1IQ0 A;  4AYB L;  4YG2 A;  2R92 K;  1TWH C;  3G4C A;  2R93 A;  1HI9 A;  1O27 A;  5TMC A;  2V6S A;  3I4N C;  3S17 K;  4A3F K;  5C44 C;  3AQO A;  4Y52 K;  1USO A;  2XCR B;  3ERE D;  4A3I K;  1RU0 A;  4C3I C;  2RH6 A;  4A3D K;  1O26 A;  3JST A;  1IW7 A;  1BDF A;  1VGX A;  1YNJ A;  1VRQ C;  3FHZ A;  3WOD A;  1AB4 A;  2NVX A;  3Q3Q A;  1F7U A;  3GTG A;  2FQO A;  2JA7 C;  2R93 C;  3I4M C;  1J6W A;  3S0X A;  3H0G A;  4GTB A;  2V6T A;  1TWH K;  3GTP A;  1XZP A;  3I4N K;  4JK1 A;  4BBS C;  2WB1 D;  3GTK C;  1F7V A;  3FKI A;  1O2B A;  3S14 K;  1TWF C;  3GEE A;  5C44 K;  2NVY K;  1GE9 A;  4LK1 A;  1O25 A;  4C3I K;  5IYB K;  2NVX C;  4QIW D;  3GTG C;  3AD8 C;  3EQL A;  3BP8 C;  1SFO C;  3S15 K;  1WCM A;  2O5I A;  4A3J C;  1O29 A;  4GTC A;  1R9T A;  5IYC C;  4YFN A;  1EFW A;  5C3E C;  4FM9 A;  3H0G C;  1YCL A;  2E2J C;  2JA7 K;  2B63 A;  4GTA A;  3I4M K;  3S1R K;  3FKI C;  3AD7 C;  1Y1W A;  1TWC K;  2A6E A;  3CAG A;  4KAT A;  4YFK A;  3HOV K;  4A3E C;  3S1Q C;  1PJ5 A;  1I50 A;  1XXB A;  3GTK K;  3CQZ A;  1TWF K;  1DCO A;  4LR2 A;  5IYD K;  3AQP A;  4A93 K;  4KC6 A;  1TWA A;  1WOS A;  3VA7 A;  1XZQ A;  1JVI A;  4LJZ A;  1K83 K;  4C45 A;  4DDQ A;  3DXJ A;  2EBB A;  2FQT A;  1SFO K;  5IP7 C;  3A8I A;  5C4J C;  3GTO C;  3GTL A;  2WB1 L;  3RZD C;  3HOY C;  5IYC K;  1TWG A;  4GFQ A;  1Y1W C;  5C3E K;  4P5B A;  5M5Y K;  3LAJ A;  2A69 A;  2GAG C;  4BLA A;  3GTJ K;  4QIW L;  1ISE A;  3N3Y A;  1WOR A;  2V6U A;  2E2I K;  4OIQ A;  4KN4 A;  1TWA C;  1C0A A;  4A3E K;  1EH1 A;  3S1Q K;  4BY7 K;  5IP9 K;  5TJ3 A;  3LAP A;  3HOX C;  2E2H A;  3HOW K;  2A68 A;  4A3C C;  1O28 A;  4BY1 K;  3RZO K;  3GTL C;  3BP3 A;  1L0W A;  4G0U A; 
#chains in the Genus database with same CATH homology
 1DCH A;  1RU0 A;  1F93 A;  4LOW A;  4C45 A;  2V6U A;  1DCO A;  1DCP A;  2EBB A;  4WIL A;  3JST A;  1USM A;  3HXA A;  1USO A;  2V6T A;  2V6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...