2V6UA

High resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
b'MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 32
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6uA00
3HXAA 4C45A 1DCOA 2V6UA 1RU0A 4WILA 1USOA 2V6TA 1USMA 1DCHA 2EBBA 1F93A 1DCPA 3JSTA 2V6SA 4LOWA
chains in the Genus database with same CATH superfamily
3HOUK 4PAAA 2PA8L 3IPJA 1XXCA 4KARA 3GTJK 1WCMA 4AH6A 1YNNA 1RU0A 1B4AA 1TWCK 5CHPA 1TWFC 4FM9A 4LJZA 4A3MK 4BKWA 5TMCA 2W7VA 1ZQ1C 4G0UA 3GEEA 1TWHC 1TWAA 2RGRA 3K7AC 3GTQC 3GTLA 1F93A 5IP7C 1Y1WA 1XZQA 1O28A 3SZZA 4A3FK 3S1QC 4A3GK 4QJVB 3BUEA 4YFXA 2NVTK 2KWAA 3A8JA 1XZPB 3S1NK 3GTPA 3I4NK 1PJ5A 4KM9A 3RZOC 2JA6A 4G0WA 4GTAA 4A3LK 3S1RK 3GTMC 1F9NA 1O24A 4PABA 2R92C 1WOPA 1UV7A 1O2AA 1G51A 1WOOA 4KMHA 2CFAB 3ADAC 2YU9C 4BXXC 2V6UA 3HOZC 4GTCA 1IW7A 2JA7C 3K7AK 3PO3C 1WQFA 2JA5C 1DCHA 5IP9K 1TWGA 4A3IK 2GSNA 4OIQA 2XCRB 3OREA 2R7ZA 4A3BC 4RMFA 1I6HC 1WQGA 5TMFA 3S2DC 3HOWK 4OIRA 3RZOK 3FOEA 1XXAA 4X6AC 3HKZD 4FZBA 1L0WA 3PO2C 4OIPA 4MEXA 3HOYC 3S15C 5M5YK 3T00A 2RH6A 3FKIK 4XSZA 1DCOA 4JK1A 1Y1VA 4G0VA 1IS1A 3GTOK 2YU9K 3NUHA 4BXXK 3S2HK 2WAQL 4C3IK 4A3DK 2XCQA 1I50A 3HOUC 2VUMA 4Q5SA 3EQLA 3PO3K 1HQMA 2JA5K 3H0GC 1AB4A 3CAGA 4C2MC 2NVXK 4LK1A 3GTJC 4G7OA 3OEPA 2R93A 4A3BK 5C4XK 2PMZD 3HOXC 1WCMK 4YFNA 4X6AK 1USOA 2NVYA 5IOSA 3H3VL 1XZQB 3HOYK 3VA7A 4A3FC 4A3GC 3H3VD 4MQ9A 3GEIA 1SFOA 3Q3QA 4GTDA 1WSRA 4GFQA 5C44C 1Y1WK 4A3LC 1R9TA 4KDDA 3H0GK 4KC6A 4C2MK 2PA8D 3S16C 1IL2A 5M3FK 4C3JK 5IYCC 3HOVC 4P5BA 3GTGC 3HOXK 3N0CA 1K83A 5FJ8K 4G7HA 3N0BA 2FQOA 4GTBA 4DDQA 4BLBA 4O2DA 3AD9C 5C4JK 5JVOA 5IP9C 2Y0SL 3BP3A 4A3IC 4KATA 4KB2A 1BS2A 2Y0SD 1JVIA 4KASA 3QX3A 3RZDC 3HOWC 5C44K 1WIHA 1TWGK 1PJ7A 1V5VA 3A8IA 1B4BA 2R7ZK 4BBSK 1I3QA 3GTKA 4WJ3M 2A68A 1WSVA 2O5IA 3S16K 1O25A 5IYCK 4A3EK 3HOVK 3FKIC 1J6VA 3GTGK 4J3NA 2E2IA 3HXAA 3GTOC 2PHCB 3S2HC 5M5XK 4G7ZA 4C3IC 1Y1VK 4A3DC 1O2BA 5M5WK 2BE5A 1TWCA 2NVXC 5EGEA 3LAPA 2B63A 5EGHA 2VUMK 4GTLA 3M4OK 4Y7NC 5C4XC 4QIWL 4XSXA 1ZYRA 3RZDK 1WCMC 1VJEA 3N3YA 4KMUA 3TFJA 1KQ4A 4C45A 2R93K 2E2HA 3A8KA 4WILA 4ILDA 5E68A 3LPXA 1I6VA 1WQHA 3T02A 2NVYK 4ZH4A 1TWAC 3CQZA 3GTLC 1IBAA 2ZFZA 4KM8A 3L4JA 4KN4A 3S14K 1Y1WC 5CJ9A 1EQRA 3BP8C 1HI9A 2GSUA 1SFOK 1JOEA 3GTPC 3T01A 2WAQD 2JA6C 1TWFA 1DD5A 4C3JC 3AQPA 4Y7NK 1YCLA 1TWHA 3M3YC 3GTQA 3I4MK 5FLMC 4OIOA 1YNJA 3MMLB 4P5AA 4Y52K 5D4DA 4LK0A 2CW0A 3AD7C 5C4JC 1K83K 3FHZA 1O29A 5JFEA 5IYBC 1TWAK 3AQOA 1X31C 5TJ3A 3GTLK 2PPBA 3GTMA 2R92A 3AH5A 1VRQC 4C3HK 1TWGC 4BY7C 1SMYA 1F7UA 5HL8A 3S0XA 4A3KC 4KN7A 4AYBL 5IYDC 3GTPK 4KAWX 3TFIA 2R7ZC 1BJTA 4BBSC 2JA6K 1IQ0A 4AYBD 3GIRA 1WORA 4A3EC 2YU9A 4NOIA 4LLGA 4A3CK 1I3QK 4LR2A 3GSIA 2JA7A 3M3YK 5C3EC 1EH1A 2XCOA 2JA5A 1XPPA 1BGWA 1Y1VC 4GT9A 3S1MC 5FLMK 3CQZC 3DXJA 4BBRK 4BY1K 4A3JC 5IYBK 2VUMC 1I50C 3M4OC 3GDZA 4XCHA 2A69A 2P5MA 4BY7K 2B63K 1YX2A 4A3KK 4OINA 5M3MK 5IYDK 2V6TA 2R93C 4WJ4A 3FOFA 1GE9A 1PJ6A 1ZVUA 1INNA 4P9SA 2Y3PA 2NVYC 5IOTA 2GAHC 2E2HK 2NVQK 3S14C 2E2JC 1ZXOA 5C3EK 3H0GA 3S17C 4YFKA 5IOQA 1SFOC 3GTJA 3S1MK 3CQZK 1O26A 4GTEA 2JA8C 4KMDA 2GSOA 4A3JK 1I50K 1R9TC 4LQYA 4XLNA 1TWFK 4A93C 3SZYA 2GAGC 1O2FB 3OPFA 4KB4A 2ZUFA 4LOWA 4QIWD 1VH2A 3G4AA 3I4MC 1XXBA 4Y52C 1TWHK 3JSTA 1K83C 2ZUEA 3GTQK 1O27A 5IP7K 3WODA 3S1QK 3G4CA 1VGXA 3TTGA 2D6FC 4QJVA 4C3HC 2E2JK 1JQWA 3HKZL 3S17K 1XZPA 1J6XA 1J98A 2P8TA 4XLPA 4Q4ZA 3GTMK 2R92K 1USMA 2JA8K 2A6EA 3GTGA 4GTFA 1R9TK 2JH3A 4A3CC 1C0AA 1IE0A 1I3QC 3TFHA 3GTKC 1BDFA 4A93K 1F7VA 1VLOA 4BLAA 2CFAA 2FQTA 3HOZK 3AD8C 2E2IC 1EK8A 2JA7K 4BBRC 1EI6A 4YG2A 4BY1C 1WOSA 2PMZL 5IORA 1TWCC 2O5JA 3GEHA 2WB1L 1I6HK 3S2DK 4GZYA 2B63C 3V4GA 4KMAA 4A3MC 2EBBA 3ERED 1EFWA 1ZBSA 2WB1D 2A6HA 3FKIA 4MEYA 5L46A 1DCPA 3PO2K 3GTOA 3S15K 2E2HC 2NVTC 3L4KA 3GTKK 2NVQC 4M1XA 3S1NC 3I4NC 1ISEA 2NVXA 1J6WA 2V6SA 3LAJA 2E2IK 3S1RC
chains in the Genus database with same CATH topology
3HXAA 4C45A 1DCOA 2V6UA 1RU0A 4WILA 1USOA 2V6TA 1USMA 1DCHA 2EBBA 1F93A 1DCPA 3JSTA 2V6SA 4LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  4C45 A;  1DCO A;  2V6U A;  1RU0 A;  4WIL A;  1USO A;  2V6T A;  1USM A;  1DCH A;  2EBB A;  1F93 A;  1DCP A;  3JST A;  2V6S A;  4LOW A; 
#chains in the Genus database with same CATH topology
 3HOU K;  4PAA A;  2PA8 L;  3IPJ A;  1XXC A;  4KAR A;  3GTJ K;  1WCM A;  4AH6 A;  1YNN A;  1RU0 A;  1B4A A;  1TWC K;  5CHP A;  1TWF C;  4FM9 A;  4LJZ A;  4A3M K;  4BKW A;  5TMC A;  2W7V A;  1ZQ1 C;  4G0U A;  3GEE A;  1TWH C;  1TWA A;  2RGR A;  3K7A C;  3GTQ C;  3GTL A;  1F93 A;  5IP7 C;  1Y1W A;  1XZQ A;  1O28 A;  3SZZ A;  4A3F K;  3S1Q C;  4A3G K;  4QJV B;  3BUE A;  4YFX A;  2NVT K;  2KWA A;  3A8J A;  1XZP B;  3S1N K;  3GTP A;  3I4N K;  1PJ5 A;  4KM9 A;  3RZO C;  2JA6 A;  4G0W A;  4GTA A;  4A3L K;  3S1R K;  3GTM C;  1F9N A;  1O24 A;  4PAB A;  2R92 C;  1WOP A;  1UV7 A;  1O2A A;  1G51 A;  1WOO A;  4KMH A;  2CFA B;  3ADA C;  2YU9 C;  4BXX C;  2V6U A;  3HOZ C;  4GTC A;  1IW7 A;  2JA7 C;  3K7A K;  3PO3 C;  1WQF A;  2JA5 C;  1DCH A;  5IP9 K;  1TWG A;  4A3I K;  2GSN A;  4OIQ A;  2XCR B;  3ORE A;  2R7Z A;  4A3B C;  4RMF A;  1I6H C;  1WQG A;  5TMF A;  3S2D C;  3HOW K;  4OIR A;  3RZO K;  3FOE A;  1XXA A;  4X6A C;  3HKZ D;  4FZB A;  1L0W A;  3PO2 C;  4OIP A;  4MEX A;  3HOY C;  3S15 C;  5M5Y K;  3T00 A;  2RH6 A;  3FKI K;  4XSZ A;  1DCO A;  4JK1 A;  1Y1V A;  4G0V A;  1IS1 A;  3GTO K;  2YU9 K;  3NUH A;  4BXX K;  3S2H K;  2WAQ L;  4C3I K;  4A3D K;  2XCQ A;  1I50 A;  3HOU C;  2VUM A;  4Q5S A;  3EQL A;  3PO3 K;  1HQM A;  2JA5 K;  3H0G C;  1AB4 A;  3CAG A;  4C2M C;  2NVX K;  4LK1 A;  3GTJ C;  4G7O A;  3OEP A;  2R93 A;  4A3B K;  5C4X K;  2PMZ D;  3HOX C;  1WCM K;  4YFN A;  4X6A K;  1USO A;  2NVY A;  5IOS A;  3H3V L;  1XZQ B;  3HOY K;  3VA7 A;  4A3F C;  4A3G C;  3H3V D;  4MQ9 A;  3GEI A;  1SFO A;  3Q3Q A;  4GTD A;  1WSR A;  4GFQ A;  5C44 C;  1Y1W K;  4A3L C;  1R9T A;  4KDD A;  3H0G K;  4KC6 A;  4C2M K;  2PA8 D;  3S16 C;  1IL2 A;  5M3F K;  4C3J K;  5IYC C;  3HOV C;  4P5B A;  3GTG C;  3HOX K;  3N0C A;  1K83 A;  5FJ8 K;  4G7H A;  3N0B A;  2FQO A;  4GTB A;  4DDQ A;  4BLB A;  4O2D A;  3AD9 C;  5C4J K;  5JVO A;  5IP9 C;  2Y0S L;  3BP3 A;  4A3I C;  4KAT A;  4KB2 A;  1BS2 A;  2Y0S D;  1JVI A;  4KAS A;  3QX3 A;  3RZD C;  3HOW C;  5C44 K;  1WIH A;  1TWG K;  1PJ7 A;  1V5V A;  3A8I A;  1B4B A;  2R7Z K;  4BBS K;  1I3Q A;  3GTK A;  4WJ3 M;  2A68 A;  1WSV A;  2O5I A;  3S16 K;  1O25 A;  5IYC K;  4A3E K;  3HOV K;  3FKI C;  1J6V A;  3GTG K;  4J3N A;  2E2I A;  3HXA A;  3GTO C;  2PHC B;  3S2H C;  5M5X K;  4G7Z A;  4C3I C;  1Y1V K;  4A3D C;  1O2B A;  5M5W K;  2BE5 A;  1TWC A;  2NVX C;  5EGE A;  3LAP A;  2B63 A;  5EGH A;  2VUM K;  4GTL A;  3M4O K;  4Y7N C;  5C4X C;  4QIW L;  4XSX A;  1ZYR A;  3RZD K;  1WCM C;  1VJE A;  3N3Y A;  4KMU A;  3TFJ A;  1KQ4 A;  4C45 A;  2R93 K;  2E2H A;  3A8K A;  4WIL A;  4ILD A;  5E68 A;  3LPX A;  1I6V A;  1WQH A;  3T02 A;  2NVY K;  4ZH4 A;  1TWA C;  3CQZ A;  3GTL C;  1IBA A;  2ZFZ A;  4KM8 A;  3L4J A;  4KN4 A;  3S14 K;  1Y1W C;  5CJ9 A;  1EQR A;  3BP8 C;  1HI9 A;  2GSU A;  1SFO K;  1JOE A;  3GTP C;  3T01 A;  2WAQ D;  2JA6 C;  1TWF A;  1DD5 A;  4C3J C;  3AQP A;  4Y7N K;  1YCL A;  1TWH A;  3M3Y C;  3GTQ A;  3I4M K;  5FLM C;  4OIO A;  1YNJ A;  3MML B;  4P5A A;  4Y52 K;  5D4D A;  4LK0 A;  2CW0 A;  3AD7 C;  5C4J C;  1K83 K;  3FHZ A;  1O29 A;  5JFE A;  5IYB C;  1TWA K;  3AQO A;  1X31 C;  5TJ3 A;  3GTL K;  2PPB A;  3GTM A;  2R92 A;  3AH5 A;  1VRQ C;  4C3H K;  1TWG C;  4BY7 C;  1SMY A;  1F7U A;  5HL8 A;  3S0X A;  4A3K C;  4KN7 A;  4AYB L;  5IYD C;  3GTP K;  4KAW X;  3TFI A;  2R7Z C;  1BJT A;  4BBS C;  2JA6 K;  1IQ0 A;  4AYB D;  3GIR A;  1WOR A;  4A3E C;  2YU9 A;  4NOI A;  4LLG A;  4A3C K;  1I3Q K;  4LR2 A;  3GSI A;  2JA7 A;  3M3Y K;  5C3E C;  1EH1 A;  2XCO A;  2JA5 A;  1XPP A;  1BGW A;  1Y1V C;  4GT9 A;  3S1M C;  5FLM K;  3CQZ C;  3DXJ A;  4BBR K;  4BY1 K;  4A3J C;  5IYB K;  2VUM C;  1I50 C;  3M4O C;  3GDZ A;  4XCH A;  2A69 A;  2P5M A;  4BY7 K;  2B63 K;  1YX2 A;  4A3K K;  4OIN A;  5M3M K;  5IYD K;  2V6T A;  2R93 C;  4WJ4 A;  3FOF A;  1GE9 A;  1PJ6 A;  1ZVU A;  1INN A;  4P9S A;  2Y3P A;  2NVY C;  5IOT A;  2GAH C;  2E2H K;  2NVQ K;  3S14 C;  2E2J C;  1ZXO A;  5C3E K;  3H0G A;  3S17 C;  4YFK A;  5IOQ A;  1SFO C;  3GTJ A;  3S1M K;  3CQZ K;  1O26 A;  4GTE A;  2JA8 C;  4KMD A;  2GSO A;  4A3J K;  1I50 K;  1R9T C;  4LQY A;  4XLN A;  1TWF K;  4A93 C;  3SZY A;  2GAG C;  1O2F B;  3OPF A;  4KB4 A;  2ZUF A;  4LOW A;  4QIW D;  1VH2 A;  3G4A A;  3I4M C;  1XXB A;  4Y52 C;  1TWH K;  3JST A;  1K83 C;  2ZUE A;  3GTQ K;  1O27 A;  5IP7 K;  3WOD A;  3S1Q K;  3G4C A;  1VGX A;  3TTG A;  2D6F C;  4QJV A;  4C3H C;  2E2J K;  1JQW A;  3HKZ L;  3S17 K;  1XZP A;  1J6X A;  1J98 A;  2P8T A;  4XLP A;  4Q4Z A;  3GTM K;  2R92 K;  1USM A;  2JA8 K;  2A6E A;  3GTG A;  4GTF A;  1R9T K;  2JH3 A;  4A3C C;  1C0A A;  1IE0 A;  1I3Q C;  3TFH A;  3GTK C;  1BDF A;  4A93 K;  1F7V A;  1VLO A;  4BLA A;  2CFA A;  2FQT A;  3HOZ K;  3AD8 C;  2E2I C;  1EK8 A;  2JA7 K;  4BBR C;  1EI6 A;  4YG2 A;  4BY1 C;  1WOS A;  2PMZ L;  5IOR A;  1TWC C;  2O5J A;  3GEH A;  2WB1 L;  1I6H K;  3S2D K;  4GZY A;  2B63 C;  3V4G A;  4KMA A;  4A3M C;  2EBB A;  3ERE D;  1EFW A;  1ZBS A;  2WB1 D;  2A6H A;  3FKI A;  4MEY A;  5L46 A;  1DCP A;  3PO2 K;  3GTO A;  3S15 K;  2E2H C;  2NVT C;  3L4K A;  3GTK K;  2NVQ C;  4M1X A;  3S1N C;  3I4N C;  1ISE A;  2NVX A;  1J6W A;  2V6S A;  3LAJ A;  2E2I K;  3S1R C; 
#chains in the Genus database with same CATH homology
 3HXA A;  4C45 A;  1DCO A;  2V6U A;  1RU0 A;  4WIL A;  1USO A;  2V6T A;  1USM A;  1DCH A;  2EBB A;  1F93 A;  1DCP A;  3JST A;  2V6S A;  4LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...