2V6XA

Stractural insight into the interaction between escrt-iii and vps4
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
SHMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
total genus 34
structure length 82
sequence length 82
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6xA00
2LRLA 1WFDA 3ZSSA 2XZEA 4IT4A 3ZSTA 1WCRA 4U7IA 3K1SA 2WWVA 2V6XA 2CPTA 2CRBA 2JQKA 4NIQA 1YXRA 2LRKA 5FVKA 2V6YB 4WZXA 2W2UA 2MPKA 4P1NA 2A9UA 5LB7B 2JQ9A 5FVLA 2K3WA 2V6YA 4U33A 3EABA 2JQHA 4U7YA 4A5XA 4CN6A 2DL1A 2WY2A 4CN4A 2RPAA 5CJ5A 4U3CA 4CN1A 4U2YA 3ZT5A 4U2ZA 5CGMA 4U31A 3ZT6A 3ZT7A 4ZEYA 1WR0A
chains in the Genus database with same CATH superfamily
2LRLA 2L9QA 3HKCE 3N9MA 3R6NA 4PJNA 2PBIA 4YSZA 1W0AA 1WFDA 1X9BA 4I55E 4CQIA 3F57A 4YSYA 1U4QA 1D1CA 4YTMA 1JNRA 3TLSA 3ZSTA 4EEBA 3KDSE 3I1AA 5J2TE 2IMLA 4DUYT 2UU9T 2V6XA 4JI3T 1I6ZA 5HEOA 1LVFA 5FY7A 5HEHA 3AE5A 3CWZB 4NXMT 3RI5A 4ZI2D 4PJLA 5KMGP 2KINB 2P9BA 3AA7B 3F2EA 4IE0A 4P1NA 5JDMA 5JR9A 2JJ9A 1E1HB 2VVNA 2B1EA 3H3AA 2XQ4A 2QGSA 3I0QA 3LBXB 4H9RC 2JPFA 3ZMZB 1NAFA 5HXEA 1XMQT 4B3RT 2R6GF 2KXPB 5JTGA 4OFZA 3OJAA 5JDFA 1XNRT 3V5UA 5LA6E 1E2AA 3RKGA 4DV5T 3F31A 3FHNA 2CMRA 4U31A 3ZT7A 2QA7A 2BS3A 3QB5K 2LJLA 4F6RC 4DR2T 5F8PA 2WBLA 1FMVA 3AEFA 3UT5E 3ZPOA 1XMOT 3MKDA 3A8YC 4O4IE 3VHLA 2Y8DA 1VOMA 2JIWA 2BBJA 4ADZA 1KEYA 1W9RA 5HYAA 2VKJA 4PK6A 1QUUA 5ADXL 2IUBA 4DV6T 4ZS2A 2I59A 4X64T 3HKDE 4NPPA 1OEDE 2UXDT 5AQKB 5F3JA 3OBVE 3PUSA 2FUPA 1O3XA 5FVLA 1U5PA 2K3WA 3U78A 4QX8B 3EABA 1VCSA 2JQHA 2BS4A 2XQYA 3UU8A 3RH3A 3C51A 1NEKA 2D0UA 2J62A 3DP7A 3RYFE 1N36T 2CWOA 5HAXA 4QH1A 4WBOA 5CA0E 5KXJA 4CI3B 4IL9A 4O4JE 3P4WA 2XHEB 2V1DB 3MACA 4M1PA 4ZXLA 2Y48B 3R84B 3KV9A 4ZEYA 3RC8A 4HN9A 4ZOLE 4Q25A 4HFHA 1OWAA 1MNEA 1T72A 4QXHB 1FMWA 4U7IA 4H9QC 3EDUA 4YJ3E 4XBFB 5LMUT 5M4YA 4DMVA 4EZ4A 1IZNB 5LJMA 4UXNB 5LGUB 4ILBA 3LBXA 2C5IT 2W67A 3ZYLA 1HFAA 4HWFA 2YDQA 3CX8B 5JQGE 2OA5A 3UULA 1BR2A 3ZC0A 3RHWA 4QH4A 4DUZT 2UUAT 2JMKA 1HS7A 5H6QB 3ZJ2A 4EYYR 3WAJA 3LG7A 1S35A 2ACZA 4IREA 4CN6A 4K0KT 5FY1A 5JDGA 1MMDA 3I9WA 2YOEA 4ZI7E 4LF4T 3T8OA 3Q9DA 4KI0F 2CXFA 4HFCA 2MYSA 5HEGA 2WAUA 3C98B 1B7TA 2CM0A 2G0UA 2E8IA 2LKGA 3ESLA 4A98A 4ASKA 4CXYA 1DU2A 3CVRA 3ZYKA 3PTRB 3SS1A 3FZLB 2MBGA 3TKLB 2FJAA 5ABFB 5HXRA 5A1LA 4HWIB 2LM9A 2PJQA 3J9X1 2KWHA 2RA1A 3NWIA 4JUYA 3ABVA 2X9YA 2XM2A 4YSXA 1NWMX 3CX7B 5FKYA 5HWYA 2V7IA 2W63A 2XQ5A 3ETVA 5AQNB 3JCFA 2DHRA 4JYAT 3CQCB 5F5WA 3ZEFB 4CI1B 1T8BA 2A72A 4I4TE 1OEDC 1J5ET 3AEAA 4K0UA 1BR4A 2LKHA 2V5CA 3IA3A 2V6YA 4IDOA 1IAPA 1H7CA 3QNUA 4JI2T 4HWHA 4H63V 3M3ZB 3PUYF 4TX5A 3ANWA 3VRBA 5ABEA 4WW0A 4BJMA 3P7IA 2VQET 4KHZF 3OPCA 2XAQB 4TWDA 3AEGA 5FXZA 4LFCT 2L8KA 2LE8A 3LK3B 4DO0A 3P8CD 4ISTA 4UR9A 2Y6XA 4EGWA 5FL1A 2MAWA 4I50E 4MLKA 2WDQA 3LDQB 2A3DA 4TV9E 1HR0T 3SRZA 3K1SA 2MTQA 3PU8A 5DABA 3RYHE 3OTOT 5TAOA 4CXWA 4PNIA 1MMAA 3RIUA 2YKSA 1YKEB 2WMNA 4HTEA 1R8IA 3C50A 4MHCA 4KHPT 4TUYE 4AKRB 5EZYE 2DLRA 5HWXA 3MK7C 5LP6E 2A2FX 3FZMB 1MNDA 1UUSA 2ODUA 5HXCA 2CWYA 5L3BB 2IC9A 4QH5A 3UU3A 5CJ5A 2CHOA 4YT0A 1N33T 3AE9A 4V1Av 3CQXC 4X1KE 2LM2A 1XNQT 4EIWA 5JREA 5ABFA 2FJDA 2N2NA 3DJBA 2LEHA 3ZN1B 3GMIA 4COFA 4U74A 2WM9A 4ZZCA 4YHHT 1KNRA 3FBZA 4TWHA 1ZHCA 2HN1A 3O9XA 3KINB 2YK0A 5JDHA 3ONJA 3TLWA 2X0HA 3UUMA 4X65T 2ZMAA 4GK0E 4PJJA 4NIQA 4QHOA 3UQ4A 4H9OC 2V6YB 4IHJE 1YQ3A 2IIUA 4F8HA 5CA1E 4QWNB 2BDEA 1YD8G 2MPKA 2C5KT 2C5JA 2H7OA 2VASA 2W2UA 4PK4A 2H89A 3PUAA 3ZMUB 4WYVA 5AFUL 3ANWB 2UXCT 2E9XA 3RPUA 2IC6A 3EAMA 2E9XC 2LSJA 1Y01A 4DIDB 3AE6A 2CEAA 2RPAA 3BQLA 1OEDA 2V7KA 4UVAB 5JDNA 1QSDA 3L3PA 2LT3A 4IE6A 3P4SA 3HKEE 3ZT5A 5LHIB 5L3DB 2LHRA 5IWAT 2CCQA 3ZT6A 4DR1T 2WP9A 5BMVE 3N2GE 4EV6A 4LFBT 2CLYC 3W15B 2YDSA 1WLXA 4CZZB 3SWHA 4P0AA 2XQ6A 1IBLT 4OYJA 2VL8A 4XZCA 3AE1A 3EI0A 4HFVA 4Z91A 1WCRA 3E22E 3T1HT 1UURA 3PURA 1M62A 3OKQA 3UFGA 5AQQB 3EUHA 4JEUB 2YU2A 3RQWA 3TLVA 4E7ZA 5JH7E 3L39A 4LFAT 3N9LA 1KNPA 2CXLA 4EB6E 3NVOA 3RF1A 3VU7H 3AEEA 5AQIB 4OYKA 5LOVE 2I6HA 4GOUA 1N32T 2JQ9A 2XM1A 2EHOC 2H7VC 3KV5A 4ERRA 4U7YA 1ZP0A 2DCFA 5BR8T 2XUEA 2X0YA 2BG9C 1LKXA 3VRAA 1G8XA 4DBRA 2XQ8A 3UUNA 5CGMA 2I0MA 4DR4T 4C91A 4FJOA 4NUUA 4UV9B 3K3NA 1WR6A 1WR0A 2WU5A 4Z8XA 3RRWA 2WWUA 1MMGA 1Z0PA 4QX7B 2D0TA 2J1DG 4PW8A 2KLQA 2Q9QA 4TV8E 3UFEA 1XDPA 5ABHA 3AA1B 2X51A 1D0ZA 3IHRA 3B13A 2D2SA 3OVUA 3B5MA 4UF0A 5FY0A 3VR8A 4DBQA 4U72A 1UGOA 5KDMC 4LF7T 3ZCIA 5LBQB 4B3MT 2LRKA 2X68A 3ONLC 2E9XB 1HX8A 5FVKA 4ILAA 2BKOA 2MOZA 2X9XA 5HXHA 3O1HA 4X62T 1HNWT 2HPLA 1ZOYA 4HGAA 2YU1A 2LSIA 4HEAA 4DR3T 2HPJA 4LF8T 3RLFF 1OEDB 4U33A 5L3GB 2B76A 2V26A 3P4QA 2L3LA 5LBMA 2VVSA 3QK6A 4O2BE 3WI3A 4LF9T 4PJMA 4BA9A 3JADA 4HKAA 1YKHB 4CN1A 4YXDA 3A5XA 3MZKB 2BVMA 4JV5T 2FJBA 2NW7A 4KUMB 4X1IE 3C4ZA 2BKNA 2X9WA 3NBXX 5LHHB 4EZHA 5FL0A 4DR6T 3FZHB 2X9HA 4O2AE 3ZKRA 5LCYA 2Q9QD 2CXDA 2JQQA 2E9XD 3K8PC 2Q9QC 2RP4A 3O4XE 4ILCA 4LMJA 2DWGA 4UIGA 1J5WA 4NXNT 4IIJE 2NP9A 3CK6A 4H9NC 3AEDA 2ZM8A 2HN2A 3H3MA 4OHFA 2W4XA 1WYBA 3PUXF 1CHUA 3FBLA 4IDQA 5E0OA 5AQTB 3QC9A 3PUZF 3CQGB 2WZHA 3SFDA 5LG4A 2A9UA 3NZQA 2W00A 4H63H 5LB7B 5LMNT 4TNVA 2YDRA 3JC6D 1D1AA 2M67A 2WB5A 2XJ7A 5CB4E 5EK3A 4A56A 1HG2A 4CXXA 5LYJE 4B3ST 3AAEB 3Q5XA 2V8SV 3CX6B 3C4XA 2ZM2A 4PK5A 3RYCE 3GWHA 4LMKA 3IBPA 4BAYB 4ZZBA 5AQPB 3U3IA 2BVLA 4FI5A 5LG3A 4JI7T 4U2ZA 4Z90A 2J4GA 2Q9QB 3EHZA 4X5TA 2CBIA 2EHOD 1HF8A 1WRDA 4YTPA 2BZBA 5L4EA 3B57A 4UF0B 5L3EB 2NTXA 3GA8A 3MA9A 3N9NA 5L3CB 2GK9A 4YY3T 3FZFB 2DWKA 3HR0A 1SA0E 4H9SE 2WSSV 2V7LA 4IE5A 2NW9A 1D0YA 4DV2T 5AQMB 1MMNA 4ZS3A 3JAEA 5IUXA 4JI1T 1S94A 1YXRA 2VWAA 3Q2MA 1KFYA 2LOSA 2KT9A 2UXNB 3N9QA 3SOLA 3RX6A 2K5BB 4DV0T 1LVKA 5L4HA 2XSAA 2PFVA 5AQGB 2FJEA 3AECA 5DQVA 1X79A 4B3TT 2NTYA 4AQGA 1UCUA 2WMOA 4UV8B 3L8RA 5J0ZA 4JBWF 1W0BA 3PUVF 3OYXA 1IBKT 3FZKB 1OXZA 4CN4A 2HHHT 4L9IA 3AE8A 5JDQA 4JI4T 1XWMA 1CUNA 4NUVA 1JNZA 2IHR1 1V9DA 2K48A 4U2YA 3VR9A 2QVAA 1QLBA 3AB3B 2W62A 3BQIA 3PUQA 2XAGB 3RGLA 5EK2A 3S4UA 4N78D 1HCIA 2XQ7A 4KMCA 5HCMA 5J1GA 3FXEB 1SUMB 5FP3A 5JDLA 4TN7B 3TLTA 2NOXA 4O4HE 2W0GA 5LGNB 3N9PA 3VKHA 4TNWA 1GQEA 2UUCT 2W66A 3D0TA 3P50A 2LSKA 2JQKA 1N34T 2VKDA 5FMNA 4ZI2C 3UQ7A 2VURA 3AA0B 2WCAA 2XAJB 3AVSA 2X67A 2WZIA 3I9YA 3CPZA 2LHNA 2M6IA 4BJNA 4C90A 3LK2B 1XZYA 2OV9A 2YEVC 4HFBA 1ZEEA 1Z8UA 3KFWX 2M6BA 5AQJB 5ETWA 3RIAA 2WY2A 4QKNA 3VKGA 4UELA 4DNDA 1J1JA 1MIVA 4AKIA 4JLEA 1UX5A 2DI4A 2X66A 3UU4A 1BR1A 2K24A 4KX6A 5AQOB 3ZMTB 4AXPA 4OX9T 5IHYA 4GKJT 3ONXA 2KZ7B 3ZJ1A 2C0SA 3N2KE 4KP3C 4UVBB 3JC6C 1BR0A 3KVBA 3AE2A 5J2UE 2QYWA 4MALA 3HI2A 3UTKA 4WNKA 5IYZE 3AAIA 4HE8A 1ZKEA 5FNVE 4EYUA 1LRZA 4I43B 4ANJA 1HNXT 2WWVA 2AXDS 4AKHA 4EAHA 3A7MA 4DVDA 2PTFA 2VKHA 3O1JA 5AQHB 3V5SA 1D1BA 4IE7A 2XAFB 1FEWA 4I0UA 5LNKA 4X1YE 2VL0A 3RRCA 1D0XA 3ZYMA 4AKGA 1E7PA 2NW8A 4DV7T 5FXWA 4JI5T 3NRXA 3L09A 3AE3A 4L0RA 5C8YE 2OLTA 3DTOA 4G2AA 4A5XA 5JR9C 5DJQC 5LHGB 3TLUA 4E7SA 1HNZT 1FIOA 3CMLA 2X0LB 4X20E 4TZ4C 3UU5A 3HA4A 4AISA 1T7SA 2KSRA 2XASB 3AE4A 3IF8B 2V7JA 5ABGA 4G63A 4HWCA 2ZM6T 1IBMT 2W61A 2BS2A 1VCTA 3LJCA 4UEMA 5HCJA 5DQWA 3Q5WA 2WU2A 3ZSSA 4UVCB 1SHZC 1T98A 4PFPA 5CFBA 3AE7A 3UUXB 4JI0T 4YFSA 3J7Yq 2PG8A 1US7B 4AI6A 2ODVA 2J47A 4EEDA 2BKPA 2BBHA 4JEHB 2QRXA 4EXTA 3PV0F 3M65A 4HFDA 2CE7A 4MBQA 2LLYA 3PUGA 1HX1B 3ZN0B 4JI8T 2V7MA 3H37A 4DMWA 5L2LA 4YTNA 2UUBT 4YJ2E 3QOFA 2EHOA 2DL1A 2E5VA 3OYZA 4KBMB 3N5LA 2YINA 3QB5A 3HKBE 4IGUA 2CHNA 1FJGT 1KNZA 3GN5B 3NRYA 4H9PC 4ZI3D 4WZXA 3RC3A 1UX4A 3KBTA 3C4WA 2FBWA 3MXZA 4HFEA 2H3RA 5FYMA 4EOZB 4DV3T 4GKKT 4O4LE 4ZHQE 2XQ3A 2D5UA 4YHJA 3AAAB 4AKLA 4AIUA 3RIFA 5JRCB 4A97A 3I0OA 2XPKA 1XDOA 1MIWA 1SE7A 1KK7A 2XQAA 2N9DA 3QUJA 2XAHB 4GIWA 1VRBA 2WDRA 3P4RA 3ETUA 3AEBA 2AE9A 3PJAJ 3LSVA 4ISSA 1I94T 2F4VT 1Y64B 2N1GA 5AQLB 2WQYA 2KNDA 2XSBA 4IL4A 4GK5E 3K3QC 3CIRA 3EVYA 2JMHA 3KV4A 3BQKA 5FXXA 2WDVA 3MJXA 3PJAA 4LMLA 4QXCB 3UU6A 3UUBA 4B6XA 5C3JA 3IEEA 4J2CA 3E08A 4PFOA 3PU3A 2K9AA 3RKOA 2H88A 2UXBT 1G73A 2D9DA 4DR5T 4AQFC 5L47A 3RYIE 2CLYB 2SPCA 4GYRA 3ZC1A 3AA6B 4LF6T 2BG9A 5AQRB 3JAFA 5AQUB 3AVRA 4QXBB 1IJ5A 2NWBA 4TWFA 2LSYA 4IDPA 2VK9A 2DNXA 2LOPA 3AXJB 1W09A 4GYSA 5HXSA 3P4PA 2LSGA 3SFEA 1WYCA 2Z6EA 3LFMA 2IW5B 5AQSB 4JI6T 4XAXB 3G06A 1YW0A 3ZMSB 3FXDB 3PUWF 3RIUC 3PDYA 4PAGA 5LXTE 4DV4T 3O1IA 2EHOB 3KBUA 3KV6A 1HG5A 5FXVA 2VB6A 1M7KA 1ZV4X 4IE4A 3LK42 4L5GA 3ZMVB 1YQ4A 4ILUA 3GN5A 3CKDA 1UK5A 4P0BA 5LJNA 2VKOA 3BK9A 5H6RB 5JR9B 3N9OA 3NZPA 2HH7A 4U3CA 2CBJA 2ZLYA 5AQFB 1EZ3A 2KMFA 3Q5EA 1AJ3A 4AQFA 5LGTB 3T1YT 3PE0A 2IDOB 4P09A 4DR7T 5JRCA 2E2AA 3KVAA 2YN6A 2XY8B 2ACXA 2V5DA 3EDVA 1HTJF 3N2OA 3NKZA 3E0ZA 2XZEA 4IT4A 2IAKA 4MFRA 2XQ9A 2WS3A 1L0VA 4DV1T 5HEJA 4HWDA 4OK0A 2VQFT 4ZI3C 5GONE 2CPTA 2CRBA 4WBNE 2E5LT 4LF5T 4YLHA 5L3FB 5JVDE 2ES0A 3FB2A 4AQYT 5C2TA 2ZM0A 5EK4A 4HFIA 4X66T 5KX5E 3K3OA 3ZLIA 1NENA 2BG9E 4CI2B 4IDZA 3RQUA 4IDNA 2UXXB 2BG9B 2XTLA 5HEUA 2NR4A 3X1DA 5AQVB 1MIYA 2CA5A 1IJ6A 3Q5DA 3WAKA 3HL6A 3ZCJA 3AXJA 3C64A 2JRKA 2KWIB 1KF6A 4O8SA
chains in the Genus database with same CATH topology
2LRLA 1WFDA 3ZSSA 2XZEA 4IT4A 3ZSTA 1WCRA 4U7IA 3K1SA 2WWVA 2V6XA 2CPTA 2CRBA 2JQKA 4NIQA 1YXRA 2LRKA 5FVKA 2V6YB 4WZXA 2W2UA 2MPKA 4P1NA 2A9UA 5LB7B 2JQ9A 5FVLA 2K3WA 2V6YA 4U33A 3EABA 2JQHA 4U7YA 4A5XA 4CN6A 2DL1A 2WY2A 4CN4A 2RPAA 5CJ5A 4U3CA 4CN1A 4U2YA 3ZT5A 4U2ZA 5CGMA 4U31A 3ZT6A 3ZT7A 4ZEYA 1WR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRL A;  1WFD A;  3ZSS A;  2XZE A;  4IT4 A;  3ZST A;  1WCR A;  4U7I A;  3K1S A;  2WWV A;  2V6X A;  2CPT A;  2CRB A;  2JQK A;  4NIQ A;  1YXR A;  2LRK A;  5FVK A;  2V6Y B;  4WZX A;  2W2U A;  2MPK A;  4P1N A;  2A9U A;  5LB7 B;  2JQ9 A;  5FVL A;  2K3W A;  2V6Y A;  4U33 A;  3EAB A;  2JQH A;  4U7Y A;  4A5X A;  4CN6 A;  2DL1 A;  2WY2 A;  4CN4 A;  2RPA A;  5CJ5 A;  4U3C A;  4CN1 A;  4U2Y A;  3ZT5 A;  4U2Z A;  5CGM A;  4U31 A;  3ZT6 A;  3ZT7 A;  4ZEY A;  1WR0 A; 
#chains in the Genus database with same CATH topology
 2LRL A;  2L9Q A;  3HKC E;  3N9M A;  3R6N A;  4PJN A;  2PBI A;  4YSZ A;  1W0A A;  1WFD A;  1X9B A;  4I55 E;  4CQI A;  3F57 A;  4YSY A;  1U4Q A;  1D1C A;  4YTM A;  1JNR A;  3TLS A;  3ZST A;  4EEB A;  3KDS E;  3I1A A;  5J2T E;  2IML A;  4DUY T;  2UU9 T;  2V6X A;  4JI3 T;  1I6Z A;  5HEO A;  1LVF A;  5FY7 A;  5HEH A;  3AE5 A;  3CWZ B;  4NXM T;  3RI5 A;  4ZI2 D;  4PJL A;  5KMG P;  2KIN B;  2P9B A;  3AA7 B;  3F2E A;  4IE0 A;  4P1N A;  5JDM A;  5JR9 A;  2JJ9 A;  1E1H B;  2VVN A;  2B1E A;  3H3A A;  2XQ4 A;  2QGS A;  3I0Q A;  3LBX B;  4H9R C;  2JPF A;  3ZMZ B;  1NAF A;  5HXE A;  1XMQ T;  4B3R T;  2R6G F;  2KXP B;  5JTG A;  4OFZ A;  3OJA A;  5JDF A;  1XNR T;  3V5U A;  5LA6 E;  1E2A A;  3RKG A;  4DV5 T;  3F31 A;  3FHN A;  2CMR A;  4U31 A;  3ZT7 A;  2QA7 A;  2BS3 A;  3QB5 K;  2LJL A;  4F6R C;  4DR2 T;  5F8P A;  2WBL A;  1FMV A;  3AEF A;  3UT5 E;  3ZPO A;  1XMO T;  3MKD A;  3A8Y C;  4O4I E;  3VHL A;  2Y8D A;  1VOM A;  2JIW A;  2BBJ A;  4ADZ A;  1KEY A;  1W9R A;  5HYA A;  2VKJ A;  4PK6 A;  1QUU A;  5ADX L;  2IUB A;  4DV6 T;  4ZS2 A;  2I59 A;  4X64 T;  3HKD E;  4NPP A;  1OED E;  2UXD T;  5AQK B;  5F3J A;  3OBV E;  3PUS A;  2FUP A;  1O3X A;  5FVL A;  1U5P A;  2K3W A;  3U78 A;  4QX8 B;  3EAB A;  1VCS A;  2JQH A;  2BS4 A;  2XQY A;  3UU8 A;  3RH3 A;  3C51 A;  1NEK A;  2D0U A;  2J62 A;  3DP7 A;  3RYF E;  1N36 T;  2CWO A;  5HAX A;  4QH1 A;  4WBO A;  5CA0 E;  5KXJ A;  4CI3 B;  4IL9 A;  4O4J E;  3P4W A;  2XHE B;  2V1D B;  3MAC A;  4M1P A;  4ZXL A;  2Y48 B;  3R84 B;  3KV9 A;  4ZEY A;  3RC8 A;  4HN9 A;  4ZOL E;  4Q25 A;  4HFH A;  1OWA A;  1MNE A;  1T72 A;  4QXH B;  1FMW A;  4U7I A;  4H9Q C;  3EDU A;  4YJ3 E;  4XBF B;  5LMU T;  5M4Y A;  4DMV A;  4EZ4 A;  1IZN B;  5LJM A;  4UXN B;  5LGU B;  4ILB A;  3LBX A;  2C5I T;  2W67 A;  3ZYL A;  1HFA A;  4HWF A;  2YDQ A;  3CX8 B;  5JQG E;  2OA5 A;  3UUL A;  1BR2 A;  3ZC0 A;  3RHW A;  4QH4 A;  4DUZ T;  2UUA T;  2JMK A;  1HS7 A;  5H6Q B;  3ZJ2 A;  4EYY R;  3WAJ A;  3LG7 A;  1S35 A;  2ACZ A;  4IRE A;  4CN6 A;  4K0K T;  5FY1 A;  5JDG A;  1MMD A;  3I9W A;  2YOE A;  4ZI7 E;  4LF4 T;  3T8O A;  3Q9D A;  4KI0 F;  2CXF A;  4HFC A;  2MYS A;  5HEG A;  2WAU A;  3C98 B;  1B7T A;  2CM0 A;  2G0U A;  2E8I A;  2LKG A;  3ESL A;  4A98 A;  4ASK A;  4CXY A;  1DU2 A;  3CVR A;  3ZYK A;  3PTR B;  3SS1 A;  3FZL B;  2MBG A;  3TKL B;  2FJA A;  5ABF B;  5HXR A;  5A1L A;  4HWI B;  2LM9 A;  2PJQ A;  3J9X 1;  2KWH A;  2RA1 A;  3NWI A;  4JUY A;  3ABV A;  2X9Y A;  2XM2 A;  4YSX A;  1NWM X;  3CX7 B;  5FKY A;  5HWY A;  2V7I A;  2W63 A;  2XQ5 A;  3ETV A;  5AQN B;  3JCF A;  2DHR A;  4JYA T;  3CQC B;  5F5W A;  3ZEF B;  4CI1 B;  1T8B A;  2A72 A;  4I4T E;  1OED C;  1J5E T;  3AEA A;  4K0U A;  1BR4 A;  2LKH A;  2V5C A;  3IA3 A;  2V6Y A;  4IDO A;  1IAP A;  1H7C A;  3QNU A;  4JI2 T;  4HWH A;  4H63 V;  3M3Z B;  3PUY F;  4TX5 A;  3ANW A;  3VRB A;  5ABE A;  4WW0 A;  4BJM A;  3P7I A;  2VQE T;  4KHZ F;  3OPC A;  2XAQ B;  4TWD A;  3AEG A;  5FXZ A;  4LFC T;  2L8K A;  2LE8 A;  3LK3 B;  4DO0 A;  3P8C D;  4IST A;  4UR9 A;  2Y6X A;  4EGW A;  5FL1 A;  2MAW A;  4I50 E;  4MLK A;  2WDQ A;  3LDQ B;  2A3D A;  4TV9 E;  1HR0 T;  3SRZ A;  3K1S A;  2MTQ A;  3PU8 A;  5DAB A;  3RYH E;  3OTO T;  5TAO A;  4CXW A;  4PNI A;  1MMA A;  3RIU A;  2YKS A;  1YKE B;  2WMN A;  4HTE A;  1R8I A;  3C50 A;  4MHC A;  4KHP T;  4TUY E;  4AKR B;  5EZY E;  2DLR A;  5HWX A;  3MK7 C;  5LP6 E;  2A2F X;  3FZM B;  1MND A;  1UUS A;  2ODU A;  5HXC A;  2CWY A;  5L3B B;  2IC9 A;  4QH5 A;  3UU3 A;  5CJ5 A;  2CHO A;  4YT0 A;  1N33 T;  3AE9 A;  4V1A v;  3CQX C;  4X1K E;  2LM2 A;  1XNQ T;  4EIW A;  5JRE A;  5ABF A;  2FJD A;  2N2N A;  3DJB A;  2LEH A;  3ZN1 B;  3GMI A;  4COF A;  4U74 A;  2WM9 A;  4ZZC A;  4YHH T;  1KNR A;  3FBZ A;  4TWH A;  1ZHC A;  2HN1 A;  3O9X A;  3KIN B;  2YK0 A;  5JDH A;  3ONJ A;  3TLW A;  2X0H A;  3UUM A;  4X65 T;  2ZMA A;  4GK0 E;  4PJJ A;  4NIQ A;  4QHO A;  3UQ4 A;  4H9O C;  2V6Y B;  4IHJ E;  1YQ3 A;  2IIU A;  4F8H A;  5CA1 E;  4QWN B;  2BDE A;  1YD8 G;  2MPK A;  2C5K T;  2C5J A;  2H7O A;  2VAS A;  2W2U A;  4PK4 A;  2H89 A;  3PUA A;  3ZMU B;  4WYV A;  5AFU L;  3ANW B;  2UXC T;  2E9X A;  3RPU A;  2IC6 A;  3EAM A;  2E9X C;  2LSJ A;  1Y01 A;  4DID B;  3AE6 A;  2CEA A;  2RPA A;  3BQL A;  1OED A;  2V7K A;  4UVA B;  5JDN A;  1QSD A;  3L3P A;  2LT3 A;  4IE6 A;  3P4S A;  3HKE E;  3ZT5 A;  5LHI B;  5L3D B;  2LHR A;  5IWA T;  2CCQ A;  3ZT6 A;  4DR1 T;  2WP9 A;  5BMV E;  3N2G E;  4EV6 A;  4LFB T;  2CLY C;  3W15 B;  2YDS A;  1WLX A;  4CZZ B;  3SWH A;  4P0A A;  2XQ6 A;  1IBL T;  4OYJ A;  2VL8 A;  4XZC A;  3AE1 A;  3EI0 A;  4HFV A;  4Z91 A;  1WCR A;  3E22 E;  3T1H T;  1UUR A;  3PUR A;  1M62 A;  3OKQ A;  3UFG A;  5AQQ B;  3EUH A;  4JEU B;  2YU2 A;  3RQW A;  3TLV A;  4E7Z A;  5JH7 E;  3L39 A;  4LFA T;  3N9L A;  1KNP A;  2CXL A;  4EB6 E;  3NVO A;  3RF1 A;  3VU7 H;  3AEE A;  5AQI B;  4OYK A;  5LOV E;  2I6H A;  4GOU A;  1N32 T;  2JQ9 A;  2XM1 A;  2EHO C;  2H7V C;  3KV5 A;  4ERR A;  4U7Y A;  1ZP0 A;  2DCF A;  5BR8 T;  2XUE A;  2X0Y A;  2BG9 C;  1LKX A;  3VRA A;  1G8X A;  4DBR A;  2XQ8 A;  3UUN A;  5CGM A;  2I0M A;  4DR4 T;  4C91 A;  4FJO A;  4NUU A;  4UV9 B;  3K3N A;  1WR6 A;  1WR0 A;  2WU5 A;  4Z8X A;  3RRW A;  2WWU A;  1MMG A;  1Z0P A;  4QX7 B;  2D0T A;  2J1D G;  4PW8 A;  2KLQ A;  2Q9Q A;  4TV8 E;  3UFE A;  1XDP A;  5ABH A;  3AA1 B;  2X51 A;  1D0Z A;  3IHR A;  3B13 A;  2D2S A;  3OVU A;  3B5M A;  4UF0 A;  5FY0 A;  3VR8 A;  4DBQ A;  4U72 A;  1UGO A;  5KDM C;  4LF7 T;  3ZCI A;  5LBQ B;  4B3M T;  2LRK A;  2X68 A;  3ONL C;  2E9X B;  1HX8 A;  5FVK A;  4ILA A;  2BKO A;  2MOZ A;  2X9X A;  5HXH A;  3O1H A;  4X62 T;  1HNW T;  2HPL A;  1ZOY A;  4HGA A;  2YU1 A;  2LSI A;  4HEA A;  4DR3 T;  2HPJ A;  4LF8 T;  3RLF F;  1OED B;  4U33 A;  5L3G B;  2B76 A;  2V26 A;  3P4Q A;  2L3L A;  5LBM A;  2VVS A;  3QK6 A;  4O2B E;  3WI3 A;  4LF9 T;  4PJM A;  4BA9 A;  3JAD A;  4HKA A;  1YKH B;  4CN1 A;  4YXD A;  3A5X A;  3MZK B;  2BVM A;  4JV5 T;  2FJB A;  2NW7 A;  4KUM B;  4X1I E;  3C4Z A;  2BKN A;  2X9W A;  3NBX X;  5LHH B;  4EZH A;  5FL0 A;  4DR6 T;  3FZH B;  2X9H A;  4O2A E;  3ZKR A;  5LCY A;  2Q9Q D;  2CXD A;  2JQQ A;  2E9X D;  3K8P C;  2Q9Q C;  2RP4 A;  3O4X E;  4ILC A;  4LMJ A;  2DWG A;  4UIG A;  1J5W A;  4NXN T;  4IIJ E;  2NP9 A;  3CK6 A;  4H9N C;  3AED A;  2ZM8 A;  2HN2 A;  3H3M A;  4OHF A;  2W4X A;  1WYB A;  3PUX F;  1CHU A;  3FBL A;  4IDQ A;  5E0O A;  5AQT B;  3QC9 A;  3PUZ F;  3CQG B;  2WZH A;  3SFD A;  5LG4 A;  2A9U A;  3NZQ A;  2W00 A;  4H63 H;  5LB7 B;  5LMN T;  4TNV A;  2YDR A;  3JC6 D;  1D1A A;  2M67 A;  2WB5 A;  2XJ7 A;  5CB4 E;  5EK3 A;  4A56 A;  1HG2 A;  4CXX A;  5LYJ E;  4B3S T;  3AAE B;  3Q5X A;  2V8S V;  3CX6 B;  3C4X A;  2ZM2 A;  4PK5 A;  3RYC E;  3GWH A;  4LMK A;  3IBP A;  4BAY B;  4ZZB A;  5AQP B;  3U3I A;  2BVL A;  4FI5 A;  5LG3 A;  4JI7 T;  4U2Z A;  4Z90 A;  2J4G A;  2Q9Q B;  3EHZ A;  4X5T A;  2CBI A;  2EHO D;  1HF8 A;  1WRD A;  4YTP A;  2BZB A;  5L4E A;  3B57 A;  4UF0 B;  5L3E B;  2NTX A;  3GA8 A;  3MA9 A;  3N9N A;  5L3C B;  2GK9 A;  4YY3 T;  3FZF B;  2DWK A;  3HR0 A;  1SA0 E;  4H9S E;  2WSS V;  2V7L A;  4IE5 A;  2NW9 A;  1D0Y A;  4DV2 T;  5AQM B;  1MMN A;  4ZS3 A;  3JAE A;  5IUX A;  4JI1 T;  1S94 A;  1YXR A;  2VWA A;  3Q2M A;  1KFY A;  2LOS A;  2KT9 A;  2UXN B;  3N9Q A;  3SOL A;  3RX6 A;  2K5B B;  4DV0 T;  1LVK A;  5L4H A;  2XSA A;  2PFV A;  5AQG B;  2FJE A;  3AEC A;  5DQV A;  1X79 A;  4B3T T;  2NTY A;  4AQG A;  1UCU A;  2WMO A;  4UV8 B;  3L8R A;  5J0Z A;  4JBW F;  1W0B A;  3PUV F;  3OYX A;  1IBK T;  3FZK B;  1OXZ A;  4CN4 A;  2HHH T;  4L9I A;  3AE8 A;  5JDQ A;  4JI4 T;  1XWM A;  1CUN A;  4NUV A;  1JNZ A;  2IHR 1;  1V9D A;  2K48 A;  4U2Y A;  3VR9 A;  2QVA A;  1QLB A;  3AB3 B;  2W62 A;  3BQI A;  3PUQ A;  2XAG B;  3RGL A;  5EK2 A;  3S4U A;  4N78 D;  1HCI A;  2XQ7 A;  4KMC A;  5HCM A;  5J1G A;  3FXE B;  1SUM B;  5FP3 A;  5JDL A;  4TN7 B;  3TLT A;  2NOX A;  4O4H E;  2W0G A;  5LGN B;  3N9P A;  3VKH A;  4TNW A;  1GQE A;  2UUC T;  2W66 A;  3D0T A;  3P50 A;  2LSK A;  2JQK A;  1N34 T;  2VKD A;  5FMN A;  4ZI2 C;  3UQ7 A;  2VUR A;  3AA0 B;  2WCA A;  2XAJ B;  3AVS A;  2X67 A;  2WZI A;  3I9Y A;  3CPZ A;  2LHN A;  2M6I A;  4BJN A;  4C90 A;  3LK2 B;  1XZY A;  2OV9 A;  2YEV C;  4HFB A;  1ZEE A;  1Z8U A;  3KFW X;  2M6B A;  5AQJ B;  5ETW A;  3RIA A;  2WY2 A;  4QKN A;  3VKG A;  4UEL A;  4DND A;  1J1J A;  1MIV A;  4AKI A;  4JLE A;  1UX5 A;  2DI4 A;  2X66 A;  3UU4 A;  1BR1 A;  2K24 A;  4KX6 A;  5AQO B;  3ZMT B;  4AXP A;  4OX9 T;  5IHY A;  4GKJ T;  3ONX A;  2KZ7 B;  3ZJ1 A;  2C0S A;  3N2K E;  4KP3 C;  4UVB B;  3JC6 C;  1BR0 A;  3KVB A;  3AE2 A;  5J2U E;  2QYW A;  4MAL A;  3HI2 A;  3UTK A;  4WNK A;  5IYZ E;  3AAI A;  4HE8 A;  1ZKE A;  5FNV E;  4EYU A;  1LRZ A;  4I43 B;  4ANJ A;  1HNX T;  2WWV A;  2AXD S;  4AKH A;  4EAH A;  3A7M A;  4DVD A;  2PTF A;  2VKH A;  3O1J A;  5AQH B;  3V5S A;  1D1B A;  4IE7 A;  2XAF B;  1FEW A;  4I0U A;  5LNK A;  4X1Y E;  2VL0 A;  3RRC A;  1D0X A;  3ZYM A;  4AKG A;  1E7P A;  2NW8 A;  4DV7 T;  5FXW A;  4JI5 T;  3NRX A;  3L09 A;  3AE3 A;  4L0R A;  5C8Y E;  2OLT A;  3DTO A;  4G2A A;  4A5X A;  5JR9 C;  5DJQ C;  5LHG B;  3TLU A;  4E7S A;  1HNZ T;  1FIO A;  3CML A;  2X0L B;  4X20 E;  4TZ4 C;  3UU5 A;  3HA4 A;  4AIS A;  1T7S A;  2KSR A;  2XAS B;  3AE4 A;  3IF8 B;  2V7J A;  5ABG A;  4G63 A;  4HWC A;  2ZM6 T;  1IBM T;  2W61 A;  2BS2 A;  1VCT A;  3LJC A;  4UEM A;  5HCJ A;  5DQW A;  3Q5W A;  2WU2 A;  3ZSS A;  4UVC B;  1SHZ C;  1T98 A;  4PFP A;  5CFB A;  3AE7 A;  3UUX B;  4JI0 T;  4YFS A;  3J7Y q;  2PG8 A;  1US7 B;  4AI6 A;  2ODV A;  2J47 A;  4EED A;  2BKP A;  2BBH A;  4JEH B;  2QRX A;  4EXT A;  3PV0 F;  3M65 A;  4HFD A;  2CE7 A;  4MBQ A;  2LLY A;  3PUG A;  1HX1 B;  3ZN0 B;  4JI8 T;  2V7M A;  3H37 A;  4DMW A;  5L2L A;  4YTN A;  2UUB T;  4YJ2 E;  3QOF A;  2EHO A;  2DL1 A;  2E5V A;  3OYZ A;  4KBM B;  3N5L A;  2YIN A;  3QB5 A;  3HKB E;  4IGU A;  2CHN A;  1FJG T;  1KNZ A;  3GN5 B;  3NRY A;  4H9P C;  4ZI3 D;  4WZX A;  3RC3 A;  1UX4 A;  3KBT A;  3C4W A;  2FBW A;  3MXZ A;  4HFE A;  2H3R A;  5FYM A;  4EOZ B;  4DV3 T;  4GKK T;  4O4L E;  4ZHQ E;  2XQ3 A;  2D5U A;  4YHJ A;  3AAA B;  4AKL A;  4AIU A;  3RIF A;  5JRC B;  4A97 A;  3I0O A;  2XPK A;  1XDO A;  1MIW A;  1SE7 A;  1KK7 A;  2XQA A;  2N9D A;  3QUJ A;  2XAH B;  4GIW A;  1VRB A;  2WDR A;  3P4R A;  3ETU A;  3AEB A;  2AE9 A;  3PJA J;  3LSV A;  4ISS A;  1I94 T;  2F4V T;  1Y64 B;  2N1G A;  5AQL B;  2WQY A;  2KND A;  2XSB A;  4IL4 A;  4GK5 E;  3K3Q C;  3CIR A;  3EVY A;  2JMH A;  3KV4 A;  3BQK A;  5FXX A;  2WDV A;  3MJX A;  3PJA A;  4LML A;  4QXC B;  3UU6 A;  3UUB A;  4B6X A;  5C3J A;  3IEE A;  4J2C A;  3E08 A;  4PFO A;  3PU3 A;  2K9A A;  3RKO A;  2H88 A;  2UXB T;  1G73 A;  2D9D A;  4DR5 T;  4AQF C;  5L47 A;  3RYI E;  2CLY B;  2SPC A;  4GYR A;  3ZC1 A;  3AA6 B;  4LF6 T;  2BG9 A;  5AQR B;  3JAF A;  5AQU B;  3AVR A;  4QXB B;  1IJ5 A;  2NWB A;  4TWF A;  2LSY A;  4IDP A;  2VK9 A;  2DNX A;  2LOP A;  3AXJ B;  1W09 A;  4GYS A;  5HXS A;  3P4P A;  2LSG A;  3SFE A;  1WYC A;  2Z6E A;  3LFM A;  2IW5 B;  5AQS B;  4JI6 T;  4XAX B;  3G06 A;  1YW0 A;  3ZMS B;  3FXD B;  3PUW F;  3RIU C;  3PDY A;  4PAG A;  5LXT E;  4DV4 T;  3O1I A;  2EHO B;  3KBU A;  3KV6 A;  1HG5 A;  5FXV A;  2VB6 A;  1M7K A;  1ZV4 X;  4IE4 A;  3LK4 2;  4L5G A;  3ZMV B;  1YQ4 A;  4ILU A;  3GN5 A;  3CKD A;  1UK5 A;  4P0B A;  5LJN A;  2VKO A;  3BK9 A;  5H6R B;  5JR9 B;  3N9O A;  3NZP A;  2HH7 A;  4U3C A;  2CBJ A;  2ZLY A;  5AQF B;  1EZ3 A;  2KMF A;  3Q5E A;  1AJ3 A;  4AQF A;  5LGT B;  3T1Y T;  3PE0 A;  2IDO B;  4P09 A;  4DR7 T;  5JRC A;  2E2A A;  3KVA A;  2YN6 A;  2XY8 B;  2ACX A;  2V5D A;  3EDV A;  1HTJ F;  3N2O A;  3NKZ A;  3E0Z A;  2XZE A;  4IT4 A;  2IAK A;  4MFR A;  2XQ9 A;  2WS3 A;  1L0V A;  4DV1 T;  5HEJ A;  4HWD A;  4OK0 A;  2VQF T;  4ZI3 C;  5GON E;  2CPT A;  2CRB A;  4WBN E;  2E5L T;  4LF5 T;  4YLH A;  5L3F B;  5JVD E;  2ES0 A;  3FB2 A;  4AQY T;  5C2T A;  2ZM0 A;  5EK4 A;  4HFI A;  4X66 T;  5KX5 E;  3K3O A;  3ZLI A;  1NEN A;  2BG9 E;  4CI2 B;  4IDZ A;  3RQU A;  4IDN A;  2UXX B;  2BG9 B;  2XTL A;  5HEU A;  2NR4 A;  3X1D A;  5AQV B;  1MIY A;  2CA5 A;  1IJ6 A;  3Q5D A;  3WAK A;  3HL6 A;  3ZCJ A;  3AXJ A;  3C64 A;  2JRK A;  2KWI B;  1KF6 A;  4O8S A; 
#chains in the Genus database with same CATH homology
 2LRL A;  1WFD A;  3ZSS A;  2XZE A;  4IT4 A;  3ZST A;  1WCR A;  4U7I A;  3K1S A;  2WWV A;  2V6X A;  2CPT A;  2CRB A;  2JQK A;  4NIQ A;  1YXR A;  2LRK A;  5FVK A;  2V6Y B;  4WZX A;  2W2U A;  2MPK A;  4P1N A;  2A9U A;  5LB7 B;  2JQ9 A;  5FVL A;  2K3W A;  2V6Y A;  4U33 A;  3EAB A;  2JQH A;  4U7Y A;  4A5X A;  4CN6 A;  2DL1 A;  2WY2 A;  4CN4 A;  2RPA A;  5CJ5 A;  4U3C A;  4CN1 A;  4U2Y A;  3ZT5 A;  4U2Z A;  5CGM A;  4U31 A;  3ZT6 A;  3ZT7 A;  4ZEY A;  1WR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...