2V6XA

Stractural insight into the interaction between escrt-iii and vps4
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
b'SHMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
total genus 34
structure length 82
sequence length 82
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6xA00
1WR0A 3ZSTA 2RPAA 4U33A 4WZXA 4A5XA 4P1NA 4CN1A 3ZT5A 2WWVA 2CPTA 3EABA 4U31A 5LB7B 4CN6A 4U2YA 2W2UA 5FVKA 3ZSSA 1YXRA 2V6YA 4IT4A 4U2ZA 3K1SA 2MPKA 2V6XA 2JQKA 2CRBA 4U7IA 4U7YA 2LRKA 2JQ9A 5FVLA 5CJ5A 1WCRA 3ZT7A 2A9UA 1WFDA 5CGMA 2XZEA 2WY2A 2V6YB 4ZEYA 3ZT6A 2DL1A 4CN4A 4NIQA 2K3WA 2JQHA 4U3CA 2LRLA
chains in the Genus database with same CATH superfamily
3AA0B 5AQRB 3SOLA 1M62A 3B5MA 4M1PA 2KINB 5EZYE 5ABEA 2WWVA 2WS3A 4UF0B 3PUQA 2WU5A 1Z0PA 4MLKA 5DABA 3AEEA 5JVDE 5ADXL 4OYKA 5M4YA 4DV5T 4GYSA 2CMRA 5AQHB 5AQNB 2BZBA 1IBLT 2JQQA 3QB5K 4JYAT 2WM9A 2YKSA 2WMNA 5DJQC 4ZI3C 1D0XA 3CQGB 3IBPA 5FL0A 4AQFA 4X65T 2C5KT 1X9BA 2MPKA 4I50E 2JQKA 4QHOA 2LRKA 3RH3A 4AKHA 1W0BA 1IBKT 2FJDA 1HCIA 5J1GA 5HXCA 5EK4A 2XZEA 2K9AA 5HAXA 2W67A 3RC3A 2QA7A 4TWDA 4EOZB 5L3GB 4PJMA 5LG3A 4PJNA 1LVKA 2VURA 4HTEA 3VRAA 3ZJ1A 4YSZA 5LXTE 3KV5A 3RC8A 3IEEA 4YHHT 2NW7A 1D1CA 4Z8XA 4A5XA 3U3IA 3ETUA 4DO0A 2ACZA 1UUSA 1G73A 2IMLA 2CPTA 3O4XE 3MXZA 4PK4A 5AQOB 4CN6A 5HXSA 3AA6B 5JREA 4LF5T 2KMFA 2QRXA 4UIGA 5IYZE 3S4UA 5LHGB 2X9WA 2C5JA 2B1EA 5F8PA 1OEDB 1ZV4X 2WCAA 5E0OA 2DLRA 3KINB 4YSXA 3JADA 5FNVE 3UU6A 4CXXA 1N34T 4HEAA 4CI2B 3NVOA 5ABFA 2DHRA 4EXTA 1OEDC 3FXEB 3D0TA 1XMQT 3JC6C 5A1LA 2NP9A 3PV0F 2J4GA 2W63A 3E08A 3K3OA 3LBXB 3PUVF 3NZPA 3MK7C 2XQ4A 3QOFA 4UELA 3UU3A 4DR6T 5JRCB 3Q5XA 5DQVA 4AXPA 4MHCA 4PJJA 1D1BA 4UVCB 3RYCE 3UQ4A 4DBQA 3V5SA 2LHRA 3AE2A 3J9X1 3ZEFB 4B6XA 2Q9QA 5AQGB 4ZI2D 3RYIE 3R84B 3P4WA 2YU1A 5KMGP 4TN7B 3AEFA 5CFBA 4V1Av 4JI1T 2JIWA 2X9HA 3CX6B 1MNDA 1BR1A 2WZHA 2BKPA 4TWFA 4AQFC 1N36T 2BS3A 1J1JA 3LJCA 4IDQA 3ZN0B 3T1YT 1O3XA 1S35A 2NOXA 3BK9A 3P4RA 4HFDA 2MAWA 3UUXB 3PE0A 1N33T 2V6YA 3PUGA 2UUBT 1UGOA 1MIYA 3LBXA 5HCMA 5HWYA 4ZI7E 5JDHA 2ZM6T 3FZMB 3Q5EA 3MJXA 5EK2A 2YDQA 4BA9A 5HEHA 4ANJA 2A9UA 2WSSV 2FBWA 2X68A 3G06A 3QNUA 2XQ8A 4I4TE 4DV7T 2XSAA 4ZEYA 4HFVA 1T72A 4FJOA 2PTFA 1ZHCA 2K3WA 2W4XA 4O4JE 3O1HA 1HTJF 4MBQA 2NR4A 3MACA 2M6IA 2UXDT 4AKIA 3ESLA 2IC9A 4PK6A 2CLYB 2VVNA 2V5DA 3QUJA 2L9QA 5LB7B 2Y48B 5L3FB 2BG9B 2UXNB 3EDVA 4DR3T 5FY7A 5JDFA 2HN1A 2LM9A 3ZT5A 3RIUA 1XDPA 2H3RA 3OVUA 5CB4E 3VR9A 4QXCB 1HR0T 4UXNB 3K1SA 4IE5A 5JRCA 3L8RA 5LBMA 3CIRA 5LG4A 4JEUB 5FVLA 2N1GA 4UV9B 5AQTB 4CXYA 2HH7A 4DV1T 4ILUA 4DMVA 4NUUA 4YXDA 3L3PA 4Z90A 4ZOLE 4HFCA 2KT9A 4O4IE 3N2KE 1J5WA 1US7B 5FXXA 1LRZA 4JI4T 3CX7B 4LMJA 1SE7A 4DV2T 4HGAA 3NZQA 3ZSTA 2PJQA 4GKJT 2BG9E 3P4SA 5IWAT 3P8CD 2FJBA 3UU4A 4HKAA 2QGSA 4NXNT 1VCSA 2DNXA 3SWHA 4NUVA 4AKLA 3EAMA 4DBRA 4E7SA 4X66T 3E0ZA 3FBZA 1KF6A 3PUYF 2XY8B 5AQVB 2Q9QD 3TLVA 3WI3A 2LJLA 5FY0A 4EV6A 3KFWX 4ADZA 2WAUA 4ERRA 5JDMA 5LNKA 4LMLA 4IT4A 4O2BE 3PTRB 3N9MA 4EB6E 3K8PC 2MBGA 2LSYA 2PBIA 1D1AA 4B3TT 2MTQA 2AXDS 2JJ9A 4DV3T 2HHHT 3UUNA 2VVSA 3E22E 3MKDA 2CBIA 1MMAA 2CEAA 2IHR1 4L0RA 4O4LE 4A97A 3ZT7A 4H9SE 5LHHB 5LJMA 4JV5T 2WY2A 3PUSA 4L5GA 4LF4T 2BBJA 3AXJB 3FHNA 4N78D 5FL1A 4ZS3A 3RIUC 2DI4A 2OV9A 4YT0A 4ZI3D 2CM0A 1Y01A 2BG9A 3AVRA 4CQIA 2RPAA 4WNKA 2G0UA 2E9XC 3RI5A 2LSKA 3UFGA 5C3JA 4JI7T 4H9RC 3CK6A 2D0TA 1JNRA 3RHWA 2LOSA 2EHOA 2H7OA 1T8BA 2VKOA 4H63H 3AE1A 4DV4T 5L4EA 3LSVA 3PUXF 4PFPA 2OLTA 3PJAA 4DUZT 1XNRT 2ZLYA 1D0ZA 2CE7A 2KWHA 4ZS2A 4JI6T 2UXCT 1HS7A 4IE6A 5J0ZA 2LM2A 4GIWA 2E9XD 3LFMA 3UULA 4I43B 2X0HA 5LP6E 2ZM2A 3H3MA 3LK42 4EAHA 3PU8A 3ZYLA 3AVSA 4WBOA 3RF1A 4OHFA 4XAXB 4LF9T 3P7IA 3O1IA 3H37A 2V6YB 4QWNB 4JI3T 5JR9A 1YKEB 3A8YC 3ANWA 1FMVA 3IHRA 2VASA 3AE6A 4I0UA 2E9XB 4JBWF 4AQGA 2CHNA 2ES0A 1ZP0A 2JQHA 3GWHA 3PU3A 2LRLA 3RPUA 3AE3A 1OEDA 1HFAA 1T7SA 2GK9A 3JC6D 4IDZA 2FJEA 4WZXA 3SFEA 4A98A 4ZXLA 3EABA 4OYJA 5LYJE 5LMUT 2JPFA 4DV6T 4TX5A 2FUPA 3CQXC 3RIAA 1AJ3A 3C98B 2V26A 3GMIA 3M3ZB 2WWUA 3OBVE 1IAPA 2XJ7A 2XQ7A 3RLFF 4YFSA 4BAYB 3C64A 3NRXA 5AQUB 4LF7T 3JCFA 4HFIA 4ZZBA 4CI1B 4E7ZA 3LK3B 2XAQB 3AAAB 3AXJA 4UEMA 2V5CA 2LLYA 3NRYA 4QX7B 5HEGA 4C90A 2XAHB 2XAJB 3PUWF 5KX5E 4DR4T 1JNZA 1ZEEA 2BDEA 3Q5DA 2SPCA 3I0OA 1HF8A 2CA5A 3HKDE 4IREA 4QX8B 3WAKA 3ZKRA 2W62A 5JH7E 2RP4A 2LOPA 2OA5A 2QYWA 4A56A 4O2AE 4EIWA 2KZ7B 2J47A 2WMOA 2XSBA 2WB5A 2WP9A 4CI3B 1QLBA 4PK5A 5KXJA 5L3DB 4CN1A 1I94T 1LKXA 2W0GA 4EEDA 5HXEA 5JTGA 3TLUA 2VKJA 5F3JA 4EZHA 4FI5A 2IAKA 4QH1A 4ASKA 4DR7T 2E2AA 1WR6A 5JR9C 5H6RB 5L47A 3AE8A 4HWIB 2A2FX 4KI0F 3BQKA 2DWKA 5AQPB 2UUCT 2CXFA 2YEVC 1OWAA 3K3NA 5ABGA 3C4WA 3HKCE 4X1IE 2JQ9A 3AE5A 4HE8A 5AQMB 3OJAA 1Z8UA 4O8SA 3BQLA 4U74A 5J2UE 3CPZA 2C5IT 3ONJA 3NWIA 1XMOT 3RGLA 5JQGE 1MMDA 4Z91A 5JDQA 3UQ7A 1FIOA 1HG2A 1KNPA 2LKHA 3L39A 5JDGA 1Y64B 2JMKA 3ONLC 3T8OA 5LGUB 3F31A 3OPCA 3WAJA 3M65A 3OKQA 4YHJA 2E9XA 3P50A 3VU7H 4DR5T 4YTPA 4IDNA 2XQ5A 1XDOA 1MIVA 4U2YA 1SA0E 1YD8G 2Y6XA 4EGWA 2UXBT 4P09A 2XPKA 5LMNT 4GK0E 2LT3A 4KUMB 2K48A 2XAGB 4IIJE 4MFRA 3P4QA 2BS4A 1X79A 3HA4A 3RKGA 2VKHA 1XNQT 1LVFA 3RYHE 5CA1E 2WZIA 5IHYA 3RRCA 1XZYA 2F4VT 3PUAA 3AE7A 2V7KA 2Q9QC 1KEYA 3N9LA 3UT5E 1WLXA 2X0LB 4C91A 3C51A 2XTLA 1KNRA 3KV6A 4ILBA 1CUNA 5LJNA 5ABHA 5AQSB 4AKRB 5L2LA 2VQET 3B13A 2HPJA 3C50A 5AQLB 1KFYA 4YLHA 2A3DA 4U3CA 3Q9DA 2XHEB 3HI2A 3EUHA 5LOVE 3TLTA 2ODVA 4UF0A 5HXHA 2BS2A 3UUBA 1FJGT 3DP7A 2XQ6A 2ZMAA 4PJLA 2WDQA 3N2OA 3SFDA 2JRKA 4PAGA 2NW9A 5LGNB 4DUYT 1GQEA 5AQKB 3JAEA 2D0UA 4U72A 4OK0A 4IL9A 4TZ4C 3ZJ2A 2M67A 2XUEA 4TV9E 2BBHA 4JI2T 1W9RA 2NW8A 4IE0A 4LMKA 2L3LA 1UK5A 3F2EA 4IHJE 1NENA 3I1AA 2DWGA 4U7IA 3RIFA 2E8IA 3N9OA 2H7VC 3N5LA 1WCRA 4HWCA 4L9IA 4XZCA 5CGMA 1WFDA 5LCYA 4YY3T 4X20E 3KV4A 2UU9T 2HPLA 3RQWA 4KX6A 1HNXT 1UURA 4EZ4A 4X64T 1BR4A 3AEAA 4HFEA 3HR0A 2RA1A 3UU8A 4YSYA 2ACXA 2IC6A 4U33A 1IZNB 1ZKEA 1I6ZA 3EI0A 4P1NA 3AAEB 5C2TA 2XQAA 3FZFB 2LSJA 3VR8A 3HL6A 2Q9QB 3UU5A 4AIUA 4NPPA 3TLSA 3B57A 2BVLA 4HWHA 2ODUA 4LF8T 4H63V 3RX6A 5AFUL 4B3RT 4HFBA 2BVMA 4HFHA 4IL4A 1SUMB 2W66A 4JUYA 3RQUA 3OTOT 4WW0A 2XM2A 1E7PA 2BKNA 4OFZA 2D2SA 2H89A 2V8SV 2YN6A 3C4XA 4DIDB 2UUAT 5BMVE 2V7JA 5FP3A 3NBXX 1VRBA 2CCQA 3OYXA 4CXWA 3AECA 5ETWA 1S94A 2YU2A 2KNDA 3CKDA 3KBTA 4JEHB 4UVBB 4X1YE 5FYMA 5JR9B 3ZMSB 1VCTA 2WQYA 3TLWA 2HN2A 2K24A 2ZM0A 3FBLA 3I9WA 5LBQB 3A5XA 3AE4A 3N2GE 2VL8A 4AISA 4X62T 2EHOB 4KHPT 4YJ3E 1M7KA 3KVAA 4TNVA 5CA0E 1EZ3A 3IA3A 5LGTB 2XQ9A 3RRWA 1T98A 2LHNA 3CX8B 4AQYT 2W2UA 3FZLB 2WDRA 3UTKA 3LDQB 2B76A 2VQFT 3AA1B 1NWMX 5HEJA 1HG5A 3R6NA 3ZYMA 3HKBE 1WYCA 4YTMA 2AE9A 2H88A 5L3BB 4AKGA 3AA7B 1HX1B 3EDUA 3ZMTB 3SRZA 4IDOA 3VKGA 1DU2A 2WU2A 4LFCT 4F6RC 5ABFB 3N9PA 5GONE 4WBNE 3O9XA 3F57A 4G2AA 2VWAA 4QH4A 3ZCIA 3ZT6A 1WRDA 5AQJB 2D5UA 3HKEE 2DL1A 3NKZA 4CN4A 3ONXA 4TV8E 4JI8T 3CMLA 3OYZA 1H7CA 5HXRA 1UX5A 2VB6A 2IDOB 2Z6EA 4K0UA 4HWDA 4JI5T 4U31A 5FKYA 3V5UA 3L09A 4HN9A 4AI6A 1G8XA 2X0YA 2NTYA 3A7MA 3CWZB 4IE7A 1YXRA 5L3CB 3U78A 2LKGA 2VKDA 2CWOA 2YINA 4PNIA 3CVRA 3UUMA 3KDSE 4F8HA 4G63A 5FY1A 2E5VA 4P0BA 4DNDA 3ETVA 2VK9A 2BKOA 1OEDE 2QVAA 2V6XA 4UR9A 2W61A 4U7YA 2XQYA 4CZZB 4DV0T 2CXDA 2LEHA 2V7LA 1BR2A 2KXPB 2R6GF 3QK6A 3W15B 4K0KT 5EK3A 3GN5A 1FMWA 3ZYKA 5KDMC 3H3AA 4TNWA 3TKLB 1J5ET 3PJAJ 2ZM8A 3P4PA 3N9QA 4PFOA 1D0YA 2X67A 2X66A 2L8KA 2YDSA 3AB3B 2LSIA 1HNZT 4KMCA 5HEOA 3ZMUB 2JMHA 3VRBA 4GK5E 4UVAB 4PW8A 3EVYA 3ZPOA 4H9OC 4X1KE 1OXZA 3ABVA 3IF8B 4ISSA 4LFAT 3FXDB 2IUBA 3PUZF 5IUXA 4TWHA 4H9PC 1IBMT 2NTXA 4QH5A 3ZCJA 2I59A 3Q2MA 4LFBT 3JAFA 1IJ6A 1L0VA 4B3MT 4XBFB 3N9NA 5DQWA 2V7MA 2CHOA 4ZI2C 3AEGA 3VHLA 1E2AA 4QXBB 1NAFA 1KK7A 3ANWB 5F5WA 1B7TA 2IW5B 4ILAA 5CJ5A 4ZZCA 3RKOA 4YTNA 4J2CA 5FMNA 1YKHB 3KBUA 2X9YA 2BG9C 4I55E 4YJ2E 5BR8T 3J7Yq 2W00A 3I0QA 4MALA 3MZKB 5L4HA 5LA6E 4KHZF 5JDLA 2V7IA 4KP3C 4NIQA 4H9QC 1E1HB 3C4ZA 5LHIB 1WR0A 4KBMB 3QB5A 5AQFB 2YOEA 1YW0A 1QSDA 5JDNA 2NWBA 2YDRA 4B3ST 1IJ5A 3ZMZB 3K3QC 4DR2T 2K5BB 2YK0A 5FXWA 2MYSA 3ZMVB 3ZC0A 3AEBA 4WYVA 1MMNA 3LG7A 5FVKA 2UXXB 4DR1T 3MA9A 3CQCB 4OX9T 1MIWA 3EHZA 3SS1A 1HNWT 1MMGA 5AQIB 3VKHA 2WBLA 4QXHB 2PG8A 4JI0T 1U4QA 4HWFA 4ISTA 1CHUA 2XM1A 5FXZA 4EYYR 4Q25A 5HEUA 1U5PA 3Q5WA 3UFEA 4COFA 2CRBA 4ILCA 2VL0A 3X1DA 2D9DA 4GYRA 2KSRA 1XWMA 3KV9A 1NEKA 3GA8A 4NXMT 2P9BA 3AE9A 1SHZC 2MOZA 4JLEA 4DMWA 4BJNA 1UCUA 2C0SA 2E5LT 4ZHQE 3BQIA 1KNZA 3RYFE 2I0MA 3ZC1A 5L3EB 1N32T 5C8YE 5H6QB 4P0AA 2M6BA 4H9NC 2EHOD 4X5TA 1FEWA 3ZN1B 1W0AA 3PDYA 1UX4A 2LSGA 3DJBA 3I9YA 4LF6T 2V1DB 1VOMA 5HCJA 2CBJA 2CXLA 3LK2B 2J62A 3ZSSA 3KVBA 4O4HE 2CLYC 4IGUA 1QUUA 1YQ3A 2A72A 4EYUA 5J2TE 3GN5B 4DVDA 2PFVA 2XQ3A 2CWYA 2XASB 2KLQA 2EHOC 3FB2A 3FZKB 3FZHB 1MNEA 4U2ZA 4UV8B 4EEBA 1BR0A 4IDPA 3PURA 1R8IA 4IE4A 5TAOA 2XAFB 1WYBA 2LE8A 2X9XA 2Y8DA 4GOUA 5HYAA 5HWXA 3T1HT 3AAIA 4GKKT 1YQ4A 3AEDA 5AQQB 5FXVA 1V9DA 1W09A 2IIUA 2N2NA 1HX8A 2J1DG 2KWIB 3DTOA 3O1JA 4TUYE 4QKNA 2DCFA 3ZLIA 2X51A 2I6HA 3QC9A 2N9DA 1ZOYA 2FJAA 2WDVA 4BJMA
chains in the Genus database with same CATH topology
1WR0A 3ZSTA 2RPAA 4U33A 4WZXA 4A5XA 4P1NA 4CN1A 3ZT5A 2WWVA 2CPTA 3EABA 4U31A 5LB7B 4CN6A 4U2YA 2W2UA 5FVKA 3ZSSA 1YXRA 2V6YA 4IT4A 4U2ZA 3K1SA 2MPKA 2V6XA 2JQKA 2CRBA 4U7IA 4U7YA 2LRKA 2JQ9A 5FVLA 5CJ5A 1WCRA 3ZT7A 2A9UA 1WFDA 5CGMA 2XZEA 2WY2A 2V6YB 4ZEYA 3ZT6A 2DL1A 4CN4A 4NIQA 2K3WA 2JQHA 4U3CA 2LRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  3ZST A;  2RPA A;  4U33 A;  4WZX A;  4A5X A;  4P1N A;  4CN1 A;  3ZT5 A;  2WWV A;  2CPT A;  3EAB A;  4U31 A;  5LB7 B;  4CN6 A;  4U2Y A;  2W2U A;  5FVK A;  3ZSS A;  1YXR A;  2V6Y A;  4IT4 A;  4U2Z A;  3K1S A;  2MPK A;  2V6X A;  2JQK A;  2CRB A;  4U7I A;  4U7Y A;  2LRK A;  2JQ9 A;  5FVL A;  5CJ5 A;  1WCR A;  3ZT7 A;  2A9U A;  1WFD A;  5CGM A;  2XZE A;  2WY2 A;  2V6Y B;  4ZEY A;  3ZT6 A;  2DL1 A;  4CN4 A;  4NIQ A;  2K3W A;  2JQH A;  4U3C A;  2LRL A; 
#chains in the Genus database with same CATH topology
 3AA0 B;  5AQR B;  3SOL A;  1M62 A;  3B5M A;  4M1P A;  2KIN B;  5EZY E;  5ABE A;  2WWV A;  2WS3 A;  4UF0 B;  3PUQ A;  2WU5 A;  1Z0P A;  4MLK A;  5DAB A;  3AEE A;  5JVD E;  5ADX L;  4OYK A;  5M4Y A;  4DV5 T;  4GYS A;  2CMR A;  5AQH B;  5AQN B;  2BZB A;  1IBL T;  2JQQ A;  3QB5 K;  4JYA T;  2WM9 A;  2YKS A;  2WMN A;  5DJQ C;  4ZI3 C;  1D0X A;  3CQG B;  3IBP A;  5FL0 A;  4AQF A;  4X65 T;  2C5K T;  1X9B A;  2MPK A;  4I50 E;  2JQK A;  4QHO A;  2LRK A;  3RH3 A;  4AKH A;  1W0B A;  1IBK T;  2FJD A;  1HCI A;  5J1G A;  5HXC A;  5EK4 A;  2XZE A;  2K9A A;  5HAX A;  2W67 A;  3RC3 A;  2QA7 A;  4TWD A;  4EOZ B;  5L3G B;  4PJM A;  5LG3 A;  4PJN A;  1LVK A;  2VUR A;  4HTE A;  3VRA A;  3ZJ1 A;  4YSZ A;  5LXT E;  3KV5 A;  3RC8 A;  3IEE A;  4YHH T;  2NW7 A;  1D1C A;  4Z8X A;  4A5X A;  3U3I A;  3ETU A;  4DO0 A;  2ACZ A;  1UUS A;  1G73 A;  2IML A;  2CPT A;  3O4X E;  3MXZ A;  4PK4 A;  5AQO B;  4CN6 A;  5HXS A;  3AA6 B;  5JRE A;  4LF5 T;  2KMF A;  2QRX A;  4UIG A;  5IYZ E;  3S4U A;  5LHG B;  2X9W A;  2C5J A;  2B1E A;  5F8P A;  1OED B;  1ZV4 X;  2WCA A;  5E0O A;  2DLR A;  3KIN B;  4YSX A;  3JAD A;  5FNV E;  3UU6 A;  4CXX A;  1N34 T;  4HEA A;  4CI2 B;  3NVO A;  5ABF A;  2DHR A;  4EXT A;  1OED C;  3FXE B;  3D0T A;  1XMQ T;  3JC6 C;  5A1L A;  2NP9 A;  3PV0 F;  2J4G A;  2W63 A;  3E08 A;  3K3O A;  3LBX B;  3PUV F;  3NZP A;  3MK7 C;  2XQ4 A;  3QOF A;  4UEL A;  3UU3 A;  4DR6 T;  5JRC B;  3Q5X A;  5DQV A;  4AXP A;  4MHC A;  4PJJ A;  1D1B A;  4UVC B;  3RYC E;  3UQ4 A;  4DBQ A;  3V5S A;  2LHR A;  3AE2 A;  3J9X 1;  3ZEF B;  4B6X A;  2Q9Q A;  5AQG B;  4ZI2 D;  3RYI E;  3R84 B;  3P4W A;  2YU1 A;  5KMG P;  4TN7 B;  3AEF A;  5CFB A;  4V1A v;  4JI1 T;  2JIW A;  2X9H A;  3CX6 B;  1MND A;  1BR1 A;  2WZH A;  2BKP A;  4TWF A;  4AQF C;  1N36 T;  2BS3 A;  1J1J A;  3LJC A;  4IDQ A;  3ZN0 B;  3T1Y T;  1O3X A;  1S35 A;  2NOX A;  3BK9 A;  3P4R A;  4HFD A;  2MAW A;  3UUX B;  3PE0 A;  1N33 T;  2V6Y A;  3PUG A;  2UUB T;  1UGO A;  1MIY A;  3LBX A;  5HCM A;  5HWY A;  4ZI7 E;  5JDH A;  2ZM6 T;  3FZM B;  3Q5E A;  3MJX A;  5EK2 A;  2YDQ A;  4BA9 A;  5HEH A;  4ANJ A;  2A9U A;  2WSS V;  2FBW A;  2X68 A;  3G06 A;  3QNU A;  2XQ8 A;  4I4T E;  4DV7 T;  2XSA A;  4ZEY A;  4HFV A;  1T72 A;  4FJO A;  2PTF A;  1ZHC A;  2K3W A;  2W4X A;  4O4J E;  3O1H A;  1HTJ F;  4MBQ A;  2NR4 A;  3MAC A;  2M6I A;  2UXD T;  4AKI A;  3ESL A;  2IC9 A;  4PK6 A;  2CLY B;  2VVN A;  2V5D A;  3QUJ A;  2L9Q A;  5LB7 B;  2Y48 B;  5L3F B;  2BG9 B;  2UXN B;  3EDV A;  4DR3 T;  5FY7 A;  5JDF A;  2HN1 A;  2LM9 A;  3ZT5 A;  3RIU A;  1XDP A;  2H3R A;  3OVU A;  5CB4 E;  3VR9 A;  4QXC B;  1HR0 T;  4UXN B;  3K1S A;  4IE5 A;  5JRC A;  3L8R A;  5LBM A;  3CIR A;  5LG4 A;  4JEU B;  5FVL A;  2N1G A;  4UV9 B;  5AQT B;  4CXY A;  2HH7 A;  4DV1 T;  4ILU A;  4DMV A;  4NUU A;  4YXD A;  3L3P A;  4Z90 A;  4ZOL E;  4HFC A;  2KT9 A;  4O4I E;  3N2K E;  1J5W A;  1US7 B;  5FXX A;  1LRZ A;  4JI4 T;  3CX7 B;  4LMJ A;  1SE7 A;  4DV2 T;  4HGA A;  3NZQ A;  3ZST A;  2PJQ A;  4GKJ T;  2BG9 E;  3P4S A;  5IWA T;  3P8C D;  2FJB A;  3UU4 A;  4HKA A;  2QGS A;  4NXN T;  1VCS A;  2DNX A;  3SWH A;  4NUV A;  4AKL A;  3EAM A;  4DBR A;  4E7S A;  4X66 T;  3E0Z A;  3FBZ A;  1KF6 A;  3PUY F;  2XY8 B;  5AQV B;  2Q9Q D;  3TLV A;  3WI3 A;  2LJL A;  5FY0 A;  4EV6 A;  3KFW X;  4ADZ A;  2WAU A;  4ERR A;  5JDM A;  5LNK A;  4LML A;  4IT4 A;  4O2B E;  3PTR B;  3N9M A;  4EB6 E;  3K8P C;  2MBG A;  2LSY A;  2PBI A;  1D1A A;  4B3T T;  2MTQ A;  2AXD S;  2JJ9 A;  4DV3 T;  2HHH T;  3UUN A;  2VVS A;  3E22 E;  3MKD A;  2CBI A;  1MMA A;  2CEA A;  2IHR 1;  4L0R A;  4O4L E;  4A97 A;  3ZT7 A;  4H9S E;  5LHH B;  5LJM A;  4JV5 T;  2WY2 A;  3PUS A;  4L5G A;  4LF4 T;  2BBJ A;  3AXJ B;  3FHN A;  4N78 D;  5FL1 A;  4ZS3 A;  3RIU C;  2DI4 A;  2OV9 A;  4YT0 A;  4ZI3 D;  2CM0 A;  1Y01 A;  2BG9 A;  3AVR A;  4CQI A;  2RPA A;  4WNK A;  2G0U A;  2E9X C;  3RI5 A;  2LSK A;  3UFG A;  5C3J A;  4JI7 T;  4H9R C;  3CK6 A;  2D0T A;  1JNR A;  3RHW A;  2LOS A;  2EHO A;  2H7O A;  1T8B A;  2VKO A;  4H63 H;  3AE1 A;  4DV4 T;  5L4E A;  3LSV A;  3PUX F;  4PFP A;  2OLT A;  3PJA A;  4DUZ T;  1XNR T;  2ZLY A;  1D0Z A;  2CE7 A;  2KWH A;  4ZS2 A;  4JI6 T;  2UXC T;  1HS7 A;  4IE6 A;  5J0Z A;  2LM2 A;  4GIW A;  2E9X D;  3LFM A;  3UUL A;  4I43 B;  2X0H A;  5LP6 E;  2ZM2 A;  3H3M A;  3LK4 2;  4EAH A;  3PU8 A;  3ZYL A;  3AVS A;  4WBO A;  3RF1 A;  4OHF A;  4XAX B;  4LF9 T;  3P7I A;  3O1I A;  3H37 A;  2V6Y B;  4QWN B;  4JI3 T;  5JR9 A;  1YKE B;  3A8Y C;  3ANW A;  1FMV A;  3IHR A;  2VAS A;  3AE6 A;  4I0U A;  2E9X B;  4JBW F;  4AQG A;  2CHN A;  2ES0 A;  1ZP0 A;  2JQH A;  3GWH A;  3PU3 A;  2LRL A;  3RPU A;  3AE3 A;  1OED A;  1HFA A;  1T7S A;  2GK9 A;  3JC6 D;  4IDZ A;  2FJE A;  4WZX A;  3SFE A;  4A98 A;  4ZXL A;  3EAB A;  4OYJ A;  5LYJ E;  5LMU T;  2JPF A;  4DV6 T;  4TX5 A;  2FUP A;  3CQX C;  3RIA A;  1AJ3 A;  3C98 B;  2V26 A;  3GMI A;  3M3Z B;  2WWU A;  3OBV E;  1IAP A;  2XJ7 A;  2XQ7 A;  3RLF F;  4YFS A;  4BAY B;  3C64 A;  3NRX A;  5AQU B;  4LF7 T;  3JCF A;  4HFI A;  4ZZB A;  4CI1 B;  4E7Z A;  3LK3 B;  2XAQ B;  3AAA B;  3AXJ A;  4UEM A;  2V5C A;  2LLY A;  3NRY A;  4QX7 B;  5HEG A;  4C90 A;  2XAH B;  2XAJ B;  3PUW F;  5KX5 E;  4DR4 T;  1JNZ A;  1ZEE A;  2BDE A;  3Q5D A;  2SPC A;  3I0O A;  1HF8 A;  2CA5 A;  3HKD E;  4IRE A;  4QX8 B;  3WAK A;  3ZKR A;  2W62 A;  5JH7 E;  2RP4 A;  2LOP A;  2OA5 A;  2QYW A;  4A56 A;  4O2A E;  4EIW A;  2KZ7 B;  2J47 A;  2WMO A;  2XSB A;  2WB5 A;  2WP9 A;  4CI3 B;  1QLB A;  4PK5 A;  5KXJ A;  5L3D B;  4CN1 A;  1I94 T;  1LKX A;  2W0G A;  4EED A;  5HXE A;  5JTG A;  3TLU A;  2VKJ A;  5F3J A;  4EZH A;  4FI5 A;  2IAK A;  4QH1 A;  4ASK A;  4DR7 T;  2E2A A;  1WR6 A;  5JR9 C;  5H6R B;  5L47 A;  3AE8 A;  4HWI B;  2A2F X;  4KI0 F;  3BQK A;  2DWK A;  5AQP B;  2UUC T;  2CXF A;  2YEV C;  1OWA A;  3K3N A;  5ABG A;  3C4W A;  3HKC E;  4X1I E;  2JQ9 A;  3AE5 A;  4HE8 A;  5AQM B;  3OJA A;  1Z8U A;  4O8S A;  3BQL A;  4U74 A;  5J2U E;  3CPZ A;  2C5I T;  3ONJ A;  3NWI A;  1XMO T;  3RGL A;  5JQG E;  1MMD A;  4Z91 A;  5JDQ A;  3UQ7 A;  1FIO A;  1HG2 A;  1KNP A;  2LKH A;  3L39 A;  5JDG A;  1Y64 B;  2JMK A;  3ONL C;  3T8O A;  5LGU B;  3F31 A;  3OPC A;  3WAJ A;  3M65 A;  3OKQ A;  4YHJ A;  2E9X A;  3P50 A;  3VU7 H;  4DR5 T;  4YTP A;  4IDN A;  2XQ5 A;  1XDO A;  1MIV A;  4U2Y A;  1SA0 E;  1YD8 G;  2Y6X A;  4EGW A;  2UXB T;  4P09 A;  2XPK A;  5LMN T;  4GK0 E;  2LT3 A;  4KUM B;  2K48 A;  2XAG B;  4IIJ E;  4MFR A;  3P4Q A;  2BS4 A;  1X79 A;  3HA4 A;  3RKG A;  2VKH A;  1XNQ T;  1LVF A;  3RYH E;  5CA1 E;  2WZI A;  5IHY A;  3RRC A;  1XZY A;  2F4V T;  3PUA A;  3AE7 A;  2V7K A;  2Q9Q C;  1KEY A;  3N9L A;  3UT5 E;  1WLX A;  2X0L B;  4C91 A;  3C51 A;  2XTL A;  1KNR A;  3KV6 A;  4ILB A;  1CUN A;  5LJN A;  5ABH A;  5AQS B;  4AKR B;  5L2L A;  2VQE T;  3B13 A;  2HPJ A;  3C50 A;  5AQL B;  1KFY A;  4YLH A;  2A3D A;  4U3C A;  3Q9D A;  2XHE B;  3HI2 A;  3EUH A;  5LOV E;  3TLT A;  2ODV A;  4UF0 A;  5HXH A;  2BS2 A;  3UUB A;  1FJG T;  3DP7 A;  2XQ6 A;  2ZMA A;  4PJL A;  2WDQ A;  3N2O A;  3SFD A;  2JRK A;  4PAG A;  2NW9 A;  5LGN B;  4DUY T;  1GQE A;  5AQK B;  3JAE A;  2D0U A;  4U72 A;  4OK0 A;  4IL9 A;  4TZ4 C;  3ZJ2 A;  2M67 A;  2XUE A;  4TV9 E;  2BBH A;  4JI2 T;  1W9R A;  2NW8 A;  4IE0 A;  4LMK A;  2L3L A;  1UK5 A;  3F2E A;  4IHJ E;  1NEN A;  3I1A A;  2DWG A;  4U7I A;  3RIF A;  2E8I A;  3N9O A;  2H7V C;  3N5L A;  1WCR A;  4HWC A;  4L9I A;  4XZC A;  5CGM A;  1WFD A;  5LCY A;  4YY3 T;  4X20 E;  3KV4 A;  2UU9 T;  2HPL A;  3RQW A;  4KX6 A;  1HNX T;  1UUR A;  4EZ4 A;  4X64 T;  1BR4 A;  3AEA A;  4HFE A;  3HR0 A;  2RA1 A;  3UU8 A;  4YSY A;  2ACX A;  2IC6 A;  4U33 A;  1IZN B;  1ZKE A;  1I6Z A;  3EI0 A;  4P1N A;  3AAE B;  5C2T A;  2XQA A;  3FZF B;  2LSJ A;  3VR8 A;  3HL6 A;  2Q9Q B;  3UU5 A;  4AIU A;  4NPP A;  3TLS A;  3B57 A;  2BVL A;  4HWH A;  2ODU A;  4LF8 T;  4H63 V;  3RX6 A;  5AFU L;  4B3R T;  4HFB A;  2BVM A;  4HFH A;  4IL4 A;  1SUM B;  2W66 A;  4JUY A;  3RQU A;  3OTO T;  4WW0 A;  2XM2 A;  1E7P A;  2BKN A;  4OFZ A;  2D2S A;  2H89 A;  2V8S V;  2YN6 A;  3C4X A;  4DID B;  2UUA T;  5BMV E;  2V7J A;  5FP3 A;  3NBX X;  1VRB A;  2CCQ A;  3OYX A;  4CXW A;  3AEC A;  5ETW A;  1S94 A;  2YU2 A;  2KND A;  3CKD A;  3KBT A;  4JEH B;  4UVB B;  4X1Y E;  5FYM A;  5JR9 B;  3ZMS B;  1VCT A;  2WQY A;  3TLW A;  2HN2 A;  2K24 A;  2ZM0 A;  3FBL A;  3I9W A;  5LBQ B;  3A5X A;  3AE4 A;  3N2G E;  2VL8 A;  4AIS A;  4X62 T;  2EHO B;  4KHP T;  4YJ3 E;  1M7K A;  3KVA A;  4TNV A;  5CA0 E;  1EZ3 A;  3IA3 A;  5LGT B;  2XQ9 A;  3RRW A;  1T98 A;  2LHN A;  3CX8 B;  4AQY T;  2W2U A;  3FZL B;  2WDR A;  3UTK A;  3LDQ B;  2B76 A;  2VQF T;  3AA1 B;  1NWM X;  5HEJ A;  1HG5 A;  3R6N A;  3ZYM A;  3HKB E;  1WYC A;  4YTM A;  2AE9 A;  2H88 A;  5L3B B;  4AKG A;  3AA7 B;  1HX1 B;  3EDU A;  3ZMT B;  3SRZ A;  4IDO A;  3VKG A;  1DU2 A;  2WU2 A;  4LFC T;  4F6R C;  5ABF B;  3N9P A;  5GON E;  4WBN E;  3O9X A;  3F57 A;  4G2A A;  2VWA A;  4QH4 A;  3ZCI A;  3ZT6 A;  1WRD A;  5AQJ B;  2D5U A;  3HKE E;  2DL1 A;  3NKZ A;  4CN4 A;  3ONX A;  4TV8 E;  4JI8 T;  3CML A;  3OYZ A;  1H7C A;  5HXR A;  1UX5 A;  2VB6 A;  2IDO B;  2Z6E A;  4K0U A;  4HWD A;  4JI5 T;  4U31 A;  5FKY A;  3V5U A;  3L09 A;  4HN9 A;  4AI6 A;  1G8X A;  2X0Y A;  2NTY A;  3A7M A;  3CWZ B;  4IE7 A;  1YXR A;  5L3C B;  3U78 A;  2LKG A;  2VKD A;  2CWO A;  2YIN A;  4PNI A;  3CVR A;  3UUM A;  3KDS E;  4F8H A;  4G63 A;  5FY1 A;  2E5V A;  4P0B A;  4DND A;  3ETV A;  2VK9 A;  2BKO A;  1OED E;  2QVA A;  2V6X A;  4UR9 A;  2W61 A;  4U7Y A;  2XQY A;  4CZZ B;  4DV0 T;  2CXD A;  2LEH A;  2V7L A;  1BR2 A;  2KXP B;  2R6G F;  3QK6 A;  3W15 B;  4K0K T;  5EK3 A;  3GN5 A;  1FMW A;  3ZYK A;  5KDM C;  3H3A A;  4TNW A;  3TKL B;  1J5E T;  3PJA J;  2ZM8 A;  3P4P A;  3N9Q A;  4PFO A;  1D0Y A;  2X67 A;  2X66 A;  2L8K A;  2YDS A;  3AB3 B;  2LSI A;  1HNZ T;  4KMC A;  5HEO A;  3ZMU B;  2JMH A;  3VRB A;  4GK5 E;  4UVA B;  4PW8 A;  3EVY A;  3ZPO A;  4H9O C;  4X1K E;  1OXZ A;  3ABV A;  3IF8 B;  4ISS A;  4LFA T;  3FXD B;  2IUB A;  3PUZ F;  5IUX A;  4TWH A;  4H9P C;  1IBM T;  2NTX A;  4QH5 A;  3ZCJ A;  2I59 A;  3Q2M A;  4LFB T;  3JAF A;  1IJ6 A;  1L0V A;  4B3M T;  4XBF B;  3N9N A;  5DQW A;  2V7M A;  2CHO A;  4ZI2 C;  3AEG A;  3VHL A;  1E2A A;  4QXB B;  1NAF A;  1KK7 A;  3ANW B;  5F5W A;  1B7T A;  2IW5 B;  4ILA A;  5CJ5 A;  4ZZC A;  3RKO A;  4YTN A;  4J2C A;  5FMN A;  1YKH B;  3KBU A;  2X9Y A;  2BG9 C;  4I55 E;  4YJ2 E;  5BR8 T;  3J7Y q;  2W00 A;  3I0Q A;  4MAL A;  3MZK B;  5L4H A;  5LA6 E;  4KHZ F;  5JDL A;  2V7I A;  4KP3 C;  4NIQ A;  4H9Q C;  1E1H B;  3C4Z A;  5LHI B;  1WR0 A;  4KBM B;  3QB5 A;  5AQF B;  2YOE A;  1YW0 A;  1QSD A;  5JDN A;  2NWB A;  2YDR A;  4B3S T;  1IJ5 A;  3ZMZ B;  3K3Q C;  4DR2 T;  2K5B B;  2YK0 A;  5FXW A;  2MYS A;  3ZMV B;  3ZC0 A;  3AEB A;  4WYV A;  1MMN A;  3LG7 A;  5FVK A;  2UXX B;  4DR1 T;  3MA9 A;  3CQC B;  4OX9 T;  1MIW A;  3EHZ A;  3SS1 A;  1HNW T;  1MMG A;  5AQI B;  3VKH A;  2WBL A;  4QXH B;  2PG8 A;  4JI0 T;  1U4Q A;  4HWF A;  4IST A;  1CHU A;  2XM1 A;  5FXZ A;  4EYY R;  4Q25 A;  5HEU A;  1U5P A;  3Q5W A;  3UFE A;  4COF A;  2CRB A;  4ILC A;  2VL0 A;  3X1D A;  2D9D A;  4GYR A;  2KSR A;  1XWM A;  3KV9 A;  1NEK A;  3GA8 A;  4NXM T;  2P9B A;  3AE9 A;  1SHZ C;  2MOZ A;  4JLE A;  4DMW A;  4BJN A;  1UCU A;  2C0S A;  2E5L T;  4ZHQ E;  3BQI A;  1KNZ A;  3RYF E;  2I0M A;  3ZC1 A;  5L3E B;  1N32 T;  5C8Y E;  5H6Q B;  4P0A A;  2M6B A;  4H9N C;  2EHO D;  4X5T A;  1FEW A;  3ZN1 B;  1W0A A;  3PDY A;  1UX4 A;  2LSG A;  3DJB A;  3I9Y A;  4LF6 T;  2V1D B;  1VOM A;  5HCJ A;  2CBJ A;  2CXL A;  3LK2 B;  2J62 A;  3ZSS A;  3KVB A;  4O4H E;  2CLY C;  4IGU A;  1QUU A;  1YQ3 A;  2A72 A;  4EYU A;  5J2T E;  3GN5 B;  4DVD A;  2PFV A;  2XQ3 A;  2CWY A;  2XAS B;  2KLQ A;  2EHO C;  3FB2 A;  3FZK B;  3FZH B;  1MNE A;  4U2Z A;  4UV8 B;  4EEB A;  1BR0 A;  4IDP A;  3PUR A;  1R8I A;  4IE4 A;  5TAO A;  2XAF B;  1WYB A;  2LE8 A;  2X9X A;  2Y8D A;  4GOU A;  5HYA A;  5HWX A;  3T1H T;  3AAI A;  4GKK T;  1YQ4 A;  3AED A;  5AQQ B;  5FXV A;  1V9D A;  1W09 A;  2IIU A;  2N2N A;  1HX8 A;  2J1D G;  2KWI B;  3DTO A;  3O1J A;  4TUY E;  4QKN A;  2DCF A;  3ZLI A;  2X51 A;  2I6H A;  3QC9 A;  2N9D A;  1ZOY A;  2FJA A;  2WDV A;  4BJM A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  3ZST A;  2RPA A;  4U33 A;  4WZX A;  4A5X A;  4P1N A;  4CN1 A;  3ZT5 A;  2WWV A;  2CPT A;  3EAB A;  4U31 A;  5LB7 B;  4CN6 A;  4U2Y A;  2W2U A;  5FVK A;  3ZSS A;  1YXR A;  2V6Y A;  4IT4 A;  4U2Z A;  3K1S A;  2MPK A;  2V6X A;  2JQK A;  2CRB A;  4U7I A;  4U7Y A;  2LRK A;  2JQ9 A;  5FVL A;  5CJ5 A;  1WCR A;  3ZT7 A;  2A9U A;  1WFD A;  5CGM A;  2XZE A;  2WY2 A;  2V6Y B;  4ZEY A;  3ZT6 A;  2DL1 A;  4CN4 A;  4NIQ A;  2K3W A;  2JQH A;  4U3C A;  2LRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...