2V6XA

Stractural insight into the interaction between escrt-iii and vps4
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
SHMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
total genus 34
structure length 82
sequence length 82
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6xA00
2CPTA 2XZEA 3K1SA 2V6YA 4CN1A 4WZXA 2V6YB 1WCRA 4P1NA 2A9UA 2CRBA 2WY2A 4U7IA 5LB7B 4A5XA 4U33A 4U3CA 3ZSTA 2JQ9A 4NIQA 2W2UA 5CJ5A 3ZT7A 2V6XA 4CN6A 4IT4A 4U2YA 2WWVA 1WFDA 4ZEYA 2JQHA 3ZT5A 3ZSSA 2JQKA 1WR0A 4CN4A 5FVKA 3EABA 4U31A 2LRLA 3ZT6A 4U7YA 5CGMA 5FVLA 1YXRA 2RPAA 4U2ZA 2MPKA 2DL1A 2LRKA 2K3WA
chains in the Genus database with same CATH superfamily
3OTOT 3ZMTB 4PK5A 3MKDA 2LE8A 3ETVA 4TUYE 1QUUA 2VKJA 3EI0A 4HWIB 4TWFA 3KINB 3L09A 1KNRA 4BJMA 3JAFA 3OKQA 2H88A 4H9OC 2XJ7A 1XNRT 3P4QA 5AQKB 5JVDE 3FXEB 4XZCA 3CKDA 1MIVA 2I0MA 2MOZA 3P4PA 4U74A 2HN2A 2VQET 2X9WA 2YINA 3SWHA 3TLUA 3FZLB 3NKZA 3PURA 3J7Yq 3JC6C 4TNVA 5HEJA 2JJ9A 1SHZC 2W61A 3A8YC 3NVOA 5LJNA 2V7JA 1WYCA 5M4YA 3OYXA 4ERRA 3K3QC 5AQMB 2VKHA 4GYSA 4IDNA 5H6QB 4QX8B 1HNZT 4OX9T 3GWHA 3ZT6A 4GKKT 3VR8A 4WBOA 4AKRB 1HX1B 4IL4A 5E0OA 3VRBA 4U2ZA 3ZCJA 3T8OA 2YU1A 3FXDB 2YDRA 4A5XA 1XMOT 4DR3T 2OV9A 4P0BA 1MNDA 5HCJA 1BR4A 3CX8B 3EDVA 4JLEA 2V1DB 4PW8A 3RRWA 4C91A 2P9BA 4H9PC 1IBKT 4YSYA 3N9MA 4U7IA 2LT3A 1D0ZA 3AA7B 4LMKA 4YHJA 3K8PC 3RKOA 4TN7B 4H9NC 3N9NA 4EZ4A 5HCMA 2XUEA 3AE6A 2V8SV 2VWAA 3AEDA 4ANJA 5JDQA 3JADA 2RP4A 2XQ8A 4DR4T 3FZFB 5HXSA 2E9XD 3PUXF 3H3MA 5DQWA 3ZKRA 1XMQT 5KX5E 5KXJA 2XM1A 4IDOA 2KZ7B 4DO0A 2XY8B 3PUAA 2CBIA 3AAIA 3GA8A 3Q5EA 2VKOA 3C4WA 4IE6A 5AQVB 4YSXA 5JDHA 3PJAJ 1IBMT 5L3EB 2VK9A 2ZM8A 3PUSA 2ZLYA 2NTXA 2VL0A 5FXZA 3LSVA 3RIFA 3UUMA 1JNRA 1T8BA 2UUCT 4B3TT 4F8HA 1I6ZA 3RH3A 3FZHB 2HPJA 2V6YA 1EZ3A 3TLVA 1D1AA 2QA7A 3R84B 5LNKA 3IA3A 2DWKA 5HXRA 1MIWA 2BG9C 2VURA 3KV6A 4QX7B 4QXCB 3ZSTA 2Q9QB 1VCTA 2CCQA 4E7SA 2LJLA 1UX4A 4I43B 4Z91A 4DV4T 2CWOA 2W62A 5JRCA 4B3ST 2F4VT 2CBJA 4QH1A 4GIWA 4L0RA 3RF1A 2HN1A 4LF9T 4CI1B 3C98B 5F3JA 1MNEA 1AJ3A 5FNVE 2JMHA 3IF8B 2A2FX 3RIUA 3PE0A 5ETWA 4HFIA 2LHNA 4O4HE 5FVKA 2J1DG 3PUGA 3AAEB 3RQUA 4EEBA 5LGTB 5JDNA 5HWYA 4H63V 5EK2A 2RPAA 3RIUC 4IE4A 2DWGA 2WSSV 4Z8XA 2DNXA 4Z90A 2QGSA 2X0YA 2UUAT 1G8XA 2LSGA 3NRXA 5EZYE 4KHPT 4UV9B 2B1EA 3F57A 2V26A 2VVNA 1VCSA 3IEEA 3Q5WA 1VRBA 3AB3B 5AQTB 4CN1A 2YK0A 3RHWA 3N5LA 2D0UA 4F6RC 2CRBA 2XASB 2D9DA 4JEHB 1YQ3A 3UUBA 2XAJB 3KV5A 1ZKEA 2XPKA 4COFA 2XQ7A 4HWHA 2ACZA 2NR4A 3NWIA 5CFBA 4Q25A 4MALA 1S35A 1XDPA 5EK4A 3ONJA 4EIWA 4YTPA 3KV9A 2H7OA 3BK9A 5LCYA 3RC3A 3WAKA 5A1LA 5JDMA 5FP3A 3AXJB 4QWNB 4B3MT 4B6XA 3UU8A 4H63H 4NUVA 2VQFT 3N9QA 2BVLA 3BQLA 3FZKB 4X1YE 5FVLA 1YXRA 2EHOC 2YEVC 1HS7A 3UQ4A 2N2NA 4EZHA 5JR9C 2MPKA 5F8PA 1J5WA 1HG5A 3RYIE 1XNQT 2NOXA 4ZS2A 2NW8A 4HFCA 3VU7H 4AXPA 5JTGA 5LHIB 3P8CD 3E0ZA 3B57A 3RYFE 1O3XA 4DR6T 5C8YE 2BG9B 4I55E 4O4IE 2D5UA 2AXDS 4UVCB 3SS1A 4K0KT 3CQGB 4U3CA 4X20E 2QYWA 4KP3C 4PJJA 3TKLB 5CJ5A 4HKAA 4DV6T 4ISSA 4ZI2C 1MMAA 1ZHCA 2IHR1 2M6BA 3VKGA 3ZC0A 2LOSA 3BQIA 2C0SA 3CPZA 2M6IA 4DR7T 3L8RA 1KNZA 1OEDB 1N33T 4DV7T 2JQHA 1US7B 5HXEA 5FYMA 1X9BA 4IGUA 2KSRA 2EHOB 2LSYA 1GQEA 3FZMB 1T7SA 3ZC1A 3ZYKA 4EB6E 4AQGA 3PUYF 2UXBT 2CMRA 1BR2A 2DL1A 2WB5A 3KV4A 4MLKA 1CUNA 2C5IT 3EVYA 4O8SA 4X1KE 1FIOA 5L4EA 4J2CA 5J2TE 4OFZA 4EV6A 4HTEA 5ABFB 4QXHB 4GK5E 4O2AE 2YDSA 4CQIA 4TWHA 4WZXA 2D0TA 3HA4A 4UV8B 4MBQA 2XAFB 3UQ7A 4JI1T 3LBXB 1MIYA 2FJAA 3SFEA 2Z6EA 5FXXA 4BA9A 2UXDT 3RLFF 4AKGA 2BKOA 2Y6XA 5L3CB 1IBLT 2RA1A 5LJMA 2ES0A 4IL9A 2WS3A 2WU2A 2X9XA 2J62A 3CVRA 4PJNA 4JYAT 5LOVE 4AQFC 2PTFA 4CI2B 4DUZT 4NUUA 2E5VA 2KLQA 1R8IA 4ILBA 4K0UA 1N34T 1D1BA 4LF5T 5BMVE 2QVAA 5AQIB 5FKYA 5LGNB 2W00A 2WDVA 3OBVE 5IUXA 4HWCA 4AIUA 2EHOD 3PUZF 4PFOA 1B7TA 3L3PA 5HEUA 4HFBA 2XQAA 3PUQA 3KVBA 2WZHA 4P09A 4I50E 3NZPA 3AA0B 3VKHA 3AE7A 2HHHT 4YHHT 2JIWA 4JI0T 2PJQA 1E2AA 2MYSA 3HR0A 3P7IA 4TX5A 4UVAB 2BKNA 2LM9A 4HWDA 4EXTA 2PFVA 4YT0A 5L47A 4AKIA 2H7VC 4MFRA 3I9WA 4BAYB 2X0LB 1YQ4A 3KVAA 2NWBA 3UT5E 2L8KA 5L3FB 2XTLA 2K5BB 2XM2A 3EHZA 2XQ6A 2E9XB 2W63A 2BDEA 3CX6B 1E7PA 3S4UA 1UURA 1W9RA 4C90A 2XAGB 3G06A 3O4XE 4UEMA 3QB5A 1U5PA 2X68A 4ZZCA 5LXTE 3Q2MA 2LRLA 3AE4A 3EDUA 3AEEA 3E08A 1W0BA 2YU2A 4U7YA 1KF6A 3OYZA 3I9YA 2M67A 2A3DA 4HFDA 4NPPA 2UU9T 1W09A 4AISA 3BQKA 4UIGA 4X5TA 5GONE 1UX5A 4HE8A 2CLYB 1HR0T 4UF0B 5AQQB 2BG9A 2K48A 3C51A 4GKJT 4IE0A 3M3ZB 3UUXB 4ZI2D 3ZN1B 3MA9A 3N2KE 3UFGA 5HYAA 3ZEFB 3N2GE 3UU6A 2SPCA 1MMDA 3H3AA 2Q9QC 2VVSA 2CM0A 2W2UA 5L3BB 4IE7A 2IUBA 5LYJE 5AQGB 1WR6A 2CXLA 3LK42 3Q5XA 4PNIA 3TLTA 4DV0T 4DV1T 1LVKA 2ACXA 2FUPA 2KNDA 2KXPB 2GK9A 2WDQA 2YKSA 2W4XA 3ESLA 2B76A 2WWUA 3P4SA 3LBXA 2IMLA 1YW0A 4PJMA 1OEDC 3PTRB 3Q9DA 5FY0A 5IWAT 2KWHA 1WR0A 1NWMX 1KFYA 2PG8A 3AXJA 3ZPOA 4U31A 3UUNA 3HL6A 4QKNA 4LF8T 5ABHA 4DIDB 4YLHA 3QB5K 3IBPA 3AECA 4U72A 4EGWA 5JDLA 3O1JA 3T1HT 2H89A 4ZI3C 2XHEB 3RYCE 2I6HA 4JI8T 1JNZA 4A56A 1HCIA 3RQWA 2X9HA 4CXXA 3PJAA 3O1IA 4E7ZA 5LG3A 1D1CA 4CXYA 4JV5T 3ABVA 3K1SA 3A7MA 5AQSB 4JEUB 3AE9A 4JUYA 3U78A 1WCRA 2Y48B 3HI2A 3PU8A 3VR9A 2DCFA 4WBNE 4ILCA 5C2TA 4DR5T 4LF4T 4H9SE 3TLWA 4LFAT 3PV0F 2MTQA 4KUMB 5FY7A 4JI7T 3B5MA 3ZMUB 3NZQA 1UGOA 2LEHA 3WI3A 4AKHA 4KX6A 2FBWA 4FJOA 3MZKB 3GMIA 3MXZA 3ETUA 4HFHA 1WRDA 5FY1A 4JI2T 3ZSSA 2QRXA 3O1HA 3OVUA 5EK3A 5LMUT 1NENA 4UR9A 4CN4A 2YDQA 4DBQA 3QNUA 1W0AA 3AVSA 1YKHB 4A97A 1Z0PA 5AFUL 3ZMZB 5FMNA 2Y8DA 4HWFA 2ZM6T 2IAKA 5AQHB 4JI6T 5AQPB 4ILAA 1OEDA 3AA1B 1QLBA 1HNWT 4LF6T 3K3NA 1N32T 2K9AA 3Q5DA 2DI4A 2WP9A 4IREA 4LMJA 3LJCA 2X0HA 4JI4T 3ZJ1A 3JC6D 2NW9A 3HKEE 3RRCA 5AQJB 4DMWA 4UVBB 4PK6A 5CA0E 3N9OA 3FHNA 1YKEB 2BS4A 4NXMT 3X1DA 3KBTA 4G2AA 2W67A 4OHFA 2WDRA 2HH7A 3CMLA 4YJ3E 2E5LT 3C4ZA 3EAMA 3NBXX 3RKGA 1KK7A 3ZLIA 3ZYMA 2LSJA 3P4RA 4N78D 2JQKA 4PJLA 1NAFA 1BR0A 4H9QC 4OYKA 4JI5T 1U4QA 2BG9E 2V5CA 4XAXB 5FXVA 2WMNA 2J47A 4YJ2E 4QHOA 4YTNA 2KWIB 4HEAA 4KHZF 3SOLA 2V6YB 3LDQB 3VHLA 5HAXA 2VKDA 2XSBA 3AE1A 1FJGT 2H3RA 5KMGP 4TV8E 4JBWF 4AQYT 4H9RC 4ZXLA 1OEDE 3R6NA 2ZMAA 3UU5A 4IDZA 2W0GA 4IDPA 2BS2A 5LB7B 2FJDA 5JR9A 1Z8UA 3OJAA 2XAQB 4DR1T 1OWAA 3VRAA 2X9YA 1V9DA 3DP7A 3JCFA 3ZT7A 4IHJE 4DV3T 2WBLA 4CN6A 2Q9QA 4GOUA 3QOFA 5AQFB 3RYHE 5C3JA 3MK7C 3NRYA 1NEKA 2NP9A 3GN5A 3P50A 1L0VA 4HN9A 3KFWX 3EUHA 5IYZE 2OLTA 5AQOB 4QH5A 1HX8A 3CK6A 3DTOA 2OA5A 3KBUA 3OPCA 5CB4E 2LLYA 1BR1A 5JH7E 2I59A 5L3DB 3AEBA 3RI5A 1M62A 4QXBB 1X79A 3C64A 5JREA 1ZEEA 1SE7A 4EAHA 3ONXA 2CA5A 2ZM2A 3AEFA 3DJBA 3T1YT 2WM9A 3P4WA 5JRCB 4ZS3A 1UK5A 3I0OA 2BVMA 2LM2A 5FL1A 3RX6A 2CHNA 4MHCA 5JR9B 5LHGB 4XBFB 1XDOA 2JPFA 5LP6E 2IIUA 2YOEA 3ZN0B 3E22E 5CA1E 3V5UA 2UXCT 2DLRA 5AQRB 3A5XA 3M65A 3ZMVB 3CQXC 2BKPA 3HKCE 3UU3A 3QUJA 4L9IA 5HXHA 1FMWA 4I4TE 2NW7A 4ZI3D 4YFSA 5CGMA 5LG4A 4P0AA 4DNDA 2MBGA 2FJEA 2WCAA 2UUBT 4DVDA 1ZV4X 2L3LA 2V7MA 3MACA 3JAEA 1XZYA 5IHYA 1QSDA 4IE5A 3LG7A 3RC8A 1IJ5A 4G63A 2LKHA 5ABFA 4ZOLE 4HFEA 1Y01A 5ABEA 4O2BE 2WY2A 2ODUA 1ZOYA 2YN6A 4YXDA 2Q9QD 4IDQA 2WAUA 3AEGA 4WNKA 3ZJ2A 2JRKA 2W66A 2V6XA 2CLYC 1UUSA 2J4GA 4DMVA 4X64T 2XSAA 2LOPA 4JI3T 3FB2A 4TNWA 4YTMA 3AE5A 3D0TA 5F5WA 4CXWA 5DABA 2UXXB 3U3IA 1CHUA 4KMCA 1J1JA 2V5DA 3AVRA 1MMNA 3EABA 5AQLB 1D0YA 2CE7A 2JQQA 2PBIA 3H37A 2E9XA 2KMFA 5FXWA 1N36T 3CWZB 4ADZA 1G73A 3ANWB 4TV9E 4V1Av 4X1IE 3UU4A 2AE9A 1E1HB 2XQYA 4DBRA 2JMKA 2VL8A 2BS3A 4UF0A 3TLSA 4TZ4C 3UULA 1T98A 5LA6E 1I94T 4LFBT 2CHOA 3I1AA 4U2YA 2FJBA 2EHOA 3AAAB 3IHRA 2X66A 4I0UA 5J1GA 1S94A 2V7IA 1D0XA 5DQVA 4EYUA 5JQGE 2VB6A 2C5JA 3CX7B 3F31A 4LMLA 4AKLA 3O9XA 3ZCIA 2CWYA 5AQUB 3LFMA 1HFAA 3ZYLA 2WQYA 4DUYT 3C4XA 5ABGA 2XQ9A 3FBLA 3V5SA 2A72A 5ADXL 1DU2A 4ZZBA 4WW0A 2IW5B 5AQNB 3MJXA 2WWVA 2ODVA 4GYRA 5J0ZA 4AI6A 1LVFA 4L5GA 3RPUA 4ASKA 4HFVA 3N2OA 1KEYA 4OYJA 5TAOA 4EEDA 1IAPA 4DV5T 4EOZB 1HTJF 2BZBA 3N9LA 4YSZA 4BJNA 3HKDE 2KINB 4ILUA 4X65T 2D2SA 3J9X1 1H7CA 2CPTA 1HF8A 4QH4A 2C5KT 2K3WA 5HEOA 5JDGA 1ZP0A 4M1PA 5L2LA 3ZMSB 2K24A 4ZHQE 2BBHA 1IZNB 2XZEA 3UFEA 5L3GB 1OXZA 3AE8A 2NTYA 5LMNT 3PDYA 2LSIA 4FI5A 1FEWA 4P1NA 4U33A 1KNPA 2LSKA 3F2EA 2JQ9A 4PK4A 3ONLC 5L4HA 2XAHB 2R6GF 3QC9A 5BR8T 2HPLA 4LFCT 3K3OA 2ZM0A 1HNXT 1WLXA 2E8IA 3ANWA 3C50A 1J5ET 1IJ6A 1SUMB 2X51A 4IT4A 1MMGA 3SRZA 3PU3A 2V7LA 1WFDA 3CIRA 4DR2T 2XQ3A 3LK3B 3ZT5A 3LK2B 5J2UE 2CXDA 4NXNT 3B13A 5LGUB 1UCUA 4A98A 4ZI7E 5LHHB 2WMOA 4AQFA 3I0QA 4O4JE 4PAGA 3L39A 2L9QA 2UXNB 3WAJA 4YY3T 2BBJA 1LRZA 2LKGA 2LRKA 2N1GA 5JDFA 4X66T 4PFPA 4DV2T 2X67A 4CI3B 1T72A 5H6RB 1VOMA 5HEHA 2XQ4A 4LF7T 4HGAA 5DJQC 5KDMC 1SA0E 2A9UA 4O4LE 1XWMA 2CEAA 2KT9A 2N9DA 3HKBE 1Y64B 4TWDA 2VASA 3PUVF 4UELA 2DHRA 4IIJE 4NIQA 5LBQB 3UTKA 3W15B 3RIAA 3GN5B 3PUWF 4KI0F 4OK0A 3AE3A 4WYVA 3CQCB 3FBZA 2IDOB 1WYBA 2WU5A 4CZZB 3AA6B 5HXCA 2MAWA 1FMVA 1M7KA 2G0UA 2WZIA 3SFDA 2LHRA 4KBMB 5FL0A 4ZEYA 2V7KA 4UXNB 2XQ5A 3RGLA 1HG2A 1YD8G 1LKXA 2IC9A 4EYYR 4X62T 2IC6A 3QK6A 2E2AA 3KDSE 4B3RT 5HEGA 4ISTA 3AEAA 5LBMA 2CXFA 4GK0E 3N9PA 5HWXA 2E9XC 3AE2A
chains in the Genus database with same CATH topology
2CPTA 2XZEA 3K1SA 2V6YA 4CN1A 4WZXA 2V6YB 1WCRA 4P1NA 2A9UA 2CRBA 2WY2A 4U7IA 5LB7B 4A5XA 4U33A 4U3CA 3ZSTA 2JQ9A 4NIQA 2W2UA 5CJ5A 3ZT7A 2V6XA 4CN6A 4IT4A 4U2YA 2WWVA 1WFDA 4ZEYA 2JQHA 3ZT5A 3ZSSA 2JQKA 1WR0A 4CN4A 5FVKA 3EABA 4U31A 2LRLA 3ZT6A 4U7YA 5CGMA 5FVLA 1YXRA 2RPAA 4U2ZA 2MPKA 2DL1A 2LRKA 2K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPT A;  2XZE A;  3K1S A;  2V6Y A;  4CN1 A;  4WZX A;  2V6Y B;  1WCR A;  4P1N A;  2A9U A;  2CRB A;  2WY2 A;  4U7I A;  5LB7 B;  4A5X A;  4U33 A;  4U3C A;  3ZST A;  2JQ9 A;  4NIQ A;  2W2U A;  5CJ5 A;  3ZT7 A;  2V6X A;  4CN6 A;  4IT4 A;  4U2Y A;  2WWV A;  1WFD A;  4ZEY A;  2JQH A;  3ZT5 A;  3ZSS A;  2JQK A;  1WR0 A;  4CN4 A;  5FVK A;  3EAB A;  4U31 A;  2LRL A;  3ZT6 A;  4U7Y A;  5CGM A;  5FVL A;  1YXR A;  2RPA A;  4U2Z A;  2MPK A;  2DL1 A;  2LRK A;  2K3W A; 
#chains in the Genus database with same CATH topology
 3OTO T;  3ZMT B;  4PK5 A;  3MKD A;  2LE8 A;  3ETV A;  4TUY E;  1QUU A;  2VKJ A;  3EI0 A;  4HWI B;  4TWF A;  3KIN B;  3L09 A;  1KNR A;  4BJM A;  3JAF A;  3OKQ A;  2H88 A;  4H9O C;  2XJ7 A;  1XNR T;  3P4Q A;  5AQK B;  5JVD E;  3FXE B;  4XZC A;  3CKD A;  1MIV A;  2I0M A;  2MOZ A;  3P4P A;  4U74 A;  2HN2 A;  2VQE T;  2X9W A;  2YIN A;  3SWH A;  3TLU A;  3FZL B;  3NKZ A;  3PUR A;  3J7Y q;  3JC6 C;  4TNV A;  5HEJ A;  2JJ9 A;  1SHZ C;  2W61 A;  3A8Y C;  3NVO A;  5LJN A;  2V7J A;  1WYC A;  5M4Y A;  3OYX A;  4ERR A;  3K3Q C;  5AQM B;  2VKH A;  4GYS A;  4IDN A;  5H6Q B;  4QX8 B;  1HNZ T;  4OX9 T;  3GWH A;  3ZT6 A;  4GKK T;  3VR8 A;  4WBO A;  4AKR B;  1HX1 B;  4IL4 A;  5E0O A;  3VRB A;  4U2Z A;  3ZCJ A;  3T8O A;  2YU1 A;  3FXD B;  2YDR A;  4A5X A;  1XMO T;  4DR3 T;  2OV9 A;  4P0B A;  1MND A;  5HCJ A;  1BR4 A;  3CX8 B;  3EDV A;  4JLE A;  2V1D B;  4PW8 A;  3RRW A;  4C91 A;  2P9B A;  4H9P C;  1IBK T;  4YSY A;  3N9M A;  4U7I A;  2LT3 A;  1D0Z A;  3AA7 B;  4LMK A;  4YHJ A;  3K8P C;  3RKO A;  4TN7 B;  4H9N C;  3N9N A;  4EZ4 A;  5HCM A;  2XUE A;  3AE6 A;  2V8S V;  2VWA A;  3AED A;  4ANJ A;  5JDQ A;  3JAD A;  2RP4 A;  2XQ8 A;  4DR4 T;  3FZF B;  5HXS A;  2E9X D;  3PUX F;  3H3M A;  5DQW A;  3ZKR A;  1XMQ T;  5KX5 E;  5KXJ A;  2XM1 A;  4IDO A;  2KZ7 B;  4DO0 A;  2XY8 B;  3PUA A;  2CBI A;  3AAI A;  3GA8 A;  3Q5E A;  2VKO A;  3C4W A;  4IE6 A;  5AQV B;  4YSX A;  5JDH A;  3PJA J;  1IBM T;  5L3E B;  2VK9 A;  2ZM8 A;  3PUS A;  2ZLY A;  2NTX A;  2VL0 A;  5FXZ A;  3LSV A;  3RIF A;  3UUM A;  1JNR A;  1T8B A;  2UUC T;  4B3T T;  4F8H A;  1I6Z A;  3RH3 A;  3FZH B;  2HPJ A;  2V6Y A;  1EZ3 A;  3TLV A;  1D1A A;  2QA7 A;  3R84 B;  5LNK A;  3IA3 A;  2DWK A;  5HXR A;  1MIW A;  2BG9 C;  2VUR A;  3KV6 A;  4QX7 B;  4QXC B;  3ZST A;  2Q9Q B;  1VCT A;  2CCQ A;  4E7S A;  2LJL A;  1UX4 A;  4I43 B;  4Z91 A;  4DV4 T;  2CWO A;  2W62 A;  5JRC A;  4B3S T;  2F4V T;  2CBJ A;  4QH1 A;  4GIW A;  4L0R A;  3RF1 A;  2HN1 A;  4LF9 T;  4CI1 B;  3C98 B;  5F3J A;  1MNE A;  1AJ3 A;  5FNV E;  2JMH A;  3IF8 B;  2A2F X;  3RIU A;  3PE0 A;  5ETW A;  4HFI A;  2LHN A;  4O4H E;  5FVK A;  2J1D G;  3PUG A;  3AAE B;  3RQU A;  4EEB A;  5LGT B;  5JDN A;  5HWY A;  4H63 V;  5EK2 A;  2RPA A;  3RIU C;  4IE4 A;  2DWG A;  2WSS V;  4Z8X A;  2DNX A;  4Z90 A;  2QGS A;  2X0Y A;  2UUA T;  1G8X A;  2LSG A;  3NRX A;  5EZY E;  4KHP T;  4UV9 B;  2B1E A;  3F57 A;  2V26 A;  2VVN A;  1VCS A;  3IEE A;  3Q5W A;  1VRB A;  3AB3 B;  5AQT B;  4CN1 A;  2YK0 A;  3RHW A;  3N5L A;  2D0U A;  4F6R C;  2CRB A;  2XAS B;  2D9D A;  4JEH B;  1YQ3 A;  3UUB A;  2XAJ B;  3KV5 A;  1ZKE A;  2XPK A;  4COF A;  2XQ7 A;  4HWH A;  2ACZ A;  2NR4 A;  3NWI A;  5CFB A;  4Q25 A;  4MAL A;  1S35 A;  1XDP A;  5EK4 A;  3ONJ A;  4EIW A;  4YTP A;  3KV9 A;  2H7O A;  3BK9 A;  5LCY A;  3RC3 A;  3WAK A;  5A1L A;  5JDM A;  5FP3 A;  3AXJ B;  4QWN B;  4B3M T;  4B6X A;  3UU8 A;  4H63 H;  4NUV A;  2VQF T;  3N9Q A;  2BVL A;  3BQL A;  3FZK B;  4X1Y E;  5FVL A;  1YXR A;  2EHO C;  2YEV C;  1HS7 A;  3UQ4 A;  2N2N A;  4EZH A;  5JR9 C;  2MPK A;  5F8P A;  1J5W A;  1HG5 A;  3RYI E;  1XNQ T;  2NOX A;  4ZS2 A;  2NW8 A;  4HFC A;  3VU7 H;  4AXP A;  5JTG A;  5LHI B;  3P8C D;  3E0Z A;  3B57 A;  3RYF E;  1O3X A;  4DR6 T;  5C8Y E;  2BG9 B;  4I55 E;  4O4I E;  2D5U A;  2AXD S;  4UVC B;  3SS1 A;  4K0K T;  3CQG B;  4U3C A;  4X20 E;  2QYW A;  4KP3 C;  4PJJ A;  3TKL B;  5CJ5 A;  4HKA A;  4DV6 T;  4ISS A;  4ZI2 C;  1MMA A;  1ZHC A;  2IHR 1;  2M6B A;  3VKG A;  3ZC0 A;  2LOS A;  3BQI A;  2C0S A;  3CPZ A;  2M6I A;  4DR7 T;  3L8R A;  1KNZ A;  1OED B;  1N33 T;  4DV7 T;  2JQH A;  1US7 B;  5HXE A;  5FYM A;  1X9B A;  4IGU A;  2KSR A;  2EHO B;  2LSY A;  1GQE A;  3FZM B;  1T7S A;  3ZC1 A;  3ZYK A;  4EB6 E;  4AQG A;  3PUY F;  2UXB T;  2CMR A;  1BR2 A;  2DL1 A;  2WB5 A;  3KV4 A;  4MLK A;  1CUN A;  2C5I T;  3EVY A;  4O8S A;  4X1K E;  1FIO A;  5L4E A;  4J2C A;  5J2T E;  4OFZ A;  4EV6 A;  4HTE A;  5ABF B;  4QXH B;  4GK5 E;  4O2A E;  2YDS A;  4CQI A;  4TWH A;  4WZX A;  2D0T A;  3HA4 A;  4UV8 B;  4MBQ A;  2XAF B;  3UQ7 A;  4JI1 T;  3LBX B;  1MIY A;  2FJA A;  3SFE A;  2Z6E A;  5FXX A;  4BA9 A;  2UXD T;  3RLF F;  4AKG A;  2BKO A;  2Y6X A;  5L3C B;  1IBL T;  2RA1 A;  5LJM A;  2ES0 A;  4IL9 A;  2WS3 A;  2WU2 A;  2X9X A;  2J62 A;  3CVR A;  4PJN A;  4JYA T;  5LOV E;  4AQF C;  2PTF A;  4CI2 B;  4DUZ T;  4NUU A;  2E5V A;  2KLQ A;  1R8I A;  4ILB A;  4K0U A;  1N34 T;  1D1B A;  4LF5 T;  5BMV E;  2QVA A;  5AQI B;  5FKY A;  5LGN B;  2W00 A;  2WDV A;  3OBV E;  5IUX A;  4HWC A;  4AIU A;  2EHO D;  3PUZ F;  4PFO A;  1B7T A;  3L3P A;  5HEU A;  4HFB A;  2XQA A;  3PUQ A;  3KVB A;  2WZH A;  4P09 A;  4I50 E;  3NZP A;  3AA0 B;  3VKH A;  3AE7 A;  2HHH T;  4YHH T;  2JIW A;  4JI0 T;  2PJQ A;  1E2A A;  2MYS A;  3HR0 A;  3P7I A;  4TX5 A;  4UVA B;  2BKN A;  2LM9 A;  4HWD A;  4EXT A;  2PFV A;  4YT0 A;  5L47 A;  4AKI A;  2H7V C;  4MFR A;  3I9W A;  4BAY B;  2X0L B;  1YQ4 A;  3KVA A;  2NWB A;  3UT5 E;  2L8K A;  5L3F B;  2XTL A;  2K5B B;  2XM2 A;  3EHZ A;  2XQ6 A;  2E9X B;  2W63 A;  2BDE A;  3CX6 B;  1E7P A;  3S4U A;  1UUR A;  1W9R A;  4C90 A;  2XAG B;  3G06 A;  3O4X E;  4UEM A;  3QB5 A;  1U5P A;  2X68 A;  4ZZC A;  5LXT E;  3Q2M A;  2LRL A;  3AE4 A;  3EDU A;  3AEE A;  3E08 A;  1W0B A;  2YU2 A;  4U7Y A;  1KF6 A;  3OYZ A;  3I9Y A;  2M67 A;  2A3D A;  4HFD A;  4NPP A;  2UU9 T;  1W09 A;  4AIS A;  3BQK A;  4UIG A;  4X5T A;  5GON E;  1UX5 A;  4HE8 A;  2CLY B;  1HR0 T;  4UF0 B;  5AQQ B;  2BG9 A;  2K48 A;  3C51 A;  4GKJ T;  4IE0 A;  3M3Z B;  3UUX B;  4ZI2 D;  3ZN1 B;  3MA9 A;  3N2K E;  3UFG A;  5HYA A;  3ZEF B;  3N2G E;  3UU6 A;  2SPC A;  1MMD A;  3H3A A;  2Q9Q C;  2VVS A;  2CM0 A;  2W2U A;  5L3B B;  4IE7 A;  2IUB A;  5LYJ E;  5AQG B;  1WR6 A;  2CXL A;  3LK4 2;  3Q5X A;  4PNI A;  3TLT A;  4DV0 T;  4DV1 T;  1LVK A;  2ACX A;  2FUP A;  2KND A;  2KXP B;  2GK9 A;  2WDQ A;  2YKS A;  2W4X A;  3ESL A;  2B76 A;  2WWU A;  3P4S A;  3LBX A;  2IML A;  1YW0 A;  4PJM A;  1OED C;  3PTR B;  3Q9D A;  5FY0 A;  5IWA T;  2KWH A;  1WR0 A;  1NWM X;  1KFY A;  2PG8 A;  3AXJ A;  3ZPO A;  4U31 A;  3UUN A;  3HL6 A;  4QKN A;  4LF8 T;  5ABH A;  4DID B;  4YLH A;  3QB5 K;  3IBP A;  3AEC A;  4U72 A;  4EGW A;  5JDL A;  3O1J A;  3T1H T;  2H89 A;  4ZI3 C;  2XHE B;  3RYC E;  2I6H A;  4JI8 T;  1JNZ A;  4A56 A;  1HCI A;  3RQW A;  2X9H A;  4CXX A;  3PJA A;  3O1I A;  4E7Z A;  5LG3 A;  1D1C A;  4CXY A;  4JV5 T;  3ABV A;  3K1S A;  3A7M A;  5AQS B;  4JEU B;  3AE9 A;  4JUY A;  3U78 A;  1WCR A;  2Y48 B;  3HI2 A;  3PU8 A;  3VR9 A;  2DCF A;  4WBN E;  4ILC A;  5C2T A;  4DR5 T;  4LF4 T;  4H9S E;  3TLW A;  4LFA T;  3PV0 F;  2MTQ A;  4KUM B;  5FY7 A;  4JI7 T;  3B5M A;  3ZMU B;  3NZQ A;  1UGO A;  2LEH A;  3WI3 A;  4AKH A;  4KX6 A;  2FBW A;  4FJO A;  3MZK B;  3GMI A;  3MXZ A;  3ETU A;  4HFH A;  1WRD A;  5FY1 A;  4JI2 T;  3ZSS A;  2QRX A;  3O1H A;  3OVU A;  5EK3 A;  5LMU T;  1NEN A;  4UR9 A;  4CN4 A;  2YDQ A;  4DBQ A;  3QNU A;  1W0A A;  3AVS A;  1YKH B;  4A97 A;  1Z0P A;  5AFU L;  3ZMZ B;  5FMN A;  2Y8D A;  4HWF A;  2ZM6 T;  2IAK A;  5AQH B;  4JI6 T;  5AQP B;  4ILA A;  1OED A;  3AA1 B;  1QLB A;  1HNW T;  4LF6 T;  3K3N A;  1N32 T;  2K9A A;  3Q5D A;  2DI4 A;  2WP9 A;  4IRE A;  4LMJ A;  3LJC A;  2X0H A;  4JI4 T;  3ZJ1 A;  3JC6 D;  2NW9 A;  3HKE E;  3RRC A;  5AQJ B;  4DMW A;  4UVB B;  4PK6 A;  5CA0 E;  3N9O A;  3FHN A;  1YKE B;  2BS4 A;  4NXM T;  3X1D A;  3KBT A;  4G2A A;  2W67 A;  4OHF A;  2WDR A;  2HH7 A;  3CML A;  4YJ3 E;  2E5L T;  3C4Z A;  3EAM A;  3NBX X;  3RKG A;  1KK7 A;  3ZLI A;  3ZYM A;  2LSJ A;  3P4R A;  4N78 D;  2JQK A;  4PJL A;  1NAF A;  1BR0 A;  4H9Q C;  4OYK A;  4JI5 T;  1U4Q A;  2BG9 E;  2V5C A;  4XAX B;  5FXV A;  2WMN A;  2J47 A;  4YJ2 E;  4QHO A;  4YTN A;  2KWI B;  4HEA A;  4KHZ F;  3SOL A;  2V6Y B;  3LDQ B;  3VHL A;  5HAX A;  2VKD A;  2XSB A;  3AE1 A;  1FJG T;  2H3R A;  5KMG P;  4TV8 E;  4JBW F;  4AQY T;  4H9R C;  4ZXL A;  1OED E;  3R6N A;  2ZMA A;  3UU5 A;  4IDZ A;  2W0G A;  4IDP A;  2BS2 A;  5LB7 B;  2FJD A;  5JR9 A;  1Z8U A;  3OJA A;  2XAQ B;  4DR1 T;  1OWA A;  3VRA A;  2X9Y A;  1V9D A;  3DP7 A;  3JCF A;  3ZT7 A;  4IHJ E;  4DV3 T;  2WBL A;  4CN6 A;  2Q9Q A;  4GOU A;  3QOF A;  5AQF B;  3RYH E;  5C3J A;  3MK7 C;  3NRY A;  1NEK A;  2NP9 A;  3GN5 A;  3P50 A;  1L0V A;  4HN9 A;  3KFW X;  3EUH A;  5IYZ E;  2OLT A;  5AQO B;  4QH5 A;  1HX8 A;  3CK6 A;  3DTO A;  2OA5 A;  3KBU A;  3OPC A;  5CB4 E;  2LLY A;  1BR1 A;  5JH7 E;  2I59 A;  5L3D B;  3AEB A;  3RI5 A;  1M62 A;  4QXB B;  1X79 A;  3C64 A;  5JRE A;  1ZEE A;  1SE7 A;  4EAH A;  3ONX A;  2CA5 A;  2ZM2 A;  3AEF A;  3DJB A;  3T1Y T;  2WM9 A;  3P4W A;  5JRC B;  4ZS3 A;  1UK5 A;  3I0O A;  2BVM A;  2LM2 A;  5FL1 A;  3RX6 A;  2CHN A;  4MHC A;  5JR9 B;  5LHG B;  4XBF B;  1XDO A;  2JPF A;  5LP6 E;  2IIU A;  2YOE A;  3ZN0 B;  3E22 E;  5CA1 E;  3V5U A;  2UXC T;  2DLR A;  5AQR B;  3A5X A;  3M65 A;  3ZMV B;  3CQX C;  2BKP A;  3HKC E;  3UU3 A;  3QUJ A;  4L9I A;  5HXH A;  1FMW A;  4I4T E;  2NW7 A;  4ZI3 D;  4YFS A;  5CGM A;  5LG4 A;  4P0A A;  4DND A;  2MBG A;  2FJE A;  2WCA A;  2UUB T;  4DVD A;  1ZV4 X;  2L3L A;  2V7M A;  3MAC A;  3JAE A;  1XZY A;  5IHY A;  1QSD A;  4IE5 A;  3LG7 A;  3RC8 A;  1IJ5 A;  4G63 A;  2LKH A;  5ABF A;  4ZOL E;  4HFE A;  1Y01 A;  5ABE A;  4O2B E;  2WY2 A;  2ODU A;  1ZOY A;  2YN6 A;  4YXD A;  2Q9Q D;  4IDQ A;  2WAU A;  3AEG A;  4WNK A;  3ZJ2 A;  2JRK A;  2W66 A;  2V6X A;  2CLY C;  1UUS A;  2J4G A;  4DMV A;  4X64 T;  2XSA A;  2LOP A;  4JI3 T;  3FB2 A;  4TNW A;  4YTM A;  3AE5 A;  3D0T A;  5F5W A;  4CXW A;  5DAB A;  2UXX B;  3U3I A;  1CHU A;  4KMC A;  1J1J A;  2V5D A;  3AVR A;  1MMN A;  3EAB A;  5AQL B;  1D0Y A;  2CE7 A;  2JQQ A;  2PBI A;  3H37 A;  2E9X A;  2KMF A;  5FXW A;  1N36 T;  3CWZ B;  4ADZ A;  1G73 A;  3ANW B;  4TV9 E;  4V1A v;  4X1I E;  3UU4 A;  2AE9 A;  1E1H B;  2XQY A;  4DBR A;  2JMK A;  2VL8 A;  2BS3 A;  4UF0 A;  3TLS A;  4TZ4 C;  3UUL A;  1T98 A;  5LA6 E;  1I94 T;  4LFB T;  2CHO A;  3I1A A;  4U2Y A;  2FJB A;  2EHO A;  3AAA B;  3IHR A;  2X66 A;  4I0U A;  5J1G A;  1S94 A;  2V7I A;  1D0X A;  5DQV A;  4EYU A;  5JQG E;  2VB6 A;  2C5J A;  3CX7 B;  3F31 A;  4LML A;  4AKL A;  3O9X A;  3ZCI A;  2CWY A;  5AQU B;  3LFM A;  1HFA A;  3ZYL A;  2WQY A;  4DUY T;  3C4X A;  5ABG A;  2XQ9 A;  3FBL A;  3V5S A;  2A72 A;  5ADX L;  1DU2 A;  4ZZB A;  4WW0 A;  2IW5 B;  5AQN B;  3MJX A;  2WWV A;  2ODV A;  4GYR A;  5J0Z A;  4AI6 A;  1LVF A;  4L5G A;  3RPU A;  4ASK A;  4HFV A;  3N2O A;  1KEY A;  4OYJ A;  5TAO A;  4EED A;  1IAP A;  4DV5 T;  4EOZ B;  1HTJ F;  2BZB A;  3N9L A;  4YSZ A;  4BJN A;  3HKD E;  2KIN B;  4ILU A;  4X65 T;  2D2S A;  3J9X 1;  1H7C A;  2CPT A;  1HF8 A;  4QH4 A;  2C5K T;  2K3W A;  5HEO A;  5JDG A;  1ZP0 A;  4M1P A;  5L2L A;  3ZMS B;  2K24 A;  4ZHQ E;  2BBH A;  1IZN B;  2XZE A;  3UFE A;  5L3G B;  1OXZ A;  3AE8 A;  2NTY A;  5LMN T;  3PDY A;  2LSI A;  4FI5 A;  1FEW A;  4P1N A;  4U33 A;  1KNP A;  2LSK A;  3F2E A;  2JQ9 A;  4PK4 A;  3ONL C;  5L4H A;  2XAH B;  2R6G F;  3QC9 A;  5BR8 T;  2HPL A;  4LFC T;  3K3O A;  2ZM0 A;  1HNX T;  1WLX A;  2E8I A;  3ANW A;  3C50 A;  1J5E T;  1IJ6 A;  1SUM B;  2X51 A;  4IT4 A;  1MMG A;  3SRZ A;  3PU3 A;  2V7L A;  1WFD A;  3CIR A;  4DR2 T;  2XQ3 A;  3LK3 B;  3ZT5 A;  3LK2 B;  5J2U E;  2CXD A;  4NXN T;  3B13 A;  5LGU B;  1UCU A;  4A98 A;  4ZI7 E;  5LHH B;  2WMO A;  4AQF A;  3I0Q A;  4O4J E;  4PAG A;  3L39 A;  2L9Q A;  2UXN B;  3WAJ A;  4YY3 T;  2BBJ A;  1LRZ A;  2LKG A;  2LRK A;  2N1G A;  5JDF A;  4X66 T;  4PFP A;  4DV2 T;  2X67 A;  4CI3 B;  1T72 A;  5H6R B;  1VOM A;  5HEH A;  2XQ4 A;  4LF7 T;  4HGA A;  5DJQ C;  5KDM C;  1SA0 E;  2A9U A;  4O4L E;  1XWM A;  2CEA A;  2KT9 A;  2N9D A;  3HKB E;  1Y64 B;  4TWD A;  2VAS A;  3PUV F;  4UEL A;  2DHR A;  4IIJ E;  4NIQ A;  5LBQ B;  3UTK A;  3W15 B;  3RIA A;  3GN5 B;  3PUW F;  4KI0 F;  4OK0 A;  3AE3 A;  4WYV A;  3CQC B;  3FBZ A;  2IDO B;  1WYB A;  2WU5 A;  4CZZ B;  3AA6 B;  5HXC A;  2MAW A;  1FMV A;  1M7K A;  2G0U A;  2WZI A;  3SFD A;  2LHR A;  4KBM B;  5FL0 A;  4ZEY A;  2V7K A;  4UXN B;  2XQ5 A;  3RGL A;  1HG2 A;  1YD8 G;  1LKX A;  2IC9 A;  4EYY R;  4X62 T;  2IC6 A;  3QK6 A;  2E2A A;  3KDS E;  4B3R T;  5HEG A;  4IST A;  3AEA A;  5LBM A;  2CXF A;  4GK0 E;  3N9P A;  5HWX A;  2E9X C;  3AE2 A; 
#chains in the Genus database with same CATH homology
 2CPT A;  2XZE A;  3K1S A;  2V6Y A;  4CN1 A;  4WZX A;  2V6Y B;  1WCR A;  4P1N A;  2A9U A;  2CRB A;  2WY2 A;  4U7I A;  5LB7 B;  4A5X A;  4U33 A;  4U3C A;  3ZST A;  2JQ9 A;  4NIQ A;  2W2U A;  5CJ5 A;  3ZT7 A;  2V6X A;  4CN6 A;  4IT4 A;  4U2Y A;  2WWV A;  1WFD A;  4ZEY A;  2JQH A;  3ZT5 A;  3ZSS A;  2JQK A;  1WR0 A;  4CN4 A;  5FVK A;  3EAB A;  4U31 A;  2LRL A;  3ZT6 A;  4U7Y A;  5CGM A;  5FVL A;  1YXR A;  2RPA A;  4U2Z A;  2MPK A;  2DL1 A;  2LRK A;  2K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...