2V6ZM

Solution structure of amino-terminal domain of human dna polymerase epsilon subunit b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
b'MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQESS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE EPSILON SUBUNIT 2
publication title The Solution Structure of the Amino-Terminal Domain of Human DNA Polymerase Epsilon Subunit B is Homologous to C-Domains of Aaa+ Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 75
sequence length 75
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF12213 Dpoe2NT DNA polymerases epsilon N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2v6zM00
3PVSA 1G4AE 1X37A 3GLGA 4KO8A 1J7KA 5C18A 3SC3A 1IQPA 5EXPA 2X8AA 5FTJA 4EIWA 1IN8A 1KSFX 1IY1A 4L16A 3GLGB 3GLFB 1OJLA 5EXSA 2DVWB 4QHSA 3VLFB 5EP4A 3UK6A 4QNRA 1JQJC 4FD2A 4WW0A 1IN6A 4FWGA 5EXTA 3ZH9B 4FWDA 5EP2A 1IXRC 5EP3A 4D82A 2CE7A 4LY6A 2QPAA 3M6AA 4A3VB 1C1KA 4QHTA 3EIHA 1NJFA 2DWZB 4FCTA 1HQCA 2C99A 1IY2A 4LJ8A 2CHVA 2C9CA 3AJIB 1NSFA 2XSZA 3HWSA 4D81A 2KRKA 1W5SA 4Z8XA 1LV7A 3K1JA 1SXJC 4LRTA 1NY6A 4KLNA 4LJAA 2R62A 1IY0A 3H4MA 2C9OA 4LJ6A 1SXJA 5FTNA 1W5TA 5EP1A 3KDSE 4KODA 3WHKA 3D8BA 4I4LA 1UM8A 3M0EA 1XXHA 1IXSB 2QBYA 2CHGA 1IN4A 2BJWA 5JI3E 1SXJB 2DZNB 2V6ZM 2CEAA 1SXJE 5EQTA 3U5ZB 1XXHB 2QBYB 1IM2A 1JR3A 3R8FA 1DO2A 2ZAMA 2ZAOA 4JN6A 4FWHA 1S3SA 2RKOA 3HU1A 4FCVA 3SYLA 4L4UA 5FTMA 3B9PA 2FNAA 3U61B 3SYKA 1R7RA 1XWIA 3HU3A 2CHQA 3WHLA 1OFIA 3KW6A 3DZDA 4QOSA 1HQYE 5FTLA 1KYIA 4D80A 1NY5A 3U60B 1L8QA 4LGMA 1NJGA 1R6BX 4FW9A 1G41A 4LCBA 4L15A 1HT1E 2Z4SA 4LRSA 1E94E 5JI2E 4LJ7A 2C98A 2DZOB 5DYGA 3GLHA 3PFIA 1QZMA 4GITA 4LJ9A 4LJ5A 3GLFA 3GLHB 4QNMA 5EXXA 3CF0A 2HCBA 1NVMA 1HT2E 2C96A 1QVRA 3BOSA 1SXJD 5DYIA 1IN7A 3CF2A 1FNNA 4LJ4A 1DO0A 4ZPXA 3GLIA 2V1UA 1IN5A 1G3IA 2QENA 5C1BA 1D2NA 4I81A 1E32A 1OFHA 2ZANA 4FCWA 5FTKA 3MHVC 3GLIB 3HU2A 2DHRA 2BJVA 2QZ4A 1JR3D 3EIEA 1IXZA 4LZZA 3PXGA 2QP9X 2Z4RA 2R65A 2VIIA 3VFDA 2XSZD
chains in the Genus database with same CATH superfamily
2JY5A 3TL4X 1G4AE 2Z7JA 2EKFA 1TH2A 4KO8A 1J7KA 1DV0A 3TPZA 1DGHA 2UUAM 4EIWA 1IN8A 3KFUG 4YY3M 1OJLA 3VLFB 1GVNA 1WHCA 4PDIA 4QNRA 1JQJC 4FD2A 4WW0A 2OPFA 3LCUA 2DAIA 4OW0A 4ANRA 3UGJA 3GLFE 2H1RA 1IXRC 2HKJA 4B3TM 2HHHM 4A3VB 2JY8A 1NV9A 4MB7A 2DNAA 1QAOA 2DWZB 4FCTA 4MH0E 1HNXM 1GKIA 2CP8A 3SMSA 1F4IA 1IY2A 3DOAA 3K9PA 2KHHA 4IBEA 2DENA 4XK8F 3FE3A 4M0DA 3W68A 1HNWM 2KW0A 3MMPA 4I5SA 3SMPA 1NSFA 2AHMA 1ZV1A 4OVZA 1EFUB 2EKKA 2KRKA 1YLAA 2M5ZA 1R5LA 1ZMVA 3FTCA 4W5WA 1NY6A 4Z8XA 5KQDA 2XLJA 2F5QA 1ZMUA 2LVOC 3RGSA 3E9SA 1GL6A 3I51A 3K92A 3KDSE 4JI2M 4WP2A 1XNQM 1NHGC 2HL7A 1IXSB 2CHGA 3HY5A 3THGA 5BPVA 1MJGM 5JI3E 1WR1B 2Y21A 1L2CA 2DWNA 1FJGM 4B7HA 1QAQA 1UFZA 1SXJE 5EQTA 2Y0TA 4DV1M 3T1HM 1K3WA 3R8FA 4G4NA 1NHWC 1DO2A 2L09A 3GRYA 1HJPA 3E4RA 3CF6E 1VEJA 1Z5AA 3U61A 4RKUF 2MR9A 3I01M 4JN6A 3J80S 4UN2B 1L2BA 4BB9A 3I4VA 2FNAA 2JZ0A 3GRVA 4JI8M 1XWIA 5L8RF 2ZTDA 1J09A 4G4QA 3JR5A 4L6V6 4NSOB 1HQYE 5KQ8A 3SHGB 1DGGA 4IJFA 4LGMA 3HZJA 2QCUA 1E9SA 1Y8GA 3CTWB 2LTUA 1AUAA 1Q02A 1SG9A 3FUVA 3SFZA 3HHZA 3C58A 5IT9S 2KRUA 3FRHA 4LF9M 4NSRA 4LRSA 1E94E 1QQWA 2ZBKB 3LW5F 3RFWA 2EJSA 3OTOM 2FFJA 2F4VM 3FUWA 4R3DA 4MGHA 2DZOB 4LF8M 3GQ5A 4GITA 1QUSA 4X64M 1QDTA 3KSXA 2XZFA 2D7EA 3JAMS 3GLFA 2RRUA 4Z6YA 1N36M 2GQFA 3CF0A 3KOZE 1RU3A 2HCBA 3LCVB 3L26A 2LVQD 2O25A 4LFCM 1T43A 1QZEA 1QVRA 2NQ8C 4M9XA 2LVNC 1I94M 1OIZA 1QDRA 4LJ4A 1NNUC 4IBBA 4AG6A 4AW4A 4AZFA 3KS8A 2D7HA 1TH4A 2JXNA 4I81A 3ZQJA 1WGLA 1VDDA 1E32A 3FUXA 3TE6A 3TWMA 3GQ4A 4DR6M 3LVVA 3U6QA 5KPRA 3K2LA 3L28A 3EIEA 2BJVA 3J7AS 3TQSA 2KDLA 1IBLM 4LZZA 3KS4A 1JB0F 3PXGA 1PM5A 2K47A 2XSZD 1NNJA 2R4JA 3ILKA 3KOYE 2LXEA 3GLGA 3NBXX 3HHYA 3E21A 1XB2B 3GPPA 3QWLA 1IQPA 3T15A 2UXBM 2HAKA 1G71A 5FTJA 1KSFX 4HLQA 2JNHA 5EXSA 2VF8A 3QYBA 1DGHB 1VG5A 2VF7A 4FWGA 5EXTA 1XMOM 3NWLA 2Z8YM 5EP2A 5EP3A 3A42A 4D82A 4G4RA 2L2DA 1OKSA 3A46A 2B3TA 1C1KA 3B7NA 2F5NA 4IBDA 4OX9M 4IBJA 4GIPA 1HQCA 4DR2M 2WZJA 2XFTA 4LJ8A 2UXDM 2CHVA 3T1YM 2D7GA 5DNYA 3SASA 5ITXE 3B7QA 5ITTA 5KO3A 5BR8M 2Q2EB 3PNVA 2DAGA 5H37D 2KNAA 4LFBM 1W5SA 1LV7A 4CIZA 3K1JA 2L4FA 2RGHA 4OVZB 4G6ZA 4IBKA 3FKEA 2C9OA 2J5YA 2V1CA 2WSCF 5ITRA 2DXIA 1OAIA 2I7PA 3I04M 5EP1A 1PJJA 2MH8A 2OO9A 3L27A 3D8BA 4P16A 3WHKA 2EA0A 1KFVA 4M9SA 3M0EA 1XXHA 2QBYA 4B3SM 4DUZM 2DWLA 2R0IA 1C7YA 4WURA 5EJCA 2CRUA 3VDPA 2LNHC 2R45A 3HKPA 4PT5A 2MGWA 1JR3A 4XBOA 4JI1M 4NRVA 3FUUA 2YNMD 2ZAMA 2ZAOA 3LQRA 2RKOA 2H5XA 2KZSA 4CISA 5ITYA 3U61B 3B74A 3FD9A 3SHFA 1TDZA 1L1TA 2CHQA 1T3TA 3DZDA 1AIPC 3U6PA 3C3DA 1KYIA 4D80A 1NY5A 1WXQA 2J7OA 4DV3M 1Z5BA 3K9OA 1HT1E 4L15A 2Z4SA 5KPZA 1N77A 4TUWA 1EIJA 1V92A 1TGUA 1PRBA 1TDHA 4LJ7A 2C98A 1HNZM 3HX3A 4M0WA 3R9XB 5FLXS 3GLHA 1N33M 4NL4H 1YSYA 4F2LA 2K6BA 3KVWA 4LJ9A 2VDBB 4LGYA 2L6OA 4IBFA 4NXMM 2OOAA 2Y20A 2LVAA 2Z3XA 2BWEA 2YQZA 3AOGA 4L78A 3W0FA 2MJ5B 1Z6TA 3HJQA 3LVWA 3L2AA 3HJ8A 1FNNA 1PGYA 2XEPA 4LF4M 2V1UA 2QENA 1ORYB 3UMMA 2KEBA 4MGIE 4FCWA 5FTKA 3HU2A 2XFSA 3SAUA 4R71A 3K8ZA 3TWKA 1K82A 4BLCA 3IECA 4DR5M 1L2DA 2QP9X 2CWBA 3H4JA 2LH0A 2XGNA 5C1BA 1P3QQ 4PCZA 1N78A 3VKGA 4II7A 1OQYA 4X62M 1V33A 1X37A 2UUBM 2I7NA 3SC3A 2R44A 3BBZA 2X8AA 4REZA 3U6EA 2XZUA 3VKHA 2OQ4A 4K0KM 4GEWA 3GLGB 4F1IA 2DVWB 2FE8A 2GNOA 3UK6A 1TF0B 1IN6A 2M60A 3NBIA 3U6DA 4OU7A 4GKKM 2JA2A 2JP7A 2N35A 4P17A 4MGYE 2QPAA 3F92A 3LMMA 3JR4A 2VQFM 4DV5M 1A5TA 4KT0F 4QHTA 1VDLA 2APLA 1NJFA 5A2QS 1R2YA 1HR0M 2C99A 2KNZA 3J81S 3FTFA 4AKGA 3GLIE 2K0BX 4GH9A 4AI6A 4MM3B 4S12A 3L29A 1R4GA 3GRRA 2XSZA 4G4OA 3HWSA 4IBIA 3A45A 3FRIA 1PJSA 1YUBA 3V76A 1I4WA 1SXJC 4KLNA 2EUCA 1V34A 1ZMWA 4LJAA 4AKIA 2KZUA 4GKJM 1IY0A 4LF5M 1D0KA 1SXJA 1W5TA 1OTRA 2W82A 1Q39A 2O01F 4JI0M 2KXEA 2VQEM 4LF6M 1UM8A 2YR0A 3U5ZA 1IFYA 1DGBA 2FS1A 2BJWA 4DUYM 1GL7A 2V6ZM 3RGPA 3GO8A 2DHYA 3U6SA 2L7IA 1Z5CA 4YHHM 2F5OA 1XXHB 2QBYB 1CUKA 3UJNA 1G59A 3AOEC 2R6FA 2JUJA 5GKNA 3AKZA 2UU9M 3A98B 3AOEA 4FCVA 3SYLA 3Q8GA 3ZC7B 4AQYM 4L4UA 2J7NA 4RF1A 3B9PA 3GPYA 1R7RA 2JZ1A 3U60A 3HU3A 2EO2A 2E5LM 3T6PA 1OFIA 4QOSA 1N32M 3SAVA 4IJEA 4IBCA 2RGOA 1L8QA 2R46A 3MJ5A 4G3OA 4R7GA 1G41A 4LCBA 3T38A 2ERCA 4MGZE 3SARA 1Z59A 2JY7A 4Q7JA 4CGYB 4JYAM 3U6MA 1YE9A 3FUTA 5JI2E 2DWMA 4B08A 1QANA 1MN3A 4PDGA 3W67A 2P5TA 1NV8A 3J7BA 1Q3BA 3PFIA 3U6LA 4GC5A 2DAEA 4JI4M 4GHLA 4B7GA 1ZAEA 1MU5A 4LJ5A 3VK8A 3GLHB 2DAKA 1H6UA 2CUZA 2LWXA 5ITQA 1QYRA 5FSWA 5LMNM 4DR3M 3FTEA 1HT2E 1MX0A 2C96A 3BOSA 2DI0A 4NRWA 3DFZA 1IN7A 2G8LA 1Q3CA 3GLIA 1IN5A 4DV7M 2F5SA 1N34M 3MK6A 1OFHA 7CATA 4BBAA 1BVSA 4HL4A 4CJ6A 2DHRA 3HHXA 1JR3D 5DFLA 1XMQM 4JXJA 3TWLA 2ZM6M 1IXZA 2UXCM 4NC6A 4JI3M 2R65A 3E46A 2VIIA 3VFDA 4X65M 2L7HA 3DA1A 4RF0A 1XC8A 4LG2A 4GHAA 2LHGA 3PVSA 4IBGA 4LZJA 3CGWA 3I4YA 1R2ZA 4HEOA 2BWBA 5C18A 3L25A 5EXPA 4DV4M 3GPUA 2QNJA 4QOZC 3GRUA 1VQ1A 1K3XA 1IY1A 2ZTCA 4L16A 3GLFB 1OAOC 4QHSA 2CV2A 5EP4A 4NXNM 3GLGE 2O5RA 3ZH9B 3GPXA 3VK7A 3C3EA 4B3RM 4FWDA 1N75A 2DZLA 3AV0A 2CE7A 2R18A 4LY6A 1GLNA 3M6AA 3UZUA 5ITXA 1J5EM 2LVPC 3EIHA 4B7FA 3IHPA 1WIVA 3U6OA 1DGFA 4JI5M 4DBGB 1GO5A 1L1ZA 2CV1A 2BNKA 5IWAM 2C9CA 4DV0M 2F5PA 4PD2A 4AG5A 3AJIB 3FYCA 3FTDA 3PNYA 1D0MA 1NO1A 4KHPM 3GP1A 1PJTA 2FOIC 4D81A 2WSEF 2G5GX 3HGIA 5E6JA 4CHTB 1TR8A 3LQQA 8CATA 3HJSA 3RE8A 3C9PA 3IG8A 4LRTA 2X49A 2HWJA 2R62A 1GJTA 1IXSA 3VDUA 3H4MA 3QAUA 2A5YB 4LJ6A 5FTNA 4GRIA 2XH9A 4KODA 5KPTA 1WJ7A 2QQ8A 1E9RA 2L4EA 4I4LA 3HHWA 1IN4A 1OIPA 1SXJB 2DZNB 5LMUM 2KA6B 2CEAA 4I8OA 4L8RC 4GC9A 3KOXE 3U5ZB 3FYDA 1IM2A 2UUCM 2G3QA 1TTEA 1XXHE 4DV2M 4DR4M 4IIWA 3QYEA 4FWHA 4DR1M 1S3SA 2FH0A 3HU1A 3J27B 5E26A 5FTMA 3U6CA 3Q8XA 5ITUA 1GABA 3SYKA 1JR3E 4JI7M 1D0LA 1QAMA 2KNVA 3KW6A 3WHLA 4B3MM 1VEKA 4RNAA 5FTLA 2CV0A 1EE8A 3SAWA 3U60B 3SBJA 4XGIA 1NJGA 2Y0QA 5IZ7D 1R6BX 2JWSA 4FW9A 4LFAM 1ZQ9A 4X66M 2QHOB 2WSFF 1IBMM 1VEGA 2K9DA 3D8LA 1PJQA 1GJSA 1LTMA 1TH3A 5DYGA 1QZMA 4JI6M 1T6OA 3AL0C 4AKHA 3KSJA 4LF7M 4M9ZA 4QNMA 4DV6M 5EXXA 3J2PB 3GLHE 1NVMA 2YFQA 4FVMA 1SXJD 1QUTA 1PJIA 5DYIA 1G8PA 3B7ZA 3CF2A 3SATA 2JY6B 1DO0A 3KP0E 4ZPXA 2DAMA 2LBCA 1G3IA 3AFHA 4Y28F 3KP1E 5IREB 1D2NA 2C5RA 4GMQA 2X4AA 2QSFX 4JV5M 2ZANA 3BXWA 2MROB 3W0LB 3IG5A 1XNRM 3MHVC 3ZCBB 3KOWE 3GQ3A 3GLIB 2CFOA 1IBKM 4DR7M 2QZ4A 2LHCA 1XHBA 2XF3A 2OOBA 3B89A 2Z4RA 4NOOB 2DKLA 5F3WA 3M7GA 4ITQA 2R4EA 3KXEC 1WGNA 4MGKE
chains in the Genus database with same CATH topology
3TL4X 1G4AE 2Z7JA 1TH2A 4KO8A 1J7KA 3TPZA 1DGHA 2UUAM 4EIWA 1IN8A 3KFUG 4YY3M 1OJLA 3VLFB 1GVNA 4PDIA 4QNRA 1JQJC 4FD2A 4WW0A 2OPFA 4OW0A 3UGJA 2H1RA 1IXRC 2HKJA 4B3TM 2HHHM 4A3VB 4MB7A 1QAOA 2DWZB 4FCTA 4MH0E 1HNXM 1GKIA 3SMSA 1IY2A 3DOAA 4IBEA 1HNWM 4M0DA 2KW0A 4I5SA 3SMPA 1NSFA 2AHMA 4OVZA 2KRKA 2M5ZA 4Z8XA 3FTCA 4W5WA 2F5QA 1NY6A 5KQDA 2XLJA 3RGSA 3E9SA 1GL6A 3I51A 3K92A 3KDSE 4JI2M 1XNQM 1NHGC 2HL7A 1IXSB 2CHGA 3THGA 5BPVA 5JI3E 1L2CA 2Y21A 1FJGM 2DWNA 4B7HA 1QAQA 1SXJE 5EQTA 2Y0TA 4DV1M 3T1HM 1K3WA 3R8FA 4G4NA 1NHWC 1DO2A 2L09A 3GRYA 3E4RA 3CF6E 1Z5AA 3U61A 3J80S 4JN6A 1L2BA 4BB9A 3I4VA 2FNAA 3GRVA 4JI8M 1XWIA 1J09A 4G4QA 3JR5A 4NSOB 1HQYE 5KQ8A 3SHGB 1DGGA 4IJFA 4LGMA 2QCUA 1E9SA 3HHZA 3CTWB 3FUVA 3C58A 3SFZA 5IT9S 2KRUA 4LF9M 4NSRA 4LRSA 1E94E 1QQWA 2ZBKB 3OTOM 3RFWA 2FFJA 2F4VM 3FUWA 4R3DA 4MGHA 2DZOB 4LF8M 3GQ5A 4GITA 4X64M 3KSXA 2XZFA 2D7EA 3JAMS 3GLFA 4Z6YA 1N36M 3CF0A 3KOZE 2HCBA 3L26A 4LFCM 1QVRA 2NQ8C 4M9XA 1I94M 4LJ4A 1NNUC 4IBBA 4AG6A 4AW4A 4AZFA 3KS8A 2D7HA 1TH4A 4I81A 1VDDA 1E32A 3FUXA 3TE6A 3TWMA 3GQ4A 4DR6M 3LVVA 3U6QA 5KPRA 3L28A 3K2LA 3EIEA 2BJVA 3J7AS 3TQSA 1IBLM 4LZZA 3KS4A 3PXGA 1PM5A 2K47A 2XSZD 1NNJA 2R4JA 3ILKA 3KOYE 2LXEA 3GLGA 3HHYA 3GPPA 3QWLA 1IQPA 3T15A 2UXBM 5FTJA 1KSFX 4HLQA 5EXSA 1DGHB 4FWGA 5EXTA 1XMOM 3NWLA 5EP2A 5EP3A 3A42A 4D82A 4G4RA 3A46A 1C1KA 2F5NA 4IBDA 4OX9M 4IBJA 4GIPA 1HQCA 4DR2M 2XFTA 4LJ8A 2UXDM 2CHVA 3T1YM 2D7GA 5DNYA 3SASA 5ITXE 5ITTA 5KO3A 5BR8M 2Q2EB 3PNVA 5H37D 4LFBM 1W5SA 1LV7A 3K1JA 2RGHA 4OVZB 4G6ZA 4IBKA 3FKEA 2C9OA 5ITRA 2V1CA 2DXIA 2I7PA 5EP1A 1PJJA 3L27A 4P16A 3WHKA 3D8BA 1KFVA 2EA0A 4M9SA 3M0EA 1XXHA 2QBYA 4B3SM 4DUZM 2DWLA 4WURA 5EJCA 3VDPA 2LNHC 2R45A 3HKPA 4PT5A 4JI1M 1JR3A 4XBOA 4NRVA 3FUUA 2YNMD 2ZAMA 2ZAOA 3LQRA 2RKOA 2KZSA 4CISA 5ITYA 3U61B 3FD9A 1TDZA 3SHFA 1L1TA 2CHQA 1T3TA 3DZDA 3U6PA 1KYIA 4D80A 1NY5A 1WXQA 2J7OA 4DV3M 1Z5BA 4L15A 1HT1E 5KPZA 2Z4SA 4TUWA 1N77A 1TGUA 1TDHA 4LJ7A 2C98A 1HNZM 4M0WA 3R9XB 5FLXS 3GLHA 1N33M 4NL4H 1YSYA 3KVWA 4LJ9A 4LGYA 2L6OA 4IBFA 4NXMM 2Y20A 2Z3XA 2YQZA 3AOGA 4L78A 3W0FA 1Z6TA 3HJQA 3LVWA 3L2AA 3HJ8A 1FNNA 2XEPA 4LF4M 2V1UA 2QENA 1ORYB 3UMMA 2KEBA 4MGIE 4FCWA 5FTKA 3HU2A 2XFSA 3SAUA 3K8ZA 3TWKA 1K82A 4BLCA 1L2DA 4DR5M 2QP9X 2LH0A 2XGNA 5C1BA 4PCZA 3VKGA 1N78A 4II7A 4X62M 1X37A 2UUBM 2I7NA 3SC3A 3U6EA 4REZA 2X8AA 3VKHA 2XZUA 2OQ4A 4K0KM 3GLGB 2DVWB 2FE8A 3UK6A 1IN6A 2M60A 3NBIA 3U6DA 4OU7A 4GKKM 2JA2A 4MGYE 2QPAA 3JR4A 3LMMA 2VQFM 4DV5M 4QHTA 1NJFA 5A2QS 1R2YA 1HR0M 2C99A 3J81S 3FTFA 4AKGA 4GH9A 4AI6A 4MM3B 4S12A 3L29A 3GRRA 2XSZA 4G4OA 3HWSA 4IBIA 3A45A 1YUBA 1I4WA 1SXJC 4KLNA 2EUCA 4LJAA 4AKIA 2KZUA 4GKJM 1IY0A 4LF5M 1SXJA 1W5TA 2W82A 1Q39A 4JI0M 2KXEA 2VQEM 4LF6M 1UM8A 2YR0A 3U5ZA 1DGBA 2BJWA 4DUYM 1GL7A 2V6ZM 3RGPA 3GO8A 3U6SA 2L7IA 1Z5CA 4YHHM 2F5OA 1XXHB 2QBYB 3UJNA 1G59A 3AOEC 5GKNA 3AKZA 2UU9M 3A98B 3AOEA 4FCVA 3SYLA 3ZC7B 4AQYM 4L4UA 2J7NA 4RF1A 3B9PA 3GPYA 1R7RA 3U60A 3HU3A 2EO2A 2E5LM 1N32M 1OFIA 4QOSA 3SAVA 4IJEA 4IBCA 2RGOA 1L8QA 2R46A 3MJ5A 4R7GA 1G41A 4LCBA 3T38A 2ERCA 4MGZE 3SARA 1Z59A 4CGYB 4JYAM 3U6MA 1YE9A 3FUTA 5JI2E 2DWMA 4B08A 1QANA 4PDGA 2P5TA 3J7BA 3U6LA 1Q3BA 3PFIA 4JI4M 4GC5A 4GHLA 4B7GA 1ZAEA 1MU5A 4LJ5A 3VK8A 3GLHB 1H6UA 2CUZA 2LWXA 5ITQA 1QYRA 5FSWA 5LMNM 4DR3M 3FTEA 1HT2E 1MX0A 2C96A 3BOSA 4NRWA 3DFZA 1IN7A 2G8LA 1Q3CA 3GLIA 1IN5A 4DV7M 2F5SA 1N34M 3MK6A 1OFHA 7CATA 4BBAA 4HL4A 2DHRA 3HHXA 1JR3D 1XMQM 2UXCM 4JXJA 3TWLA 2ZM6M 1IXZA 4JI3M 2R65A 4X65M 2VIIA 3VFDA 2L7HA 3DA1A 4RF0A 1XC8A 4LG2A 4GHAA 3PVSA 4IBGA 4LZJA 1R2ZA 3I4YA 5C18A 3L25A 5EXPA 4DV4M 3GPUA 4QOZC 3GRUA 1K3XA 1IY1A 4L16A 3GLFB 4QHSA 2CV2A 5EP4A 4NXNM 2O5RA 3ZH9B 3GPXA 3VK7A 4B3RM 4FWDA 1N75A 3AV0A 2CE7A 2R18A 4LY6A 1GLNA 3M6AA 3UZUA 5ITXA 1J5EM 3EIHA 4B7FA 3U6OA 1DGFA 4JI5M 1L1ZA 2CV1A 2BNKA 5IWAM 2C9CA 4DV0M 2F5PA 4PD2A 4AG5A 3AJIB 3FYCA 3FTDA 3PNYA 4KHPM 3GP1A 2FOIC 4D81A 3HGIA 2G5GX 4CHTB 5E6JA 8CATA 3LQQA 3HJSA 3RE8A 3IG8A 4LRTA 2X49A 2R62A 3VDUA 3H4MA 3QAUA 2A5YB 4LJ6A 5FTNA 4GRIA 2XH9A 4KODA 5KPTA 4I4LA 1E9RA 3HHWA 1IN4A 1SXJB 2DZNB 5LMUM 2KA6B 2CEAA 4I8OA 4L8RC 4GC9A 3KOXE 3U5ZB 3FYDA 1IM2A 2UUCM 4DV2M 4DR4M 4IIWA 4FWHA 4DR1M 1S3SA 3HU1A 3J27B 5E26A 5FTMA 3U6CA 3Q8XA 5ITUA 3SYKA 4JI7M 1QAMA 3WHLA 3KW6A 4B3MM 4RNAA 5FTLA 2CV0A 1EE8A 3SAWA 3U60B 3SBJA 4XGIA 1NJGA 2Y0QA 5IZ7D 1R6BX 4FW9A 4LFAM 1ZQ9A 4X66M 1IBMM 3D8LA 1TH3A 5DYGA 1QZMA 4JI6M 3AL0C 4AKHA 3KSJA 4LF7M 4M9ZA 4QNMA 4DV6M 5EXXA 3J2PB 1NVMA 2YFQA 4FVMA 1SXJD 1PJIA 5DYIA 1G8PA 3CF2A 3SATA 1DO0A 3KP0E 4ZPXA 1G3IA 3AFHA 5IREB 3KP1E 2C5RA 1D2NA 4GMQA 2X4AA 4JV5M 2ZANA 3W0LB 3IG5A 1XNRM 3MHVC 3ZCBB 3KOWE 3GQ3A 3GLIB 2CFOA 1IBKM 4DR7M 2QZ4A 1XHBA 2XF3A 2Z4RA 4NOOB 5F3WA 3M7GA 4ITQA 2R4EA 3KXEC 4MGKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVS A;  1G4A E;  1X37 A;  3GLG A;  4KO8 A;  1J7K A;  5C18 A;  3SC3 A;  1IQP A;  5EXP A;  2X8A A;  5FTJ A;  4EIW A;  1IN8 A;  1KSF X;  1IY1 A;  4L16 A;  3GLG B;  3GLF B;  1OJL A;  5EXS A;  2DVW B;  4QHS A;  3VLF B;  5EP4 A;  3UK6 A;  4QNR A;  1JQJ C;  4FD2 A;  4WW0 A;  1IN6 A;  4FWG A;  5EXT A;  3ZH9 B;  4FWD A;  5EP2 A;  1IXR C;  5EP3 A;  4D82 A;  2CE7 A;  4LY6 A;  2QPA A;  3M6A A;  4A3V B;  1C1K A;  4QHT A;  3EIH A;  1NJF A;  2DWZ B;  4FCT A;  1HQC A;  2C99 A;  1IY2 A;  4LJ8 A;  2CHV A;  2C9C A;  3AJI B;  1NSF A;  2XSZ A;  3HWS A;  4D81 A;  2KRK A;  1W5S A;  4Z8X A;  1LV7 A;  3K1J A;  1SXJ C;  4LRT A;  1NY6 A;  4KLN A;  4LJA A;  2R62 A;  1IY0 A;  3H4M A;  2C9O A;  4LJ6 A;  1SXJ A;  5FTN A;  1W5T A;  5EP1 A;  3KDS E;  4KOD A;  3WHK A;  3D8B A;  4I4L A;  1UM8 A;  3M0E A;  1XXH A;  1IXS B;  2QBY A;  2CHG A;  1IN4 A;  2BJW A;  5JI3 E;  1SXJ B;  2DZN B;  2V6Z M;  2CEA A;  1SXJ E;  5EQT A;  3U5Z B;  1XXH B;  2QBY B;  1IM2 A;  1JR3 A;  3R8F A;  1DO2 A;  2ZAM A;  2ZAO A;  4JN6 A;  4FWH A;  1S3S A;  2RKO A;  3HU1 A;  4FCV A;  3SYL A;  4L4U A;  5FTM A;  3B9P A;  2FNA A;  3U61 B;  3SYK A;  1R7R A;  1XWI A;  3HU3 A;  2CHQ A;  3WHL A;  1OFI A;  3KW6 A;  3DZD A;  4QOS A;  1HQY E;  5FTL A;  1KYI A;  4D80 A;  1NY5 A;  3U60 B;  1L8Q A;  4LGM A;  1NJG A;  1R6B X;  4FW9 A;  1G41 A;  4LCB A;  4L15 A;  1HT1 E;  2Z4S A;  4LRS A;  1E94 E;  5JI2 E;  4LJ7 A;  2C98 A;  2DZO B;  5DYG A;  3GLH A;  3PFI A;  1QZM A;  4GIT A;  4LJ9 A;  4LJ5 A;  3GLF A;  3GLH B;  4QNM A;  5EXX A;  3CF0 A;  2HCB A;  1NVM A;  1HT2 E;  2C96 A;  1QVR A;  3BOS A;  1SXJ D;  5DYI A;  1IN7 A;  3CF2 A;  1FNN A;  4LJ4 A;  1DO0 A;  4ZPX A;  3GLI A;  2V1U A;  1IN5 A;  1G3I A;  2QEN A;  5C1B A;  1D2N A;  4I81 A;  1E32 A;  1OFH A;  2ZAN A;  4FCW A;  5FTK A;  3MHV C;  3GLI B;  3HU2 A;  2DHR A;  2BJV A;  2QZ4 A;  1JR3 D;  3EIE A;  1IXZ A;  4LZZ A;  3PXG A;  2QP9 X;  2Z4R A;  2R65 A;  2VII A;  3VFD A;  2XSZ D; 
#chains in the Genus database with same CATH topology
 2JY5 A;  3TL4 X;  1G4A E;  2Z7J A;  2EKF A;  1TH2 A;  4KO8 A;  1J7K A;  1DV0 A;  3TPZ A;  1DGH A;  2UUA M;  4EIW A;  1IN8 A;  3KFU G;  4YY3 M;  1OJL A;  3VLF B;  1GVN A;  1WHC A;  4PDI A;  4QNR A;  1JQJ C;  4FD2 A;  4WW0 A;  2OPF A;  3LCU A;  2DAI A;  4OW0 A;  4ANR A;  3UGJ A;  3GLF E;  2H1R A;  1IXR C;  2HKJ A;  4B3T M;  2HHH M;  4A3V B;  2JY8 A;  1NV9 A;  4MB7 A;  2DNA A;  1QAO A;  2DWZ B;  4FCT A;  4MH0 E;  1HNX M;  1GKI A;  2CP8 A;  3SMS A;  1F4I A;  1IY2 A;  3DOA A;  3K9P A;  2KHH A;  4IBE A;  2DEN A;  4XK8 F;  3FE3 A;  4M0D A;  3W68 A;  1HNW M;  2KW0 A;  3MMP A;  4I5S A;  3SMP A;  1NSF A;  2AHM A;  1ZV1 A;  4OVZ A;  1EFU B;  2EKK A;  2KRK A;  1YLA A;  2M5Z A;  1R5L A;  1ZMV A;  3FTC A;  4W5W A;  1NY6 A;  4Z8X A;  5KQD A;  2XLJ A;  2F5Q A;  1ZMU A;  2LVO C;  3RGS A;  3E9S A;  1GL6 A;  3I51 A;  3K92 A;  3KDS E;  4JI2 M;  4WP2 A;  1XNQ M;  1NHG C;  2HL7 A;  1IXS B;  2CHG A;  3HY5 A;  3THG A;  5BPV A;  1MJG M;  5JI3 E;  1WR1 B;  2Y21 A;  1L2C A;  2DWN A;  1FJG M;  4B7H A;  1QAQ A;  1UFZ A;  1SXJ E;  5EQT A;  2Y0T A;  4DV1 M;  3T1H M;  1K3W A;  3R8F A;  4G4N A;  1NHW C;  1DO2 A;  2L09 A;  3GRY A;  1HJP A;  3E4R A;  3CF6 E;  1VEJ A;  1Z5A A;  3U61 A;  4RKU F;  2MR9 A;  3I01 M;  4JN6 A;  3J80 S;  4UN2 B;  1L2B A;  4BB9 A;  3I4V A;  2FNA A;  2JZ0 A;  3GRV A;  4JI8 M;  1XWI A;  5L8R F;  2ZTD A;  1J09 A;  4G4Q A;  3JR5 A;  4L6V 6;  4NSO B;  1HQY E;  5KQ8 A;  3SHG B;  1DGG A;  4IJF A;  4LGM A;  3HZJ A;  2QCU A;  1E9S A;  1Y8G A;  3CTW B;  2LTU A;  1AUA A;  1Q02 A;  1SG9 A;  3FUV A;  3SFZ A;  3HHZ A;  3C58 A;  5IT9 S;  2KRU A;  3FRH A;  4LF9 M;  4NSR A;  4LRS A;  1E94 E;  1QQW A;  2ZBK B;  3LW5 F;  3RFW A;  2EJS A;  3OTO M;  2FFJ A;  2F4V M;  3FUW A;  4R3D A;  4MGH A;  2DZO B;  4LF8 M;  3GQ5 A;  4GIT A;  1QUS A;  4X64 M;  1QDT A;  3KSX A;  2XZF A;  2D7E A;  3JAM S;  3GLF A;  2RRU A;  4Z6Y A;  1N36 M;  2GQF A;  3CF0 A;  3KOZ E;  1RU3 A;  2HCB A;  3LCV B;  3L26 A;  2LVQ D;  2O25 A;  4LFC M;  1T43 A;  1QZE A;  1QVR A;  2NQ8 C;  4M9X A;  2LVN C;  1I94 M;  1OIZ A;  1QDR A;  4LJ4 A;  1NNU C;  4IBB A;  4AG6 A;  4AW4 A;  4AZF A;  3KS8 A;  2D7H A;  1TH4 A;  2JXN A;  4I81 A;  3ZQJ A;  1WGL A;  1VDD A;  1E32 A;  3FUX A;  3TE6 A;  3TWM A;  3GQ4 A;  4DR6 M;  3LVV A;  3U6Q A;  5KPR A;  3K2L A;  3L28 A;  3EIE A;  2BJV A;  3J7A S;  3TQS A;  2KDL A;  1IBL M;  4LZZ A;  3KS4 A;  1JB0 F;  3PXG A;  1PM5 A;  2K47 A;  2XSZ D;  1NNJ A;  2R4J A;  3ILK A;  3KOY E;  2LXE A;  3GLG A;  3NBX X;  3HHY A;  3E21 A;  1XB2 B;  3GPP A;  3QWL A;  1IQP A;  3T15 A;  2UXB M;  2HAK A;  1G71 A;  5FTJ A;  1KSF X;  4HLQ A;  2JNH A;  5EXS A;  2VF8 A;  3QYB A;  1DGH B;  1VG5 A;  2VF7 A;  4FWG A;  5EXT A;  1XMO M;  3NWL A;  2Z8Y M;  5EP2 A;  5EP3 A;  3A42 A;  4D82 A;  4G4R A;  2L2D A;  1OKS A;  3A46 A;  2B3T A;  1C1K A;  3B7N A;  2F5N A;  4IBD A;  4OX9 M;  4IBJ A;  4GIP A;  1HQC A;  4DR2 M;  2WZJ A;  2XFT A;  4LJ8 A;  2UXD M;  2CHV A;  3T1Y M;  2D7G A;  5DNY A;  3SAS A;  5ITX E;  3B7Q A;  5ITT A;  5KO3 A;  5BR8 M;  2Q2E B;  3PNV A;  2DAG A;  5H37 D;  2KNA A;  4LFB M;  1W5S A;  1LV7 A;  4CIZ A;  3K1J A;  2L4F A;  2RGH A;  4OVZ B;  4G6Z A;  4IBK A;  3FKE A;  2C9O A;  2J5Y A;  2V1C A;  2WSC F;  5ITR A;  2DXI A;  1OAI A;  2I7P A;  3I04 M;  5EP1 A;  1PJJ A;  2MH8 A;  2OO9 A;  3L27 A;  3D8B A;  4P16 A;  3WHK A;  2EA0 A;  1KFV A;  4M9S A;  3M0E A;  1XXH A;  2QBY A;  4B3S M;  4DUZ M;  2DWL A;  2R0I A;  1C7Y A;  4WUR A;  5EJC A;  2CRU A;  3VDP A;  2LNH C;  2R45 A;  3HKP A;  4PT5 A;  2MGW A;  1JR3 A;  4XBO A;  4JI1 M;  4NRV A;  3FUU A;  2YNM D;  2ZAM A;  2ZAO A;  3LQR A;  2RKO A;  2H5X A;  2KZS A;  4CIS A;  5ITY A;  3U61 B;  3B74 A;  3FD9 A;  3SHF A;  1TDZ A;  1L1T A;  2CHQ A;  1T3T A;  3DZD A;  1AIP C;  3U6P A;  3C3D A;  1KYI A;  4D80 A;  1NY5 A;  1WXQ A;  2J7O A;  4DV3 M;  1Z5B A;  3K9O A;  1HT1 E;  4L15 A;  2Z4S A;  5KPZ A;  1N77 A;  4TUW A;  1EIJ A;  1V92 A;  1TGU A;  1PRB A;  1TDH A;  4LJ7 A;  2C98 A;  1HNZ M;  3HX3 A;  4M0W A;  3R9X B;  5FLX S;  3GLH A;  1N33 M;  4NL4 H;  1YSY A;  4F2L A;  2K6B A;  3KVW A;  4LJ9 A;  2VDB B;  4LGY A;  2L6O A;  4IBF A;  4NXM M;  2OOA A;  2Y20 A;  2LVA A;  2Z3X A;  2BWE A;  2YQZ A;  3AOG A;  4L78 A;  3W0F A;  2MJ5 B;  1Z6T A;  3HJQ A;  3LVW A;  3L2A A;  3HJ8 A;  1FNN A;  1PGY A;  2XEP A;  4LF4 M;  2V1U A;  2QEN A;  1ORY B;  3UMM A;  2KEB A;  4MGI E;  4FCW A;  5FTK A;  3HU2 A;  2XFS A;  3SAU A;  4R71 A;  3K8Z A;  3TWK A;  1K82 A;  4BLC A;  3IEC A;  4DR5 M;  1L2D A;  2QP9 X;  2CWB A;  3H4J A;  2LH0 A;  2XGN A;  5C1B A;  1P3Q Q;  4PCZ A;  1N78 A;  3VKG A;  4II7 A;  1OQY A;  4X62 M;  1V33 A;  1X37 A;  2UUB M;  2I7N A;  3SC3 A;  2R44 A;  3BBZ A;  2X8A A;  4REZ A;  3U6E A;  2XZU A;  3VKH A;  2OQ4 A;  4K0K M;  4GEW A;  3GLG B;  4F1I A;  2DVW B;  2FE8 A;  2GNO A;  3UK6 A;  1TF0 B;  1IN6 A;  2M60 A;  3NBI A;  3U6D A;  4OU7 A;  4GKK M;  2JA2 A;  2JP7 A;  2N35 A;  4P17 A;  4MGY E;  2QPA A;  3F92 A;  3LMM A;  3JR4 A;  2VQF M;  4DV5 M;  1A5T A;  4KT0 F;  4QHT A;  1VDL A;  2APL A;  1NJF A;  5A2Q S;  1R2Y A;  1HR0 M;  2C99 A;  2KNZ A;  3J81 S;  3FTF A;  4AKG A;  3GLI E;  2K0B X;  4GH9 A;  4AI6 A;  4MM3 B;  4S12 A;  3L29 A;  1R4G A;  3GRR A;  2XSZ A;  4G4O A;  3HWS A;  4IBI A;  3A45 A;  3FRI A;  1PJS A;  1YUB A;  3V76 A;  1I4W A;  1SXJ C;  4KLN A;  2EUC A;  1V34 A;  1ZMW A;  4LJA A;  4AKI A;  2KZU A;  4GKJ M;  1IY0 A;  4LF5 M;  1D0K A;  1SXJ A;  1W5T A;  1OTR A;  2W82 A;  1Q39 A;  2O01 F;  4JI0 M;  2KXE A;  2VQE M;  4LF6 M;  1UM8 A;  2YR0 A;  3U5Z A;  1IFY A;  1DGB A;  2FS1 A;  2BJW A;  4DUY M;  1GL7 A;  2V6Z M;  3RGP A;  3GO8 A;  2DHY A;  3U6S A;  2L7I A;  1Z5C A;  4YHH M;  2F5O A;  1XXH B;  2QBY B;  1CUK A;  3UJN A;  1G59 A;  3AOE C;  2R6F A;  2JUJ A;  5GKN A;  3AKZ A;  2UU9 M;  3A98 B;  3AOE A;  4FCV A;  3SYL A;  3Q8G A;  3ZC7 B;  4AQY M;  4L4U A;  2J7N A;  4RF1 A;  3B9P A;  3GPY A;  1R7R A;  2JZ1 A;  3U60 A;  3HU3 A;  2EO2 A;  2E5L M;  3T6P A;  1OFI A;  4QOS A;  1N32 M;  3SAV A;  4IJE A;  4IBC A;  2RGO A;  1L8Q A;  2R46 A;  3MJ5 A;  4G3O A;  4R7G A;  1G41 A;  4LCB A;  3T38 A;  2ERC A;  4MGZ E;  3SAR A;  1Z59 A;  2JY7 A;  4Q7J A;  4CGY B;  4JYA M;  3U6M A;  1YE9 A;  3FUT A;  5JI2 E;  2DWM A;  4B08 A;  1QAN A;  1MN3 A;  4PDG A;  3W67 A;  2P5T A;  1NV8 A;  3J7B A;  1Q3B A;  3PFI A;  3U6L A;  4GC5 A;  2DAE A;  4JI4 M;  4GHL A;  4B7G A;  1ZAE A;  1MU5 A;  4LJ5 A;  3VK8 A;  3GLH B;  2DAK A;  1H6U A;  2CUZ A;  2LWX A;  5ITQ A;  1QYR A;  5FSW A;  5LMN M;  4DR3 M;  3FTE A;  1HT2 E;  1MX0 A;  2C96 A;  3BOS A;  2DI0 A;  4NRW A;  3DFZ A;  1IN7 A;  2G8L A;  1Q3C A;  3GLI A;  1IN5 A;  4DV7 M;  2F5S A;  1N34 M;  3MK6 A;  1OFH A;  7CAT A;  4BBA A;  1BVS A;  4HL4 A;  4CJ6 A;  2DHR A;  3HHX A;  1JR3 D;  5DFL A;  1XMQ M;  4JXJ A;  3TWL A;  2ZM6 M;  1IXZ A;  2UXC M;  4NC6 A;  4JI3 M;  2R65 A;  3E46 A;  2VII A;  3VFD A;  4X65 M;  2L7H A;  3DA1 A;  4RF0 A;  1XC8 A;  4LG2 A;  4GHA A;  2LHG A;  3PVS A;  4IBG A;  4LZJ A;  3CGW A;  3I4Y A;  1R2Z A;  4HEO A;  2BWB A;  5C18 A;  3L25 A;  5EXP A;  4DV4 M;  3GPU A;  2QNJ A;  4QOZ C;  3GRU A;  1VQ1 A;  1K3X A;  1IY1 A;  2ZTC A;  4L16 A;  3GLF B;  1OAO C;  4QHS A;  2CV2 A;  5EP4 A;  4NXN M;  3GLG E;  2O5R A;  3ZH9 B;  3GPX A;  3VK7 A;  3C3E A;  4B3R M;  4FWD A;  1N75 A;  2DZL A;  3AV0 A;  2CE7 A;  2R18 A;  4LY6 A;  1GLN A;  3M6A A;  3UZU A;  5ITX A;  1J5E M;  2LVP C;  3EIH A;  4B7F A;  3IHP A;  1WIV A;  3U6O A;  1DGF A;  4JI5 M;  4DBG B;  1GO5 A;  1L1Z A;  2CV1 A;  2BNK A;  5IWA M;  2C9C A;  4DV0 M;  2F5P A;  4PD2 A;  4AG5 A;  3AJI B;  3FYC A;  3FTD A;  3PNY A;  1D0M A;  1NO1 A;  4KHP M;  3GP1 A;  1PJT A;  2FOI C;  4D81 A;  2WSE F;  2G5G X;  3HGI A;  5E6J A;  4CHT B;  1TR8 A;  3LQQ A;  8CAT A;  3HJS A;  3RE8 A;  3C9P A;  3IG8 A;  4LRT A;  2X49 A;  2HWJ A;  2R62 A;  1GJT A;  1IXS A;  3VDU A;  3H4M A;  3QAU A;  2A5Y B;  4LJ6 A;  5FTN A;  4GRI A;  2XH9 A;  4KOD A;  5KPT A;  1WJ7 A;  2QQ8 A;  1E9R A;  2L4E A;  4I4L A;  3HHW A;  1IN4 A;  1OIP A;  1SXJ B;  2DZN B;  5LMU M;  2KA6 B;  2CEA A;  4I8O A;  4L8R C;  4GC9 A;  3KOX E;  3U5Z B;  3FYD A;  1IM2 A;  2UUC M;  2G3Q A;  1TTE A;  1XXH E;  4DV2 M;  4DR4 M;  4IIW A;  3QYE A;  4FWH A;  4DR1 M;  1S3S A;  2FH0 A;  3HU1 A;  3J27 B;  5E26 A;  5FTM A;  3U6C A;  3Q8X A;  5ITU A;  1GAB A;  3SYK A;  1JR3 E;  4JI7 M;  1D0L A;  1QAM A;  2KNV A;  3KW6 A;  3WHL A;  4B3M M;  1VEK A;  4RNA A;  5FTL A;  2CV0 A;  1EE8 A;  3SAW A;  3U60 B;  3SBJ A;  4XGI A;  1NJG A;  2Y0Q A;  5IZ7 D;  1R6B X;  2JWS A;  4FW9 A;  4LFA M;  1ZQ9 A;  4X66 M;  2QHO B;  2WSF F;  1IBM M;  1VEG A;  2K9D A;  3D8L A;  1PJQ A;  1GJS A;  1LTM A;  1TH3 A;  5DYG A;  1QZM A;  4JI6 M;  1T6O A;  3AL0 C;  4AKH A;  3KSJ A;  4LF7 M;  4M9Z A;  4QNM A;  4DV6 M;  5EXX A;  3J2P B;  3GLH E;  1NVM A;  2YFQ A;  4FVM A;  1SXJ D;  1QUT A;  1PJI A;  5DYI A;  1G8P A;  3B7Z A;  3CF2 A;  3SAT A;  2JY6 B;  1DO0 A;  3KP0 E;  4ZPX A;  2DAM A;  2LBC A;  1G3I A;  3AFH A;  4Y28 F;  3KP1 E;  5IRE B;  1D2N A;  2C5R A;  4GMQ A;  2X4A A;  2QSF X;  4JV5 M;  2ZAN A;  3BXW A;  2MRO B;  3W0L B;  3IG5 A;  1XNR M;  3MHV C;  3ZCB B;  3KOW E;  3GQ3 A;  3GLI B;  2CFO A;  1IBK M;  4DR7 M;  2QZ4 A;  2LHC A;  1XHB A;  2XF3 A;  2OOB A;  3B89 A;  2Z4R A;  4NOO B;  2DKL A;  5F3W A;  3M7G A;  4ITQ A;  2R4E A;  3KXE C;  1WGN A;  4MGK E; 
#chains in the Genus database with same CATH homology
 3TL4 X;  1G4A E;  2Z7J A;  1TH2 A;  4KO8 A;  1J7K A;  3TPZ A;  1DGH A;  2UUA M;  4EIW A;  1IN8 A;  3KFU G;  4YY3 M;  1OJL A;  3VLF B;  1GVN A;  4PDI A;  4QNR A;  1JQJ C;  4FD2 A;  4WW0 A;  2OPF A;  4OW0 A;  3UGJ A;  2H1R A;  1IXR C;  2HKJ A;  4B3T M;  2HHH M;  4A3V B;  4MB7 A;  1QAO A;  2DWZ B;  4FCT A;  4MH0 E;  1HNX M;  1GKI A;  3SMS A;  1IY2 A;  3DOA A;  4IBE A;  1HNW M;  4M0D A;  2KW0 A;  4I5S A;  3SMP A;  1NSF A;  2AHM A;  4OVZ A;  2KRK A;  2M5Z A;  4Z8X A;  3FTC A;  4W5W A;  2F5Q A;  1NY6 A;  5KQD A;  2XLJ A;  3RGS A;  3E9S A;  1GL6 A;  3I51 A;  3K92 A;  3KDS E;  4JI2 M;  1XNQ M;  1NHG C;  2HL7 A;  1IXS B;  2CHG A;  3THG A;  5BPV A;  5JI3 E;  1L2C A;  2Y21 A;  1FJG M;  2DWN A;  4B7H A;  1QAQ A;  1SXJ E;  5EQT A;  2Y0T A;  4DV1 M;  3T1H M;  1K3W A;  3R8F A;  4G4N A;  1NHW C;  1DO2 A;  2L09 A;  3GRY A;  3E4R A;  3CF6 E;  1Z5A A;  3U61 A;  3J80 S;  4JN6 A;  1L2B A;  4BB9 A;  3I4V A;  2FNA A;  3GRV A;  4JI8 M;  1XWI A;  1J09 A;  4G4Q A;  3JR5 A;  4NSO B;  1HQY E;  5KQ8 A;  3SHG B;  1DGG A;  4IJF A;  4LGM A;  2QCU A;  1E9S A;  3HHZ A;  3CTW B;  3FUV A;  3C58 A;  3SFZ A;  5IT9 S;  2KRU A;  4LF9 M;  4NSR A;  4LRS A;  1E94 E;  1QQW A;  2ZBK B;  3OTO M;  3RFW A;  2FFJ A;  2F4V M;  3FUW A;  4R3D A;  4MGH A;  2DZO B;  4LF8 M;  3GQ5 A;  4GIT A;  4X64 M;  3KSX A;  2XZF A;  2D7E A;  3JAM S;  3GLF A;  4Z6Y A;  1N36 M;  3CF0 A;  3KOZ E;  2HCB A;  3L26 A;  4LFC M;  1QVR A;  2NQ8 C;  4M9X A;  1I94 M;  4LJ4 A;  1NNU C;  4IBB A;  4AG6 A;  4AW4 A;  4AZF A;  3KS8 A;  2D7H A;  1TH4 A;  4I81 A;  1VDD A;  1E32 A;  3FUX A;  3TE6 A;  3TWM A;  3GQ4 A;  4DR6 M;  3LVV A;  3U6Q A;  5KPR A;  3L28 A;  3K2L A;  3EIE A;  2BJV A;  3J7A S;  3TQS A;  1IBL M;  4LZZ A;  3KS4 A;  3PXG A;  1PM5 A;  2K47 A;  2XSZ D;  1NNJ A;  2R4J A;  3ILK A;  3KOY E;  2LXE A;  3GLG A;  3HHY A;  3GPP A;  3QWL A;  1IQP A;  3T15 A;  2UXB M;  5FTJ A;  1KSF X;  4HLQ A;  5EXS A;  1DGH B;  4FWG A;  5EXT A;  1XMO M;  3NWL A;  5EP2 A;  5EP3 A;  3A42 A;  4D82 A;  4G4R A;  3A46 A;  1C1K A;  2F5N A;  4IBD A;  4OX9 M;  4IBJ A;  4GIP A;  1HQC A;  4DR2 M;  2XFT A;  4LJ8 A;  2UXD M;  2CHV A;  3T1Y M;  2D7G A;  5DNY A;  3SAS A;  5ITX E;  5ITT A;  5KO3 A;  5BR8 M;  2Q2E B;  3PNV A;  5H37 D;  4LFB M;  1W5S A;  1LV7 A;  3K1J A;  2RGH A;  4OVZ B;  4G6Z A;  4IBK A;  3FKE A;  2C9O A;  5ITR A;  2V1C A;  2DXI A;  2I7P A;  5EP1 A;  1PJJ A;  3L27 A;  4P16 A;  3WHK A;  3D8B A;  1KFV A;  2EA0 A;  4M9S A;  3M0E A;  1XXH A;  2QBY A;  4B3S M;  4DUZ M;  2DWL A;  4WUR A;  5EJC A;  3VDP A;  2LNH C;  2R45 A;  3HKP A;  4PT5 A;  4JI1 M;  1JR3 A;  4XBO A;  4NRV A;  3FUU A;  2YNM D;  2ZAM A;  2ZAO A;  3LQR A;  2RKO A;  2KZS A;  4CIS A;  5ITY A;  3U61 B;  3FD9 A;  1TDZ A;  3SHF A;  1L1T A;  2CHQ A;  1T3T A;  3DZD A;  3U6P A;  1KYI A;  4D80 A;  1NY5 A;  1WXQ A;  2J7O A;  4DV3 M;  1Z5B A;  4L15 A;  1HT1 E;  5KPZ A;  2Z4S A;  4TUW A;  1N77 A;  1TGU A;  1TDH A;  4LJ7 A;  2C98 A;  1HNZ M;  4M0W A;  3R9X B;  5FLX S;  3GLH A;  1N33 M;  4NL4 H;  1YSY A;  3KVW A;  4LJ9 A;  4LGY A;  2L6O A;  4IBF A;  4NXM M;  2Y20 A;  2Z3X A;  2YQZ A;  3AOG A;  4L78 A;  3W0F A;  1Z6T A;  3HJQ A;  3LVW A;  3L2A A;  3HJ8 A;  1FNN A;  2XEP A;  4LF4 M;  2V1U A;  2QEN A;  1ORY B;  3UMM A;  2KEB A;  4MGI E;  4FCW A;  5FTK A;  3HU2 A;  2XFS A;  3SAU A;  3K8Z A;  3TWK A;  1K82 A;  4BLC A;  1L2D A;  4DR5 M;  2QP9 X;  2LH0 A;  2XGN A;  5C1B A;  4PCZ A;  3VKG A;  1N78 A;  4II7 A;  4X62 M;  1X37 A;  2UUB M;  2I7N A;  3SC3 A;  3U6E A;  4REZ A;  2X8A A;  3VKH A;  2XZU A;  2OQ4 A;  4K0K M;  3GLG B;  2DVW B;  2FE8 A;  3UK6 A;  1IN6 A;  2M60 A;  3NBI A;  3U6D A;  4OU7 A;  4GKK M;  2JA2 A;  4MGY E;  2QPA A;  3JR4 A;  3LMM A;  2VQF M;  4DV5 M;  4QHT A;  1NJF A;  5A2Q S;  1R2Y A;  1HR0 M;  2C99 A;  3J81 S;  3FTF A;  4AKG A;  4GH9 A;  4AI6 A;  4MM3 B;  4S12 A;  3L29 A;  3GRR A;  2XSZ A;  4G4O A;  3HWS A;  4IBI A;  3A45 A;  1YUB A;  1I4W A;  1SXJ C;  4KLN A;  2EUC A;  4LJA A;  4AKI A;  2KZU A;  4GKJ M;  1IY0 A;  4LF5 M;  1SXJ A;  1W5T A;  2W82 A;  1Q39 A;  4JI0 M;  2KXE A;  2VQE M;  4LF6 M;  1UM8 A;  2YR0 A;  3U5Z A;  1DGB A;  2BJW A;  4DUY M;  1GL7 A;  2V6Z M;  3RGP A;  3GO8 A;  3U6S A;  2L7I A;  1Z5C A;  4YHH M;  2F5O A;  1XXH B;  2QBY B;  3UJN A;  1G59 A;  3AOE C;  5GKN A;  3AKZ A;  2UU9 M;  3A98 B;  3AOE A;  4FCV A;  3SYL A;  3ZC7 B;  4AQY M;  4L4U A;  2J7N A;  4RF1 A;  3B9P A;  3GPY A;  1R7R A;  3U60 A;  3HU3 A;  2EO2 A;  2E5L M;  1N32 M;  1OFI A;  4QOS A;  3SAV A;  4IJE A;  4IBC A;  2RGO A;  1L8Q A;  2R46 A;  3MJ5 A;  4R7G A;  1G41 A;  4LCB A;  3T38 A;  2ERC A;  4MGZ E;  3SAR A;  1Z59 A;  4CGY B;  4JYA M;  3U6M A;  1YE9 A;  3FUT A;  5JI2 E;  2DWM A;  4B08 A;  1QAN A;  4PDG A;  2P5T A;  3J7B A;  3U6L A;  1Q3B A;  3PFI A;  4JI4 M;  4GC5 A;  4GHL A;  4B7G A;  1ZAE A;  1MU5 A;  4LJ5 A;  3VK8 A;  3GLH B;  1H6U A;  2CUZ A;  2LWX A;  5ITQ A;  1QYR A;  5FSW A;  5LMN M;  4DR3 M;  3FTE A;  1HT2 E;  1MX0 A;  2C96 A;  3BOS A;  4NRW A;  3DFZ A;  1IN7 A;  2G8L A;  1Q3C A;  3GLI A;  1IN5 A;  4DV7 M;  2F5S A;  1N34 M;  3MK6 A;  1OFH A;  7CAT A;  4BBA A;  4HL4 A;  2DHR A;  3HHX A;  1JR3 D;  1XMQ M;  2UXC M;  4JXJ A;  3TWL A;  2ZM6 M;  1IXZ A;  4JI3 M;  2R65 A;  4X65 M;  2VII A;  3VFD A;  2L7H A;  3DA1 A;  4RF0 A;  1XC8 A;  4LG2 A;  4GHA A;  3PVS A;  4IBG A;  4LZJ A;  1R2Z A;  3I4Y A;  5C18 A;  3L25 A;  5EXP A;  4DV4 M;  3GPU A;  4QOZ C;  3GRU A;  1K3X A;  1IY1 A;  4L16 A;  3GLF B;  4QHS A;  2CV2 A;  5EP4 A;  4NXN M;  2O5R A;  3ZH9 B;  3GPX A;  3VK7 A;  4B3R M;  4FWD A;  1N75 A;  3AV0 A;  2CE7 A;  2R18 A;  4LY6 A;  1GLN A;  3M6A A;  3UZU A;  5ITX A;  1J5E M;  3EIH A;  4B7F A;  3U6O A;  1DGF A;  4JI5 M;  1L1Z A;  2CV1 A;  2BNK A;  5IWA M;  2C9C A;  4DV0 M;  2F5P A;  4PD2 A;  4AG5 A;  3AJI B;  3FYC A;  3FTD A;  3PNY A;  4KHP M;  3GP1 A;  2FOI C;  4D81 A;  3HGI A;  2G5G X;  4CHT B;  5E6J A;  8CAT A;  3LQQ A;  3HJS A;  3RE8 A;  3IG8 A;  4LRT A;  2X49 A;  2R62 A;  3VDU A;  3H4M A;  3QAU A;  2A5Y B;  4LJ6 A;  5FTN A;  4GRI A;  2XH9 A;  4KOD A;  5KPT A;  4I4L A;  1E9R A;  3HHW A;  1IN4 A;  1SXJ B;  2DZN B;  5LMU M;  2KA6 B;  2CEA A;  4I8O A;  4L8R C;  4GC9 A;  3KOX E;  3U5Z B;  3FYD A;  1IM2 A;  2UUC M;  4DV2 M;  4DR4 M;  4IIW A;  4FWH A;  4DR1 M;  1S3S A;  3HU1 A;  3J27 B;  5E26 A;  5FTM A;  3U6C A;  3Q8X A;  5ITU A;  3SYK A;  4JI7 M;  1QAM A;  3WHL A;  3KW6 A;  4B3M M;  4RNA A;  5FTL A;  2CV0 A;  1EE8 A;  3SAW A;  3U60 B;  3SBJ A;  4XGI A;  1NJG A;  2Y0Q A;  5IZ7 D;  1R6B X;  4FW9 A;  4LFA M;  1ZQ9 A;  4X66 M;  1IBM M;  3D8L A;  1TH3 A;  5DYG A;  1QZM A;  4JI6 M;  3AL0 C;  4AKH A;  3KSJ A;  4LF7 M;  4M9Z A;  4QNM A;  4DV6 M;  5EXX A;  3J2P B;  1NVM A;  2YFQ A;  4FVM A;  1SXJ D;  1PJI A;  5DYI A;  1G8P A;  3CF2 A;  3SAT A;  1DO0 A;  3KP0 E;  4ZPX A;  1G3I A;  3AFH A;  5IRE B;  3KP1 E;  2C5R A;  1D2N A;  4GMQ A;  2X4A A;  4JV5 M;  2ZAN A;  3W0L B;  3IG5 A;  1XNR M;  3MHV C;  3ZCB B;  3KOW E;  3GQ3 A;  3GLI B;  2CFO A;  1IBK M;  4DR7 M;  2QZ4 A;  1XHB A;  2XF3 A;  2Z4R A;  4NOO B;  5F3W A;  3M7G A;  4ITQ A;  2R4E A;  3KXE C;  4MGK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...