2V6ZM

Solution structure of amino-terminal domain of human dna polymerase epsilon subunit b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE EPSILON SUBUNIT 2
publication title The Solution Structure of the Amino-Terminal Domain of Human DNA Polymerase Epsilon Subunit B is Homologous to C-Domains of Aaa+ Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 75
sequence length 75
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF12213 Dpoe2NT DNA polymerases epsilon N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2v6zM00
1HQCA 1XXHA 3GLFA 5EP1A 3DZDA 4KO8A 2BJVA 4I81A 5DYIA 5EQTA 5C1BA 3GLGB 1IXZA 3CF2A 3SYKA 3B9PA 2Z4SA 1IN7A 3PXGA 1NVMA 2DWZB 3CF0A 3D8BA 5JI3E 1OFIA 4D80A 2R62A 5EXPA 1UM8A 3HU2A 3GLHB 4LRTA 1S3SA 1SXJD 3GLIA 4LJ8A 1JQJC 1IY1A 2C96A 1HQYE 1R6BX 4LJAA 5FTMA 3AJIB 4LY6A 1E94E 4FWGA 1J7KA 3BOSA 2FNAA 4FCTA 2QBYB 4D81A 1HT1E 4D82A 1XWIA 1DO0A 1IXSB 1NJFA 3SC3A 5EP2A 3HU3A 2ZAOA 3GLGA 2C9OA 1NY6A 5FTKA 4JN6A 3R8FA 3HWSA 4KODA 1KSFX 3PVSA 4QNRA 3U5ZB 2KRKA 1C1KA 2CEAA 1JR3A 3GLHA 2BJWA 4FD2A 4FCVA 1G41A 2CHVA 1G4AE 3WHLA 2CE7A 4LRSA 4L4UA 1IM2A 2C9CA 4I4LA 4LGMA 5EP3A 1R7RA 1SXJC 3WHKA 3U60B 1NJGA 3VLFB 1NY5A 2QBYA 2Z4RA 2ZAMA 2QP9X 4QNMA 4ZPXA 2QZ4A 4A3VB 3U61B 2DVWB 2XSZA 2XSZD 4FWDA 1LV7A 4LJ9A 1W5TA 3KDSE 3H4MA 1SXJE 2DHRA 1IN8A 4L16A 4KLNA 5JI2E 1L8QA 2CHGA 1OFHA 2QENA 2V1UA 5FTNA 1G3IA 1SXJB 1JR3D 1OJLA 4GITA 4QHSA 5DYGA 2CHQA 2QPAA 1IN4A 4QHTA 4Z8XA 1HT2E 5FTJA 4FW9A 3VFDA 4EIWA 2DZOB 2RKOA 2ZANA 1IN6A 2C98A 3K1JA 4LJ6A 1NSFA 5EXXA 3EIHA 4QOSA 1X37A 1QZMA 2C99A 2VIIA 4LCBA 5FTLA 1FNNA 4LJ7A 2R65A 3GLFB 1XXHB 3M0EA 4FCWA 3ZH9B 3HU1A 4LJ4A 2X8AA 1SXJA 4FWHA 1IQPA 4LZZA 2DZNB 3UK6A 3GLIB 5C18A 1D2NA 4LJ5A 5EXSA 1IN5A 5EXTA 1IXRC 1KYIA 3MHVC 1QVRA 1IY2A 1W5SA 4WW0A 5EP4A 2V6ZM 3PFIA 3KW6A 1E32A 4L15A 3SYLA 1DO2A 1IY0A 3M6AA 2HCBA 3EIEA
chains in the Genus database with same CATH superfamily
3I01M 5KPRA 4MH0E 1XXHA 3GLHE 5EQTA 3KOWE 4KO8A 4I81A 5DYIA 3GLGB 2K9DA 3Q8XA 2KNAA 1Z5BA 2APLA 2JY8A 3PXGA 5LMUM 4DV1M 2J7NA 2VF7A 2XFTA 2R62A 3C58A 3HJSA 4NRWA 2WSCF 5KPTA 1QUTA 3FUTA 4AKGA 3UZUA 2C96A 2DKLA 5FTMA 1NNJA 2GNOA 4LY6A 4RF0A 1N77A 4X62M 3A42A 1XC8A 1ZQ9A 3BOSA 4REZA 2UXDM 1L2DA 1EFUB 1NNUC 2O5RA 4P17A 2KEBA 1R5LA 3FYDA 3DFZA 4DV7M 1IFYA 2VF8A 2ZAOA 3GLGA 1NY6A 1T3TA 1IBLM 4LGYA 2X4AA 4B3MM 3HWSA 4KODA 3IHPA 4NL4H 3W0FA 4IJFA 3U5ZB 2P5TA 2FS1A 3LVVA 1Y8GA 3AL0C 1JR3A 4GRIA 1Z5CA 3DA1A 3HZJA 1WGNA 1G4AE 4NSOB 3TE6A 4X64M 2F5SA 1VEKA 2CE7A 3GRVA 1IM2A 2CV2A 2LBCA 1QDRA 1N34M 1SXJC 1ZV1A 3WHKA 4CIZA 4X65M 3F92A 3VLFB 1NY5A 2J5YA 3I04M 1DGFA 4QNMA 2XZFA 4ZPXA 1N36M 2KZUA 2QZ4A 1DGGA 3NBXX 2DVWB 3U61B 2XSZD 3BXWA 3FKEA 4FWDA 2LHCA 4IBFA 1NV9A 3HKPA 1W5TA 5IZ7D 3U6CA 5KPZA 4RF1A 2UU9M 1EIJA 2G3QA 2L7IA 5L8RF 3U5ZA 4M0WA 3SATA 1QDTA 3U6OA 2WSEF 1JR3D 2DHYA 3IG8A 4F2LA 5KO3A 1Q3CA 3KSXA 2CHQA 2DWNA 4MM3B 1GABA 1IN4A 4R7GA 4B7GA 1D0MA 4FW9A 2KXEA 4JYAM 3AOEA 2HHHM 2RKOA 1GL6A 1ZMVA 1Q3BA 1XXHE 3U6MA 2XZUA 3IG5A 3B74A 3EIHA 3LQQA 2CFOA 3RGSA 2VIIA 3U61A 3LQRA 5IREB 1IBMM 2LVQD 5FTLA 2DAEA 1FNNA 2Y20A 2E5LM 4LJ7A 3T1HM 3J7BA 2UUBM 2KW0A 3M0EA 3W0LB 2YQZA 2R4EA 2F5QA 3HU1A 4LJ4A 3M7GA 2KA6B 2R46A 2Q2EB 1G71A 1LTMA 2FH0A 3J81S 3V76A 4G4RA 4FWHA 1TH3A 4LFAM 4GC5A 4JI0M 3VDPA 5C18A 4UN2B 1IN5A 3PNVA 2HL7A 5EXTA 3FUUA 4LFBM 3U6SA 2F5OA 4IBIA 4JI4M 4IBDA 3GLGE 2L4FA 4MGIE 3AFHA 5FSWA 2F5PA 1E32A 1ZMWA 4L15A 1DO2A 5FLXS 1XMQM 1GO5A 1IY0A 4FCVA 4I8OA 2HCBA 1JR3E 2R0IA 1OQYA 2BJVA 2CRUA 3CF2A 3B9PA 5IT9S 2Z4SA 2H1RA 1KFVA 1NVMA 4B7HA 1NV8A 3K9OA 4PDGA 1K3XA 4JI3M 3IECA 1QYRA 4X66M 4D80A 4HLQA 5EXPA 1UM8A 4G6ZA 1PJIA 3KS8A 4II7A 1T43A 4DR4M 8CATA 1G59A 1JQJC 1SG9A 1IY1A 1XNRM 1QAQA 4LJAA 1PJTA 1J09A 3LCVB 1XHBA 3B7ZA 1AIPC 3D8LA 1QANA 2KHHA 4FWGA 4YY3M 2OPFA 1J7KA 5ITXA 4LZJA 4JI7M 4FCTA 3LVWA 2XH9A 4D81A 1HT1E 2QQ8A 2D7HA 3SBJA 2DI0A 2RGHA 2EJSA 2LH0A 5IWAM 3U6QA 1DV0A 4GKKM 4BB9A 4AKHA 1IXSB 1TH2A 2MJ5B 4DR2M 1QAOA 3HU3A 3GPPA 2DWMA 2DENA 2D7EA 3FUVA 3VDUA 2XFSA 4Z6YA 1KSFX 3CGWA 4B7FA 2EUCA 2KNVA 2BWEA 3ILKA 2JWSA 2LTUA 3Q8GA 2X49A 4L4UA 2LHGA 5EP3A 4I4LA 1WJ7A 4ANRA 2W82A 1Z5AA 3SARA 4DUZM 1NJGA 4PCZA 2Z4RA 3QYEA 2LWXA 2Y0TA 3I51A 2XSZA 3L29A 1IXSA 4FVMA 3KDSE 2O01F 4L8RC 3SAUA 3QYBA 3HY5A 2N35A 1YE9A 2YFQA 4L16A 1L2BA 2EKFA 2CHGA 4LF9M 2V1UA 5FTNA 1G3IA 4AI6A 1WHCA 3I4YA 3J7AS 2DAIA 5DYGA 2Z8YM 3ZC7B 1TF0B 2LVPC 3GPUA 4Z8XA 5BR8M 2F4VM 4DV2M 3B7QA 1TDHA 5E6JA 2EA0A 1VDLA 2ZANA 2LVNC 3J80S 1N32M 2L2DA 2R44A 1N33M 2XF3A 2NQ8C 4QOSA 1TDZA 2VQFM 2L4EA 1OKSA 4LF5M 1D0KA 3TWLA 2Y0QA 3FTCA 3SMSA 2HAKA 4IBGA 2Z7JA 3RE8A 3SFZA 4LF4M 1WXQA 2H5XA 2X8AA 2XGNA 3PNYA 3K8ZA 4IBJA 4K0KM 3H4JA 4LG2A 1FJGM 5ITTA 2KNZA 2KRUA 3HX3A 1K3WA 4IBBA 4IBKA 5F3WA 3QWLA 5ITXE 4LZZA 3GLIB 1D0LA 4JV5M 3W67A 3T38A 4DR7M 3KXEC 3L27A 1PRBA 3TL4X 1R2YA 4TUWA 4G4NA 3HHZA 4OX9M 2GQFA 4F1IA 3TPZA 3SYLA 4R3DA 2R6FA 4P16A 2DAMA 3J27B 4AKIA 3FRHA 2DWLA 2V1CA 3DZDA 5EP1A 4AQYM 5C1BA 1OAOC 2CP8A 1DGBA 3SYKA 4QOZC 4KHPM 1HJPA 4G3OA 2JZ1A 3GPXA 1N75A 5JI3E 1OFIA 3KFUG 2UUCM 4LRTA 3KS4A 3FUXA 3UMMA 3GLIA 4LJ8A 1C7YA 3FTEA 4DR1M 1OIPA 4DUYM 3UGJA 3FYCA 4OW0A 3DOAA 2O25A 3SAVA 1VEGA 4GIPA 1E94E 4NSRA 1AUAA 1G8PA 5DFLA 3ZCBB 4DBGB 4JI8M 4JXJA 1A5TA 2CUZA 2DAGA 2FNAA 2MGWA 4GH9A 2QBYB 4PDIA 3FD9A 5ITUA 4GKJM 3KVWA 2KZSA 2K6BA 1ZAEA 4W5WA 1GJTA 3L28A 3TWKA 3B89A 4L78A 1DO0A 4JI2M 1V92A 2JA2A 3AOEC 1NJFA 4LFCM 1V34A 2HWJA 5EP2A 3VK7A 2C9OA 2RGOA 4XGIA 5FTKA 4JN6A 3JR4A 4CISA 3U6EA 4CJ6A 4LF6M 1TGUA 4MGYE 3UJNA 2ZBKB 4DR5M 2KRKA 1C1KA 3HHYA 3MK6A 2BJWA 2BNKA 5LMNM 2M5ZA 4BBAA 3NWLA 1WR1B 4AZFA 2CHVA 1XNQM 4CHTB 2C9CA 5BPVA 3HJ8A 1R7RA 5H37D 3U60B 1R2ZA 3SASA 2XEPA 3QAUA 4Y28F 5ITQA 2QBYA 4DV0M 4M9ZA 2DAKA 1YLAA 3HJQA 4A3VB 2LVOC 4XK8F 3KP0E 3HHXA 3U6DA 2DHRA 5A2QS 4DR3M 3K92A 1Z59A 2I7PA 4HL4A 1IN8A 4PT5A 4S12A 4KLNA 5JI2E 1L8QA 4DR6M 2C5RA 1Q02A 3JR5A 2JZ0A 1NHGC 1VDDA 2M60A 2I7NA 1SXJB 1XB2B 2QHOB 4IIWA 3GO8A 1T6OA 1YUBA 2R45A 3GQ5A 4QHTA 1HR0M 1HT2E 5FTJA 3VFDA 1L2CA 4L6V6 2FOIC 3VKGA 3U60A 4NXMM 2JXNA 1IN6A 2C98A 2UXCM 4LJ6A 1NSFA 5EXXA 1QZMA 2C99A 4JI5M 2OO9A 4OVZB 1ORYB 2AHMA 1NHWC 4MGHA 2R65A 2R4JA 1PM5A 3GLFB 3GRUA 3ZH9B 1MX0A 2WZJA 4AW4A 2F5NA 2QCUA 5DNYA 3GLIE 4PD2A 1PJJA 3MJ5A 1OAIA 4WP2A 3GRYA 4NOOB 2QSFX 2LNHC 4GC9A 1SXJA 4NRVA 2QNJA 4WURA 3RGPA 3TQSA 3VK8A 4LF8M 2DZNB 3AOGA 3SHGB 3U6LA 2L7HA 4G4QA 1D2NA 3CTWB 4GHAA 5ITYA 4LJ5A 4DV4M 1IXRC 1KYIA 2VQEM 3A45A 4JI1M 1IY2A 1Q39A 1W5SA 1GLNA 4WW0A 1E9SA 1F4IA 3KW6A 1VEJA 4OVZA 3BBZA 3KP1E 3M6AA 1L1TA 3EIEA 1HQCA 2DZLA 4RNAA 3KOXE 3GLFA 2EKKA 2JY7A 4GMQA 3L2AA 4CGYB 4YHHM 4B3RM 1IXZA 2G5GX 4M9SA 3LCUA 2ERCA 2BWBA 2ZTCA 1IN7A 3TWMA 2DWZB 2FFJA 3CF0A 3D8BA 1E9RA 3SHFA 4AG6A 3C3DA 4IBEA 3HU2A 3GLHB 1S3SA 1SXJD 1VQ1A 2G8LA 4B3SM 2D7GA 1V33A 4AG5A 3ZQJA 1L1ZA 1HQYE 1R6BX 1QZEA 1CUKA 1TH4A 1YSYA 1TR8A 1Z6TA 3AJIB 4RKUF 4DV3M 1PJSA 3I4VA 4JI6M 4IJEA 2LVAA 1GJSA 5ITRA 3HHWA 2CWBA 1K82A 4D82A 2K0BX 1XWIA 1DGHB 4IBCA 2HKJA 3SC3A 4Q7JA 2EO2A 3T15A 1BVSA 2FE8A 3VKHA 3AV0A 3SMPA 3R8FA 1EE8A 1I94M 1NO1A 4I5SA 3W68A 2KDLA 3PVSA 4QNRA 2CV1A 2CEAA 4HEOA 3GLHA 4MB7A 3C3EA 4NC6A 2CV0A 4FD2A 2JNHA 1G41A 2JUJA 3WHLA 2YNMD 4LRSA 3A46A 2L09A 4LGMA 4NXNM 3FUWA 2OQ4A 3FE3A 1TTEA 3GQ3A 3KOYE 1OIZA 2R18A 3SAWA 1I4WA 3E4RA 2ZAMA 3E46A 2QP9X 1J5EM 2L6OA 3R9XB 2JP7A 3L26A 1DGHA 4LF7M 3THGA 4GHLA 1GKIA 1LV7A 4B08A 4LJ9A 3H4MA 1SXJE 2ZTDA 1PGYA 2MH8A 4GEWA 3E9SA 1RU3A 4DV5M 3J2PB 4M9XA 1UFZA 1H6UA 3NBIA 4XBOA 3KOZE 1VG5A 4MGZE 1IBKM 1OFHA 2QENA 2K47A 1MU5A 1MJGM 3A98B 1ZMUA 1OJLA 5GKNA 4GITA 4QHSA 3GQ4A 3FRIA 3FTDA 2QPAA 2Y21A 3K9PA 3T1YM 3JAMS 2UXBM 4OU7A 4EIWA 2DXIA 4MGKE 7CATA 2DZOB 1OTRA 2VDBB 3GLFE 2UUAM 3C9PA 3K1JA 5E26A 2JY5A 3GPYA 1X37A 1P3QQ 4LCBA 5KQDA 3AKZA 4DV6M 1N78A 1HNXM 3LMMA 4R71A 4B3TM 3GP1A 2WSFF 3RFWA 1XXHB 3GRRA 4FCWA 5KQ8A 2XLJA 2OOBA 3K2LA 1QUSA 2B3TA 2MR9A 3HGIA 2A5YB 5EJCA 4KT0F 1IQPA 1PJQA 3LW5F 1XMOM 1HNWM 3UK6A 2JY6B 1WIVA 4M0DA 1JB0F 2Z3XA 1GVNA 3OTOM 5EXSA 2YR0A 3E21A 1WGLA 1QAMA 3MHVC 1QVRA 3U6PA 2ZM6M 3KSJA 5EP4A 3FTFA 1R4GA 2MROB 2OOAA 2J7OA 2V6ZM 3CF6E 3PFIA 3T6PA 4BLCA 4ITQA 4G4OA 2DNAA 1HNZM 1MN3A 3L25A 1GL7A 3B7NA 2LXEA 3MMPA 2RRUA 1QQWA
chains in the Genus database with same CATH topology
5KPRA 4MH0E 1XXHA 5EQTA 3KOWE 4KO8A 4I81A 5DYIA 3GLGB 3Q8XA 1Z5BA 3PXGA 5LMUM 4DV1M 2J7NA 2XFTA 2R62A 3C58A 3HJSA 4NRWA 5KPTA 3FUTA 4AKGA 3UZUA 2C96A 5FTMA 1NNJA 4RF0A 4LY6A 1N77A 4X62M 3A42A 1ZQ9A 3BOSA 4REZA 2UXDM 1L2DA 1NNUC 2O5RA 2KEBA 3FYDA 3DFZA 4DV7M 2ZAOA 3GLGA 1IBLM 1NY6A 1T3TA 4LGYA 2X4AA 4B3MM 3HWSA 4KODA 4NL4H 3W0FA 4IJFA 3U5ZB 2P5TA 3LVVA 3AL0C 1JR3A 4GRIA 1Z5CA 3DA1A 1G4AE 4NSOB 3TE6A 4X64M 2F5SA 2CE7A 3GRVA 1IM2A 2CV2A 1N34M 1SXJC 3WHKA 4X65M 3VLFB 1NY5A 1DGFA 4QNMA 2XZFA 4ZPXA 1N36M 2KZUA 2QZ4A 1DGGA 3U61B 2DVWB 1XC8A 2XSZD 3FKEA 4FWDA 4IBFA 3HKPA 5IZ7D 1W5TA 3U6CA 5KPZA 4RF1A 2UU9M 2L7IA 3U5ZA 4M0WA 3SATA 3U6OA 5KO3A 1JR3D 3IG8A 1Q3CA 3KSXA 2CHQA 2DWNA 4MM3B 1IN4A 4R7GA 4B7GA 4FW9A 2KXEA 3AOEA 2HHHM 2RKOA 1GL6A 1Q3BA 3U6MA 2XZUA 3IG5A 3EIHA 3LQQA 2CFOA 3RGSA 2VIIA 3U61A 3LQRA 5IREB 1IBMM 5FTLA 2Y20A 1FNNA 2E5LM 4LJ7A 3T1HM 3J7BA 2UUBM 2KW0A 3M0EA 3W0LB 2YQZA 2R4EA 2F5QA 3HU1A 4LJ4A 3M7GA 2KA6B 2R46A 2Q2EB 3J81S 4G4RA 4FWHA 1TH3A 4LFAM 4GC5A 4JI0M 3VDPA 5C18A 1IN5A 3PNVA 2HL7A 5EXTA 3FUUA 4LFBM 3U6SA 2F5OA 4IBIA 4JI4M 4IBDA 4MGIE 3AFHA 5FSWA 2F5PA 1E32A 4L15A 1DO2A 5FLXS 1XMQM 1IY0A 4FCVA 4I8OA 2HCBA 2BJVA 3CF2A 3B9PA 5IT9S 2Z4SA 2H1RA 1KFVA 1NVMA 4B7HA 1K3XA 4PDGA 4JI3M 1QYRA 4X66M 4D80A 4HLQA 5EXPA 1UM8A 4G6ZA 1PJIA 3KS8A 4II7A 4DR4M 8CATA 1G59A 1JQJC 1IY1A 1XNRM 1QAQA 4LJAA 1J09A 1XHBA 3D8LA 1QANA 4YY3M 4FWGA 2OPFA 1J7KA 5ITXA 4LZJA 4JI7M 4FCTA 3LVWA 2XH9A 4D81A 1HT1E 3SBJA 2D7HA 2RGHA 5IWAM 2LH0A 3U6QA 4GKKM 4BB9A 4AKHA 1IXSB 1TH2A 4DR2M 1QAOA 3HU3A 3GPPA 2DWMA 2D7EA 3FUVA 3VDUA 2XFSA 4Z6YA 1KSFX 4B7FA 2EUCA 3ILKA 2X49A 4L4UA 5EP3A 4I4LA 2W82A 1Z5AA 3SARA 4DUZM 1NJGA 4PCZA 2Z4RA 2LWXA 2Y0TA 3L29A 2XSZA 3I51A 4FVMA 3KDSE 4L8RC 3SAUA 1YE9A 2YFQA 4L16A 1L2BA 2CHGA 4LF9M 2V1UA 5FTNA 1G3IA 4AI6A 3I4YA 3J7AS 5DYGA 3ZC7B 3GPUA 4Z8XA 5BR8M 2F4VM 4DV2M 1TDHA 5E6JA 2EA0A 2ZANA 3J80S 1N32M 1N33M 2XF3A 2NQ8C 4QOSA 1TDZA 2VQFM 4LF5M 3TWLA 2Y0QA 3FTCA 3SMSA 4IBGA 2Z7JA 3RE8A 3SFZA 4LF4M 1WXQA 2X8AA 2XGNA 3PNYA 3K8ZA 4IBJA 4K0KM 4LG2A 1FJGM 5ITTA 2KRUA 1K3WA 4IBBA 4IBKA 5F3WA 3QWLA 5ITXE 4LZZA 3GLIB 4JV5M 3T38A 4DR7M 3KXEC 3L27A 3TL4X 1R2YA 4TUWA 4G4NA 3HHZA 4OX9M 3TPZA 3SYLA 4R3DA 4P16A 3J27B 4AKIA 2DWLA 2V1CA 3DZDA 5EP1A 4AQYM 5C1BA 1DGBA 3SYKA 4QOZC 4KHPM 3GPXA 1N75A 5JI3E 1OFIA 3KFUG 2UUCM 4LRTA 3KS4A 3FUXA 3UMMA 3GLIA 4LJ8A 3FTEA 4DR1M 4DUYM 3UGJA 3FYCA 4OW0A 3DOAA 3SAVA 4GIPA 1E94E 4NSRA 1G8PA 3ZCBB 4JI8M 4JXJA 2CUZA 4GH9A 2FNAA 2QBYB 4PDIA 3FD9A 5ITUA 4GKJM 3KVWA 2KZSA 4W5WA 1ZAEA 3L28A 3TWKA 4L78A 1DO0A 4JI2M 2JA2A 3AOEC 1NJFA 4LFCM 5EP2A 3VK7A 2C9OA 2RGOA 4XGIA 5FTKA 4JN6A 3JR4A 4CISA 3U6EA 4LF6M 1TGUA 4MGYE 3UJNA 2ZBKB 4DR5M 2KRKA 1C1KA 3HHYA 3MK6A 2BJWA 2BNKA 5LMNM 2M5ZA 4BBAA 3NWLA 4AZFA 2CHVA 1XNQM 4CHTB 2C9CA 5BPVA 3HJ8A 1R7RA 5H37D 3U60B 1R2ZA 3SASA 2XEPA 3QAUA 5ITQA 2QBYA 4DV0M 4M9ZA 3HJQA 4A3VB 3KP0E 3HHXA 3U6DA 2DHRA 5A2QS 4DR3M 3K92A 1Z59A 2I7PA 4HL4A 1IN8A 4PT5A 4S12A 4KLNA 5JI2E 1L8QA 4DR6M 2C5RA 3JR5A 1NHGC 1VDDA 2I7NA 1SXJB 2M60A 4IIWA 3GO8A 1YUBA 2R45A 3GQ5A 4QHTA 1HR0M 1HT2E 5FTJA 3VFDA 1L2CA 3VKGA 2FOIC 3U60A 4NXMM 1IN6A 2C98A 2UXCM 4LJ6A 1NSFA 5EXXA 1QZMA 2C99A 4JI5M 4OVZB 1ORYB 2AHMA 1NHWC 4MGHA 2R65A 2R4JA 1PM5A 3GLFB 3GRUA 3ZH9B 1MX0A 4AW4A 2F5NA 2QCUA 5DNYA 1PJJA 4PD2A 3MJ5A 3GRYA 4NOOB 2LNHC 4GC9A 1SXJA 4NRVA 4WURA 3RGPA 3TQSA 3VK8A 4LF8M 2DZNB 3AOGA 3SHGB 3U6LA 2L7HA 4G4QA 1D2NA 3CTWB 4GHAA 5ITYA 4LJ5A 4DV4M 1IXRC 1KYIA 2VQEM 3A45A 4JI1M 1IY2A 1Q39A 1W5SA 1GLNA 4WW0A 1E9SA 3KW6A 4OVZA 3KP1E 3M6AA 1L1TA 3EIEA 1HQCA 4RNAA 3GLFA 3KOXE 4B3RM 4JYAM 4GMQA 3L2AA 4CGYB 4YHHM 1IXZA 2G5GX 4M9SA 2ERCA 1IN7A 3TWMA 2DWZB 2FFJA 3CF0A 3D8BA 1E9RA 3SHFA 4AG6A 4IBEA 3HU2A 3GLHB 1S3SA 1SXJD 2G8LA 4B3SM 2D7GA 4AG5A 1L1ZA 1HQYE 1R6BX 1TH4A 1YSYA 1Z6TA 3AJIB 4DV3M 3I4VA 4JI6M 4IJEA 5ITRA 3HHWA 1K82A 4D82A 1XWIA 1DGHB 4IBCA 2HKJA 3SC3A 2EO2A 3T15A 2FE8A 3VKHA 3AV0A 3SMPA 3R8FA 1EE8A 1I94M 4I5SA 3PVSA 4QNRA 2CV1A 2CEAA 3GLHA 4MB7A 2CV0A 4FD2A 1G41A 3WHLA 2YNMD 4LRSA 3A46A 2L09A 4LGMA 4NXNM 3FUWA 2OQ4A 3GQ3A 3KOYE 2R18A 3SAWA 1I4WA 3E4RA 2ZAMA 3R9XB 2QP9X 1J5EM 2L6OA 3L26A 1DGHA 4LF7M 3THGA 4GHLA 1GKIA 1LV7A 4B08A 4LJ9A 3H4MA 1SXJE 3E9SA 4DV5M 3J2PB 4M9XA 3NBIA 1H6UA 4XBOA 3KOZE 4MGZE 1IBKM 1OFHA 2QENA 2K47A 1MU5A 3A98B 5GKNA 1OJLA 4GITA 4QHSA 3GQ4A 3FTDA 2QPAA 2Y21A 3T1YM 3JAMS 2UXBM 4OU7A 4EIWA 2DXIA 4MGKE 7CATA 2DZOB 2UUAM 3K1JA 5E26A 3GPYA 1X37A 5KQDA 4LCBA 4DV6M 3AKZA 1N78A 1HNXM 3LMMA 4B3TM 3GP1A 3RFWA 1XXHB 3GRRA 4FCWA 5KQ8A 2XLJA 3K2LA 3HGIA 2A5YB 5EJCA 1IQPA 1XMOM 1HNWM 3UK6A 4M0DA 2Z3XA 1GVNA 3OTOM 5EXSA 2YR0A 1QAMA 3MHVC 1QVRA 3U6PA 2ZM6M 3KSJA 5EP4A 3FTFA 4BLCA 2J7OA 2V6ZM 3CF6E 3PFIA 4ITQA 4G4OA 1HNZM 3L25A 1GL7A 2LXEA 1QQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQC A;  1XXH A;  3GLF A;  5EP1 A;  3DZD A;  4KO8 A;  2BJV A;  4I81 A;  5DYI A;  5EQT A;  5C1B A;  3GLG B;  1IXZ A;  3CF2 A;  3SYK A;  3B9P A;  2Z4S A;  1IN7 A;  3PXG A;  1NVM A;  2DWZ B;  3CF0 A;  3D8B A;  5JI3 E;  1OFI A;  4D80 A;  2R62 A;  5EXP A;  1UM8 A;  3HU2 A;  3GLH B;  4LRT A;  1S3S A;  1SXJ D;  3GLI A;  4LJ8 A;  1JQJ C;  1IY1 A;  2C96 A;  1HQY E;  1R6B X;  4LJA A;  5FTM A;  3AJI B;  4LY6 A;  1E94 E;  4FWG A;  1J7K A;  3BOS A;  2FNA A;  4FCT A;  2QBY B;  4D81 A;  1HT1 E;  4D82 A;  1XWI A;  1DO0 A;  1IXS B;  1NJF A;  3SC3 A;  5EP2 A;  3HU3 A;  2ZAO A;  3GLG A;  2C9O A;  1NY6 A;  5FTK A;  4JN6 A;  3R8F A;  3HWS A;  4KOD A;  1KSF X;  3PVS A;  4QNR A;  3U5Z B;  2KRK A;  1C1K A;  2CEA A;  1JR3 A;  3GLH A;  2BJW A;  4FD2 A;  4FCV A;  1G41 A;  2CHV A;  1G4A E;  3WHL A;  2CE7 A;  4LRS A;  4L4U A;  1IM2 A;  2C9C A;  4I4L A;  4LGM A;  5EP3 A;  1R7R A;  1SXJ C;  3WHK A;  3U60 B;  1NJG A;  3VLF B;  1NY5 A;  2QBY A;  2Z4R A;  2ZAM A;  2QP9 X;  4QNM A;  4ZPX A;  2QZ4 A;  4A3V B;  3U61 B;  2DVW B;  2XSZ A;  2XSZ D;  4FWD A;  1LV7 A;  4LJ9 A;  1W5T A;  3KDS E;  3H4M A;  1SXJ E;  2DHR A;  1IN8 A;  4L16 A;  4KLN A;  5JI2 E;  1L8Q A;  2CHG A;  1OFH A;  2QEN A;  2V1U A;  5FTN A;  1G3I A;  1SXJ B;  1JR3 D;  1OJL A;  4GIT A;  4QHS A;  5DYG A;  2CHQ A;  2QPA A;  1IN4 A;  4QHT A;  4Z8X A;  1HT2 E;  5FTJ A;  4FW9 A;  3VFD A;  4EIW A;  2DZO B;  2RKO A;  2ZAN A;  1IN6 A;  2C98 A;  3K1J A;  4LJ6 A;  1NSF A;  5EXX A;  3EIH A;  4QOS A;  1X37 A;  1QZM A;  2C99 A;  2VII A;  4LCB A;  5FTL A;  1FNN A;  4LJ7 A;  2R65 A;  3GLF B;  1XXH B;  3M0E A;  4FCW A;  3ZH9 B;  3HU1 A;  4LJ4 A;  2X8A A;  1SXJ A;  4FWH A;  1IQP A;  4LZZ A;  2DZN B;  3UK6 A;  3GLI B;  5C18 A;  1D2N A;  4LJ5 A;  5EXS A;  1IN5 A;  5EXT A;  1IXR C;  1KYI A;  3MHV C;  1QVR A;  1IY2 A;  1W5S A;  4WW0 A;  5EP4 A;  2V6Z M;  3PFI A;  3KW6 A;  1E32 A;  4L15 A;  3SYL A;  1DO2 A;  1IY0 A;  3M6A A;  2HCB A;  3EIE A; 
#chains in the Genus database with same CATH topology
 3I01 M;  5KPR A;  4MH0 E;  1XXH A;  3GLH E;  5EQT A;  3KOW E;  4KO8 A;  4I81 A;  5DYI A;  3GLG B;  2K9D A;  3Q8X A;  2KNA A;  1Z5B A;  2APL A;  2JY8 A;  3PXG A;  5LMU M;  4DV1 M;  2J7N A;  2VF7 A;  2XFT A;  2R62 A;  3C58 A;  3HJS A;  4NRW A;  2WSC F;  5KPT A;  1QUT A;  3FUT A;  4AKG A;  3UZU A;  2C96 A;  2DKL A;  5FTM A;  1NNJ A;  2GNO A;  4LY6 A;  4RF0 A;  1N77 A;  4X62 M;  3A42 A;  1XC8 A;  1ZQ9 A;  3BOS A;  4REZ A;  2UXD M;  1L2D A;  1EFU B;  1NNU C;  2O5R A;  4P17 A;  2KEB A;  1R5L A;  3FYD A;  3DFZ A;  4DV7 M;  1IFY A;  2VF8 A;  2ZAO A;  3GLG A;  1NY6 A;  1T3T A;  1IBL M;  4LGY A;  2X4A A;  4B3M M;  3HWS A;  4KOD A;  3IHP A;  4NL4 H;  3W0F A;  4IJF A;  3U5Z B;  2P5T A;  2FS1 A;  3LVV A;  1Y8G A;  3AL0 C;  1JR3 A;  4GRI A;  1Z5C A;  3DA1 A;  3HZJ A;  1WGN A;  1G4A E;  4NSO B;  3TE6 A;  4X64 M;  2F5S A;  1VEK A;  2CE7 A;  3GRV A;  1IM2 A;  2CV2 A;  2LBC A;  1QDR A;  1N34 M;  1SXJ C;  1ZV1 A;  3WHK A;  4CIZ A;  4X65 M;  3F92 A;  3VLF B;  1NY5 A;  2J5Y A;  3I04 M;  1DGF A;  4QNM A;  2XZF A;  4ZPX A;  1N36 M;  2KZU A;  2QZ4 A;  1DGG A;  3NBX X;  2DVW B;  3U61 B;  2XSZ D;  3BXW A;  3FKE A;  4FWD A;  2LHC A;  4IBF A;  1NV9 A;  3HKP A;  1W5T A;  5IZ7 D;  3U6C A;  5KPZ A;  4RF1 A;  2UU9 M;  1EIJ A;  2G3Q A;  2L7I A;  5L8R F;  3U5Z A;  4M0W A;  3SAT A;  1QDT A;  3U6O A;  2WSE F;  1JR3 D;  2DHY A;  3IG8 A;  4F2L A;  5KO3 A;  1Q3C A;  3KSX A;  2CHQ A;  2DWN A;  4MM3 B;  1GAB A;  1IN4 A;  4R7G A;  4B7G A;  1D0M A;  4FW9 A;  2KXE A;  4JYA M;  3AOE A;  2HHH M;  2RKO A;  1GL6 A;  1ZMV A;  1Q3B A;  1XXH E;  3U6M A;  2XZU A;  3IG5 A;  3B74 A;  3EIH A;  3LQQ A;  2CFO A;  3RGS A;  2VII A;  3U61 A;  3LQR A;  5IRE B;  1IBM M;  2LVQ D;  5FTL A;  2DAE A;  1FNN A;  2Y20 A;  2E5L M;  4LJ7 A;  3T1H M;  3J7B A;  2UUB M;  2KW0 A;  3M0E A;  3W0L B;  2YQZ A;  2R4E A;  2F5Q A;  3HU1 A;  4LJ4 A;  3M7G A;  2KA6 B;  2R46 A;  2Q2E B;  1G71 A;  1LTM A;  2FH0 A;  3J81 S;  3V76 A;  4G4R A;  4FWH A;  1TH3 A;  4LFA M;  4GC5 A;  4JI0 M;  3VDP A;  5C18 A;  4UN2 B;  1IN5 A;  3PNV A;  2HL7 A;  5EXT A;  3FUU A;  4LFB M;  3U6S A;  2F5O A;  4IBI A;  4JI4 M;  4IBD A;  3GLG E;  2L4F A;  4MGI E;  3AFH A;  5FSW A;  2F5P A;  1E32 A;  1ZMW A;  4L15 A;  1DO2 A;  5FLX S;  1XMQ M;  1GO5 A;  1IY0 A;  4FCV A;  4I8O A;  2HCB A;  1JR3 E;  2R0I A;  1OQY A;  2BJV A;  2CRU A;  3CF2 A;  3B9P A;  5IT9 S;  2Z4S A;  2H1R A;  1KFV A;  1NVM A;  4B7H A;  1NV8 A;  3K9O A;  4PDG A;  1K3X A;  4JI3 M;  3IEC A;  1QYR A;  4X66 M;  4D80 A;  4HLQ A;  5EXP A;  1UM8 A;  4G6Z A;  1PJI A;  3KS8 A;  4II7 A;  1T43 A;  4DR4 M;  8CAT A;  1G59 A;  1JQJ C;  1SG9 A;  1IY1 A;  1XNR M;  1QAQ A;  4LJA A;  1PJT A;  1J09 A;  3LCV B;  1XHB A;  3B7Z A;  1AIP C;  3D8L A;  1QAN A;  2KHH A;  4FWG A;  4YY3 M;  2OPF A;  1J7K A;  5ITX A;  4LZJ A;  4JI7 M;  4FCT A;  3LVW A;  2XH9 A;  4D81 A;  1HT1 E;  2QQ8 A;  2D7H A;  3SBJ A;  2DI0 A;  2RGH A;  2EJS A;  2LH0 A;  5IWA M;  3U6Q A;  1DV0 A;  4GKK M;  4BB9 A;  4AKH A;  1IXS B;  1TH2 A;  2MJ5 B;  4DR2 M;  1QAO A;  3HU3 A;  3GPP A;  2DWM A;  2DEN A;  2D7E A;  3FUV A;  3VDU A;  2XFS A;  4Z6Y A;  1KSF X;  3CGW A;  4B7F A;  2EUC A;  2KNV A;  2BWE A;  3ILK A;  2JWS A;  2LTU A;  3Q8G A;  2X49 A;  4L4U A;  2LHG A;  5EP3 A;  4I4L A;  1WJ7 A;  4ANR A;  2W82 A;  1Z5A A;  3SAR A;  4DUZ M;  1NJG A;  4PCZ A;  2Z4R A;  3QYE A;  2LWX A;  2Y0T A;  3I51 A;  2XSZ A;  3L29 A;  1IXS A;  4FVM A;  3KDS E;  2O01 F;  4L8R C;  3SAU A;  3QYB A;  3HY5 A;  2N35 A;  1YE9 A;  2YFQ A;  4L16 A;  1L2B A;  2EKF A;  2CHG A;  4LF9 M;  2V1U A;  5FTN A;  1G3I A;  4AI6 A;  1WHC A;  3I4Y A;  3J7A S;  2DAI A;  5DYG A;  2Z8Y M;  3ZC7 B;  1TF0 B;  2LVP C;  3GPU A;  4Z8X A;  5BR8 M;  2F4V M;  4DV2 M;  3B7Q A;  1TDH A;  5E6J A;  2EA0 A;  1VDL A;  2ZAN A;  2LVN C;  3J80 S;  1N32 M;  2L2D A;  2R44 A;  1N33 M;  2XF3 A;  2NQ8 C;  4QOS A;  1TDZ A;  2VQF M;  2L4E A;  1OKS A;  4LF5 M;  1D0K A;  3TWL A;  2Y0Q A;  3FTC A;  3SMS A;  2HAK A;  4IBG A;  2Z7J A;  3RE8 A;  3SFZ A;  4LF4 M;  1WXQ A;  2H5X A;  2X8A A;  2XGN A;  3PNY A;  3K8Z A;  4IBJ A;  4K0K M;  3H4J A;  4LG2 A;  1FJG M;  5ITT A;  2KNZ A;  2KRU A;  3HX3 A;  1K3W A;  4IBB A;  4IBK A;  5F3W A;  3QWL A;  5ITX E;  4LZZ A;  3GLI B;  1D0L A;  4JV5 M;  3W67 A;  3T38 A;  4DR7 M;  3KXE C;  3L27 A;  1PRB A;  3TL4 X;  1R2Y A;  4TUW A;  4G4N A;  3HHZ A;  4OX9 M;  2GQF A;  4F1I A;  3TPZ A;  3SYL A;  4R3D A;  2R6F A;  4P16 A;  2DAM A;  3J27 B;  4AKI A;  3FRH A;  2DWL A;  2V1C A;  3DZD A;  5EP1 A;  4AQY M;  5C1B A;  1OAO C;  2CP8 A;  1DGB A;  3SYK A;  4QOZ C;  4KHP M;  1HJP A;  4G3O A;  2JZ1 A;  3GPX A;  1N75 A;  5JI3 E;  1OFI A;  3KFU G;  2UUC M;  4LRT A;  3KS4 A;  3FUX A;  3UMM A;  3GLI A;  4LJ8 A;  1C7Y A;  3FTE A;  4DR1 M;  1OIP A;  4DUY M;  3UGJ A;  3FYC A;  4OW0 A;  3DOA A;  2O25 A;  3SAV A;  1VEG A;  4GIP A;  1E94 E;  4NSR A;  1AUA A;  1G8P A;  5DFL A;  3ZCB B;  4DBG B;  4JI8 M;  4JXJ A;  1A5T A;  2CUZ A;  2DAG A;  2FNA A;  2MGW A;  4GH9 A;  2QBY B;  4PDI A;  3FD9 A;  5ITU A;  4GKJ M;  3KVW A;  2KZS A;  2K6B A;  1ZAE A;  4W5W A;  1GJT A;  3L28 A;  3TWK A;  3B89 A;  4L78 A;  1DO0 A;  4JI2 M;  1V92 A;  2JA2 A;  3AOE C;  1NJF A;  4LFC M;  1V34 A;  2HWJ A;  5EP2 A;  3VK7 A;  2C9O A;  2RGO A;  4XGI A;  5FTK A;  4JN6 A;  3JR4 A;  4CIS A;  3U6E A;  4CJ6 A;  4LF6 M;  1TGU A;  4MGY E;  3UJN A;  2ZBK B;  4DR5 M;  2KRK A;  1C1K A;  3HHY A;  3MK6 A;  2BJW A;  2BNK A;  5LMN M;  2M5Z A;  4BBA A;  3NWL A;  1WR1 B;  4AZF A;  2CHV A;  1XNQ M;  4CHT B;  2C9C A;  5BPV A;  3HJ8 A;  1R7R A;  5H37 D;  3U60 B;  1R2Z A;  3SAS A;  2XEP A;  3QAU A;  4Y28 F;  5ITQ A;  2QBY A;  4DV0 M;  4M9Z A;  2DAK A;  1YLA A;  3HJQ A;  4A3V B;  2LVO C;  4XK8 F;  3KP0 E;  3HHX A;  3U6D A;  2DHR A;  5A2Q S;  4DR3 M;  3K92 A;  1Z59 A;  2I7P A;  4HL4 A;  1IN8 A;  4PT5 A;  4S12 A;  4KLN A;  5JI2 E;  1L8Q A;  4DR6 M;  2C5R A;  1Q02 A;  3JR5 A;  2JZ0 A;  1NHG C;  1VDD A;  2M60 A;  2I7N A;  1SXJ B;  1XB2 B;  2QHO B;  4IIW A;  3GO8 A;  1T6O A;  1YUB A;  2R45 A;  3GQ5 A;  4QHT A;  1HR0 M;  1HT2 E;  5FTJ A;  3VFD A;  1L2C A;  4L6V 6;  2FOI C;  3VKG A;  3U60 A;  4NXM M;  2JXN A;  1IN6 A;  2C98 A;  2UXC M;  4LJ6 A;  1NSF A;  5EXX A;  1QZM A;  2C99 A;  4JI5 M;  2OO9 A;  4OVZ B;  1ORY B;  2AHM A;  1NHW C;  4MGH A;  2R65 A;  2R4J A;  1PM5 A;  3GLF B;  3GRU A;  3ZH9 B;  1MX0 A;  2WZJ A;  4AW4 A;  2F5N A;  2QCU A;  5DNY A;  3GLI E;  4PD2 A;  1PJJ A;  3MJ5 A;  1OAI A;  4WP2 A;  3GRY A;  4NOO B;  2QSF X;  2LNH C;  4GC9 A;  1SXJ A;  4NRV A;  2QNJ A;  4WUR A;  3RGP A;  3TQS A;  3VK8 A;  4LF8 M;  2DZN B;  3AOG A;  3SHG B;  3U6L A;  2L7H A;  4G4Q A;  1D2N A;  3CTW B;  4GHA A;  5ITY A;  4LJ5 A;  4DV4 M;  1IXR C;  1KYI A;  2VQE M;  3A45 A;  4JI1 M;  1IY2 A;  1Q39 A;  1W5S A;  1GLN A;  4WW0 A;  1E9S A;  1F4I A;  3KW6 A;  1VEJ A;  4OVZ A;  3BBZ A;  3KP1 E;  3M6A A;  1L1T A;  3EIE A;  1HQC A;  2DZL A;  4RNA A;  3KOX E;  3GLF A;  2EKK A;  2JY7 A;  4GMQ A;  3L2A A;  4CGY B;  4YHH M;  4B3R M;  1IXZ A;  2G5G X;  4M9S A;  3LCU A;  2ERC A;  2BWB A;  2ZTC A;  1IN7 A;  3TWM A;  2DWZ B;  2FFJ A;  3CF0 A;  3D8B A;  1E9R A;  3SHF A;  4AG6 A;  3C3D A;  4IBE A;  3HU2 A;  3GLH B;  1S3S A;  1SXJ D;  1VQ1 A;  2G8L A;  4B3S M;  2D7G A;  1V33 A;  4AG5 A;  3ZQJ A;  1L1Z A;  1HQY E;  1R6B X;  1QZE A;  1CUK A;  1TH4 A;  1YSY A;  1TR8 A;  1Z6T A;  3AJI B;  4RKU F;  4DV3 M;  1PJS A;  3I4V A;  4JI6 M;  4IJE A;  2LVA A;  1GJS A;  5ITR A;  3HHW A;  2CWB A;  1K82 A;  4D82 A;  2K0B X;  1XWI A;  1DGH B;  4IBC A;  2HKJ A;  3SC3 A;  4Q7J A;  2EO2 A;  3T15 A;  1BVS A;  2FE8 A;  3VKH A;  3AV0 A;  3SMP A;  3R8F A;  1EE8 A;  1I94 M;  1NO1 A;  4I5S A;  3W68 A;  2KDL A;  3PVS A;  4QNR A;  2CV1 A;  2CEA A;  4HEO A;  3GLH A;  4MB7 A;  3C3E A;  4NC6 A;  2CV0 A;  4FD2 A;  2JNH A;  1G41 A;  2JUJ A;  3WHL A;  2YNM D;  4LRS A;  3A46 A;  2L09 A;  4LGM A;  4NXN M;  3FUW A;  2OQ4 A;  3FE3 A;  1TTE A;  3GQ3 A;  3KOY E;  1OIZ A;  2R18 A;  3SAW A;  1I4W A;  3E4R A;  2ZAM A;  3E46 A;  2QP9 X;  1J5E M;  2L6O A;  3R9X B;  2JP7 A;  3L26 A;  1DGH A;  4LF7 M;  3THG A;  4GHL A;  1GKI A;  1LV7 A;  4B08 A;  4LJ9 A;  3H4M A;  1SXJ E;  2ZTD A;  1PGY A;  2MH8 A;  4GEW A;  3E9S A;  1RU3 A;  4DV5 M;  3J2P B;  4M9X A;  1UFZ A;  1H6U A;  3NBI A;  4XBO A;  3KOZ E;  1VG5 A;  4MGZ E;  1IBK M;  1OFH A;  2QEN A;  2K47 A;  1MU5 A;  1MJG M;  3A98 B;  1ZMU A;  1OJL A;  5GKN A;  4GIT A;  4QHS A;  3GQ4 A;  3FRI A;  3FTD A;  2QPA A;  2Y21 A;  3K9P A;  3T1Y M;  3JAM S;  2UXB M;  4OU7 A;  4EIW A;  2DXI A;  4MGK E;  7CAT A;  2DZO B;  1OTR A;  2VDB B;  3GLF E;  2UUA M;  3C9P A;  3K1J A;  5E26 A;  2JY5 A;  3GPY A;  1X37 A;  1P3Q Q;  4LCB A;  5KQD A;  3AKZ A;  4DV6 M;  1N78 A;  1HNX M;  3LMM A;  4R71 A;  4B3T M;  3GP1 A;  2WSF F;  3RFW A;  1XXH B;  3GRR A;  4FCW A;  5KQ8 A;  2XLJ A;  2OOB A;  3K2L A;  1QUS A;  2B3T A;  2MR9 A;  3HGI A;  2A5Y B;  5EJC A;  4KT0 F;  1IQP A;  1PJQ A;  3LW5 F;  1XMO M;  1HNW M;  3UK6 A;  2JY6 B;  1WIV A;  4M0D A;  1JB0 F;  2Z3X A;  1GVN A;  3OTO M;  5EXS A;  2YR0 A;  3E21 A;  1WGL A;  1QAM A;  3MHV C;  1QVR A;  3U6P A;  2ZM6 M;  3KSJ A;  5EP4 A;  3FTF A;  1R4G A;  2MRO B;  2OOA A;  2J7O A;  2V6Z M;  3CF6 E;  3PFI A;  3T6P A;  4BLC A;  4ITQ A;  4G4O A;  2DNA A;  1HNZ M;  1MN3 A;  3L25 A;  1GL7 A;  3B7N A;  2LXE A;  3MMP A;  2RRU A;  1QQW A; 
#chains in the Genus database with same CATH homology
 5KPR A;  4MH0 E;  1XXH A;  5EQT A;  3KOW E;  4KO8 A;  4I81 A;  5DYI A;  3GLG B;  3Q8X A;  1Z5B A;  3PXG A;  5LMU M;  4DV1 M;  2J7N A;  2XFT A;  2R62 A;  3C58 A;  3HJS A;  4NRW A;  5KPT A;  3FUT A;  4AKG A;  3UZU A;  2C96 A;  5FTM A;  1NNJ A;  4RF0 A;  4LY6 A;  1N77 A;  4X62 M;  3A42 A;  1ZQ9 A;  3BOS A;  4REZ A;  2UXD M;  1L2D A;  1NNU C;  2O5R A;  2KEB A;  3FYD A;  3DFZ A;  4DV7 M;  2ZAO A;  3GLG A;  1IBL M;  1NY6 A;  1T3T A;  4LGY A;  2X4A A;  4B3M M;  3HWS A;  4KOD A;  4NL4 H;  3W0F A;  4IJF A;  3U5Z B;  2P5T A;  3LVV A;  3AL0 C;  1JR3 A;  4GRI A;  1Z5C A;  3DA1 A;  1G4A E;  4NSO B;  3TE6 A;  4X64 M;  2F5S A;  2CE7 A;  3GRV A;  1IM2 A;  2CV2 A;  1N34 M;  1SXJ C;  3WHK A;  4X65 M;  3VLF B;  1NY5 A;  1DGF A;  4QNM A;  2XZF A;  4ZPX A;  1N36 M;  2KZU A;  2QZ4 A;  1DGG A;  3U61 B;  2DVW B;  1XC8 A;  2XSZ D;  3FKE A;  4FWD A;  4IBF A;  3HKP A;  5IZ7 D;  1W5T A;  3U6C A;  5KPZ A;  4RF1 A;  2UU9 M;  2L7I A;  3U5Z A;  4M0W A;  3SAT A;  3U6O A;  5KO3 A;  1JR3 D;  3IG8 A;  1Q3C A;  3KSX A;  2CHQ A;  2DWN A;  4MM3 B;  1IN4 A;  4R7G A;  4B7G A;  4FW9 A;  2KXE A;  3AOE A;  2HHH M;  2RKO A;  1GL6 A;  1Q3B A;  3U6M A;  2XZU A;  3IG5 A;  3EIH A;  3LQQ A;  2CFO A;  3RGS A;  2VII A;  3U61 A;  3LQR A;  5IRE B;  1IBM M;  5FTL A;  2Y20 A;  1FNN A;  2E5L M;  4LJ7 A;  3T1H M;  3J7B A;  2UUB M;  2KW0 A;  3M0E A;  3W0L B;  2YQZ A;  2R4E A;  2F5Q A;  3HU1 A;  4LJ4 A;  3M7G A;  2KA6 B;  2R46 A;  2Q2E B;  3J81 S;  4G4R A;  4FWH A;  1TH3 A;  4LFA M;  4GC5 A;  4JI0 M;  3VDP A;  5C18 A;  1IN5 A;  3PNV A;  2HL7 A;  5EXT A;  3FUU A;  4LFB M;  3U6S A;  2F5O A;  4IBI A;  4JI4 M;  4IBD A;  4MGI E;  3AFH A;  5FSW A;  2F5P A;  1E32 A;  4L15 A;  1DO2 A;  5FLX S;  1XMQ M;  1IY0 A;  4FCV A;  4I8O A;  2HCB A;  2BJV A;  3CF2 A;  3B9P A;  5IT9 S;  2Z4S A;  2H1R A;  1KFV A;  1NVM A;  4B7H A;  1K3X A;  4PDG A;  4JI3 M;  1QYR A;  4X66 M;  4D80 A;  4HLQ A;  5EXP A;  1UM8 A;  4G6Z A;  1PJI A;  3KS8 A;  4II7 A;  4DR4 M;  8CAT A;  1G59 A;  1JQJ C;  1IY1 A;  1XNR M;  1QAQ A;  4LJA A;  1J09 A;  1XHB A;  3D8L A;  1QAN A;  4YY3 M;  4FWG A;  2OPF A;  1J7K A;  5ITX A;  4LZJ A;  4JI7 M;  4FCT A;  3LVW A;  2XH9 A;  4D81 A;  1HT1 E;  3SBJ A;  2D7H A;  2RGH A;  5IWA M;  2LH0 A;  3U6Q A;  4GKK M;  4BB9 A;  4AKH A;  1IXS B;  1TH2 A;  4DR2 M;  1QAO A;  3HU3 A;  3GPP A;  2DWM A;  2D7E A;  3FUV A;  3VDU A;  2XFS A;  4Z6Y A;  1KSF X;  4B7F A;  2EUC A;  3ILK A;  2X49 A;  4L4U A;  5EP3 A;  4I4L A;  2W82 A;  1Z5A A;  3SAR A;  4DUZ M;  1NJG A;  4PCZ A;  2Z4R A;  2LWX A;  2Y0T A;  3L29 A;  2XSZ A;  3I51 A;  4FVM A;  3KDS E;  4L8R C;  3SAU A;  1YE9 A;  2YFQ A;  4L16 A;  1L2B A;  2CHG A;  4LF9 M;  2V1U A;  5FTN A;  1G3I A;  4AI6 A;  3I4Y A;  3J7A S;  5DYG A;  3ZC7 B;  3GPU A;  4Z8X A;  5BR8 M;  2F4V M;  4DV2 M;  1TDH A;  5E6J A;  2EA0 A;  2ZAN A;  3J80 S;  1N32 M;  1N33 M;  2XF3 A;  2NQ8 C;  4QOS A;  1TDZ A;  2VQF M;  4LF5 M;  3TWL A;  2Y0Q A;  3FTC A;  3SMS A;  4IBG A;  2Z7J A;  3RE8 A;  3SFZ A;  4LF4 M;  1WXQ A;  2X8A A;  2XGN A;  3PNY A;  3K8Z A;  4IBJ A;  4K0K M;  4LG2 A;  1FJG M;  5ITT A;  2KRU A;  1K3W A;  4IBB A;  4IBK A;  5F3W A;  3QWL A;  5ITX E;  4LZZ A;  3GLI B;  4JV5 M;  3T38 A;  4DR7 M;  3KXE C;  3L27 A;  3TL4 X;  1R2Y A;  4TUW A;  4G4N A;  3HHZ A;  4OX9 M;  3TPZ A;  3SYL A;  4R3D A;  4P16 A;  3J27 B;  4AKI A;  2DWL A;  2V1C A;  3DZD A;  5EP1 A;  4AQY M;  5C1B A;  1DGB A;  3SYK A;  4QOZ C;  4KHP M;  3GPX A;  1N75 A;  5JI3 E;  1OFI A;  3KFU G;  2UUC M;  4LRT A;  3KS4 A;  3FUX A;  3UMM A;  3GLI A;  4LJ8 A;  3FTE A;  4DR1 M;  4DUY M;  3UGJ A;  3FYC A;  4OW0 A;  3DOA A;  3SAV A;  4GIP A;  1E94 E;  4NSR A;  1G8P A;  3ZCB B;  4JI8 M;  4JXJ A;  2CUZ A;  4GH9 A;  2FNA A;  2QBY B;  4PDI A;  3FD9 A;  5ITU A;  4GKJ M;  3KVW A;  2KZS A;  4W5W A;  1ZAE A;  3L28 A;  3TWK A;  4L78 A;  1DO0 A;  4JI2 M;  2JA2 A;  3AOE C;  1NJF A;  4LFC M;  5EP2 A;  3VK7 A;  2C9O A;  2RGO A;  4XGI A;  5FTK A;  4JN6 A;  3JR4 A;  4CIS A;  3U6E A;  4LF6 M;  1TGU A;  4MGY E;  3UJN A;  2ZBK B;  4DR5 M;  2KRK A;  1C1K A;  3HHY A;  3MK6 A;  2BJW A;  2BNK A;  5LMN M;  2M5Z A;  4BBA A;  3NWL A;  4AZF A;  2CHV A;  1XNQ M;  4CHT B;  2C9C A;  5BPV A;  3HJ8 A;  1R7R A;  5H37 D;  3U60 B;  1R2Z A;  3SAS A;  2XEP A;  3QAU A;  5ITQ A;  2QBY A;  4DV0 M;  4M9Z A;  3HJQ A;  4A3V B;  3KP0 E;  3HHX A;  3U6D A;  2DHR A;  5A2Q S;  4DR3 M;  3K92 A;  1Z59 A;  2I7P A;  4HL4 A;  1IN8 A;  4PT5 A;  4S12 A;  4KLN A;  5JI2 E;  1L8Q A;  4DR6 M;  2C5R A;  3JR5 A;  1NHG C;  1VDD A;  2I7N A;  1SXJ B;  2M60 A;  4IIW A;  3GO8 A;  1YUB A;  2R45 A;  3GQ5 A;  4QHT A;  1HR0 M;  1HT2 E;  5FTJ A;  3VFD A;  1L2C A;  3VKG A;  2FOI C;  3U60 A;  4NXM M;  1IN6 A;  2C98 A;  2UXC M;  4LJ6 A;  1NSF A;  5EXX A;  1QZM A;  2C99 A;  4JI5 M;  4OVZ B;  1ORY B;  2AHM A;  1NHW C;  4MGH A;  2R65 A;  2R4J A;  1PM5 A;  3GLF B;  3GRU A;  3ZH9 B;  1MX0 A;  4AW4 A;  2F5N A;  2QCU A;  5DNY A;  1PJJ A;  4PD2 A;  3MJ5 A;  3GRY A;  4NOO B;  2LNH C;  4GC9 A;  1SXJ A;  4NRV A;  4WUR A;  3RGP A;  3TQS A;  3VK8 A;  4LF8 M;  2DZN B;  3AOG A;  3SHG B;  3U6L A;  2L7H A;  4G4Q A;  1D2N A;  3CTW B;  4GHA A;  5ITY A;  4LJ5 A;  4DV4 M;  1IXR C;  1KYI A;  2VQE M;  3A45 A;  4JI1 M;  1IY2 A;  1Q39 A;  1W5S A;  1GLN A;  4WW0 A;  1E9S A;  3KW6 A;  4OVZ A;  3KP1 E;  3M6A A;  1L1T A;  3EIE A;  1HQC A;  4RNA A;  3GLF A;  3KOX E;  4B3R M;  4JYA M;  4GMQ A;  3L2A A;  4CGY B;  4YHH M;  1IXZ A;  2G5G X;  4M9S A;  2ERC A;  1IN7 A;  3TWM A;  2DWZ B;  2FFJ A;  3CF0 A;  3D8B A;  1E9R A;  3SHF A;  4AG6 A;  4IBE A;  3HU2 A;  3GLH B;  1S3S A;  1SXJ D;  2G8L A;  4B3S M;  2D7G A;  4AG5 A;  1L1Z A;  1HQY E;  1R6B X;  1TH4 A;  1YSY A;  1Z6T A;  3AJI B;  4DV3 M;  3I4V A;  4JI6 M;  4IJE A;  5ITR A;  3HHW A;  1K82 A;  4D82 A;  1XWI A;  1DGH B;  4IBC A;  2HKJ A;  3SC3 A;  2EO2 A;  3T15 A;  2FE8 A;  3VKH A;  3AV0 A;  3SMP A;  3R8F A;  1EE8 A;  1I94 M;  4I5S A;  3PVS A;  4QNR A;  2CV1 A;  2CEA A;  3GLH A;  4MB7 A;  2CV0 A;  4FD2 A;  1G41 A;  3WHL A;  2YNM D;  4LRS A;  3A46 A;  2L09 A;  4LGM A;  4NXN M;  3FUW A;  2OQ4 A;  3GQ3 A;  3KOY E;  2R18 A;  3SAW A;  1I4W A;  3E4R A;  2ZAM A;  3R9X B;  2QP9 X;  1J5E M;  2L6O A;  3L26 A;  1DGH A;  4LF7 M;  3THG A;  4GHL A;  1GKI A;  1LV7 A;  4B08 A;  4LJ9 A;  3H4M A;  1SXJ E;  3E9S A;  4DV5 M;  3J2P B;  4M9X A;  3NBI A;  1H6U A;  4XBO A;  3KOZ E;  4MGZ E;  1IBK M;  1OFH A;  2QEN A;  2K47 A;  1MU5 A;  3A98 B;  5GKN A;  1OJL A;  4GIT A;  4QHS A;  3GQ4 A;  3FTD A;  2QPA A;  2Y21 A;  3T1Y M;  3JAM S;  2UXB M;  4OU7 A;  4EIW A;  2DXI A;  4MGK E;  7CAT A;  2DZO B;  2UUA M;  3K1J A;  5E26 A;  3GPY A;  1X37 A;  5KQD A;  4LCB A;  4DV6 M;  3AKZ A;  1N78 A;  1HNX M;  3LMM A;  4B3T M;  3GP1 A;  3RFW A;  1XXH B;  3GRR A;  4FCW A;  5KQ8 A;  2XLJ A;  3K2L A;  3HGI A;  2A5Y B;  5EJC A;  1IQP A;  1XMO M;  1HNW M;  3UK6 A;  4M0D A;  2Z3X A;  1GVN A;  3OTO M;  5EXS A;  2YR0 A;  1QAM A;  3MHV C;  1QVR A;  3U6P A;  2ZM6 M;  3KSJ A;  5EP4 A;  3FTF A;  4BLC A;  2J7O A;  2V6Z M;  3CF6 E;  3PFI A;  4ITQ A;  4G4O A;  1HNZ M;  3L25 A;  1GL7 A;  2LXE A;  1QQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...