2V74B

Crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), in complex with s-adenosyl-homocysteine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
331
structure length
331
Chain Sequence
AVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-ARGININE METHYLTRANSFERASE CARM1
publication title Insights Into Histone Code Syntax from Structural and Biochemical Studies of Carm1 Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 99
structure length 331
sequence length 331
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2v74B02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2v74B01
5DWQA 5K0FA 7MHTA 4PCLA 3B3GA 4OBWA 5LQNA 2O07A 4RTMA 4P7JA 4C05A 1HMYA 4GC5A 4K6MA 3BGIA 1QZZA 3G2PA 3HVJA 4RTJA 1RI3A 2OZVA 3LHDA 1JQEA 3DXXA 5DPMA 5HFJA 3IV6A 3FTCA 2Z6UA 2PLWA 3CCFA 1NKVA 2CMHA 2EFJA 2IP2A 3GRZA 3Q87B 4FS8A 3PTAA 1YFJA 1KP9A 1IY9A 1HNNA 3EVFA 5DXAA 4FT4A 1P1BA 2Y1XA 1BOOA 1KR5A 2FHPA 3IHTA 3KQOA 4AZWA 4DCGA 5BW4A 3UJAA 5KVAA 3B7PA 4EQZA 1TPYA 2OXTA 1QYRA 5HIIA 2WA2A 2H00A 2OY0A 1XVAA 5EHGA 3MAGA 2NP6A 4HH4A 1RJFA 2XBMA 1B42A 4Y2HA 2ZTHA 3ME5A 3FPFA 3THSA 2P8JA 5EEGA 4DM3A 2IH2A 4KDRA 4PIPA 2GPYA 3FUUA 1SG9A 3UBTA 2HNKA 3HA7A 3M6XA 4P58A 4YUVA 5FTWA 1NW8A 5K09A 1AV6A 2AOXA 1ZG3A 1D2CA 3C6KA 4NECA 4KVZA 4YUYA 1H1DA 3UJ9A 3B89A 5K03A 2P35A 2PX2A 5GM1A 3AWIA 2R3SA 5H02A 5LSAA 2PXXA 5CUQA 4YV1A 3SR4A 4RVFA 4HTFB 3T7TA 2BR5A 2PX5A 4ISCA 4F84A 3CC8A 4X60A 4LWPA 2ZIEA 4PYIA 1P91A 4F86A 3SGLA 2C7PA 3DMGA 5F2OA 4DA4A 4ZTBA 3PX3A 4XUEA 2UYCA 1SUIA 2YXDA 1BHJA 2NXJA 1YUBA 3E23A 3NVMB 2B3TA 2G8NA 2IBSA 3B3FA 2PX8A 1NV8A 4R6WA 3GJYA 3BKWA 3BWYA 1SUSA 3EVDA 3A27A 3KQMA 3GDHA 5DX8A 1JG2A 3A7DA 1JG3A 2HWKA 3HCBA 2IDKA 2CKDA 3HNRA 3LKZA 5CVEA 3CBGA 3OE4A 1DL5A 5ICFA 4E2XA 10MHA 1N7IA 2OYRA 4BLUA 5DM0A 5K0CA 5DXJA 3P9NA 5D1NA 3EVCA 3JWIA 4V0RA 3TRKA 3LCUA 2A14A 2VDWA 3PT9A 4HRAA 4Y30A 4E2ZA 3HCFA 1RJDA 4RTOA 3ER9A 1RI4A 1XXLA 3V8VA 5FA5A 1VP3A 4C08A 4U7TB 5T6BA 1VP9A 3ELWA 4RYLA 3SVZA 1G60A 2IFTA 2V7EA 5U4XA 3AXSA 3OPNA 4FP9A 4BLWA 4E70A 3IEIA 3A4TA 5JR3A 3GGDA 2Z6AA 4B17A 2BR3A 1AQIA 5D1HA 1N7JA 2K4MA 1JSXA 4FT2A 5E1OA 1SQGA 5CIYA 3MTIA 4QVKA 2JH9A 2AN4A 2PSSA 3B5IA 2EG5A 3KR1A 4E33A 3KQTA 5HILA 3C0KA 3CVOA 3PB3A 3ELDA 1G8AA 5DX0A 4PYJA 3PX2A 4PGGA 3KPUA 1KHHA 2VDVE 2ZLBA 1RI2A 5FHQA 1MHTA 1TW2A 5T67A 3VYWA 1EJ0A 4C07A 3G88A 4GF5A 2ONYA 2P3LA 3L8DA 4ER0A 1R6AA 3I5UA 4HGYA 3KU1A 3Q7EA 5EZQA 3P2IA 3NWBA 3E8SA 3OZRA 2ZVJA 5G02A 3P97A 4PYMA 3GRRA 3GWZA 4AZVA 2EJTA 2ZFUA 1VBFA 4LECA 4FGZA 4ER7A 4LWOA 5F2NA 2IH4A 3T7SA 3CGGA 3SMQA 3G8BA 5HIMA 3OU6A 3H2BA 4BLVA 1NW3A 5E2BA 5EOVA 4YUZA 1KPIA 4E2YA 4EMSA 1OR8A 5EEHA 3PVCA 2AOUB 2ZWAA 3A25A 2YX1A 2NP7A 1YZHA 4C04A 3FPHA 3NDJA 2WA1A 2ZZMA 3B3JA 3CJQA 3IYLW 1DCTA 4PYLA 1FP2A 1BKYA 1YZ3A 4U7PB 5ICGA 3BWBA 3EPPA 3LCVB 1MJFA 2BM9A 2PY6A 3UJ8A 1KXZA 2LD4A 3FYDA 3UZUA 4GQBA 4X63A 2R6ZA 3EVBA 4LG1A 3PFHA 2PT6A 5DM1A 2OB2A 3UJDA 2GB4A 2YXEA 5EIFA 5C9ZA 2DULA 3ANXA 3CJTA 3KPVA 3OE5A 2JHCA 3T0IA 2ONZA 3NWEA 1N2XA 3HA3A 4MQ4A 1RI5A 3EVAA 5EMKA 1EAMA 2ZULA 5GIPE 3OFKA 3FTEA 3MCTA 1RJGA 2G71A 1NW6A 3KQVA 1G38A 3LDFA 3KKZA 2VZ9A 3I9FA 2ZBQA 3G2MA 4WVLA 3I64A 5EPEA 3FYCA 5EC8A 3TM5A 4G56A 2P3OA 2G1PA 1VE3A 3T7RA 1EIZA 3U81A 3MTEA 1V39A 1U2ZA 3GCZA 4PGHA 1TW3A 2ZCJA 4PWYA 5CD1A 1G8SA 2OO3A 3K0BA 2JJQA 1IM8A 1L3CA 3HA5A 4OA5A 2PX4A 2ORED 4C06A 1L1EA 3SSMA 2KW5A 4YMHA 2N47A 4ATNA 4KIGA 4PYOA 2QE6A 2ZW9A 2CWWA 1F38A 1JQ3A 3F4KA 5M5BA 4PCAA 5GINE 4QDKA 4RTQA 4C03A 5K05A 1Z3CA 2B2CA 1FBNA 1KYWA 5E9QA 4RTLA 3KPJA 3P71T 3QOWA 4RTRA 3EEOA 2B78A 2PWYA 3HVIA 1JSZA 5KYGA 3R6TA 2VP3A 3LKDA 4MHTA 4PYQA 3BKXA 2I7CA 2AN5A 3DMFA 4HTFA 5ERGB 4AZTA 3LBYA 3G7UA 4EK9A 5DLYA 4R8RA 2AVNA 4GC9A 3GRVA 2PV0A 3TKYA 3FTFA 3X0DA 2AOWA 3TLJA 1M6YA 2CL5A 2NXNA 5EIWA 5C0OE 2AS0A 4A6EA 2XVMA 2IDJA 1L3IA 5CVDA 1QANA 4QPPA 3MB5A 2GH1A 2QM3A 4GBED 4CKCA 4GOLD 4P7GA 1XDUA 2PBFA 5EKUA 4DF3A 1SQFA 3E7PA 2I9KA 4O29A 3UFBA 2QYOA 2ZIGA 3OZTA 4PINA 2AOTB 4DCMA 4YUXA 1JG4A 5B1SA 4KIFA 3KQYA 2NNWB 2OKCA 4QQNA 1YB2A 3JWJA 5IH3A 5FCDA 3AJDA 3HEMA 4PYNA 3NDIA 5E9JA 3UJ7A 1FP1D 2GS9A 4AX8A 1AQJA 1FJXA 4L7VA 4HC4A 4CKBA 3QV2A 3MERA 4RTNA 1P39A 3KQQA 3NW9A 1ZQ9A 3KR0A 5FQOA 1RI1A 1KPHA 3MHTA 2Y1WA 4OBXA 4GEKA 3MCZA 3TQSA 3FPEA 1I1NA 3GXOA 4QQKA 4F85A 3HCEA 2C7RA 3C3PA 3HCDA 4RSRA 4RTKA 3KPWA 4XCXA 1O9HA 3P2KA 5DTMA 2H11A 4A6DA 2JH8A 5KS2A 1EQAA 1QAQA 4CXMA 3HTXA 5DX1A 4C4AA 4CWAA 2VDUE 5EMJA 2HR1A 4YMGA 3UWPA 4EKIA 3HCCA 1O9GA 1VPTA 4RTPA 3NMUF 3NVKI 4Z2YA 3LL7A 4YV2A 1XDSA 3SSNA 1WXWA 1NV9A 3BXOA 3P9IA 3E05A 5BW5A 2JG3A 5KQSA 1ZGJA 3JWGA 2B9EA 3OCJA 3KQWA 2GLUA 2C7OA 3EGEA 3LDUA 5FWAA 3LECA 5HIKA 4KRGA 4XUCA 4RTSA 3DUWA 1XTPA 3LSTA 3MGGA 4QPNA 3C6MA 3NTVA 2NXCA 4FSDA 3EVEA 2E5WA 4HSGA 3ERCA 3OU2A 3C3YA 3G8AA 3O4FA 2BM8A 1SKMA 2V74B 2AOUA 3ELYA 4ER3A 4UOEA 1ZHFA 2CMGA 2YVLA 3FTDA 5DM4A 1UWVA 4XUDA 3KR9A 1I4WA 2PGXA 3A26A 5E8RA 4RX1A 5C1IA 2P3QA 5IKMA 3BT7A 3PFGA 3DMHA 5HEKA 4ER6A 2BH2A 4AUKA 3LPMA 2G72A 4KDCA 3NJRA 2AOVA 4CTKA 5EG5A 1ORIA 5EGSA 4YUWA 1ZKDA 4OA8A 1P1CA 2HV9A 2ZBPA 2EX4A 5MHTA 4DZRA 2ZWVA 4DKJA 1JTEA 5BXYA 5CVUA 2UZ4A 5FUBA 1QAOA 5LQCA 1NBIA 3M70A 5F2KA 3O7WA 5LQAA 2YTZA 3A7EA 3DH0A 4GOMD 4JXJA 3TR6A 5DSXA 1NW5A 2IGTA 3D2LA 1Q0SA 3SM3A 2XYRA 2P1DA 4X41A 1X1BA 1M6EX 2P40A 3GIWA 5E1MA 3GNLA 3M6VA 5FQNA 2XYQA 5K0LA 4GOND 5ICCA 1YF3A 2FK8A 3OZSA 2QY6A 2ZSUA 3KHKA 4QVGA 5FULA 5E2AA 3TFWA 3QOXA 4PYKA 1ZGAA 2P7HA 3FRHA 3DULA 3REOA 5K0EA 1XCJA 3UJ6A 3DR5A 2Q41A 2JHAA 3FUVA 3HM2A 3LBFA 5JUWA 1NE2A 5K01A 5LR6A 2I62A 3M4XA 5HIJA 1WXXA 1PJZA 2H1RA 1D2GA 2PXCA 2PJDA 2PXAA 2IPXA 3DXZA 3DXYA 1FPQA 5LQJA 5FWDA 3UA3A 5DTQA 3M33A 1JG1A 3SX0A 1BC5A 2ESRA 5EKXA 4ER5A 1UFKA 2PVCA 3AXTA 3UA4A 3ORHA 3RW9A 1EG2A 5E1DA 3S68A 4AZSA 3I58A 4BY9E 3BUSA 4R6XA 3FRIA 2EJUA 5DM2A 5FA8A 3ELUA 3FUTA 3G89A 3LCCA 2IBTA 4GUAA 3K6RA 5DSTA 3RODA 1VLMA 3WSTA 2G70A 4WXHA 2O57A 4V0QA 4QDJA 3R24A 4KW7A 9MHTA 4EKGA 4YV0A 3GO4A 5CCXA 2AR0A 1NBHA 2XVAA 2XYVA 4H0NA 1XJ5A 4OQEA 4GOOD 1VL5A 4RV9A 2OB1A 1G55A 1G6Q1 3BGVA 3O31A 2GAFA 3CKKA 1X19A 3M6WA 3KPYA 4BP3A 1R74A 2ZZNA 1Y8CA 2FYTA 2BR4A 3KQPA 4PONA 4E30A 2AOTA 3FPJA 5K0NA 2BZGA 1Q0TA 4PIMA 2ZBRA 4RWZA 3BZBA 3EGIA 2YXLA 3VC2A 2FCAA 1VQ1A 1R8XA 3R3HA 1KIAA 5EVJA 4IV0A 3UJCA 3TM4A 3PS9A 2AZTA 2P7IA 1L3BA 2UYOA 1WZNA 2P41A 3R0QA 1JQDA 5LQRA 4MTLA 3DLIA 5DRTA 4DMGA 5K0GA 4E2WA 4M38A 2JHPA 3KR2A 2VS1A 1KYZA 3PLAE 2O0LA 3UJBA 2NXEA 8MHTA 5FHRA 3VSEA 5EMLA 2PKWA 1ORHA 3G2OA 3I53A 1R18A 4P7FA 4R8SA 1L9KA 4RVHA 5KQRA 2IH5A 3HP7A 5HZMA 1M0EA 3VC1A 5GM2A 4MWZA 5FADA 1NW7A 4PNEA 1X1CA 3P8ZA 4OQDA 1I9GA 3EVGA 3G5TA 2ADMA 3BWMA 5DRYA 4CKEA 4OX9Y 3DTNA 5T64A 3DOUA 2AN3A 5LQUA 3M6UA 5GOZA 3EMBA 4IKPA 3OU7A 1R8YA 3BGDA 3OFJA 4M7RA 2FPOA 3SSOA 1NT2A 5CVVA 1DUSA 4QTTB 1XCLA 3CJRA 1VIDA 5EMMA 3LDGA 4CTJA 4FSXA 5ICEA 5GP1A 3HVHA 3FUXA 2F8LA 3P2EA 1D2HA 2OBFA 3FZGA 5GWXA 4MIKA 2UYQA 2I6GA 4POOA 1WS6A 1RJEA 1WY7A 5E9WA 5EHIA 1XDZA 1AF7A 3GRYA 1KPGA 5CVJA 4IWNA 4DQ0A 2WK1A 1SVUA 2ZZKA 2O06A 4X61A 3HCAA 5K0JA 5CCBA 4IV8A 3TMAA 5BP7A 1UIRA 3AY0A 1EJ6A 1X1AA 5EQJB 4E32A 4EVIA 1O54A 4E31A 1IXKA 1R00A 2IIPA 5EZSA 3P9CA 2PWPA 1QAMA 3FUWA 2YUIA 4FZVA 4HGZA 4BP1A 2DPMA 3ER8A 2FK7A 2ZIFA 3DLCA 5DT2A 2C7QA 5K8VA 3ID6C 3THRA 3JWHA 3EEYA 1PRYA 5E1BA 2AVDA 3SXJA 5E8JA 2YR0A 1JTFA 2FRXA 2GA9A 3TOSA 2OPBA 2QRVA 2B25A 3BWCA 3EMDA 3FPGA 3GU3A 3P9KA 1T43A 2QRVB 4X1OA 4QTUB 2YQZA 4M37A 4RVDA 5GIOE 4HG2A 3LX6A 3MQ2A 3RIEA 1YFLA 5P8WA 5LQKA 3EVZA 5HOQA 2NYUA 1WG8A 3R9XB 4KWCA 4RVGA 5DTRA 3TKAA 3TPZA 2UYHA 3DP7A 2ERCA 3HVKA 3G2QA 3LGAA 5CM2Z 1JR4A 3V97A 1F3LA 4M36A 3EGVA 4P7KA 4FR0A 1INLA 3GRUA 1X1DA 2PT9A 3KQSA 4R05A 5K0BA 2Z6QA 2O05A 2HMYB 2HTEA 3G5LA
chains in the Genus database with same CATH superfamily
2R6JA 4YCAA 1R0WA 4PR0A 3QXJA 4R2KA 5HFNA 5LYJA 1P4GA 4XCQA 2G07A 2F4VB 2A92A 2GYVA 2X4DA 4BATA 1U7HA 4HQ0A 4LYAA 1RPNA 1X80B 2A5JA 4HYEA 1E5XA 3LFHA 1JE0A 1QRRA 2IYWA 4MPTA 4XQEA 2VUIB 3RB8A 3UW1A 4EEXA 2WIGA 2XNJA 3GRZA 4XVUA 3PTAA 3CQ9A 4PEVA 2Z8YM 4DABA 3E7DA 1SC6A 3NHPA 1P1BA 3IHTA 1A0OA 3E3OA 2ZT7A 1HE2A 1E3WA 4A92A 4B81A 5CW1A 1TC1A 1NVAA 2CY0A 2C3UA 3NEAA 4GD3Q 3SS9X 3ZWCA 2I4OA 1N2CB 1CUCA 1ZNXA 4IRUB 5EHGA 4KR7A 3OQNA 4BZXA 2BI7A 3WTBA 2XNHA 3FPFA 1AMNA 5LP6C 5KBYA 3F49S 1S9HA 1P6QA 1E79A 2FZCA 3LT1A 4O4LF 2WPNA 2HLNA 1N2ZA 3BK7A 4WLFA 2TMDA 2ADOA 1SG9A 1WSAA 3SR0A 1UK7A 5A2QA 1Q0LA 4G0ZA 2O54A 4MLDA 2NVUA 1AHPA 2LR0A 1L8XA 1QHSA 4QNRA 1OX4A 2MJLA 1H1DA 1OLUB 1T2NA 2WLTA 3DMNA 3G3EA 3VBCA 3VDXA 4J94A 2VDOB 1NVVR 2QN3A 2XCOA 4YMTA 3TTVA 1PG2A 2J6IA 2PXXA 3EZ7A 1CPYA 3LPDA 4RVFA 1RIIA 4Z86A 3MB8A 2GBFA 4Y0VA 2JEZA 4G8BA 1EGVB 1DIBA 1XQ9A 2OHHA 2IV7A 3UOGA 1GCOA 3JU3A 5CGQB 2ZQ5A 1JBKA 2ERXA 2ZRDA 4O0LA 1XO1A 5CXSA 4Z99A 1NV8A 1SY7A 3BMQB 5IJWA 3Q7RA 1DJOA 3WRYC 3Q7TA 3C4JA 4TTAA 2B98A 4L5JA 1SUSA 4TMXA 5IKPA 5AK3A 1Q74A 4BKUA 3O4VA 5AKZA 5DX8A 3RUHA 3B70A 1JG3A 4JI2B 2BKLA 2QTTA 1T1IA 2Y0DA 4ROTA 3MJTA 5MN5A 4H3SA 2Y1OA 3TCKA 1S8FA 4DDVA 3H3XA 2LXNA 4I55B 3UJNA 4OM7A 3I6YA 2GSWA 2XE6A 4ND4A 1I24A 3PRJA 2JFBA 3MMSA 5IUJC 4LDPA 1IUOA 1RSZA 1UADA 1J20A 1JEQA 1OREA 2REOA 4O4LA 4BEBA 2NO6A 5EWLA 5FA5A 4PSKA 1EDBA 1LDNA 1PT9A 1QH0A 4J0GA 4KK3A 2C97A 3ZX5A 2HU8A 2MSEB 1A82A 2W2PA 1BNCA 2CEKA 3I52A 4GNKA 3PQ5A 1Y3AA 3AUXA 3PE3A 4J0KA 1BFDA 4G1BA 5JMTA 5C8XA 2K4MA 1JSXA 4GSYA 5E1OA 4F2PA 5KX5F 4EMBA 4AUMA 5I8ZA 1XU9A 3K6SA 3GGCA 4ZYUA 4F46A 1KVQA 3DOJA 3PX2A 2RFLA 3CIOA 2C4WA 3BMOA 3HLKA 1Z4IA 1NNLA 4MWGA 4HFJA 4GOJA 2HWYA 1CIJA 4QPCA 4F3NA 1WUKS 2FUG1 2XB9A 4R9NA 3AQIA 3Q7EA 2WJPA 2NUAB 3RRXA 3QE2A 4PO1A 5A5GA 4R41A 1PP4A 1DO2A 3E8SA 3OZRA 4NYJQ 2YVAA 4TKLA 4K46A 1L5QA 2EJTA 1XFAA 1YR7A 2ZK7A 5IJXA 2IH4A 2R7NA 2ZRFA 1UANA 1U2GA 4KQGA 5TQ2B 4CDRA 1TEZA 3VR5D 2NOAA 1YQWA 2FQ1A 3R44A 3KWLA 5EOVA 2QPLA 1OR8A 1V25A 1MB2A 1B0AA 1QFYA 1WCXA 2ZWAA 3OEWA 1ZVMA 2C9DA 4XD7D 4JMLA 2Z0MA 4MUNA 2NZWA 3DOIA 3FM9A 4AMZA 2I2FA 3CJQA 3H9QA 3BWDD 1O94C 1DCTA 5JEDA 1FP2A 1AGYA 4LI0A 5ALTA 2V9ZA 3IE1A 4CFSA 1THGA 4LF8B 5BOSB 2QPOA 4GU5A 2DSTA 1ODCA 4LG1A 3ROTA 3TB4A 4TT3A 4BNKA 3C7CB 2GLTA 3E27A 4YNBA 5IANA 4JXXA 4ZTZB 3L77A 1Z5OA 3IAFA 4YB8A 5CA0B 1PYOA 3U4QA 5LD2B 3ADBA 1YQEA 2JHCA 2CFCA 3EVAA 5D8DA 3OZCA 1MC8A 1P5FA 2OP0A 1QHHA 5ADHA 3H1AA 3E5RA 3ZWOA 2MYPA 1RYNA 3E9MA 4IGEA 5ARDA 3VH3A 4DR2B 3TW8A 1XRMA 4Y1EA 4I4TF 1EVJA 3BHNA 1FDOA 1PWEA 2HC9A 2VUSA 1E2EA 1NRXA 3HUDA 1I14A 4H60A 1DGQA 3IQIX 2Q0QA 4H59A 2VHVA 1U2ZA 2ZUFA 2F1JA 1CRPA 4HWRA 4PWYA 4X7MA 3O4GA 4HZGA 3DE7X 4M0MA 5J1SB 2JJQA 3R3VA 2AN1A 4ZRNA 1SN7A 4QDXA 2GAJA 5J40A 4YRSA 2R8RA 2NO9A 4XJTA 3Q3IA 1LSUA 4BBAA 5BWNA 3GT7A 5FOXA 1QH9A 1YHYA 3MLEA 4Q4CA 1JDUA 4PWZA 3QG5A 5T41A 5B3LA 3DHYA 3M2TA 4QTYA 1N9ZA 1PGOA 4M55A 5EERA 1BYIA 1VMAA 2IODA 3F4KA 3VH4A 1RWVA 3W2EA 1TU4A 4IV5A 5DYWA 5I9MA 3ESCA 3ROMA 2VJKA 5ARBA 5HKAA 3NIBA 1RQRA 2GYYA 3H5VA 2JIQA 2JJMA 5JANA 3AL2A 4HTFA 3BWXA 3V7WA 3RYCB 4G1CA 1IBMB 1N3IA 4EK9A 1GPMA 5DLYA 4B87A 1M54A 1NF8A 2AVNA 3FLBA 5KKAA 4CHTA 2CB0A 4ZICA 2PV0A 5JQGB 3LK6A 4MA0A 1XVUA 2ZWIA 3UN1A 4NR0A 4J1TC 1Z7EA 4I4TA 3FYUB 4XB6B 1C29B 2CXPA 2G5CA 4YXWA 2B8TA 1COZA 4WA8A 3L1KA 3UAWA 1NBMD 2EOAA 4ID3A 3RVDA 2QSJA 2AOTB 3ICVA 4HWPA 3RVQA 1V6AA 1E9SA 1NSYA 2DPGA 2WJ4A 4KIFA 4PZLA 4DSNA 3LP6A 3DOHA 4IUBS 1BA2A 3UW3A 4IQ0A 3JZDA 4C7MA 3GLIE 2EWWA 2WD7A 4YTEA 1W5EA 3NXSA 4AX8A 4MGYR 4W63A 1WD7A 2Z5LA 2CCGA 2AFHB 1O5IA 1O77A 3L6OO 3MEQA 3FPBA 5U4QA 3NW9A 3KOWA 4YV7A 1BHSA 2ATEA 1WOMA 2J3EA 2TRSB 3HL0A 1U8CB 1MQ8B 1JNYA 2ZWPA 2ZB2A 1TF2A 3ZEAA 1P2GA 3GXOA 3OESA 2HHAA 1N9GA 1UXJA 2B8WA 2C7RA 1M3SA 2XHZA 3EEFA 2UYYA 3RRYA 3FPCA 1H2BA 4FKMA 3RTAA 4C4SA 1Z2EA 2G9RA 1HDYA 3I05A 2B8NA 4FX5A 5HG0A 3WWCA 5JZOA 3IEPA 2HPAA 2DU8A 3FOCA 3PDUA 1OA1A 2FG5A 2V7TA 1B3BA 4ND8B 4V0LA 4EG4A 1DEOA 3FZNA 4ZYXA 4DSTA 3NMUF 1U4SA 3MQFA 2XEDA 4RU1A 2Q2QA 2P9JA 1UFQA 2CL6X 5BW5A 4GVLA 1BD4A 1GPKA 2JHGA 3NBUA 1NXVA 5KTNA 1P81A 1W6RA 5FI3A 5K2MA 4EAQA 4MEJA 3RRJA 2PS3A 3GB9A 4I50B 1UDXA 3C6YA 2UUPA 2AMFA 1N0VC 1WCV1 2IXFA 3DUWA 4WY5A 3DAOA 1JQJC 5JMPA 3HXOA 4JEHA 5E7QA 4KR6A 4QELA 4WFQA 5IAAA 3GUVA 3FF1A 2DE0X 3AVOA 2F8SA 3UUEA 1SUEA 2JKYA 2VJNA 4KQEA 3BIXA 1Y8QA 4FNMA 4OL9A 5PNTA 2YVLA 2AUMA 2RONA 3PQ4A 3ZHZA 3AHFA 1B1CA 1DTEA 3E1GA 3KXDA 1SBYA 4Y2PA 5NLLA 2XSZD 3BT7A 5KOHA 3UGQA 3KEMA 1ZD5A 3SSOA 4RDIA 3Q15C 1MABA 5G0UA 1P5RA 2BD0A 3QQ5A 1IVNA 1TE2A 2NADA 4DZRA 3K0FA 3PXEA 4JB3A 3SDSA 2LKDA 3F7TA 4IDNA 1GPLA 5CBPB 5L4SA 3H2HA 4MYTA 2D5CA 4Y1RA 1Z29A 1KRWA 3I37X 4JS0A 4M9CA 4R51A 3TR6A 5B36A 4HVAA 4A2QA 2IUSA 2FN8A 4LE2A 3IH5A 1EQ2A 4MW7A 3GA5A 3PQEA 4QTXA 2VQ6A 4BB6A 1E3JA 3MGKA 3JQ7A 1M72A 3RV3A 2D2FA 2XYQA 3HPRA 4F1WA 5AW1A 5K0EA 2ODQA 4KTVE 1H2ZA 4IIJF 3EN0A 1N5LA 5A0TA 1A4UA 1YACA 2ZBUA 4R1MA 2WICA 5DYYA 4V38A 3VPCA 4WKCA 3NHBA 5AYVA 3PK0A 1PZGA 4WVFA 5KSPA 2HXSA 4AY3A 4Z3KA 1S2GA 3MPUA 2QORA 1JBQA 2C83A 5EZYF 2V3CC 2A33A 5KTKA 1W4ZA 4A0GA 3N0XA 5LB2A 3CWQA 3V2HA 1DRJA 4HJXA 1QOPB 1KR2A 1ELOA 2WMYA 4X93A 4BMCA 5ALGA 3URKA 1GP2A 3HFJA 1P4RA 3N59A 2W6NA 3ZWBA 4OK3A 4HZUB 4DS3A 2Q2WA 1GVNB 5K45A 3QXXA 5E1DA 2IJGX 3V7NA 2WOOA 3LA8A 3BUSA 1GPUA 1HL7A 1WBJB 1O0SA 1T3TA 1UPCA 2WFLA 3D0RA 3HXPA 3IQXA 3G89A 4H17A 4ASUD 5A1JA 2QEQA 3EEBA 3QWFA 5H5JA 3RODA 4RLHA 1J9GA 1L5ZA 2GD0A 3IDZA 3L3BA 3EC2A 3ILYA 4GM0A 2JCYA 1IFXA 3EUWA 3P4YA 4JBYA 4S3MA 3EVNA 1MQAA 4ZC8A 3T8YA 1VL1A 4HK4A 4BCBA 4QG3A 1T5DX 1WW8A 4OQEA 3FJ1A 3GEBA 4XYBA 1RQ7A 1NJ1A 3AL3A 4WXRA 1LFAA 2PAFA 2GTIA 1QFMA 5EE1A 4BN4A 1Z39A 4DMCA 4DG9A 3CKKA 1ENPA 4JUFA 3CZ9A 3PXXA 3GJXC 4UW9A 4K9SA 1LQTA 4E30A 3P27A 5KNBA 2GF2A 2QSZA 2WM8A 3SZLA 2O8FB 3CSSA 3UMRA 4F6LA 1REQA 1XTVA 4AURA 4BNFA 5EZYA 5EIEA 3AJ9A 2Y4OA 4DQDA 1VQ1A 2ID4A 2YINC 4EA6A 1VIVA 4QC2A 4P3YA 4A8JA 1BGWA 2QX9A 1Z4PX 1Z0AA 2B94A 1ACMA 2ODWA 1KFEB 2RGGA 3KD3A 1WM1A 4G25A 3K2IA 5DGDA 5JLAA 1O96B 2OLEA 3VU1A 3PQ2A 4GRIA 5BSGA 3HO6A 5IDVA 1DAPA 4DMGA 1T9ZA 1W96A 2V6FA 2W4MA 1FQOA 3H11A 4LYHA 1L1FA 2ZI7A 2D1FA 4G1EB 4LV6A 3VV3A 1V95A 1FYVA 1ORHA 3TIXB 4CCWA 3SBXA 1LS6A 5LIRA 1KFKB 3DVAB 1M0EA 3EGXA 5K3BA 3QKIA 1YR3A 1DHRA 5IDQA 5SYAA 2VN8A 3IIJA 3O2NA 1A1SA 3ZWQA 1YDEA 3G2LA 5BXQC 5CCEA 1ZD4A 3BWMA 5FTKA 1GXSB 4B8WA 4EHJA 3PNPA 4CV1A 2VRBA 4HPJB 5H3HA 4II2A 5AKLA 3SJCA 3IP6A 1XKTA 3QWIA 3EG9B 3HJNA 2FPOA 4K81B 4Y7DA 3WYFA 1L4YA 4DEYA 1N5MA 1AMUA 4Y2GA 3C5WP 5HTKA 1O5TA 5IJ9A 2Z1MA 5JCXA 1ESEA 1KY4A 4KSCA 4UTPA 1HR0B 3VVLA 1LBHA 1V7QA 1LJLA 4JLMA 3KJZA 4QU9A 1FFCA 2CCJA 3U49A 1B8OA 2AJLI 4KAFA 2VA9A 1T91A 4I5DA 2X77A 1M5RA 2ZIVB 4LJ5A 2HB6A 4O4HB 1GLGA 5T8KA 2GM5A 2O06A 3HUEA 2R47A 1XQYA 3F5QA 3HCAA 2DF8A 4IOKA 4JENA 4MX8A 2M9MA 3KWFA 5EAIA 3F8WA 1OJ7A 1UIRA 2BUAA 2NYRA 1NF3A 1FUKA 4K88A 3K2BA 3ASZA 4EITA 5FB3A 4V0SA 1O54A 2J7PD 3GFSA 4E31A 3RUAA 4HL6A 4M7PA 3S2FA 3UV3A 3HYCA 3PUJA 2Q8NA 4UEWA 4DARA 1KSGA 4I4CA 2RE8A 3AB3A 4D45A 4L4UA 4QYIA 1K7SN 2WF7A 1S2NA 3TSZA 1TJYA 3RFTA 3B2QA 3CN9A 1R4ZA 2QN9A 1I0LA 1NN0A 1YQXA 3LIIA 3MWJA 5B58T 3TNLA 2GA9A 1LX6A 2OPBA 4GAEA 1GG8A 3L6CA 1MB4A 5JPCA 2VTBA 1CS0A 2QMOA 1WNTA 2CL0X 2YZNA 3MUNA 3CW2A 4E5DA 4BRZA 5LWHA 1KO1A 5IPFA 3Q6NA 4KI7A 4U6QA 2BBSA 3HN6A 2IU3A 2RHWA 4G1VA 1DWUA 4RS4A 2P2GA 1VHWA 2XCLA 4IKEA 1M9NA 3GEEA 5F4ZA 4YONB 4F4IA 4NYMR 3VSCA 1CFJA 3PCXA 2UYHA 4HGOA 1F6WA 1K68A 4DUYB 1LI5A 1EVQA 2YJZA 4L5IA 2RC6A 1CY7A 4LMBA 2D0IA 3BGIA 1OSNA 4M49A 4Q6BA 3T0FA 3A1DA 3IO3A 3EPKA 4ZEWA 3E9ZA 5K0FA 3P26A 4FFBA 4EYOA 4BGUA 4HATA 1A8IA 2WB2A 3CF4A 4LVCA 3G2PA 3HVJA 4TWZA 2ZI5A 5BNFA 2OZVA 4ZZ1A 2QLMA 3DWIA 5L7WA 4RUKA 1V9SA 4L6IA 2Q1TA 3T5PA 4WRRA 4KKVA 2IIVA 3FB4A 4FFLA 1HPLA 5L3QB 1HNNA 3KKQA 5DXAA 3VR6D 2FHPA 4B3CA 3OZUA 1RYFA 3DDSA 5K20A 1D9XA 3R3ZA 4D9BA 1VJCA 1R7RA 2H1FA 4QNMA 5GZ6A 5ARCA 3BDIA 5DLEA 4CN8A 4YT4A 1GZDA 3AW9A 3V1TC 3JWPA 3S5JA 5G53C 5M3BA 2VNIA 4LJYA 1NXQA 3ZE2B 4WT7A 1MFZA 1T9BA 2GJ4A 1KK1A 3A8TA 3NHJA 3P2MA 4FI3F 4P81A 1CP2A 5FLYA 4LRXA 1CUIA 2HO4A 1C4KA 4UUNA 3VHXB 3DBLA 4Q1DA 3GLIA 1M2VB 3UPDA 3CUVA 4P38A 3KYCA 3WGQA 4LYGA 3K1YA 1VI6A 2BIFA 3PJDA 5H02A 1IWPB 4R01A 4O59O 3C6BA 5LBIA 3I62A 4X60A 3OPQA 1BS2A 3C8UA 5LZ4A 4TYWA 3S27A 3GJ5A 3RD5A 1XZBA 4L50A 2DUMA 4DCJA 5FI0B 3QYJA 2XMGA 3VHQA 1KQFA 1DCFA 2O5CA 4L0DA 1S3GA 5G0VA 4ZDIA 1WKVA 4C5CA 4R6WA 2NAPA 4ZGBA 1DXOA 2FP3A 3JQAD 2ZUWA 1E20A 4ZHQF 3KTFA 3ZDDA 3C16C 3RVNA 2BFCA 3L1JA 3UMVA 4AYTA 3K71B 1KJWA 5FBQB 2VCYA 4M9ZA 2HWKA 1GA6A 1GL6A 2IDKA 3HNRA 5GVSA 4Q05A 4JROA 4RKWA 1ZOIA 2NSDA 1N7IA 2W6JD 4Y3UA 2GK3A 2IXTA 3ZHVA 4HNSA 4R71A 2IZ6A 2A14A 4QBTA 1S1MA 1KO4A 3IHLA 2GNOA 1RJDA 1DC3A 1BE6A 1I2CA 1E1DA 1L4MA 1WQ4A 2OFWA 3I04A 2O2DA 2HA6A 4N40A 4R84A 1HK7A 3AIIA 1C1HA 3N7TA 4QEZA 2BV3A 2HIMA 2YOGA 2NPFA 4BRUA 4EHLA 2JLVA 3ADOA 3Q72A 5ED4A 1FFWA 1NOIA 2CSXA 3FFWA 3FVTA 1U0TA 1WXGA 5AUOB 1SJ9A 3ETGA 1A9XB 1VLJA 1SQGA 2BP7B 3DQZA 3PQ3A 6AT1A 2AN4A 4JJZA 5J3JA 4YY3B 5L8VA 3L9WA 2IF0A 4KLRA 5JALA 1QO0D 3C7AA 3F98A 4ETMA 1JLSA 2CXTA 5CLLA 2OPHA 1J5XA 2JFFA 4MXDA 4WESA 1PNQA 3AUYA 3NV7A 4MR7A 5KNLA 1ONBA 1XZDA 3CF2A 1EJ0A 3IVMA 2OHIA 2ZIAA 3NV9A 4JOSA 5AK6A 2XXBA 1VSTA 4L74A 2AZMA 1J0DA 1T3HA 3U4CA 5HF9A 1L4FA 4L1KA 5DBHX 4Z2AA 4ZHQA 4L6CA 4BIMA 4M1QA 1G2IA 2QAIA 4EL5A 3STWA 4EO7A 2FW9A 4GLJA 1W46A 5G0WA 4B3XA 1GZ5A 3D6NB 5A3JA 3SMQA 1L4UA 4D9GA 1NE7A 1PCXA 1YZVA 3IBCA 1BGXT 2V7WA 3QVKA 3EXIA 8GPBA 1VG1A 3PVCA 2FPPA 2ORWA 1HYHA 4MLCA 4ZC1A 4DJFC 1CF2O 5CHYA 1HZJA 1CG6A 1YZHA 2HCJB 4YCSA 2W6OA 3AINA 3UOAB 4D0SA 1UWKA 3BWBA 3IMGA 3U1TA 2YV1A 4DMFA 2VQDA 3UJ8A 5F98A 4U2FA 3IAM1 5B2FA 4B3SB 2JJ8A 2QI9C 4M7OA 4IGKA 1EDEA 3D3WB 2ZI4A 5DM1A 5H59A 2Z3ZA 1A5SB 3EC7A 4I4LA 2V7QD 2XECA 1P1FA 1O94D 1WUYA 4ZREA 4ZMRA 5MGNA 4HYYA 4J16A 2FHSA 5UKDA 1B6GA 1FW8A 1N2XA 2WPDA 2PMFA 3AHCA 3SZGA 4CIAA 4ZI5A 3R2JA 4K6CA 2XRMA 3HDTA 2XTZA 4JB8A 3TIIA 3VZPA 5HRAA 2F55A 1FFBA 1RJGA 1QV9A 3OE1A 5HSGA 1YRHA 1JKXA 2GD2A 3EZXA 1EHYA 4OLBA 2YWFA 4TUYB 2ZB4A 3GRKA 2GASA 3QUCA 3IJRA 5EC8A 2AGVA 4OUDA 3MTEA 5F3DA 2FVYA 3TQRA 4PGHA 4CG2A 2F3PA 4NENB 4CM6A 1TGYA 2VNHA 1CR2A 2EDAA 5CCBA 3JARA 3ACBA 2SICE 3DDZX 2F7SA 1BKSB 2Q9UA 3FETA 3MSXA 4TTTS 4YMHA 1YB5A 2B99A 5G4KB 4EZBA 4BNTA 1XBTA 4EG3A 1P7YA 1PJ2A 2KQUA 3AUFA 1VSQA 4ITUA 4JT8A 2ZU6A 1VCHA 2HHJA 2Q3BA 4H7DA 2XPCA 4N49A 4S0ZA 3T9BA 1M2KA 4NFSA 4ESOA 2EFGA 4X3OA 1PJCA 1RWOA 3PNOA 1OBVA 4MDHA 4I1RA 2EBWA 1GPYA 1SK8A 1NVMB 3I01A 3KO8A 4FW9A 2JGFA 5ERGB 4MV1A 2RAFA 5IJ0B 4FVTA 5I7HA 2ZOSA 2JJ2A 2IWRA 2PIAA 3PR3A 1XP5A 2PVSA 1LTHR 3QVLA 3WK4A 4ERNA 2P1RA 2AS0A 2ZUEA 3PQDA 3QW2A 2JLCA 4FCTA 4UM9D 5CVDA 1QANA 3ZQKA 3V3KA 4DV5B 2A78A 1CZLA 1T4CB 3ZUGA 3BHIA 2J41A 1OFHA 3GJRA 4QOHA 4MUMA 2PGIA 1DDIA 4PGFA 4U7WA 3IXLA 4JDUA 1ZR4A 3H5NA 3DEAA 4BOYA 2NNWB 2OKCA 1MTZA 3OIGA 3SVTA 3TRIA 4ND1A 2PH5A 4TTVA 2EKZA 1R6BX 1HURA 3TTYA 1G98A 4QIHA 2WF6A 2WDZA 3GMDA 3T12A 3KQQA 3BOSA 4NULA 4E03A 1ZA1A 4DIKA 4JMPA 3OWOA 3TXXA 1KRXA 1KPHA 3G68A 4LX8A 4OBXA 3GVCA 5FBLB 3HWX1 2WQZA 1FUEA 3DE1X 1SB8A 5FUXA 4PO8A 2GPTA 4F9TA 3WX0A 1BYUA 2VTDA 4LZOA 3HKBB 3HCDA 1JDBB 3KPWA 1P29A 4LXIA 4OQYA 1I2AA 5CB6A 2QUHA 3LO5A 4K87A 4JUIA 4XD2A 2BW0A 1CVRA 2P0YA 4HN4B 4P32A 1DFGA 1E2DA 4N65A 1QAQA 2OXIA 1Y6ZA 5DX1A 3B1XA 2WT9A 3OY2A 3JD3A 5K4GA 1JZSA 2ZJ1A 5DN6A 3U3RA 4I9UA 4GX0A 3RYHB 4Z51A 3FB1A 2OCXA 1E2KA 1VPTA 5ESXA 4QUGA 3DV0B 1NV9A 2OAP1 1FLVA 4H9GA 5AVXA 1YRQA 5JXWA 4BBJA 3SI7A 2GLUA 2OOSA 1N6OA 1VBNA 2JD1A 4JJ4A 1O97C 4OHBA 3IKLA 3LT2A 4UAUA 5DTJA 5ULLA 2P6NA 1I51A 5I7EA 1FF9A 3WGJA 1K9SA 2H0RA 3V4FA 1WLYA 1ANKA 2PR7A 2O8EB 1KYIA 1EFAA 2I34A 4IXWA 4KWEA 1C80A 2ZYGA 3T9AA 1XNQB 3ERCA 5HFAA 2ZUSA 5D86A 5CM9C 2NU9A 4Q1VA 5BSHA 2VUUA 1IXZA 2PZFA 2WYIA 3NM4A 3CZRA 3OMLA 2BUCA 3P32A 1ZUNB 3QA3E 4ANFA 5A5EA 4AY4A 3HEAA 3K0CC 4DM7A 4B4UA 5BRAA 5E8RA 2ZAYA 3NLLA 4B6FA 2NM0A 4DLVA 3PDCA 5EA2A 1TLTA 3ZGXA 4FOTA 1UT6A 5KNDD 3LPMA 1RWPA 2I7VA 1DCMA 1RQXA 2EW8A 1RYDA 2C8LA 3DEIA 2BFOA 1AOXA 1QDEA 2I4MA 3KEGA 3ZJUA 1GV1A 3U40A 5B3JA 4OCZA 2EBUA 4PN7A 4J7UA 4FINA 4EY3A 2IUTA 5IAGA 4CM3A 4DLYA 3PKJA 3DH0A 3O8OA 2CHGA 3G0DA 4NICA 4KXWA 4AF7A 4GBMA 2Y67A 5C1BA 1J8MF 5AW8A 2JBAA 2IGTA 2JI6A 1JWBB 5HBRA 4KLNA 3OZXA 1NPDA 2QD4A 4FM9A 3LTNC 1KEVA 4P93A 1MA3A 4I8DA 1JP7A 3K9BA 1TAQA 4MRVA 2IU0A 1P5HA 3N1UA 4HDRA 3OTHA 2H1VA 2ZXEA 3QGMA 4CIVA 4X90A 1OFTA 3KVYA 1NVTA 1OROA 3T1NA 1V4VA 3COSA 1E2BA 3QYPA 5F7OA 1MEJA 5AI5A 5CXQA 2C59A 2R2AA 3UUGA 3LVRE 1BX0A 3RRFA 1Y4AE 1UMBB 4DIEA 3IQGX 3W5CA 1Y4SA 2GUWA 1OVGA 5CIQA 4U8GA 3U37A 1YHZA 3PRKE 2H4ZA 3M9XA 3QPUA 3VZBA 4WKOA 1U65A 2QG4A 1UBFA 1CP3A 3LUJA 4WAUA 2VZ8A 4F06A 4B35A 2QMEA 3BGWA 1BZYA 2WFZA 3GFBA 3L05A 1AGNA 4Z8XA 1TJPB 2B69A 3EH1A 3I9V6 2Z1DA 3DUFA 4TWRA 2CJYA 3LCCA 4OXNA 3SZ3A 1VFNA 2BAGA 3T5CA 2OGTA 1J56A 4IY1A 4NCKA 5E0OA 4B3HA 4BTEA 1XUOA 4PSAA 1E1RA 2CVQA 2BFMA 4RK7A 1LRJA 1E5VA 4CI9A 4DWJA 3TJZA 3TDMA 4ESEA 1VL0A 1WPXA 1M7GA 2FEWB 1G6Q1 1QF9A 3I1FA 3JXEA 4HQFA 4TS4A 2X8BA 2QXYA 5EHZA 3OD5A 2DBRA 1P1JA 5D5PA 2FJ0A 3Q3JB 4GO1A 4XDHA 3EB9A 3SR3A 4YRGA 3KQPA 3CRW1 4AJ9A 2X2PA 2DXIA 3PFFA 1V3QE 3OIYA 3VC2A 3UT6A 1YQUA 2C82A 2W42A 4I3FA 5JFTA 4ETWA 1VYVA 3AERA 1DNPA 2FMXA 4J07A 2V7VA 4PC2A 4GYYA 2FPWA 2IY8A 2HK6A 2X15A 5AK0A 1C0PA 3HV0A 3SKVA 6ABPA 5LQRA 3LXUX 1CNMA 1KAQA 2QENA 3HLTA 3ZY5A 1IN8A 1X7GA 2C61A 4I2VA 3REFA 2P9BA 2PZ8A 2NSJA 3OLYA 3QYFA 3EMVA 4F60A 4OHWA 5B58C 3G2OA 3OE7D 2J5XA 3AFMA 2WHPB 3P45A 2FQQA 2JZOA 4H7KA 3UXEA 5A3VA 1ZVVA 3TXAA 4Z0NA 4QYWA 3NOQA 2IELA 4E7PA 1UM8A 1EFCA 2E4VA 2EBHX 2Z2KA 2JAOA 1OAOA 3CZPA 3LDHA 4LHWA 4BUZA 2VP0A 2VJOA 1OPXA 4BVGA 3STYA 2ENWA 3WRXA 3AUKA 4GX2A 1G64A 4AVYA 5D6NA 4D80A 1NFRA 1NYRA 2R87A 3RC9A 5C7IO 5CU7A 1Y3BE 5ICMA 5EE5B 3FHJA 2O8BA 2VP4A 3OJXA 5CVVA 4JJ8A 1M7HA 1DP4A 3CJRA 3NTRA 3R5TA 4UEKA 3TL2A 5JS1A 5GP1A 4A03A 2O5VA 3P2EA 2B35A 5EINA 2XWSA 4HNQA 3ZCQA 2ATCA 2VYVA 1A9QA 2I5PO 3UYLA 1ZX1A 1W1WA 4HQNA 2WK1A 1PU2A 2ZZKA 4PCUA 4WNAB 4YMWA 1GN9A 3GJ3A 3O3OB 3ECSA 3ZE6A 2WTUA 4BFWA 4DV4B 4Y0AA 2JFQA 5JH7F 4J0EA 3AJAA 3IAS1 4YALA 5H9VA 2HY7A 2YWHA 4Y9SA 1C1XA 4FYMA 4YO8A 4YQEA 2XGJA 4PVDA 1LA2A 2FDRA 1PL7A 1QNFA 1QAMA 1EE9A 2IUUA 1XTTA 2Y27A 5H8WA 3C3WA 3KKMA 2ZIFA 3E58A 3T4PA 3RC3A 1G6KA 1LBEA 3RUDA 4LBYA 1NAIA 5ILOA 3QVUA 4XQCA 2BGWA 1ZH6A 4KIJA 2J59A 3WNZA 1DQZA 1GTMA 2Q9BA 2BEUB 5COQA 4C22A 5JAPA 3FPGA 1GRCA 3I6BA 2OHJA 1IY8A 4ZRMA 3L92A 1X7ZB 2FA9A 1A5ZA 1Q1AA 1G7SA 2BFDA 4D3XA 2JFOA 1WXFA 5EJGA 4HG2A 2JLBA 1A7JA 1UJMA 5A3QA 3SQWA 2VLBA 1E0KA 4FPXA 1PW5A 1H3NA 1Q1NA 4RH3A 1GDHA 1US8B 1W35A 1WZUA 3ROQA 4BFVA 3EQ2A 2CMFA 4BMSA 2QTVB 3TKAA 3HVKA 1RT9A 4FMDF 2GO7A 5JG7A 1PV4A 1K2VN 5FWXA 3BBPA 3KYJB 2QD1A 3OSZA 3TI7A 4M0UA 4LTMA 1X1DA 1JECA 2W5UA 2X5OA 2YH2A 4YCJA 1IK4A 1IBRA 4P1ZA 5BSEA 4CQNA 4FGUA 3ZLVA 1OXBB 4UDOA 1R5NA 2I4RA 3B3GA 3GCXA 5DHTA 3D64A 1FP4B 2PJUA 2QRUA 4YO7A 4HQ6A 5LQNA 3HDHA 2P6OA 4P92A 1YZNA 3RVJA 2DTDA 4P7JA 4QLOA 4C05A 2GHIA 2BGKA 4DIUA 1MEOA 1V47A 4CV0A 5AXCA 5K3CA 1NHGA 4A91A 1Z4OA 4G5GA 3RC8A 5K9ZA 3OFNA 1LVHA 3PL5A 4Z9BA 5EJ8A 5KJFA 2IP2A 1I9CA 1SEVA 2EFJA 2WSYB 4OOFA 4B3RB 4PX9A 3WOHA 1XZIA 3LK7A 1ACLA 1E66A 3OH8A 5EUMA 2DQKA 4Q7LA 3QUTA 4TMVA 4M9XA 5TC4A 3MOIA 4G0UA 2ZT8A 1CJCA 2FX2A 4FX2A 4DWVA 1J2JA 3I8OA 4CQLB 5FXMA 3NAQA 5KYVA 2V7UA 2DVMA 2RGDA 2WA2A 3IKJA 1XVAA 2V54A 3S8MA 1H0KA 3Q40A 4DV7B 3M4NA 1Z0DA 4D8VA 1T13A 4DIOA 4ZMBA 1MUUA 2DRIA 2PO7A 1W4CA 1P8JA 3A3NA 5SV2A 3RSQA 4DQXA 1N57A 2ODTX 1D0IA 1T5BA 5AVTA 1NDUA 5JXIA 1MDBA 2GPYA 3O4HA 3HVUA 1TO2E 3LP8A 3NYIA 1NW8A 2ANBA 1RM5A 4Q1EA 3W5VA 1RXYA 1IEVA 2OV6A 2NO1A 1K97A 1LJUA 2BGLA 2BTQB 3UK6A 2NG1A 2ON6A 2QP9X 3DCIA 4CMEC 2NU8A 4HQOA 3N2GB 1NQTA 3AEQA 1DX4A 4QJ5A 1SVSA 4Q1AA 1OAKA 1U7WA 2XT0A 1Z5GA 4ZVKA 3ZCUA 4C7VA 2SCUA 1E92A 2QX7A 1KGSA 3KUDA 3EE6A 3L8ZA 5K3SA 3WIVA 3AW8A 2G67A 5K3AA 3E9YA 4HNUA 2OK7A 2AQHA 1OFUX 1HDEA 3SKYA 3W5HA 5DMHA 3R7SA 4RETA 4PLGA 2A30A 3BS4A 2VJQA 3E23A 3GJ7A 3H6GA 3OJOA 1RRGA 1M2WA 2FFJA 4UREA 2BFEA 2G0AA 2ZRQA 1GWNA 4IJMA 1IRIA 4L9RA 3HJAA 3MAAC 3WGYA 5IVPA 3AI3A 3RIXA 3G82C 4R1TA 2ZWMA 3CLHA 5TGTA 1XZMA 4AJLA 2PUAA 4HB2A 4Q34A 4PG8A 4DIFA 1VMKA 3NQ41 3U3OA 1R0LA 5ICFA 3AESA 1W48A 5CYOA 5A4IS 1L6RA 3IOEA 2H8KA 3AVQA 4LCEA 1XWIA 3N2NA 2GPBA 2HK9A 1HQCA 5JBQA 2GPAA 5BRJA 2H1LA 2GPWA 3M82A 4L76A 1X6VA 5ECDA 4F6RA 1Y63A 4GZ3A 1RI4A 4OJTA 1QZTA 4E88A 3GZNA 3KSZO 1VP9A 3DMTA 4LCBA 2G83A 2IFTA 1E69A 4PVCA 4R9RA 3C5EA 1T0HB 5JR3A 2E1RA 1XZKA 3MTDA 5IDYA 2WRZA 5D1HA 3WB9A 1MKYA 2CCKA 1CQJB 4RXMA 4IDHA 3U19A 1E3IA 1AG9A 1G5PA 2JS7A 2PSSA 3B5IA 2R00A 4F91B 2NZYA 1KS2A 2VXYA 3CVOA 3B13B 3ORQA 3QLUA 5F3RA 1XA0A 4E14A 1GTRA 5AQ1A 2D8MA 1X1QA 1MHTA 1P77A 1TW2A 4FFSA 2EKBA 3DL0A 1M83A 1NJFA 3G88A 4IXTA 5ECWA 1PKXA 3ESQA 4CCYB 3GRFA 4ER0A 2HX1A 3E03A 3H5IA 3HMQA 3R6GA 4J0HA 5EZQA 1HTWA 5E6UA 4ZANA 1M2OA 2PQ6A 1L5YA 3NWBA 1MJGA 4I9HA 4PGAA 3SXUB 4KPYA 2ZFUA 1MXHA 3LHIA 4PQRA 4BJHB 4E1BA 3EGWA 2G25A 4TX1A 4IDAA 5FI5A 4R31A 4MWSA 5BWMA 2AFVA 5BSVA 1HNZB 3FSJX 3Q98A 4BQFA 2CLEB 1Y5LA 3A25A 1PX2A 2OV8A 3DMDA 3NAMA 4O3FA 4WLVA 1J0CA 3HBNA 1XNHA 4X7RA 4U7PB 4K5QA 1JQ5A 3QELA 4LWQA 1CDEA 1DCKA 3HKCA 4X85A 3VVBA 2GFIA 5KKNB 2BM9A 2C54A 3PQFA 3UZUA 3T4XA 2EXXA 4UUOA 4CMHA 2QTAA 1UXOA 3DFUA 3ZWYA 5KJ1A 1GTSA 3IRUA 3Q8LA 1FJGB 2EGHA 2RHHA 1PDVA 3QLVC 2X13A 3UJDA 2V5UA 1C3EA 4AZ0A 4QJ4A 3R5FA 1SEPA 2XGOA 3UPTA 2C2XA 3X44A 2ZTUA 2FFQA 1F8UA 1LPSA 3BJIC 1RI5A 5F78A 3ZU3A 2JKVA 4TTPA 4M1YA 4WLNA 2GVZC 3TSCA 1KC3A 3OZ7A 5ALZA 4C1NA 3GLGB 2RSLA 1ZM7A 1XQVA 2FU5C 4GL2A 1FTQA 1J2EA 3PNSA 2VZ9A 4FNOA 2YRFA 3E82A 4EPWA 1QLHA 3RVPA 1SR8A 3G2MA 4JQCA 3IBSA 1X92A 3BWVA 1KMNA 5JOQA 3ZH2A 3TQFA 1V39A 3F1LA 5FBRB 3QHPA 2Q28A 1I1OA 1N6HA 3CY6A 1Z2NX 1CD5A 3AEUB 3SJ7A 3ABIA 5JZBA 3I2KA 1V6CA 4EG6A 3T9FA 2PGAA 1QF6A 2Y92A 2ZRIA 1UJ6A 3ZX4A 1B43A 3R0VA 3QENA 4HF7A 2ZW9A 2CF5A 2D13A 1IWBB 2N1MA 4J1QA 4BQPA 3DV2A 3KXKA 2VRCD 2DLNA 3BH0A 4DOMA 1ZJWA 2Q6KA 3DOCA 1NSFA 4XFDA 5C81A 1OCEA 3BXPA 1P0IA 4IAOA 3B1KA 1M1ZA 4YRFA 1T6XA 2JF0A 1H0HA 2ZRPA 1QUFA 3QFFA 1SVMA 3S1SA 2J0EA 3ZXIA 4AQDA 3PJFA 1RDFA 4BO4A 4KGZA 3V80A 4YUAA 1UBUS 1Z38A 1CHDA 2QPAA 5HF6A 4CN9A 3GRVA 3O4IA 4RCYA 5JXHA 3NBYC 4WXYB 1GQFA 4WX2B 1QFSA 2CL5A 1OPRA 1ZA2A 2YJNA 3B5EA 3LBAA 1DV1A 1F06A 2J08A 4Q4LA 1RJ9B 5EJ2A 2OQVA 2H4FA 1DS6A 4QOIA 3TNJA 2UUCB 4CCSA 2CK3A 1LFDB 2C7BA 2GH1A 2RI6A 3OWHA 4XDYA 3TFOA 3HZRA 3K0KA 3FI0A 1KOLA 2GDZA 2BGJA 1QDLB 1GLVA 4DCMA 4L5YA 4QLBA 1ZD1A 3DBRA 1PHRA 5FBVB 1RKVA 1W7AA 2ZTSA 3O9ZA 4RMIA 1X70A 3NBMA 3QEMB 1L5RA 3SEAA 3BCSA 4MITA 4QOSA 1GPWB 3HEMA 4DLKA 4MI9A 3GEMA 4I6GA 4OQQA 1OXVA 2B21A 4KH1A 4BEVA 2DFTA 4TL8A 5T6MA 2G6BA 1E6LA 1QH8B 1DC5A 1XZQA 2J9GA 2JH3A 4KHZA 1CJSA 4MLPA 1RI1A 3RG8A 4C6HA 1M67A 4FC6A 3GXBA 3T52A 5AW5A 1NBME 3NTUA 2WY2D 4RL6A 3SIPA 1RCUA 1T9HA 1G8PA 3F7OA 5BMVF 3A6JA 3FSGA 4EFMA 1JWLA 2CXQA 3UGKA 1NP6A 2HRBA 5DNWA 5F1KA 3VX3A 4XCXA 5A5FA 1RFGE 3DYVA 1UMKA 2PUJA 2VHUA 4DILA 5KIAA 4BPBA 1A2OA 1ECGA 4DBLC 1JXMA 3F9RA 4DR1B 3CLRC 3IDAA 4C4AA 2GHQA 2WF8A 5D6OA 3RWOA 2WJZB 2XGMA 3V4SA 4AFNA 5KC8A 1TQ6A 3FBTA 5AR1A 3G2HA 4Q9AA 4G36A 5T3UA 4EF4A 2PKQP 5AOBA 3BXGA 4JR1A 1VKRA 1XDSA 4JA0A 3P9IA 1WVMA 3BXOA 4YACA 3R7FA 4RHTA 5KQSA 2QAGC 4JY7A 3NKLA 2BFFB 2XB2A 1DQYA 4REQB 2FDCA 3LECA 3W6ZA 2FZ5A 3BX1A 4K3UA 3RU7A 5JAQA 4EFKA 2JGDB 1B8VA 1FUUA 4FGWA 4LXUA 1P2FA 2IUEA 5FFFA 3ZCPA 3ILXA 4BQRA 4LK3A 4QATA 4M54A 5TE9A 1GQSA 5EQTA 3I8XA 2X0FA 4QT4A 5L6LB 4XWYA 1XXHB 1W59A 4Z8YA 2FN3A 1O97D 1G2QA 1R6VA 2BM8A 1S0UA 2PHZA 3M4JA 1SVNA 3EFHA 3OM1A 1B6RA 3LXRA 1V7CA 4JELA 5JJ5A 1WCWA 2Q99A 5JT1A 1P5JA 3FMGA 3CU5A 4IWYA 3LA6A 1U4NA 1BDBA 4DCUA 2P3QA 2RJ3A 4QT0A 4HX9A 4XRRA 5KO2A 1E3DA 1T5SA 2DHDA 4UBMA 4Y2JA 5EN4A 4MUEA 5BMVA 2CFSA 1F60A 1A27A 3HKDA 2KS6A 1J70A 4KQ6A 4N3AA 2VHJA 5EGSA 1PFWA 1RAGA 3CKYA 5ALRA 2HV9A 2WE7A 2ZJ6A 1T0BA 4X1YB 4I6EA 3VNVA 1C4WA 2OXEA 4M86A 1X7YA 4MKHA 4Q47A 5IABA 4XSHA 1NWHA 4EUSA 3U3JA 1DDGA 5CIWA 2GRJA 3KKOA 2FN4A 3M9WA 3ED5A 4R1LA 4IFIA 4RFSA 5DN9A 2GEJA 1C9NA 5MN4A 2BTEA 4BFTA 1U8TA 4GPAA 3L7NA 4D57A 3N2YA 4GKVA 1PVDA 3ZHSA 5TEVA 3ZQ6A 2R25B 3N70A 4GOND 2WD9A 4IVQA 4CIDA 1R3DA 5F77A 2C84A 1U1IA 5JD4A 2P7HA 2VPZA 4DKXA 4LC9A 2D54A 1XCJA 4XTRA 2W2NA 2WB4A 1RXSA 3H17A 2DT8A 2EF0A 1ODJA 4DJDC 5KYYB 2I8AA 4OLFA 5TNXA 2H08A 3I5YA 1EWTA 3GRCA 1X8KA 1YXMA 1TZ2A 3S2YA 4KN5A 3DHVA 3GA0A 3S2GA 1IPFA 2NSHA 2V0NA 1X3SA 3ETHA 1HYBA 1IJBA 2HLPA 2PZMA 1XKQA 2EQBA 4IMJB 1DUVG 3FDZB 1KH3A 5JASA 1GGEA 3H0CA 4G5OA 2B7LA 3FKQA 1G3UA 1ZVKA 1FJ2A 2HXYA 3KLNA 2ESRA 3KUCA 5F12A 2B83A 2IZ0A 3B8HA 5IKOA 4BNZA 4EZIA 4F93B 2GCOB 3P9YA 4JBXA 3EDCA 1GCAA 1T5TA 2JCSA 2XCIA 1F2TB 3GRPA 2QU8A 2R6DA 3CLVA 2R4TA 3GT0A 4JC8A 4R81A 421PA 5JYEA 5DM2A 3BHJA 3U4AA 4JUDX 3GLFE 2HQSA 3R9IA 2NQTA 2R6CA 3FR8A 5J1TB 5I3ZA 2P9FA 2HSWA 4NQZA 4UHFA 4TWAA 3SC2B 4QDJA 2XX3A 5TGDA 3WJAA 2BN4A 3KSMA 5AI8A 5GONF 4DV1B 1Q3TA 1FW6A 1QGYA 1VHJA 3PNQA 3ADCA 4Q19A 1HE3A 1IQUA 4KP7A 1S4QA 5HE8A 1P1HA 5AW3A 1SU6A 1YC2A 1ZW1A 2H85A 2HLHA 1QMGA 3H2KA 3OOHA 3T3NA 3WDKA 2DHCA 4A26A 2ZR9A 5AWFC 4UNRA 3BB4A 4A1OA 5REQA 2CNWD 5ALOA 5ISMA 3AVXA 2VK1A 3GFOA 3E7WA 5B1DA 4CLOA 4J0QA 4EG8A 3VI4B 1YQ9A 3UUFA 1KIAA 1KS9A 1O1YA 1UZAA 4F4UA 4Q15A 4CIXA 1DQSA 1JR2A 1U9IA 2X9VA 3R5HA 3R0QA 3TQTA 1QTQA 2NSYA 2F8TA 3RT9A 2RAPA 4MTLA 1NN1A 1E4EB 1YH3A 3E9DA 4G0OA 3JAWB 1F3OA 4A0RA 1CR4A 1SZJG 2K87A 3PQ6A 1EE2A 1P4AA 1YULA 3GBPA 4HS9A 4OV6B 1Z0ZA 4P34A 3UF0A 5FRDA 5KQRA 3OCUA 1PYDA 3KEQA 1VE7A 3NS7A 4RO0A 2CMDA 1DKPA 2D00A 1XCOA 4WTOA 1HZZA 2W2XA 3D02A 3T06B 5KDOA 5JXJA 4HEA1 1S4MA 1II9A 1T2FA 2BHTA 1Y81A 1ZN7A 3DE4X 1LWNA 3V55A 2Y1EA 5ITWA 2AWNA 3GGJA 5GONA 2ADMA 4L16A 4OTZA 2A57A 4E0BA 4OX9Y 4ZQIA 5B1YA 2DUUA 2AN3A 3KTAA 1G8JA 2C2ZA 4JNCA 2FFHA 4PC6A 3OFJA 3UQZA 4HHEA 3GDWA 2Y0PA 5CDYA 1ECBA 4TM8A 4EATA 1VIDA 1IZ9A 3MT0A 2PRYA 1SU8A 4MYCA 3C5HA 2A9KA 2Q1WA 3AIOA 3LYLA 3ZWWA 1D2HA 3DTVD 4ZI7F 2QJTA 1A2BA 2QTNA 3FVWA 4BDTA 3LUAA 3I4LA 2PYIA 3NWOA 4O3MA 4OI0A 4D4MA 2QX6A 4ZCSA 3UANA 2O7SA 2Q46A 3MTJA 4KN6A 4TXHA 3QMMA 4I36A 4X1KA 2IY7A 4ZRDA 1T2VA 5EL0A 5CCDA 3VISA 3WDSA 4LC0A 4DIDA 4R4JA 1EAYA 5ENDA 2X0JA 3JVEA 4KO8A 5D51S 2PRJA 4B4KA 1ZOOA 2B34A 5EQJB 3M6FA 4EVIA 2FN7A 2I6FA 3Q3EA 1Y0BA 4FLEA 5EE9A 1OILA 1XVIA 2AB0A 1VJDA 1BA3A 3DMPA 4H77A 4J6FA 2V1UA 3TIVA 1GZ3A 5EHNA 1OT3A 4L3OA 1I10A 3TZHA 1TDJA 1PSDA 4BX3A 2ZRLA 3PEFA 4G2NA 1EUDA 3I5XA 4J0JA 5DYGA 3KAQA 4TQ9A 4YRZA 4CNQA 1WB4A 4F12A 4RZUA 1PGJA 2NU6B 5BORA 4M0DA 3WLKX 1Z2CA 2UVPA 3AM4A 2ZYWX 3BWCA 3P94A 1X74A 1LD3A 1OGJA 1SXJC 1W93A 2FSGA 2Q5FA 2O3JA 4MUGA 4QTUB 1GYPA 2FW7A 3I28A 3QVGB 4ZARA 2FEMA 4A5SA 2PH1A 2VDKB 2XWQA 2ISQA 1CT9A 3LX6A 4DR4B 2LP4Y 4LNUA 3PFIA 5LLSA 2C9ZA 3DDOA 1KA9H 3CRQA 1WIWA 5KSOA 3CUKA 4HXEB 3VI3B 3WYGA 4ZI7A 3HXQA 1W85B 3U9TA 2G4VA 5J4YA 1JR4A 1KMHB 5KMGB 2AKEA 4YFVA 4C0QC 5JQWA 3KBBA 1XDGA 4H6WA 3A3PA 1NIJA 3GQBA 2XQFA 3KV1A 1VSVA 4ZD6A 1WWKA 2C58A 4O4IF 1G9TA 1NM5A 4GXRA 4XX1A 4F2HA 3V2GA 4O4JB 4X91A 4IFTA 2PGOA 2L19A 2G80A 3C8MA 2HUPA 1CUAA 1YR9A 2WJIA 2XUHA 4G8CA 4GC5A 4NMWA 4DYDA 1SCQA 1E99A 1PJAA 1UJ5A 3O0DA 3DXXA 4JVMA 3BPSA 1XAJA 1YK1A 3NBFA 2GK7A 3ZS9A 4E5UA 2XEXA 4RK0A 4RD6A 2Y1LA 4JI1B 3Q6MA 1U7XA 1VGRA 4QNNA 3CEMA 3L0DA 2Y1XA 1BOOA 4S04A 3QU5A 5IU6A 3PSHA 1V11A 4HRYA 4WBXC 4A0SA 2Q1SA 4EQZA 1Z62A 3ZNPA 2FXIA 1FFXB 1QYRA 5AH0A 4YAGA 3GLRA 3RO7A 4MMZB 4WNYA 1B42A 4Y2HA 3CT4A 4Q4HA 4RM2A 3DPIA 3A3YA 5BR7A 2YRWA 1QMPA 2C31A 2CMKA 4PRKA 2P8JA 2ZUUA 1QQBA 3ZWKA 3C14C 3KZVA 1JSLA 3H4IA 1ZGGA 1X9GA 3L01A 4G4SP 4Q7JB 1ULHA 2NO0A 5IT4A 1K5HA 4V1CA 4G0WA 1A96A 1H93A 1N5IA 3H83A 4YUVA 1ZONA 1T1SA 3DGEC 3LUCA 4HQRA 3HY6A 4BNVA 1EXMA 1D2CA 1U1EA 4IXMA 3UFXA 4NECA 5FOTA 1W36B 1VL8A 4RF5A 1TJ5A 1ZL2A 2KLBA 4H15A 4W8GA 1E32A 1IMOA 3NDPA 4YAFA 1GAXA 3W5AA 4RNDB 5CUQA 1N33B 1OLXA 3IURA 4O4IA 4UOQA 3OVMA 4ZQHA 2HWWA 4AS2A 2Q5EA 3TLBA 3KCQA 3TG8A 1T8WA 4NNPA 1SCNE 1EWVA 2J07A 1IHDA 5AKXA 4P0PB 2C8VA 1NBMA 1XLVA 4B32A 3AHDA 4PAMA 2G8NA 3B3FA 1CDDA 5GQSA 2OO5A 3KB6A 4DG5A 5K8JB 4D6YA 4KCGA 4BQNA 5JCPA 4FWIB 4WCDA 1YOBA 5HM8A 1D3AA 2HLDD 2LPMA 1E9RA 3D7RA 3EVDA 5CDHA 5K8LA 2W4QA 3N2IA 5FV4A 3O03A 3WLPA 2CKDA 2JVJA 1SOAA 3C97A 3DF9A 3H8VA 3FGPA 1V43A 1BXGA 1CRLA 3IBYA 3LQ2A 4JWKA 3ZHCA 3ZLUA 3ZKWA 1U8XX 3HZZA 1XR3A 4FXOA 1I5RA 4E51A 2YHAA 3R3UA 3HBLA 4HXYA 1J49A 1MV8A 1JFFB 1QJCA 1CR6A 3DLBA 1EZZA 3TINA 3V8NA 5EXSA 3NBXX 4BLWA 3AWDA 1EFRD 2V8BA 1V1MA 3A4TA 3GN1A 1I6MA 4RNCA 4CQMD 1CUVA 3M7IA 1JMVA 4N18A 1WPQA 2ACVA 2YDYA 4HB4A 4KYUA 1XZJA 5J2TF 3TKLA 4DC9A 1LSJA 5CIYA 1IXYA 1YUMA 2JH9A 2B1JA 4NXMB 3LQ4A 3OLQA 1IBLB 5JPDA 1PR9A 1GPH1 2DCMA 3VNRA 4EGFA 1E2FA 3AHIA 3CURA 5A3SA 2D1SA 2Y71A 3ES9A 1JLLB 1NRIA 1O03A 1RI2A 3B9QA 2X2EA 4P4LA 3QFCA 1EBBA 3AHGA 3SBDA 4C07A 1TUBA 1XTSA 3E3NA 3KXLA 2ONYA 5A4MS 1DBPA 1J97A 1ULTA 4ESVA 4U0JA 2IP4A 4JU8A 2I99A 3F3YA 4Z4IA 4GH5A 3TFWA 1U2GC 2E9SA 3E2MA 3LC2O 3PXCX 4H4EA 1OAAA 1U0EA 2GD1O 3OHSX 4M1SA 3GLHB 1DEHA 3FROA 2H65A 3RC2A 3T7SA 1FFHA 2HKIA 2V5VA 1BW9B 5KKCA 3B2EA 3LQKA 4DV2B 1VJ5A 1JXOA 1PZNA 1KPIA 3OQIB 3SF8A 4N8DA 4GECA 2AOUB 2VP5A 3OEEA 1UAYA 4O6VA 3HDVA 3CZQA 3P5BA 2QX4A 1TM3E 5HF8A 3B78A 1QK4A 4BIIA 3F5SA 5TGZA 5BQOA 1DJNA 4C43A 5BV7A 5A9RA 1DU4A 2X41A 2MT9A 4KXXA 1LF5A 4E3ZA 5K5EA 1P2DA 1YNSA 3G2IA 4I0WB 4R83A 5GADl 3CEAA 4EJ0A 3VZRA 5CLIA 2HQ1A 2PS0A 4QQFA 3BRWA 5IP5A 2C1ZA 4BQQA 2B6HA 3FWZA 1A8SA 4HUQB 2B4KA 1DEKA 3T0IA 3NWEA 4D42A 5JSQA 2LE0A 5I7RA 3A9TA 5C4IA 2ZDGA 4F11A 2OCBA 4XPZA 1MJHA 1T1EA 1HEIA 4FEYA 4IQGA 2G1UA 1WXQA 4FYIA 3OX3A 1OU4A 5KJCA 3PTZA 2D62A 2XT6A 4DPLA 1N5JA 3KQVA 1ACJA 3EJ6A 3UG6A 3WJ7A 3D59A 4M83A 3KZMA 2ZBQA 1AC5A 3CBQA 5DGXA 3CE6A 1ZNZA 3NR2A 2ZPTX 3TM5A 3UKDA 4M8NE 1PTKA 1JFTA 2OUKA 3RREA 4ZVLA 5B37A 3U81A 1WV0A 3AHEA 5JROA 3LOPA 4N01A 3EIUA 1MLDA 1XMVA 2Y1FA 4WKGA 1KOJA 1H2RS 4P2GA 4XVHA 2BBOA 5HE9A 1ECJA 4CDMA 1D09A 4IJKA 1V1RB 2LBPA 3DR3A 3MELA 1A50B 1FQKA 1PDWA 3MRSA 3OZGA 3PENA 3OJCA 5CRIA 1U63A 2GZDA 1QH1B 1K08A 1PG0A 5JDIA 2YFKA 4JB0A 3AGQA 5AJWA 5TQVA 3ZHXA 3ZS8A 6GPBA 4ZEVA 2CWWA 4ZIRA 1F38A 4YWHA 1SMKA 2CF6A 3UMJA 3ESYA 3ZY3A 5JAUA 5LM3A 5LUAA 4OAQA 1ZVQA 3H9BA 5E6RB 4AP6A 1PR6A 4Z9AA 2F67A 3MWDB 3NOXA 4ZGWA 5ADVA 1KYWA 3IIMA 4N5LA 4YVFA 2IYUA 4DBZA 1D4FA 4CIYA 1ZAKA 1WZIA 3S4YA 1TAUA 1OZGA 4UHDA 3D3KA 1TQ8A 3BKXA 4LZLA 4RQBA 4I66A 2DZDA 2XMDA 4U6SA 3DE0X 4AZTA 1Z4KA 3JD1A 2A5DA 2D1QA 5TMDA 1C7QA 1KDOA 3ZVLA 2QZ9A 5HKBA 5FLKA 3IDQA 3EEQA 5L4NA 1U7OA 1UBTS 4BECA 4KQWA 2JJ1D 2WIFA 3B1FA 4WCFB 1MR3F 3KKEA 4RPHA 5JNTA 1QK5A 2OK8A 1BCSA 3MHPA 4W9NA 1SXQA 4JJKA 1ZSVA 1B26A 3RT1A 1IBCA 1TQ4A 1G21E 2B1QA 3INRA 4FJ0A 5CM8B 5E4FA 1O95D 3JQDA 3OLWA 5F21A 4UFNA 1QFXA 3KE8A 3DOFA 3T1VA 5FL7A 3KQUA 3SX4A 3N2KA 3RT7A 1VJTA 3A1UA 3BC1A 2GS9A 4AY6A 1CUFA 2ZANA 4PPGA 1YRAA 4H7EA 4JI6B 3SCZA 1VBKA 3WYBA 4EMUA 1J2TA 1WUTA 3K8YA 3BFVA 5L40A 1ZRHA 4FW8A 4YP0A 2EKQA 1WF3A 4AMVA 5JTTA 2O0HA 4IMIB 4D56A 4JCOA 2FWBA 3C3PA 4UPVA 3QIAA 2B4AA 4UASA 2O1SA 3ZHTA 4IXNA 1SQ6A 2V3WA 5IEJA 1QCCA 3A9VA 5G41A 4BE9A 1K7CA 1TOAA 1CY6A 4HB0A 5CB8A 3C70A 4MW6A 4CKEB 4N9WA 1ENOA 3DL7A 4PY2A 1QG0A 1KDZA 1COWD 3QXHA 5K99A 4PW0A 5AD1A 3LXXA 4MW1A 4F3TA 1ZGJA 1VXOA 3CLRD 3HCPA 4ENPA 4NCAA 2E87A 3EGEA 4Y2RA 1XA4A 1E2LA 5ER6A 2BM0A 1ZWKA 2RGBA 3CE9A 1PEKE 1LH0A 1TCVA 3F71A 2NWQA 4MAAA 4F4CA 3ODGA 2FUKA 1ZS9A 4ZVQA 3ZZTA 5DHSA 4FSDA 4KN9S 1LNQA 5HP4A 1WB6A 4HSGA 2E5WA 3RIYA 3BTSA 1JNXX 3O4FA 1E64A 4I3GA 3M3DA 3WMXA 4YQFA 1QGED 3B1WA 4UFOA 3BK2A 2R1VA 5I7WA 3FTDA 2Z8YA 4CU5A 4CKXA 4ZT5A 4DT1B 4XIIA 3ZIAD 1CEYA 1JN0A 2REQB 1YMQA 3C45A 4XUDA 4NNJA 3KR9A 3AR9A 4WEQA 2PGXA 2Z9BA 3RK4A 4OFWA 1POXA 3NHRA 1KU6A 1KJIA 3GJ6A 3QPBA 1ONSA 1ORIA 4F8YA 5MHTA 5KWVA 3T7IA 2EX4A 3MWEB 1YVDA 2B2NA 2ZWVA 4J90A 5ALKA 5EMHA 3H5WA 1QWSA 3PHIA 3ZGLA 2JIDA 1LZLA 4YDSA 1N3BA 3BE4A 3PVZA 2YOHA 2I2CA 3RUFA 3A7EA 1VLLA 3ZV5A 4EW6A 1KRHA 1F4PA 4IUDS 3OBBA 3DO5A 4FJ2A 3NUZA 4UM7A 4RYDA 2VYCA 1P7VA 2P1DA 3EXHA 1UBLS 1KDTA 2AJTA 5CVCA 5HUQA 5DHPA 4TRRA 4Q16A 3M6VA 4OSPA 4H7FA 4Y2VA 1TQHA 5L95A 6YASA 2HU5A 5LP6F 2CZQA 3C7TA 3VU3A 4P4UA 4PYKA 4TSFA 3FRHA 4GOKA 1JHYA 3K15A 5K3FB 2Y93A 3W6UA 5JI2E 1XMOB 3A04A 1CNEA 3M4XA 3Q9UA 4N03A 3ZBTA 2OGUA 4XGQA 1RAFA 2HPZA 1IWOA 3NC1C 3DZ8A 4PSVA 2XUAA 2IPXA 2J3LA 4BJ1A 1GTJ1 1QHXA 2AMJA 5L3SA 2B30A 2AJDA 3CG0A 1OB5A 1WVGA 1BGVA 4RY0A 3A2NA 2JRCA 3I1JA 3U3ZA 4D97A 5B6JA 3EAGA 3RE1A 2WSSD 4OQMA 5ICSA 3U6KA 3KJEA 1FQJA 2Y1GA 3VR6A 2AL7A 4XWGA 5CAEB 3S68A 2ZIWB 5CB4B 4M87A 3FX2A 4MKZA 3ZVRA 4US0R 4DPMA 3COWA 5GAJA 2H8GA 4DQKA 2VRNA 3DTYA 4Z49A 4WKBA 3BA6A 3QPCA 1PG5A 1M1NA 3CX7A 1T2EA 3D4BA 1N2CE 3ZIDA 2A58A 2W6ZA 3PF9A 1H65A 4OJNA 5EZ6B 5IKXA 3TOCA 4NH0A 5FPSA 1EFUA 1G5TA 2JIOA 2RHJA 2YQ4A 3C3KA 3MLAA 3DVRX 3BXHA 4JJAA 4ZJPA 2ZZNA 2LZ0A 1U28A 3F9IA 4BUJA 2VTVA 2WVJA 3UVEA 3NM6B 2OBXA 1CQIA 2FW8A 4AKEA 1JZQA 2CHQA 4BGEA 4TVKA 2FP4B 3WNCA 4A8JC 1UQTA 2AG6A 1SHZA 4O2LA 2P1ZA 3T3OA 2EU8A 2XB4A 1M34A 1AK2A 1QC5A 3LRTA 4BNWA 1UJ2A 4MYRA 3QYAA 1BJRE 1NXPA 2QV0A 2YJ4A 2CYAA 3ZDQA 2NU7B 1X8LA 4TWJA 3KYDB 1LLUA 2R85A 1ZD9A 1TIKA 3IXMA 4YCBA 5GGYA 1NQVA 1YIOA 2NPIA 1VSBA 2PKWA 3BREA 3C15C 3JSAA 3ZWPA 4MJLA 1CLUA 4GDMA 2VK4A 1ZM4A 2ECPA 3E4CA 4ZV7A 3OIUA 4CGYA 5B12A 5J58A 2XCSB 5F3WB 3FF4A 4D02A 1G0OA 1NQ5A 3VPSA 1P4JA 4GKJB 1OX6A 3EVGA 1WZCA 2AW3A 1UDBA 4GM1A 3WKBA 1FSPA 1H2XA 4YAJA 1Q0PA 5DDIP 4ND3A 4M46A 4OVKA 2IBMA 3G1WA 1Z0IA 4P6VF 2X5NA 5LQUA 3TDKA 1A5AB 3J81k 1YB1A 2WUGA 1RAAA 4IKPA 2NTJA 3BGDA 4M7RA 1PD0A 2ECQA 1H94A 3HKEA 4HDAA 4ECEA 1XTJA 2REXB 2YJTD 3HNOA 4I19A 4AECA 1XCLA 3TTUA 1TT5A 4CTJA 3HVRA 1JS1X 1VBMA 4OQLA 1WP9A 3AU8A 5WRFA 1XMJA 2EBFX 3F90A 4DAEA 1OFVA 1Z2PX 3MN1A 5IYZF 3HYNA 3QVJA 1UAGA 2PMBA 5AI4A 2FV8A 4WZZA 1QO0A 5T8KC 2GK6A 1G8MA 1O5OA 4A23A 4RV5A 5KINB 3FG9A 3RIGA 5CVJA 2Q6OA 3K5WA 3GEPA 5DNEA 3FKJA 4AK9A 1PSZA 2J6BA 2QJWA 2MYUA 5SYNA 3F4LA 1EJ6A 2XW6A 3HR8A 4ILKA 4RHEA 4XRGA 1U0SY 3R6LA 1H05A 2APJA 3IAHA 3JSXA 1KFJB 1XCMA 4AS1A 3SC3A 5BN3B 1S2LA 2XIQA 4LJ7A 1ZHOA 2GBLA 3T15A 1YD7A 2YUIA 2FK7A 1V35A 1JDVA 2ZSAA 2VBFA 1QDUA 1JAIA 5K8VA 3FCEA 1V16B 1SBNE 3B6EA 4HV4A 4BWYA 4NBSA 3B6ZA 5FT9A 1GLNA 3CB4A 5F7XA 1T34A 4PZDA 5IS2A 5G0TA 2QRVB 3WWZA 4ZAWA 3KFXA 2P6RA 2ZSDA 1W9MA 5TR9A 4CMIA 5GIOE 1I8TA 2PPLA 3GFVA 3KT3A 3DKPA 4KODA 1JJIA 4OHFA 3U4IA 4MWBA 4DA9A 5T4BA 3UK0A 1I2BA 4BKMA 3ZBQA 5BUCA 2OVFA 4AKHA 1ZIOA 4Z0TA 4XWWA 3GEHA 1K06A 3PFWO 1NP7A 4WZBB 3WBFA 5IYZA 2N9UA 2NZXA 4Q7KA 1FC0A 2FMHA 1C4XA 4MUYA 3V97A 4ZZ3A 3FGZA 3ZDCA 4NZ9A 1Y48E 3I30X 3IAEA 5SICE 4QEDA 5IEBA 3SQLA 4UVIA 3W4KA 1ABEA 2NUTA 1Y1SA 2UVDA 2W6IA 3E9NA 4CR8A 2ZSBA 5HWSA 2QTHA 4XEUA 2GZAA 1GKKA 1GNTA 4PZAA 1C7RA 3SHWA 3I4CA 1TUEA 1X42A 1PEDA 1V3TA 4XZ3A 1LLQA 1I7PA 1YONA 1VECA 3HE3A 4TYYA 5EP1A 1C4OA 1EWKA 1ENYA 1NI4B 2A1UB 1DTWA 2VP2A 4ILEA 4DT1A 3O1LA 5CYGA 1W75A 3WGNA 3AYZB 4FT4A 4Y6PA 5AW9A 3TBFA 1YE8A 5DYTA 4AZWA 1DRWA 2NZJA 3ZYCA 4AX4A 3MTAA 4X71A 1UR5A 3FVVA 3U1BA 3THYB 1S2MA 2XMQA 5BYBA 2OA0A 1RWNA 2YCLA 5F9FA 4PR3A 3QE4A 3MAGA 3OUZA 1YBFA 2CXHA 4PTYA 2P69A 2O8DA 4KX5A 4GXTA 1AKQA 1YC5A 3CZCA 1H9BA 2E4WA 3L06A 3THSA 1DC4A 1E5DA 1RC1A 2X86A 1HETA 3KYIB 3QKUA 4HGNA 4RVOA 4Y9DA 3N7UA 4UU8A 3LCMA 2OGWA 1DZ3A 2WMOB 5FTLA 1G21A 2HNKA 1PBNA 3C1OA 3P0HA 4PLHA 5ENVA 2C4UA 4J2TA 2YFYA 1EUCA 9ABPA 2H9YA 3QNMA 3ZGYA 4N5HX 3VNSA 1BE0A 1GFZA 3O91A 5LL6P 1KKUA 4NDAA 3VQTA 4DADA 2HMTA 1JDSA 2I2XB 4Y2UA 3MYYA 2B7CA 2JK0A 1H2YA 3PEEA 3KZXA 4Z7QB 4CKWB 1W4RA 1V5WA 3DWGA 5HQ3B 2J30A 3OM0A 3HS3A 3ZC3A 1AB6A 4Z9XA 1YUBA 3Q0EA 1UZMA 3L1UA 1UOPA 1FX0B 2A1IA 4FNGA 2Q3CA 2H2GA 2VH1A 4RA6B 2EF1A 5BNTA 4D0LB 2H3EA 2YVUA 4JWTA 4ZVPA 3VZQA 3A27A 3C5CA 3R7DA 4CEIA 3A7DA 4RZXA 5EMNA 3RFCA 1N8TA 3O2QB 5CVEA 2EVWX 1Z63A 3MXOA 4X64B 3DC7A 2KI5A 1JQLB 1PBTA 4UVGA 3D2CA 4F4FA 1EH5A 4L4YA 1ZN9A 4ZDJA 4YP6A 1G41A 4L8LA 3GUYA 2ZCUA 2O23A 5EP3A 5ENZA 5CG1A 1XRQA 2W71A 3EUFA 1YDMA 2DKNA 4FD2A 1XNRB 3WSWA 1PD1A 1YRLA 3IVAA 4V0OA 4ROSA 4MVJH 3AXSA 4RZSA 3TZEA 4J0DA 3IEIA 3HG7A 2WQ7A 2JPDA 1OZ0A 5LFAA 1SHTX 4A10A 3W4IA 2OESA 3SS7X 2PRKA 1F6DA 1WB5A 1N7JA 2HJRA 1Q95A 3H75A 1Z0JA 2DC1A 3JQGA 3PHLA 1E2UA 1R27A 4BKQA 3IIIA 4QXQA 3Q7QA 2CLIB 2DPYA 3E15A 5JYDA 2ZJYA 2YHUA 3S7TA 3O92A 4FZRA 3V6LA 2JIZD 2VFAA 1NTOA 3L8DA 3NNDA 3PSAA 5I7OA 4MVCA 3I5UA 3SSAA 3AUUA 4LX0A 4QUEA 2WDPA 2I2WA 2RH8A 4QXPA 4JSYA 4PCVA 4TV9F 5HCNA 3AR7A 4DQUA 1U0GA 1F4LA 4KO3S 4CM8B 3L0IB 4RVCA 1BHQ1 1GNPA 3H2BA 4L78A 1CUBA 5A6SB 1MW9X 3WDMA 5JYBA 3INTA 2X0EA 1KZYC 2QP3A 3HYSA 1QIJA 4C04A 2BJVA 1SM4A 2HA0A 1Q84A 1V26A 3HGMA 3JATB 4ALMA 2NPOA 3V6MA 5AFSA 3CPHA 2F2TA 3PPWA 3DHEA 2XAAA 2VC2B 4M8IA 2E2WA 2Q5IA 2F1OA 3O8QA 1WMAA 4Y9UA 5BQFA 2P6UA 2ZIXB 3FVRA 4X63A 2Z8XA 1TJ3A 4J16C 2CLFB 3O8LA 1YTLA 5ESRA 4NL4H 1USKA 3ST7A 3ZE1B 2BL4A 3ZW7A 4FYPA 3EF3A 4OJYA 1IYZA 1KYXA 1SUBA 4LYDA 1L1QA 2OZLB 1AA6A 1A8PA 1UCFA 3CUSA 3KB1A 1Z08A 5EMKA 4TT3D