2V75A

N-terminal domain of nab2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
YTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Structure of the N-Terminal Mlp1-Binding Domain of the Saccharomyces Cerevisiae Mrna-Binding Protein, Nab2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 37
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11517 Nab2 Nuclear abundant poly(A) RNA-bind protein 2 (Nab2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.40 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 2v75A00
2V75A 2JPSA 3LCNA
chains in the Genus database with same CATH superfamily
4HSBA 2NOIA 1KG7A 1P7MA 4B24A 2XHIA 3OS1A 3CWUA 3OYAA 3D4VA 1YQLA 4AI5A 2NOFA 4BE2A 4E9EA 3FHFA 3I0WA 1KEAA 1YQRA 4OFEA 5CHZA 1LMZA 4BE1A 3KTUA 3OYCA 1KG6A 4EA5A 4OFAA 3OYIA 1M3QA 1XG7A 4IKFA 4E7KA 3OH9A 3S3OA 4ZTJA 3N5NX 3CW7A 2NOLA 4E7LA 3LCNA 1WEFA 3OYDA 4EA4A 1MUNA 2YG8A 1N39A 3OYBA 2I5WA 2NOEA 3OYHA 2W04A 1N3CA 1NKUA 3OYMA 3S3NA 1XQPA 5FRMA 3CVSA 4B22A 1KO9A 2OFKA 3OYNA 3I0XA 4ZTFA 2W03A 3G0QA 1EBMA 3OGDA 1ORPA 4EVVA 3VW4A 5FROA 4YPHA 3F10A 5KN9A 2JG6A 3NNQA 3IH7A 1PU7A 1U84A 2NOZA 1YQMA 1NGNA 5KN8A 1KG4A 1PU8A 1WEIA 1N3AA 3S3MA 4B21A 1DIZA 4OFHA 3OH6A 1MPGA 1XQOA 1RRSA 4BDZA 3CWAA 2YG9A 3L2RA 2JHNA 4DK9A 3L2UA 1KG2A 1KG3A 1FN7A 4EJYA 4E9HA 4EW0A 1YQKA 3OS0A 4AI4A 4BE0A 4EW4A 3KNTA 1ORNA 3L2QA 5DPKA 1WEGA 3OYLA 4YPRA 1RRQA 3OY9A 4B23A 1VRLA 3L2VA 1LWYA 4AIAA 2NOBA 3S6IA 4E7JA 4UOBA 3OYFA 4E9GA 4EJZA 3R2XC 3OYKA 3OYGA 3L2WA 1KG5A 4E9FA 3FSPA 5FRNA 4E7HA 2OFIA 1MUYA 3CWSA 3F0ZA 2JHJA 4E7IA 1P59A 1LWWA 2NOHA 1MUDA 3FHGA 1PU6A 4YOQA 1HU0A 1KQJA 2JPSA 4BDYA 2V75A 3CVTA 3N0UA 4PIIA 5AN4A 3OS2A 2H56A 4UNFA 3CWTA 4NZGA 3OYEA 1LWVA 3IHOA 2ABKA 1PVSA 3OYJA 4BACA 1M3HA
chains in the Genus database with same CATH topology
3OYFA 4E7LA 3LCNA 3OYDA 3OYKA 3OYGA 3L2WA 3S3MA 3OS1A 3OYBA 3OYAA 3OYHA 5FRNA 4BDZA 2W04A 4E7HA 3OYMA 4BE2A 3L2RA 3S3NA 4E7IA 3L2UA 5FRMA 2JPSA 3OS0A 3OYNA 4BDYA 4BE0A 4ZTFA 2V75A 2W03A 3L2QA 4BE1A 3OS2A 3OYLA 3OYCA 4NZGA 3OYEA 3VW4A 3OY9A 5FROA 3OYIA 4IKFA 3L2VA 4E7KA 3S3OA 4E7JA 3NNQA 4ZTJA 3OYJA 4BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V75 A;  2JPS A;  3LCN A; 
#chains in the Genus database with same CATH topology
 4HSB A;  2NOI A;  1KG7 A;  1P7M A;  4B24 A;  2XHI A;  3OS1 A;  3CWU A;  3OYA A;  3D4V A;  1YQL A;  4AI5 A;  2NOF A;  4BE2 A;  4E9E A;  3FHF A;  3I0W A;  1KEA A;  1YQR A;  4OFE A;  5CHZ A;  1LMZ A;  4BE1 A;  3KTU A;  3OYC A;  1KG6 A;  4EA5 A;  4OFA A;  3OYI A;  1M3Q A;  1XG7 A;  4IKF A;  4E7K A;  3OH9 A;  3S3O A;  4ZTJ A;  3N5N X;  3CW7 A;  2NOL A;  4E7L A;  3LCN A;  1WEF A;  3OYD A;  4EA4 A;  1MUN A;  2YG8 A;  1N39 A;  3OYB A;  2I5W A;  2NOE A;  3OYH A;  2W04 A;  1N3C A;  1NKU A;  3OYM A;  3S3N A;  1XQP A;  5FRM A;  3CVS A;  4B22 A;  1KO9 A;  2OFK A;  3OYN A;  3I0X A;  4ZTF A;  2W03 A;  3G0Q A;  1EBM A;  3OGD A;  1ORP A;  4EVV A;  3VW4 A;  5FRO A;  4YPH A;  3F10 A;  5KN9 A;  2JG6 A;  3NNQ A;  3IH7 A;  1PU7 A;  1U84 A;  2NOZ A;  1YQM A;  1NGN A;  5KN8 A;  1KG4 A;  1PU8 A;  1WEI A;  1N3A A;  3S3M A;  4B21 A;  1DIZ A;  4OFH A;  3OH6 A;  1MPG A;  1XQO A;  1RRS A;  4BDZ A;  3CWA A;  2YG9 A;  3L2R A;  2JHN A;  4DK9 A;  3L2U A;  1KG2 A;  1KG3 A;  1FN7 A;  4EJY A;  4E9H A;  4EW0 A;  1YQK A;  3OS0 A;  4AI4 A;  4BE0 A;  4EW4 A;  3KNT A;  1ORN A;  3L2Q A;  5DPK A;  1WEG A;  3OYL A;  4YPR A;  1RRQ A;  3OY9 A;  4B23 A;  1VRL A;  3L2V A;  1LWY A;  4AIA A;  2NOB A;  3S6I A;  4E7J A;  4UOB A;  3OYF A;  4E9G A;  4EJZ A;  3R2X C;  3OYK A;  3OYG A;  3L2W A;  1KG5 A;  4E9F A;  3FSP A;  5FRN A;  4E7H A;  2OFI A;  1MUY A;  3CWS A;  3F0Z A;  2JHJ A;  4E7I A;  1P59 A;  1LWW A;  2NOH A;  1MUD A;  3FHG A;  1PU6 A;  4YOQ A;  1HU0 A;  1KQJ A;  2JPS A;  4BDY A;  2V75 A;  3CVT A;  3N0U A;  4PII A;  5AN4 A;  3OS2 A;  2H56 A;  4UNF A;  3CWT A;  4NZG A;  3OYE A;  1LWV A;  3IHO A;  2ABK A;  1PVS A;  3OYJ A;  4BAC A;  1M3H A; 
#chains in the Genus database with same CATH homology
 3OYF A;  4E7L A;  3LCN A;  3OYD A;  3OYK A;  3OYG A;  3L2W A;  3S3M A;  3OS1 A;  3OYB A;  3OYA A;  3OYH A;  5FRN A;  4BDZ A;  2W04 A;  4E7H A;  3OYM A;  4BE2 A;  3L2R A;  3S3N A;  4E7I A;  3L2U A;  5FRM A;  2JPS A;  3OS0 A;  3OYN A;  4BDY A;  4BE0 A;  4ZTF A;  2V75 A;  2W03 A;  3L2Q A;  4BE1 A;  3OS2 A;  3OYL A;  3OYC A;  4NZG A;  3OYE A;  3VW4 A;  3OY9 A;  5FRO A;  3OYI A;  4IKF A;  3L2V A;  4E7K A;  3S3O A;  4E7J A;  3NNQ A;  4ZTJ A;  3OYJ A;  4BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...