2V75A

N-terminal domain of nab2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
YTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Structure of the N-Terminal Mlp1-Binding Domain of the Saccharomyces Cerevisiae Mrna-Binding Protein, Nab2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 37
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11517 Nab2 Nuclear abundant poly(A) RNA-bind protein 2 (Nab2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.40 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 2v75A00
2JPSA 2V75A 3LCNA
chains in the Genus database with same CATH superfamily
4E7KA 1M3QA 1N3CA 2JHNA 5KN9A 1P59A 1MUYA 1LMZA 1MUNA 3LCNA 1VRLA 1LWWA 1XG7A 3OYAA 5FRNA 4UNFA 3OYBA 1PU6A 1KG6A 1NKUA 3KNTA 1YQLA 5AN4A 4BE2A 3OYMA 4E9GA 5FRMA 4ZTJA 3I0XA 4OFHA 3OYCA 4PIIA 1EBMA 3OYHA 4YOQA 1M3HA 3N5NX 4B21A 4ZTFA 2JG6A 4NZGA 3OGDA 4IKFA 1LWVA 2NOZA 1XQPA 3CW7A 3OS1A 4EVVA 3OS0A 1WEFA 3OYJA 4B23A 4E7HA 1ORNA 4EW0A 2YG8A 1KG2A 2NOBA 1U84A 2NOIA 4BE0A 2H56A 3I0WA 2NOLA 3OH6A 3OYEA 3VW4A 3S3OA 1P7MA 3R2XC 1YQRA 4E7LA 2JHJA 4BDYA 3OY9A 3F0ZA 4AI4A 1KG7A 2JPSA 3L2QA 3G0QA 3L2WA 3L2RA 4BACA 4HSBA 3OH9A 4E9EA 1WEIA 3OYKA 4BE1A 3FHFA 1NGNA 4BDZA 1RRQA 2I5WA 3IHOA 1KEAA 3KTUA 3S3MA 1WEGA 1N3AA 2W03A 1KO9A 3D4VA 3N0UA 3CWUA 4YPHA 3L2UA 4AI5A 1YQMA 5KN8A 4EJZA 3S6IA 3IH7A 4EJYA 4B24A 3OYDA 2NOEA 3OYGA 1HU0A 1N39A 3L2VA 4E7IA 1KG5A 1PVSA 4OFAA 3FSPA 3OYLA 1FN7A 3OYFA 1KG3A 2ABKA 3NNQA 4YPRA 4OFEA 3CVSA 2NOHA 1ORPA 1MUDA 1PU8A 1YQKA 1KQJA 3OYNA 2W04A 1LWYA 2XHIA 4EA5A 4DK9A 4B22A 1RRSA 3CWTA 3OS2A 2NOFA 1DIZA 2OFKA 2V75A 3FHGA 4AIAA 5DPKA 5CHZA 1KG4A 3F10A 2YG9A 1PU7A 1MPGA 4E9FA 3OYIA 4E7JA 4EW4A 4E9HA 3S3NA 2OFIA 5FROA 3CWSA 3CVTA 3CWAA 1XQOA 4EA4A 4UOBA
chains in the Genus database with same CATH topology
3OYNA 3L2UA 2W04A 4BE0A 3LCNA 5FRNA 3OYAA 3OYBA 3OYEA 3VW4A 3S3OA 3OS2A 4E7LA 3OYDA 3OYGA 4BE2A 3OYMA 4BDYA 3OY9A 5FRMA 2V75A 4ZTJA 3L2VA 4E7IA 2JPSA 3L2QA 3L2WA 3OYCA 3OYHA 3L2RA 3OYLA 4BACA 4ZTFA 3OYIA 3OYFA 4E7JA 3OYKA 4NZGA 4BE1A 4IKFA 4BDZA 3NNQA 3S3NA 3OS1A 5FROA 3OS0A 3OYJA 4E7HA 3S3MA 2W03A 4E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPS A;  2V75 A;  3LCN A; 
#chains in the Genus database with same CATH topology
 4E7K A;  1M3Q A;  1N3C A;  2JHN A;  5KN9 A;  1P59 A;  1MUY A;  1LMZ A;  1MUN A;  3LCN A;  1VRL A;  1LWW A;  1XG7 A;  3OYA A;  5FRN A;  4UNF A;  3OYB A;  1PU6 A;  1KG6 A;  1NKU A;  3KNT A;  1YQL A;  5AN4 A;  4BE2 A;  3OYM A;  4E9G A;  5FRM A;  4ZTJ A;  3I0X A;  4OFH A;  3OYC A;  4PII A;  1EBM A;  3OYH A;  4YOQ A;  1M3H A;  3N5N X;  4B21 A;  4ZTF A;  2JG6 A;  4NZG A;  3OGD A;  4IKF A;  1LWV A;  2NOZ A;  1XQP A;  3CW7 A;  3OS1 A;  4EVV A;  3OS0 A;  1WEF A;  3OYJ A;  4B23 A;  4E7H A;  1ORN A;  4EW0 A;  2YG8 A;  1KG2 A;  2NOB A;  1U84 A;  2NOI A;  4BE0 A;  2H56 A;  3I0W A;  2NOL A;  3OH6 A;  3OYE A;  3VW4 A;  3S3O A;  1P7M A;  3R2X C;  1YQR A;  4E7L A;  2JHJ A;  4BDY A;  3OY9 A;  3F0Z A;  4AI4 A;  1KG7 A;  2JPS A;  3L2Q A;  3G0Q A;  3L2W A;  3L2R A;  4BAC A;  4HSB A;  3OH9 A;  4E9E A;  1WEI A;  3OYK A;  4BE1 A;  3FHF A;  1NGN A;  4BDZ A;  1RRQ A;  2I5W A;  3IHO A;  1KEA A;  3KTU A;  3S3M A;  1WEG A;  1N3A A;  2W03 A;  1KO9 A;  3D4V A;  3N0U A;  3CWU A;  4YPH A;  3L2U A;  4AI5 A;  1YQM A;  5KN8 A;  4EJZ A;  3S6I A;  3IH7 A;  4EJY A;  4B24 A;  3OYD A;  2NOE A;  3OYG A;  1HU0 A;  1N39 A;  3L2V A;  4E7I A;  1KG5 A;  1PVS A;  4OFA A;  3FSP A;  3OYL A;  1FN7 A;  3OYF A;  1KG3 A;  2ABK A;  3NNQ A;  4YPR A;  4OFE A;  3CVS A;  2NOH A;  1ORP A;  1MUD A;  1PU8 A;  1YQK A;  1KQJ A;  3OYN A;  2W04 A;  1LWY A;  2XHI A;  4EA5 A;  4DK9 A;  4B22 A;  1RRS A;  3CWT A;  3OS2 A;  2NOF A;  1DIZ A;  2OFK A;  2V75 A;  3FHG A;  4AIA A;  5DPK A;  5CHZ A;  1KG4 A;  3F10 A;  2YG9 A;  1PU7 A;  1MPG A;  4E9F A;  3OYI A;  4E7J A;  4EW4 A;  4E9H A;  3S3N A;  2OFI A;  5FRO A;  3CWS A;  3CVT A;  3CWA A;  1XQO A;  4EA4 A;  4UOB A; 
#chains in the Genus database with same CATH homology
 3OYN A;  3L2U A;  2W04 A;  4BE0 A;  3LCN A;  5FRN A;  3OYA A;  3OYB A;  3OYE A;  3VW4 A;  3S3O A;  3OS2 A;  4E7L A;  3OYD A;  3OYG A;  4BE2 A;  3OYM A;  4BDY A;  3OY9 A;  5FRM A;  2V75 A;  4ZTJ A;  3L2V A;  4E7I A;  2JPS A;  3L2Q A;  3L2W A;  3OYC A;  3OYH A;  3L2R A;  3OYL A;  4BAC A;  4ZTF A;  3OYI A;  3OYF A;  4E7J A;  3OYK A;  4NZG A;  4BE1 A;  4IKF A;  4BDZ A;  3NNQ A;  3S3N A;  3OS1 A;  5FRO A;  3OS0 A;  3OYJ A;  4E7H A;  3S3M A;  2W03 A;  4E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...