2V7WA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with 5'-fluorodeoxyadenosin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
total genus 77
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7wA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7wA01
2Q6LA 2CC2A 2V7TA 2V7UA 2C5HA 2WR8A 2Q6IA 2ZBUA 1WU8A 2C4TA 2CW5A 5B6IA 5FIUA 2C5BA 2ZBVA 2C4UA 2V7WA 2C2WA 5LMZA 2CBXA 2Q6KA 2V7VA 2Q6OA 1RQPA 2V7XA 2F4NA 4CQJA 1RQRA
chains in the Genus database with same CATH superfamily
3PFFA 1CKEA 4KN5A 4NCHA 5CPBA 4ENUA 4KE6A 1TU4A 2FQ1A 2GPNA 1GYRA 5EHIA 3MD0A 4UM7A 3ROKA 4DG8A 4OXRA 2IHZA 4RK0A 1UJ2A 2SKCA 3N2ZB 3PTAA 3PWZA 5INTA 4N8SA 2WYIA 1DQPA 1YDGA 4RZHA 4BX2A 2ZJ4A 4QGBA 1XRQA 5HKKD 2XB8A 3EAQA 4HEQA 2WA2A 4MCAA 4CFZA 3A37A 1P18A 4OP3A 4BU0A 4LV5B 4KN9S 1MB2A 1WXQA 3DV9A 3VR4D 4LY9A 1SU8A 1YHYA 1IM2A 3DMDA 5A0FA 1KAMA 1G64A 4Y30A 4BMDA 4C21A 4RDJA 3C3CA 1MNAA 3O03A 4O2AF 2FP4B 4JLKA 4JJKA 4RNDB 4WCFB 1IEWA 3TZKA 1XNGA 2IXFA 1TB4A 2Q6LA 3AB3A 3UA4A 2VHWA 1L5VA 4KQ9A 3W9BA 3BNWA 2AFIA 3M5WA 2GAIA 2Z5VA 3OWXA 4QUIA 2NUTA 3A3PA 1A5ZA 3NBZC 1X7YA 3E2PA 2V98A 3IFSA 3OX4A 5AESA 2WIBA 1X39A 3GRCA 3AJRA 3HN2A 3N6XA 2X1MA 3KQOA 5CA0A 3C8DA 3KSMA 1RXCA 2JJ2A 1VL0A 4TXLA 1CLEA 1XDZA 2I66A 5FUBA 2VJCA 3PE6A 3NT4A 3RVRA 3I9JA 3I61A 1VE6A 4G0UA 4XKWA 1G9XA 4XX1A 2Q3HA 2QOEA 3Q8LA 2O8EA 1RLIA 3ZU4A 5C34B 3EGOA 3TMAA 2P1ZA 1N8NA 3OCVA 4V3BA 1SQSA 2XB6A 5KNBD 5BOVA 5F5NA 5K4GA 3BMQB 1U3DA 2WU4A 2DOGA 2ZTLA 3MVEA 2RHHA 2YCLA 2OGSA 1DXYA 3HCPA 4L76A 1KAGA 4LVOA 3AU9A 3I8SA 3LGXA 3OKCA 1X70A 2B37A 4X63A 3RQIA 3SS9X 4Y6QA 4HFJA 4QYMA 5L4LA 4AJJA 3WRYC 1R0KA 2HU8A 2VHXA 1XDDA 2K2QB 1PFKA 3B60A 1IPHA 2WSSD 4G1EB 2NSYA 1TGYA 5EIFA 5HZHA 4I2VA 1VP3A 3LQEA 1WZIA 2RCYA 4O4JA 4O4IA 1RHKA 4G84A 2VA9A 3MNFA 3BMXA 1K4KA 2GCEA 2DUWA 4MUHA 4MRSA 4RA6B 1UBRS 1VIAA 4WKPA 2Y6UA 3OX2A 1IHOA 1S9HA 3EY4A 5K3SA 3O7MA 4P58A 1ZL2A 4D99A 5JLAA 1JKJA 2FG6C 4X7BA 1E6LA 4V0LA 4D4MA 4BO1A 1SKYE 4NCIA 1VLJA 1SRRA 3Q98A 1GGHA 4KIJA 4PG5A 3LQ1A 2I76A 3O8NA 1N9GB 4PN7A 3AUAA 4LZOA 2HRRA 3G1TA 1VGVA 4KLRA 5ER9A 4EPVA 1PSDA 5IBQA 1UFQA 5AUPB 1G19A 4JLNA 5I3ZA 3ZY3A 2CNKA 4MX8A 3ETGA 2G5GX 2JAQA 4X66B 4BY9E 3IC5A 2PMBA 4H7EA 5MF6A 2VBSA 3QVXA 4C30A 1R74A 2LNDA 2Q5IA 4JVNA 4O08A 2PT9A 2X14A 3K09C 2AFIB 1UOEA 2D00A 2WF6A 1IU9A 1T5IA 3BTOA 3GARA 1VQLB 5EWLA 3VR4H 1DC6A 3JY6A 5DHAA 2G67A 4MEBA 5DNVA 1RVV1 2FEOA 2XMGA 4J0KA 3OCZA 2FPIA 4Q0MA 2CDBA 3DV0B 3K72B 3UKJA 3PC6A 1K1EA 3TTXA 4RF4A 4HO1X 4TMZA 1BWPA 3PHGA 3HXTA 3FZNA 3HJFA 2HW8A 3M6XA 1Q22A 1PU2A 3FUXA 1AN0A 1OFUA 4J2HA 2VCYA 3HEMA 3OHPA 5TMPA 4EY4A 3GEEA 2GEJA 5KYTA 1M34E 4JI6B 1D0VA 1YJ5A 2J48A 4B74A 3NONA 5E1DA 1K28D 1O5TA 3AFMA 2NO5A 3TZQA 4PONA 5KKCA 3CF2A 5KNDA 5E3IA 2IF2A 2NYRA 1HT1E 2UV8A 3WYBA 2D59A 3Q3VA 4F3TA 4C6TB 4KO4S 2DETA 4DLVA 4QWWA 3UCFA 3F1LA 1RYBA 2PH1A 1BCSA 4KAJA 5BN3B 5EP3A 5LFAA 3QFTA 3EARA 4LHEA 3ILYA 4MVCA 2PX4A 4HR7A 2NV4A 4K03A 1RBMA 2A9QA 3LVQE 4K40A 5C32A 2XECA 2AHOA 2CVHA 5H16A 3IUYA 4EHIA 1CQZA 2JEYA 1HDYA 1S4MA 1JE0A 3C6ZA 2GJSA 1HFWA 1II8A 3E5RA 3P9YA 1POWA 4ZVOA 4D02A 2PMFA 4FYPA 2DKNA 2E4AA 2FSGA 3ENWA 4O5AA 1M1UA 5CVEA 3T5AA 2XODA 1ENZA 3EFOB 3QIAA 3ZDEA 5H70A 1Z7EA 1J25A 3SQMA 1R8XA 1O6GA 3P2YA 4ZOLF 1JQ3A 2Q6KA 2AMFA 1YRYE 5HIAA 2VLIA 4KAFA 1JXMA 2A5LA 2OGTA 1E7SA 1XSEA 3G2QA 3NHFA 4CLDA 2FMXA 2N75A 1MGPA 2ODEA 3T7JA 4X0CA 4BAGA 3JSAA 4TROA 2W37A 1KVQA 4BUZA 1SUDA 1US8A 3T1TA 3HV2A 3IQHX 3MWEA 2XCIA 4X65B 1WEHA 2HK6A 5EJMA 1RKBA 1M8PA 2JIMA 3L8MA 1K2VN 2JASA 5ESXA 2R60A 3G1UA 1C3JA 1O4WA 2FRDC 3ZK9A 4BWVA 3REFA 1N6HA 5E7IA 3BCUA 3U9LA 5KOHB 3FI9A 1W73A 3KDSE 5EEHA 3BDIA 1WSVA 3O95A 3P0IA 3SXJA 1NUHA 1Q0HA 2XVMA 1QLJA 2CEAA 3LRTA 4MVJH 4OGGA 3X43A 3CUEF 4E33A 3WGGA 2DU8A 3ZNPA 1NG9A 4YUWA 4G6ZA 3U3OA 1CY4A 5CA1A 4H0CA 4ZALA 3KB6A 2L19A 1YJ8A 2G9ZA 4H18A 1SOWA 3V3TA 5H3CA 4O2BB 2OPHA 4QDUA 2CYBA 2AOTB 4PHFA 3I6QA 4KLZA 4XB6B 2VH5R 3TIVA 2BGNA 4RADA 2QXTA 3U40A 2QL5A 5JALA 2BZ0A 5TS2A 4HAYA 5JASA 1OBOA 2EQBA 2HLDA 4G6IA 2PSJA 3AK4A 1II9A 5CM8B 3CZQA 1IEXA 5CBPB 5F9MA 3ZCXA 4BXOB 4RA6A 3U3KA 2UAGA 3AG6A 3LFTA 1J49A 2WUEA 2Q6VA 1C30B 3KLNA 2V5UA 2PY6A 1Y5RA 3TSOA 1CJCA 4Z4YA 1HDXA 1INLA 1ZD2P 2VYFA 1H2XA 2J5QA 4LIPD 4R7TA 2WWVD 4EHAA 2PA0A 1UANA 4LJ5A 4LK2A 4EZEA 3SIXA 5BSEA 4GPTA 2WAXA 1YLOA 5A4AA 4AMUA 1ODSA 4P6VF 1HZJA 2GYWA 2IC5A 4Q3NA 1I3CA 5EMLA 3PL5A 3RGWS 4DIFA 3NWJA 2NZUG 3BB4A 3QW4B 2VR1A 1O5IA 3WMRA 4DIOA 2RCNA 1LPMA 1VTKA 3IXMA 4YIKA 3R3HA 4Z2AA 4F60A 1JECA 2FZVA 4OHXA 1RKVA 3KLPX 1OBFO 4HADA 1N8RD 5HBRA 1ETUA 2Q1SA 4YVFA 5C4GB 2WC1A 3QU5A 4BN5A 3ZLTA 4MR7A 4N3CA 2QN1A 5EE5B 1P1HA 1QTRA 4HEA1 1YR1A 4ZKEA 4WXYB 3KHTA 1XZNA 1Z5GA 3SJ7A 3VPCA 3X1KA 4AF7A 5FA5A 4P2BA 1O8BA 5JZOA 1UK9A 2A58A 4ZGGA 3IESA 4IX9A 4KBYA 4KACA 4NE9A 5FBQB 5CDFA 4JBYA 1SO8A 1L5SA 3T7AA 3ZHTA 4W5TA 1IN1A 2HB6A 3VUFA 1Q7EA 3D3EA 2O6HA 8MHTA 2PIAA 1VJSA 1N2HA 5FQNA 3X1YA 2BGGA 2FX5A 3IAEA 5F4JA 3BILA 2ZBPA 3RHTA 1KMIY 2H2DA 5KYUA 3ZBPA 4KPUB 5BOSA 3AVYA 5EMKA 1E79D 2PDAA 1IHPA 2NWQA 2WPNA 4A16A 2QX4A 4Q00A 2X4DA 1X2EA 3N53A 4CMGA 4CJXA 4YRBA 3FBWA 2G80A 3MOIA 4YAUA 2EERA 1OB5A 2IDMA 3IP1A 3I23A 3KB2A 1AA9A 2ZZQA 4OQZA 4WECA 3LLSA 3QBEA 2P90A 4RV9A 4LGCA 4ML3A 3EGDB 5BMOA 4UE6A 3JYQA 5BOSB 2BE9A 4DCMA 4R0NA 3V1UA 1WW8A 5CU7A 4PR0A 3FPHA 2GH1A 3TJRA 4EHFA 2OPBA 1CEQA 1GQSA 2VEOA 5CM2Z 1QDLB 3R3YA 5DJ5A 5KI6A 4E3WA 1UH5A 1PKVA 1P5ZB 2LCFA 2YHAA 1XU4A 4L8VA 5LZ7A 3ACBA 3Q12A 5IXJA 3SWWA 2B1GA 3IVAA 3GGDA 1P5RA 3EW7A 3G79A 1UKCA 3REOA 4EVRA 5FO1A 3OPVA 4ZPJA 5EI5A 4OLBA 2W00A 1V5EA 1RP1A 4LFCB 2QTVA 1ISSA 4Z0TA 3V32A 4HDMB 3PVSA 2OBNA 4H77A 4F6LA 2PVPA 2GZ2A 1KIMA 1QRSA 1NVDA 1Q0LA 2IP4A 3C5WP 4R41A 2OAGA 1SBIA 1T8WA 4EGAA 4CG3A 2P4SA 4NHEA 4C4OA 3QNMA 6CHYA 1B41A 4TZ0A 2ZSAA 4KITB 3CMAB 4NYMQ 4TOIA 3W8FA 4DMFA 4X93A 4R6WA 4RELA 3TLAA 3H3XA 2VP6A 3U1VA 4HXGA 4ZCRA 5E95A 4AI6A 1A3CA 3LUHA 1TQDA 2YFYA 1VZ3A 2LDBA 3LHFA 3OEYA 1VJ1A 2YMLA 4V0MA 3SJAA 5L7WA 4DKXA 1Q9SA 1PR3A 2HPAA 1IQRA 1OVMA 4BN4A 2N46A 5IDWA 3ROXA 1EFTA 1YACA 1J8QA 2Q0XA 5CW2A 1X8KA 3WADA 4B2YA 3Q41A 1U3UA 3DWGA 3ONNA 1Q19A 2VAVA 3UG7A 2I6TA 2WJPA 4RTRA 1MO6A 4NXNB 3CX3A 3UMGA 5JFGA 3VX4A 4P9SA 3FMFA 3LMKA 1PJAA 4D98A 4O2BA 1N0UA 2AIRA 3HPRA 4OIFA 5BYKA 5JJ5A 3E1GA 3QF7A 2E1BA 4B6FA 3RROA 4XOTA 2R65A 1A69A 2Y9PB 1CUIA 2WD7B 3H9GA 1DKQA 2WF7A 4R2KA 3UJ8A 4L5AA 4EKGA 3TM4A 4MAAA 4PGMA 5HIMA 1YVRA 2A0UA 1Z16A 1WAMA 1Y48E 1YJNB 4B0OA 1FVHA 4HZUA 2H5JA 1P4MA 1HDCA 5A5GA 1DQNA 3LXMA 3UGKA 2GXSA 2X1HA 4YQEA 1TRKA 1F3OA 2ZRBA 3M70A 3ZI4A 1ES9A 3FCSB 3V6LA 2WUVA 1M1YE 4ZQIA 4GKJB 4DWOA 2CXXA 3IAS6 4FOLA 4L16A 1UWKA 4WVLA 3O26A 2F55A 4U2BA 4URWR 5FORA 2IPNA 2QP3A 1B8VA 1UBSB 3TUJC 1E77A 4D97A 5K0JA 4L6IA 1ZEJA 1C9MA 2OL4A 3H9NA 4X1YB 3UT5B 3N2NA 4LXIA 2ZR0A 5CXXA 4IIBA 1LPAB 3GSIA 2DFVA 3FWKA 4I1OA 2HEGA 1Z56C 3KWFA 5JQGA 1OH8A 1PQ4A 1HYQA 4FR0A 1CDEA 1SVKA 4G9GA 1QVGB 1K27A 5B1HA 2A9KA 2ZJ0A 1LI7A 4JP8A 1VBFA 1VMIA 2XDWA 3EBOA 1DAPA 1E6WA 4MPRA 5A9SB 2VNKA 2P79A 2R11A 4UXIA 1I3LA 4XCQA 3D7KA 3E03A 4OHCA 3S29A 1YULA 3WRXA 4CKCB 2ZE7A 4BDSA 1LBHA 5BW5A 2BFOA 5ECGC 3JQEA 1KYXA 2NV6A 3HBAA 3PKZA 1P5HA 3A6DA 3ESRA 2WG0A 1QF7A 3GVLA 2B5VA 3DWEX 3W04A 3CTPA 2I6GA 2HDWA 5BN5A 3FMPB 4ZZ1A 2Q0SA 1NXQA 4QG3A 5AK6A 4YCNA 4EG5A 2ZT7A 4OHPA 1Y8RA 4RLQA 3KCQA 3IERA 2WUFA 4Q9JA 1ZNXA 4U2EA 4QBHA 1BROA 5PNTA 3I2KA 3GLRA 3I09A 2NU8A 2HPZA 2MSLA 1MPXA 4P38A 4C2AA 4GFDA 2C7PA 4TQ9A 4Z4CA 3EVGA 3PI7A 4J0DA 4RHFA 3M9XA 1U2DA 3TNYA 4C5BA 5MN4A 1ZHHA 1QHFA 4ZO7A 2XRMA 3CCQB 1OAAA 1ODKA 3RUPA 3L0IB 3I01M 1DBRA 4S2UA 2NXCA 3ZV6A 3CN9A 2DBVO 8AT1A 3CE9A 3F8WA 3H2JA 3STTA 4LVCA 1F9AA 4B73A 1VQ1A 4X1OA 2GCIA 4YJ3F 1DAKA 2GFQA 3U9SA 1FXUA 3WDKA 3KSAC 3LCUA 1WOMA 3BH0A 2WYVA 2AR9A 1CEXA 4ARCA 3JQ9C 1V5WA 3C3KA 4MQFB 1NHWA 2HYIC 1FTYA 2WYWA 4YUVA 5CG2A 1KS2A 5K01A 5IYWA 4R3UC 3VPGA 4EFDA 4KYTA 1YONA 5K8LA 3ISVA 2E85A 3O3CA 1PYOA 1U4SA 5L46A 2I3ZA 3GNSA 5B37A 3Q8WA 1Q86D 4XLEA 1Y9ZA 1TQ2A 4OG2A 4WCDA 4DSOA 3QWIA 1HI9A 1QMPA 2WVGA 2XR1A 1IJBA 1JXQA 2Y0DA 3KNZA 4DE5A 5BWBA 2XGOA 4FEAA 1JAZA 3GPIA 1H3NA 5DYYA 4M1TA 1ODFA 3D8TA 4XUDA 3MELA 4XOPA 2Q4TA 3NHKA 2HJHA 2R751 4KV7A 4W5HA 3OI7A 4RE5A 5IAKA 3IQFA 5JC1A 2CV0A 1Z0KA 2V96A 2X9GA 5HHTA 1R5BA 5GOTA 4S1PA 3UM9A 4XN0A 2G4CA 3M83A 3W8NA 5EWJA 2W4QA 1J1UA 2PD3A 2JVIA 4IJQA 1TT7A 3MRTA 2XAUA 1ORHA 1O96B 3H16A 4JBXA 4JK3A 1ZW1A 4O1HA 4BO7A 4D9BA 5DNUA 1L5OA 1FZTA 4I5IA 4LJAA 1C9JA 1KH1A 1FL9A 1ZAKA 4O29A 1U0LA 1H8HD 3CPHA 4UM8B 1TKAA 3IKTA 1HR0B 4RL4A 4R8VA 1OX4A 2LZJA 1ISRA 3K1JA 1R88A 4K9PA 5CG1A 5IJWA 1P0IA 4EG8A 4YJ3B 1Y9EA 4KI0A 2ODQA 1E8NA 5LBIA 3SM9A 5FI0B 1F7VA 4YCAA 2A5FA 5JXJA 1RCTE 1PZXA 3DD5A 4HY3A 1YZ3A 1XPRA 4C87A 1QTNA 3DNFA 4I99A 1XRSB 2C3UA 1OGIA 4ER3A 4L7VA 1RWOA 3KM0A 3V42A 3ZV7A 1EB8A 3V9AA 2VRCA 3WLAA 1KI9A 1THZA 5JTTA 2ZOSA 2F8TA 1T9BA 2IE0A 2C99A 5BSTA 1B14A 1XHEA 5ECYA 5FEMA 3ZWAA 4DCTA 2C2GA 2PQ6A 2VSOA 3QNUA 3MLBA 1C4XA 1BHSA 3OLCX 2C78A 4JLDA 5D2CA 3DO5A 1GUYA 3FWZA 3NVAA 5DYWA 3WAKA 4F6RB 1R6AA 2IZOA 3COJA 4IV8A 1CX9B 3RUDA 1XQ9A 1XZAA 2FWJA 1Z6TA 3B36A 5A6VA 4QOIA 2Q9BA 1K8RA 1TJ3A 4EJSB 3D2BA 4NNPA 4P4NA 4R69A 3R23A 2WW8A 3OJLA 1OH7A 4QDXA 2G04A 5EJ8A 3GDHA 5J2UA 3L7NA 2CJYA 4PIPA 3BICA 2MJLA 3EXG2 1QUFA 1UBOS 2MMCA 4HB3A 1N9GA 1IPEA 4QQNA 2H1IA 3MCWA 1IDN1 3HEBA 2WDZA 3QX3A 3IELA 5FWYB 4GKKB 1FFYA 1CU1A 1FSGA 2OT3B 2GDJA 1UFOA 3EIUA 5I8WA 1CYEA 3W9YA 1P17A 2ZSFA 1E3LA 2DKOA 1XFAA 3QEOA 1F1BA 4US0R 1JB1A 1FDSA 3MM4A 1W5BA 2LPMA 4V3CA 3MCVA 3V46A 2VDRB 1T0JB 1B8OA 2D2VA 1GPKA 1NDUA 2PLWA 3OPYI 4G37A 1QYVA 1CZUA 2GM4A 4O8ZA 3LCJA 1SKUA 3PRYA 2HXGA 2ZDQA 3H6HA 1JEYB 3K96A 1A27A 2EKDA 1IHXA 1O08A 5T57A 3W5IA 3L7MA 1L3BA 1DOZA 1G4AE 2PO5A 4NV1A 5CCXA 4JKIA 1T9HA 2PKQP 4P2GA 2A2ZA 1BZYA 3VYUB 1O0CA 4BAUA 4GQBA 1OC4A 1UAGA 4A15A 1GR0A 2MYPA 4UMDA 2X8AA 1NZJA 2NU8B 1E7MA 4ER7A 4NK5A 3ZHOA 2ZB4A 3QGMA 4Z4GA 8OHMA 4R40A 2BFBA 2QVLA 2GHIA 2Y0CA 4CMIA 4X06A 4B9EA 4GXQA 3DXXA 4KUEA 3CCRB 3LQ4A 4PEVA 3CWZA 1OFTA 1IL0A 5TT1A 3E20A 3IXLA 4QSMA 4CEIA 2GJAA 3W6NA 3HJGA 4K28A 4KNWA 2I29A 5AVKA 3L6UA 1PQUA 6YASA 1SC1A 3O9ZA 4OX9B 4MWTA 1M54A 4ZYYA 4BU1A 3L8CA 4DLRA 1HWYA 5F4OA 4PNPA 5CIWA 1L5QA 3O9VA 5TS3A 4BV2A 3RC2A 5KTRA 2CXQA 3U7HB 3UV6A 2Q46A 1R1DA 3P27A 1VHJA 4YV1A 3N5CA 5FL3A 2O5EA 2XDQA 4J76A 1QKJA 3S1SA 4UHHA 2C4MA 2BI4A 1OB2A 2QTVB 4V2UA 2AEJA 1OFVA 2OAP1 3Q2OA 5ES4B 2RJNA 5IU6A 3CONA 4DLWA 3IS3A 2B1QA 3AUSA 1NVMB 4YALA 1DCTA 4XQCA 4C05A 2VNIA 3K73O 1CIVA 1YL7A 1J0BA 1H23A 4HQOA 2D7CA 2XYPA 3BC1A 4UXJA 4CTKA 4YMGA 1SY7A 2XXAA 4E08A 1IXYA 4DR5B 2HMAA 3JQ8B 1AB5A 1NKVA 5D1NA 4Y2RA 4N3GA 3AVWA 1T2UA 2HSJA 1UMBA 2QU7A 2VBGA 4N9QA 1SK9A 1UADA 2PUCA 2FZWA 5ELXA 3H6KA 2AG5A 1WXXA 4HLUA 3P4XA 3R75A 4BV8A 5JD3A 2J6CA 3DZGA 4ZPXA 5CCDA 2ZBFA 3UWDA 2JCBA 2YY6A 1YMQA 3KXKA 1VPTA 3JD2A 4GVPA 4LKRA 5BURA 1CUZA 3AJEA 3LQ6A 4B4VA 1SMKA 4CKBA 5E6SA 3N0RA 1IBSA 3AF5A 1W1WA 3RDPA 3S3TA 2Y4NA 3G49A 3KYCA 3UJHA 2VUHB 1W581 4QGFA 4ZQCB 4WHMA 1IBCA 2QL9A 2MDTA 1C9EA 4UHBA 1CP3A 3AIIA 3K8ZA 1RACA 4ZT2A 5TQ0B 5FOXA 3ZHBA 4L4UA 1RYNA 1YJWB 1NI4B 2CXOA 5K6RA 3D0KA 3T3HA 4DMUB 4YRLA 1RPNA 3QSYA 1XVVA 2ABWA 1Z15A 1V96A 4YLEA 1GZ6A 2VRNA 4BO2A 1IJEA 4LF4B 4TRJA 4WJLA 4WZLA 1PV4A 5EWMA 3WJ2A 1MOPA 4B4DA 1QCCA 2BFDB 2QRVB 4BKRA 5ITZA 4QLOA 5KTOA 5CTJA 3SXUB 2GK6A 1QFSA 1JEAA 2V54A 2WFLB 3IKMB 3KEFA 3Q87B 4EMUA 1SEVA 3IUNA 1Y9JA 2HF2A 3S8YA 3ZWYA 3VTKA 2AWNA 3GEHA 1C3LA 2G72A 4LYFA 3U37A 3VUEA 4YCCA 4GEGA 5FBKA 4RF2A 4PW0A 2JB9A 1EJBA 3PQ8A 3GT0A 2WYUA 3E9MA 4JL6A 5K3OA 3B1ZA 2IIQA 1K5PA 3IUJA 5EGSA 4DN6A 5HQTA 3WICA 2RC6A 3QOWA 5ICGA 2RG7A 3L0PA 3O3MB 1WOSA 2R1ZA 1KWKA 4EW2A 5CNMA 3H5OA 4ME6A 3ZGXA 1WUJS 1YVDA 2CLKB 1QH1A 2VSXA 3OZDA 3TCKA 3U13A 4C7XA 3AIOA 2DHRA 2PO7A 4JBWA 2CWDA 3RK1A 4AL4A 3I04A 1ILWA 1XWIA 4EW1A 2AX3A 1MPTA 3AR6A 3L7DA 3CVXA 4MR9B 2BFFB 4F7WA 2B5OA 4LUCA 1S8FA 3F96A 4OIMA 1S1CA 3ASRA 2HXSA 2YXNA 1Y8QB 1JPNA 5B58T 1CUWA 2VG8A 1F8FA 2XNDA 1KI8A 1GPDG 3ASVA 3FUTA 1QG6A 3AY0A 2EJWA 4FR5A 3RT1A 3UCXA 3VU9A 3VNBA 2YQ4A 1JHZA 1OD6A 4FDTA 5DZSA 2GEVA 4DNRB 1RPZA 3GPLA 5IYZF 2FF5A 3WGUA 3PNSA 1KR2A 3IAUA 3QKRA 4GNKA 1XCBA 2OMEA 3GZ4A 1XRNA 4QELA 4BO3A 1TPZA 1UOQA 1K7YA 3MWDA 3VH2A 5I7RA 3FUUA 2DFKB 3BZBA 4DFDA 2PV0A 5A7FA 5AKHA 1CR1A 2ZBDA 3VKGA 2EZ9A 3EVCA 1PK7A 1V5VA 4YRMA 1IE3A 3D0OA 4XIYA 4RVHA 3MJHA 4R6XA 5FUWA 1BFDA 2GTPA 1A8SA 2ZZGA 1B43A 3OJOA 3ICCA 1LI5A 1ODIA 2FMUA 3LIPA 5A05A 1SIUA 3TOSA 3WK4A 4IHJF 5IYRA 1HTWA 1JDPA 3P20A 4MK4A 1T6XA 4DSNA 3ZWBA 1ACLA 3QTBA 4YS6A 1OXVA 2X8JA 3CSSA 1KNXA 1V6SA 2ZETA 2H7YA 4NABA 2OCYC 2I03A 3DOOA 1V11A 1C0PA 3R3ZA 1OLSB 2QNIA 3KQVA 3R5HA 3GOQA 4GGPA 5D1HA 2O5VA 5BY2A 2H7XA 2I6XA 3TSAA 4IDEA 5KNBH 3MRVA 2MSEB 3ZWDA 3CEJA 4MYDA 2V3CC 1KFEB 1G2QA 1UUFA 2ID8A 3ID6C 4IGEA 4UTXA 5JFOA 3NANA 2PZFA 4RPKA 4BWFB 1BDBA 4LX0A 2HCRA 1P5JA 2QENA 3L1HA 1NR1A 2QLMA 3BQNB 4RFSB 1M2VB 2Q5FA 4WZTA 2AZDA 3MTQA 4ROSA 3G3EA 3M5CA 3VSDA 1E94E 5AW1A 1WMBA 4PNHA 3FVRA 2P78A 2Q5JA 5LQAA 3M2PA 3OTOB 1Q0PA 1DADA 1EIWA 4RD2A 2WMNB 3ZE6A 4BB9A 4XWWA 2OCLA 1UJ6A 2NQTA 2PPLA 5KJCA 4MIEA 2HSWA 2QT1A 2R8ZA 3VTZA 2H4FA 3CY6A 3EIQA 6ADHA 1J2JA 4CFYA 1ZS9A 3WLTA 4D79A 4ZP1A 2BUAA 5ICFA 4IILA 3AEYA 1WZEA 4L72A 1C9NA 4RSMA 4JLWA 3V55A 1SVOA 4TUYF 3CVWA 4LQLA 3MW8A 4M9QA 5LDDC 3OLVA 4X1IB 3RVBA 4OJKA 1G7SA 4MKXA 3OQMA 4URVR 3B6ZA 2XOKA 1HDZA 2DPMA 3GMDA 1OTYA 1PTKA 5GM1A 5G4KB 1I3KA 5LLSA 1UAYA 3ZXUB 2BMFA 3ZWKA 4KGXA 2X5JO 2XUAA 1EUQA 1N6LA 3ABSB 1I7LA 3AUFA 4YMHA 1AURA 2JANA 2HSEA 5HUHA 3A35A 2YZMA 4IZ6A 3TQOA 2C5FA 2OO5A 1R4NB 1NBMA 5KYXB 2O8DA 4XMYA 4K5QA 2F3TA 2X5XA 3KHUA 2ZRQA 4TLLB 2IHKA 3AFHA 2I55A 1JN0A 4CEJB 4R2IA 1ML4A 1MNQA 4J29A 3P9IA 4A6DA 2PUAA 3H9EO 5KNCH 2PANA 1KMMA 1K86A 1OQAA 4KREA 3HKBB 1E0AA 2OAQ1 1VHLA 2FMIA 2JAOA 2PWZA 4K9DA 4C5AA 4MLCA 2PFGA 3RS9A 2PSSA 1I94B 4ACAA 4MCIA 2FU5C 3F6YA 1FFSA 5FCDA 2D8MA 1H4VB 3D5EA 4D0GA 1ML3A 5U4XA 1GN8A 1JHMA 4JITA 1YGYA 3ELYA 3K9QO 4HXEB 1UDCA 3FGNA 3F9RA 2F1KA 3MQ4A 2W93A 5JCOA 4MI6A 5TXGA 4MB6A 4GVXA 2Z9BA 3GOHA 1U9CA 4QGGA 4LMBA 1UD6A 2J3QA 4O4JF 4V0NA 5GPBA 1DUIA 2BMEA 4MGEA 2JGRA 1JDSA 2BZSA 2V6IA 4AX4A 4FW9A 4F91B 4HDSA 2XA1A 5EZ5A 1VJGA 1XEFA 2EF0A 1WIWA 3E2IA 5DIZA 1K0UA 4GRIA 5EJGA 2CHGA 4D81A 5KOJA 4NBKA 4TTSA 1XRJA 3V8PA 2IS4A 4A8HA 1RRCA 3BMNB 3MMPA 3OFNA 1OLXA 2BKVA 4LI3X 3V4VB 3H97A 4NBNA 4QYSA 2XRZA 4GPD1 3KVRA 3CWCA 3O3OB 3P5BA 1J5EB 3V33A 4R2HA 5K0LA 4AYXA 4XWKA 3CCEB 5D6OA 1W4BA 1EHYA 2JRLA 2JZNA 3ELUA 3O3NB 1Z6AA 2PXXA 4L85A 1V2GA 4II2A 1CRWG 4B6QA 1MD9A 5IH3A 2PTGA 3AEZA 1VHDA 4BNJA 3UBMA 5F35A 3THSA 2VN8A 5HDQA 2BKLA 4PZCA 4QU9A 2PSHA 1TYBE 2OO3A 1NXOA 2PGAA 2OV3A 3FPAA 1R9GA 1I4TD 2PAAA 5CJ2A 4OAPA 1JSZA 3ZY2A 1MB4A 2AZTA 3V4FA 2QTZA 3RV4A 4KE9A 2GASA 4KV9A 3TTYA 4C20A 2NU9A 4KJZA 1GQ2A 2OQIA 3ICOA 1YU9A 4MRAA 4OYLA 3ZDRA 1EVZA 1U3FA 3WQBA 5JADA 3KD3A 4MQ5A 5AJZA 4TLDA 3ZJ5A 4CM1A 4EIWA 1W7AA 2FR8C 1CY8A 4I8XA 4LXYA 2AN1A 5AVVA 1JUDA 2GXQA 2IBMA 2O7NA 1FNCA 1R0RE 4OH1A 3E0XA 5CFQA 5SV2A 3K9GA 3L6RA 5EJFA 3W7VA 5BVHA 4CRWB 2XV1A 3DXZA 4HD8A 3T1OA 5ICMA 2FJPA 5DXFA 2AFHA 3IOCA 4Z7JA 3OOYA 1XZLA 3WJ7A 3GRKA 4K9LA 5TRTA 3NBAA 2IXAA 3WKEA 1ZOOA 5CHEA 5CD9A 1JNXX 3FMGA 1XZEA 4D42A 2YV5A 2JDID 3OM8A 3GJYA 3QA3E 4DBVO 3T5DA 4MWGA 2ZBRA 3FDXA 2L0XA 3RSCA 1AF4A 3VR5A 1ZOPA 1DDGA 5EHXA 1CK4A 3NM4A 1HL3A 2FHSA 3F67A 3T9DA 5DM1A 3QLTA 1N0WA 1YCGA 1FMFA 5AM4A 2EP7A 1JKFA 4TZTA 3W3AD 2O54A 1DKUA 4BC0A 4PHCA 4W6ZA 1UT5A 3MB8A 3AKZA 4KKTA 3C8UA 3MCZA 2OV8A 1ZDMA 3TLXA 3TXXA 5IJ0A 4DLXA 3ZD6A 2ID4A 3CESA 1W1UA 2IT1A 3H11B 4I50B 3PKIA 1GQRA 3MTAA 3TG8A 5KKAA 3WP1B 3ANXA 5M34A 4O3MA 5KHAA 4E2WA 4HWPA 5LMNB 2Q99A 5K99A 2YHIB 2HQ1A 2ZSEA 4XAQA 3G71B 3U62A 4PXSA 3DS8A 2JIBA 5ELLA 3RIEA 4C9BA 5ALWA 3E22B 3P32A 1B6RA 4KU4A 1U99A 1XCJA 2ENUA 2P5SA 4IIUA 1ORIA 1TK2A 4PG6A 1CRQA 3D7MA 4DQVA 2C7RA 3PCXA 5IDQA 3H4TA 3BS4A 5B1DA 3DFFA 2VWQA 5U9CA 4M37A 1YR3A 1RI4A 2QW1A 3HYTA 4XOIA 1TAUA 4I1RA 2I22A 4ZT3A 2HU2A 2FK7A 4G1BA 1BVUA 4JS0A 4RCVA 3TW6A 4TTQA 2Q3CA 1YKFA 1WWKA 4OLJA 5I9MA 3GLGB 5JDCC 3PFNA 3T7RA 5G4KA 1CF2O 1IAQA 4HDMA 1WCWA 2H0QA 2VNSA 1OGYA 3AYXB 3KU4A 3TNJA 3V7NA 4MVJI 5J5CA 3K1TA 3DDHA 4LZPA 5K7SA 2GBLC 1VE3A 2QDKA 4S1TA 2XCUA 3OFJA 4BE7B 4GGMX 3ENNA 2GS9A 3UW1A 4WXEA 4X6UA 2B9VA 4WCFA 1S2NA 3RK0A 4L8GA 4L0DA 3TLBA 3EQ7A 2J07A 1URPA 1CWUA 4LGYA 3GLFA 2YIMA 3KQTA 4FFDA 1QHSA 1OXBB 4XL9A 4PNEA 2UUBB 5CK4A 4D80A 2ORWA 1FYVA 1P74A 3GN1A 4MRMB 3OKFA 1VG9B 3TI7A 4ZQEA 4FB5A 4CIBA 1O1YA 3CR7A 3H0KA 4TTRA 2Y0PA 4L4SA 3I01A 5LBUA 4LOLA 1ECLA 3AI2A 5FYQA 3ZZTA 4M46A 2OD7A 2Q0QA 3G0OA 4LQCA 5EYPA 3BK7A 3L18A 5DNDA 2FPXA 3WWYA 4Q9LA 3UCEA 2HRCA 2XCLA 2G6TA 2E6KA 3D3NA 5FYDA 4E03A 4S1OA 5ALYA 4D26A 1JU3A 2P0EA 4RL6A 1XC7A 3QU7A 2VAMA 5JQGF 2R7LA 3FB1A 3AQ4A 4PSUA 2ZROA 2R8PA 4ZD6A 3WX0A 1OB0A 2Z9DA 2J9GA 4DK1A 1WD5A 1PJQA 5JG7A 1PWYE 1ZUNA 1XA0A 2C96A 2PZAA 2D7JA 4QHTA 1EE1A 3U9TA 4KR7A 2EZ4A 3NYQA 3BY2A 1LNZA 1R5JA 4D8TA 1G55A 1FFHA 4W8OA 1PZFA 3T9EA 3KPWA 1JFFB 1EA7A 2GEKA 2CF5A 1T2CA 2F1OA 1IOLA 3Q6QA 3TPZA 4QLBA 2Q4BA 1WDTA 1U9YA 4V2IA 4CIWA 1DTSA 1SBCA 3W5CA 4RMNA 1HMYA 1SHLA 3P2JA 1WPGA 3ZWCA 5BVGB 4HATA 3U7JA 1JIKA 1YRAA 2NACA 3PG5A 2CVFA 1NVVR 4EO4A 3LQ2A 3VAAA 2YDXA 3HVJA 1ZVKA 1BCSB 1YS7A 3KUKA 3CX7A 4FYXA 2JC3A 5BN3A 3GVHA 4HCJA 5JZVA 2QKYA 4QRDA 3OPMA 1P3DA 4US1R 3UO8B 1MOSA 1QCYA 4Z8XA 4UAGA 1VRWA 5DI9A 5F3RA 3VNQA 4X05A 1M76A 2ZUCA 1EIZA 1KY5A 1RAEA 2YZGA 3M0EA 4UD2A 4CKCA 4F04A 4OGKA 4PCAA 4PF1A 5EOVA 3AUTA 4AROA 4BNWA 4CF6A 1FTNA 1BG6A 4NE2A 3SC3A 3CXUA 3K0AB 3N2LA 5IKXA 3UH1A 3C1AA 5HIKA 3ZCTA 3RUHA 2B4RO 3A1FA 3BD6A 2CL7X 3HMQA 1VBKA 5JQGB 3WLPA 3H1AA 1DBSA 5EHNA 3BB3A 5EIXA 3RSGA 2FSPA 4QO8A 4BNVA 3T1QA 2DBRA 3DDUA 1QAQA 2GJKA 3AUKA 1I36A 5AJXA 4DV4B 2YJ5A 4D5EA 4E2XA 4YXWD 4ACBA 1AUVA 3TLJA 2GN1A 2CMFA 1W8DA 3CE6A 4R1QA 2JI7A 1MQSA 4F92B 3IPAA 1CPYA 2QLFA 3AL0C 1V1JA 1D2AA 3ZKWA 4BLTA 1II0A 2YWRA 3E9NA 4IS3A 5GIPE 4UTVA 1Q5PA 3FNBA 2JCYA 2HWKA 4AN4A 8ABPA 3G6WA 1I5OA 4GECA 3PTZA 3CVOA 3OLXA 5GONA 1MH9A 4LV8B 2I4IA 1BE8A 2I34A 3EDQA 1S8NA 3R5TA 3F4BA 3W5SA 2R25B 2FR8A 4ZARA 3V7WA 3OLWA 3ZGYA 3W9UA 4NY1A 5CGZA 2WNHA 3MF4A 5BNTA 3GV0A 1TMGE 5EIHA 5TJHA 1RM5A 2AW3A 2D1YA 1ZGJA 4NOJA 1TUIA 1KEKA 1CC1S 3DEJA 4PGOA 3KPUA 4AKIA 2PU7A 2OK8A 2GBPA 4MS4B 1EJ2A 5AJHA 3ZWOA 2NP7A 4E30A 3AR9A 3TR6A 1UR5A 4HDRB 1NUQA 4KYUA 5HM8A 2NU7A 1BX3A 3GRAA 4J6EA 5TMEA 2CCKA 4J1QA 4KR9A 4A5SA 3OIYA 5BPHA 3MTIA 3TUIC 2C61A 5ELMA 2I2FA 4G8CA 3E4CA 5H81A 4C0LA 4XOUA 1M7HA 2RONA 4P4SB 4C1NA 1J4AA 3AUYA 4LK3A 4OU5A 4QBFA 2PMDA 1J39A 3UPUA 3GJ0A 3M6UA 2M6SA 1HDIA 1HT0A 2MINB 1DC8A 1GFIA 3HDQA 4JQZA 2EWMA 5B2FA 1RXVA 4F96A 3OAAA 2OYCA 4KK4A 2QUKA 2VIIA 2CHFA 1G98A 3V76A 4LYGA 5CTAA 5HKLA 1WXEA 3QEMB 3VZDA 2ZWAA 1TMOA 2PMWB 2VDUE 2UXDB 4YYEA 1ADYA 3UMJA 2VTDA 5CGQB 4CCYA 1H9CA 2VWHA 3WIVA 5DBFA 1LDEA 2M32A 5F7OA 2I8AA 4TV8A 1SCNE 2QUBA 3F4LA 4RGVA 1IHMA 2BKXA 3CKLA 5ALLA 3IV9A 3JASA 1Z2EA 1EX6A 4LHWA 4XGQA 4J4TA 3X2SA 1TZMA 3L93A 4BWYA 5ALNA 1CP2A 3MFQA 1E3JA 5EZQA 1X74A 1Z5NA 1YQEA 3E70C 4G1FA 2I1QA 4X20B 1WUIS 4GKAA 1SUEA 4RWEA 2Q9AA 3R2JA 4FEYA 2JFUA 1XMOB 1JLLB 4B32A 5I9IA 3EXHC 3TFOA 2XD4A 5DGHA 3UFBA 1CY6A 3K70B 2VYVA 4WY8A 1I2MA 3F3YA 1ELOA 3FX2A 1VLHA 2F8SA 1DE0A 2F48A 3UXHA 2BHLA 2H1FA 3BMCB 4LYAA 4G09A 5FOUA 5KAMA 2QU8A 3UJDA 2B7CA 1QP8A 1I3MA 5T41A 3FDZA 2HMTA 5A71A 1I9CA 2OG1A 3WL6A 2GGSA 4CQMD 4RTOA 1FTQA 1AQ6A 1QAOA 1GQOA 2PWYA 4CGYA 3GLIA 1NRWA 3ML1A 4OJQA 3RHFA 1H2AS 2FUKA 5FNVF 1FNNA 1MB3A 4MARA 3O7WA 2J1LA 3RS2A 2VDOB 1XTQA 1NPYA 3OEHD 3H94A 4C0KA 3JZMA 1WORA 4RM3A 3C8HA 5E0KB 4Z0NA 1IBMB 5F4ZA 2AR0A 2YOHA 2IYYA 5ESWA 4CKBB 1VPEA 3OZGA 4RY2A 2VF8A 3Q3GE 4XA8A 1KY2A 2BEVA 2W2NA 3M5DA 2ZRFA 1Q0SA 1ZSNA 2REBA 2PNFA 1NY5A 3AEQB 4LN1A 4HDNB 1BGXT 4H3VA 1WXFA 4NV3A 1A5AB 1Y63A 1SUIA 5HF8A 4ANFA 4ZHQF 5E2IA 4PAAA 2XQIA 2YJ4A 2D5LA 1I9GA 3O1LA 1TM7E 2GJRA 1RJ9A 1QO0D 2DUNA 1I8DA 1WHTB 5ALUA 5JSFA 2EQAA 3JR3A 2AHRA 4LJ6A 5DM2A 3PITA 4NMLA 1Z25A 4FMCF 3SHTA 4UTZA 4DEYA 1ESNA 1BRMA 1M8KA 1Y3AA 2QX9A 2C03A 4R98A 4KOAA 3EY9A 4K9QA 1PLLA 2WBLC 4Q05A 3LUBA 4Q9HA 1XK7A 3I2JA 3BIJA 4WN3A 1Y42X 1SOMA 4JR1A 1SURA 4NFYA 1M34A 3G5AA 4QOFA 4A0HA 2QIOA 1AXEA 3PHCA 3WQQA 2QD3A 3THXB 3LECA 5L3VA 3GJRA 4R2MA 2AXQA 3Q5DA 4ZOBA 3TIFA 3VSCA 4LDZA 3QE2A 4X1IA 4Q03A 3QZUA 4DY4A 1KJ8A 3B1XA 1P60A 2F7SA 3KFLA 5U1PA 5CURA 5K3AA 4E07A 1BC5A 5CT5A 1CDDA 3WTBA 1L8AA 3D1VA 1MHTA 1ZVVA 1SCUA 4I66A 4WKNA 4XLAA 2PT5A 3LL4A 3PCRB 3DE4X 4BYGA 1VRVA 2C5AA 1XR3A 1KS9A 4JKOA 3WLRA 1ZD3A 3ZGNA 4A03A 3KUCA 1MO3A 3DZDA 4I3GA 4N18A 2EFJA 3OSZA 3S0JA 3WIDA 1EWVA 4X62B 3GR6A 4PQRA 3ZDBA 2XOKD 1KQPA 3JQBC 5AI4A 4Y9RA 4IY1A 3TD6A 3UWPA 3WGLA 1GRCA 3O75A 3HS3A 1FY2A 4QXMA 5DI3A 5K6AA 5KS2A 2A4MA 1SVIA 2QYOA 1NMQA 1C30A 3QVVA 2XUZA 4JENA 1A2OA 3WK5A 4R8RA 1AO0A 3UT0A 1MO4A 2V6BA 5LQMA 4PGFA 5FDFA 1EMDA 1DGQA 4OXYA 4L50A 3HCBA 3LBIA 3KDPA 4DANA 4DLBA 4OI2A 4PZ0A 3O31A 3QFFA 2HJWA 2PUWA 4ZT6A 4OEHA 4AKHA 3GL9A 3D4PA 5AKGA 1OILA 1R18A 3IKLA 5U4QA 3ZX4A 4OHZA 4F11A 3IT3A 3F6PA 2DHCA 1CUFA 3K2QA 4MROA 3S7ZA 2ZI7A 5EFZA 2BISA 3Q39A 4FMDF 3NE5B 4Z9XA 3RRNA 1A4XA 3BE8A 4FYHA 3RTGA 4RK5A 1N75A 1XLTA 4IW3B 3L49A 4QGAA 3NAQA 3V8VA 2MU1A 3ZDDA 2JBHA 4L3OA 2GLXA 3BQMB 3T3MB 3WLHA 2H1RA 3A9SA 3HGTA 1UPAA 5AW3A 2VCEA 1YCFA 1Q1GA 2WD8A 1AGNA 3A1UA 3BTSA 3SP1A 1YE3A 4S05A 2HH9A 4H7FA 5KVVA 4LNUB 4DQ0A 2AJLI 2PL9A 4M9UA 3K2IA 4LBYA 2A94A 3D4LA 1CUGA 4PTLA 1ZCBA 5E8RA 4CMKA 4ALMA 2RGNA 2ZAIA 1N33B 4TKZA 2AXEA 1S2GA 1H94A 2FF7A 1U3WA 1Y6JA 2P9CA 3ADOA 3F47A 3DC2A 2ZPUA 3ITEA 3T0FA 1QQ6A 2A5GA 4ARZA 4DC0A 1R0SA 3HDGA 1PL8A 5BWCA 3F46A 4F3NA 1TZ2A 3W0LB 1N5RA 2CDRA 3SJUA 2VZLA 1A1SA 4BNKA 1FTSA 4XKVA 1U8FO 4OL9A 5HXBA 2SECE 4AZ3B 5F9FA 4I5GA 1WTHD 5AP9A 1G7RA 1AHNA 3ND8A 5D7NA 2CLSA 3VZRA 1Z4JA 1OIXA 1MW9X 1U0GA 2CBZA 4URUR 3ZEIA 4FW8A 2D1FA 2W98A 2G1KA 2XA2A 1UDBA 1L5RA 3H8JA 3KSZO 1AUQA 4I8DA 5J40A 3B8EA 4ZI5A 1G42A 1B2RA 1NOIA 3MD9A 4G0YA 3A31A 4CLHA 3SVTA 3GLIB 2DOKA 3V1MA 1RWWA 4WZKA 5AI5A 2XTAA 1H1LB 2BDTA 3DZ8A 4TGLA 3ITDA 4QICA 1H2ZA 5E2BA 4MVJG 4N5MA 3HP1A 4XDZA 3BMCA 3P9PA 4N8DA 2HRQA 1JA0A 2ZBGA 5DSTA 4X97A 4EECA 3ASTA 2P77A 2BBWA 5ARCA 2JLUA 1FIUA 3A6KA 1I7DA 3BMOA 3DLHA 2I4RA 2OG2A 3ORQA 1M90D 4Q4CA 4OLFA 1SBYA 2ZULA 3RODA 3RAJA 5A0VA 1C7QA 2DYIA 2ATXA 2IPOA 1DP4A 1ZI9A 3OBIA 3OKPA 3SZRA 3UAXA 4CW7A 4CKZA 4M0FA 3UAWA 4F8JA 4Q1DA 5H9WA 2IU0A 5K09A 5KB3A 1MTZA 4V24A 2ZBQA 4MW2A 3VHXB 1Q6ZA 1K98A 3G8CA 1R16A 3DPIA 1AKTA 2E18A 3VNUA 1HFKA 4UDOA 3WLNA 3JQPA 4DCOA 3Q9SA 4OD0A 3W06A 3RG8A 1HF3A 4DA9A 4DSTA 1CR4A 3TQHA 4E11A 2RG1A 2GM9A 2R6JA 4KXYA 5CBPA 1OJLA 1T29A 2IHNA 3AHGA 3ANNA 3UFXA 5GADl 5E6UB 3W05A 3LS2A 4R0VA 4LYHA 4EG0A 2OXFA 3RI3A 4IIXA 3VU9B 3WIUA 2QNRA 5CDYA 3QWBA 1NRKA 1KO1A 1SWVA 2PX5A 2XUQA 3EK2A 4Q9AA 3X44A 4Q6WA 3MJRA 4MKIA 5IVKA 2BE7A 4HB4A 5BSYA 3CGGA 1KY4A 3RHSA 3BUSA 1P5FA 1VHTA 1PEDA 2A33A 2H08A 2WSSA 5F2NA 2IUFA 2SNIE 4MYCA 3TLZA 4FN5A 1N6NA 4TRRA 1XMSA 4ZOAA 4E0BA 5HQ3A 3FHTA 3QA9A 2ZVJA 4LV6A 2GBLA 4C3OB 3VNRA 4X7CA 2WTAA 3ZTTA 3QELA 4TRMA 1RLUA 4RIHA 1JHQA 3TDKA 4DMCA 5DGXA 1KI7A 2Y2VA 2C94A 3GCZA 1B16A 1CFZA 4WFQA 2CE7A 2YZ7A 4YYZA 3BCSA 1ZD5A 1BMFA 2WTEA 4HB0A 5EJIA 1DXQA 1NE2A 1W6RA 1XMVA 1XG5A 3NQ41 3L7IA 5IWCA 4OO3A 2BCGY 2NV2B 2P6MA 3QE4A 3HDJA 5DYIA 4DILA 3IV7A 5B4TA 1FFAA 5KSPA 3IIJA 4J1TA 4YCSA 3HSYA 4ARVA 2QRVA 1H6BA 2ZAYA 3GUYA 3FOWA 5DASA 4EFNA 2I33A 2PT6A 5IDXA 2IHVA 3VDNB 4GOOD 1MP0A 4PO9A 2ZYRA 1KU0A 3OE5A 2DR0A 3JPWA 4B80A 3VVMA 1YX2A 2VL7A 3SYRA 2ZUSA 1TLTA 1NNI1 3UWMA 3NB0A 2IPAB 1FP2A 3COPA 5EN4A 4KRYA 2IYVA 4ZV4A 2JAXA 3OQVA 3LBNA 1OFIA 1HZZC 4GRAA 4I9UA 2J3HA 1V0JA 3KB8A 2ZCVA 3GZTB 4WN9A 5HGXA 4COOA 1TA0A 2LR0A 3RW9A 4X6YA 4HDKB 1YRBA 5BN4A 1NYTA 3D3QA 5IEJA 5SYMA 2Y0BA 4ID3A 3PPYA 4J0JA 5DTEA 1PCXA 2JGEA 1FJHA 1XO1A 3OZAA 4LPKA 4M3NA 3ETDA 1LC0A 4U8HA 5JIBA 3OF2A 4EZIA 5D7BA 2QSZA 3AUJB 1SQGA 1QGAA 4DW8A 1J0EA 2QPTA 3LI2A 1HV8A 2Q4RA 1SEPA 2WAOA 4H6WA 1EFKA 3QPAA 4ONEA 4NQRA 3TTWA 1NQXA 2YXDA 4Z0HO 2WVAA 1U0EA 2P5TB 4IJMA 1XWFA 3OIVA 4GX2A 4RTSA 2X4IA 3RVLA 2MSNA 4XVHA 2W6NA 1JQDA 3B5IA 2FLWA 2QQFA 3KTFA 3R0VA 2VDQB 4PPYA 4RVGA 4MKHA 5J4LA 3HXMA 3U49A 3GGGA 2CZGA 3GH1A 2V4UA 4AY3A 3O8QA 3PPIA 3IDZA 1DFHA 1M2GA 2M2IA 5EUMA 4UPDA 5KSOA 1RZRA 1LSSA 5B7PA 2K7FA 3CZCA 4RLHA 721PA 4EX7A 1PQPA 1FU7A 3UAVA 3L0BA 2H2HA 4RAOA 4UW9A 3D2CA 4OBXA 4BDTA 1KJQA 4WOPA 4BQIA 1V35A 3EFEA 3R3VA 3A4TA 1AK9A 3K35A 5C2JB 1WKCA 4OYYA 3HP4A 1NM5C 5IT5A 2ZPAA 4DG9A 5BVHB 3KBOA 2MCFA 3SCZA 4LMRA 4XYMA 1BVHA 1CUHA 2ZRPA 4EJSA 1I2DA 4MV3A 2PM8A 3TZCA 3NUQA 1SB9A 3AEQA 3ANYB 4YT5A 1WUKS 3O38A 3ILXA 1TA9A 3TW0A 2YKGA 1N2GA 3NUZA 3KJQA 2CJXA 2GD1O 4V0KA 2P2ZA 1IJFA 2E87A 3OLZA 4UU1A 3SZOA 3F9CA 1Z62A 4A3SA 1UEJA 1ZHFA 3PF9A 4GF5A 2QXUA 1N32B 3FYSA 4BZXA 2IU6A 5AM0A 1WPQA 3NBYC 3V48A 2AJCA 3ST7A 2H5EA 3P1JA 4HB2A 1GEGA 1DFGA 4QQ8A 1JDNA 4OHUA 3S5JA 5I7VA 3TS1A 4UU7A 1VHWA 3GLTA 2WD9A 2V9PA 2R1UA 3PIIA 2ES4A 1YIDA 4PLGA 4UVGA 3M6WA 1OYVA 5JS1A 5EPEA 3GJSA 3CMEB 2IL1A 4L4YA 3U1BA 2OWEA 5FQOA 4YMSA 3ND6A 3E22A 1IM5A 1GWNA 4LXTA 1J22A 5A06A 3D3JA 2LKDA 3RG2A 4PZYA 4ZDKA 3NT2A 1FA9A 3RU3A 1MIOB 1NXPA 3WV4A 1X13A 3BMNA 3EFHA 1MOZA 3RVDA 4YRNA 4LGMA 3AUUA 2VRCD 3IMFA 1C8KA 4I14A 4WZBE 3EWAA 3OOSA 4X44A 1P29A 2BZ1A 2VPPA 3OCWA 5SY6A 4YV7A 3B1JA 4EP1A 4ZAYA 5LOVF 4ZYUA 3N0TA 3DNMA 1E7QA 3EEBA 5HZBA 2G63A 2ZJOA 5GTDA 1PL6A 3TGLA 3TYXA 2BMWA 1GTL1 3OZFA 5SY4A 3PQEA 4KVZA 1ZUD1 3JWPA 4YI3A 5EHZA 1HURA 2RJ3A 3MJSA 3RF7A 5IULC 1LKZA 3B38A 3LUGA 1U8TA 3OEWA 4IUCS 5FV4A 3S8EA 4FWTA 4IO0A 1USUA 3DWFA 3D1LA 3JQDA 3F98A 4MS3A 4B3SB 3R6DA 2CK3D 3VR5D 5I47A 4EKYA 3CMMA 3F8SA 1TUBA 2D5IA 1F14A 1YQTA 2E5WA 3KVYA 2MINA 3P9CA 4U8GA 1NBIA 4UVHA 1THGA 5F1KA 3ZVRA 4CTNA 5JZ9A 4NCKA 1XUOA 1EKXA 2E21A 2RGEA 2JARA 3LY5A 5CXUA 2I2WA 2QM0A 3ZHVA 3EIOA 3QMMA 3PGLA 1JIUA 1QH8B 2F67A 3W8DA 2VF5X 4UULA 1L7OA 3L0OA 3AKDA 4Q1VA 2E4UA 2B7BA 3OPYB 2IPMA 3FNHA 4B43A 5C1BA 3M1YA 4RD6A 2FMKA 4UDYX 4HAXA 4IFTA 2HV9A 3IDSA 2CFCA 2I2CA 3BG5A 2TECE 1S5PA 3ONDA 1DBQA 2XLBA 1RWPA 2YYAA 1LJUA 2V65A 3F8TA 3FROA 4K8RB 4LDPA 4MA5A 5FA8A 4GDFA 1IMJA 1HMPA 4HQFA 5BYJA 3OJ0A 1XCOA 3ZNQA 7MDHA 1UP7A 3GEBA 1FUEA 4Q82A 4ZO9A 1JIVA 3FFBA 3VPSA 2G25A 4S12A 5LOVB 1J8YF 1YI2B 2V6JA 3LKZA 3CEPB 2YXLA 1XDUA 3R6TA 3ZCVA 1L5YA 5FTNA 1N77A 1W49A 5JXWA 1KI1A 4TMWA 1GSHA 1W8IA 2GXUA 3QWAA 1PFQA 2RK4A 3RTBA 4YDQA 1IUPA 3LWNA 1N1EA 2ATVA 1SC6A 2BONA 4C4XA 4CQMA 2FRXA 1RIIA 4QGHA 1RRMA 1DELA 2I78A 5COQA 1JLLA 3A3KA 3I9MA 3SLNA 4DBLE 2B82A 1DC7A 2CMGA 3DKRA 3LQYA 4XNFA 3GIRA 4JHLA 1O7JA 4O2BF 4RGQA 3IEUA 4AFNA 3OC6A 4HUQA 4PS0A 4HRVA 2Z6BD 2E82A 5HZMA 3HABA 1UBGA 4BRZA 1TYEB 4BFVA 3U16A 4D9EA 3CV3A 2AZMA 2FSIA 2NYVA 4FDVA 2DULA 3RB8A 1A97A 2QVCA 3H2HA 3SSOA 2QVBA 4CMIB 1DXOA 1K68A 5H3HA 3H2BA 4N49A 9LDBA 2C8VA 5AW8A 3H4IA 1MABA 4XPZA 4I1UA 4E2ZA 1XZQA 3GAZA 2FPUA 2G77B 3EZ7A 3CRZA 1KQFA 4JYMA 7MHTA 2QGFA 4J4BA 1F06A 1GSOA 4DQLA 2XDQB 3GQVA 3BGDA 4LISA 5LKAA 5DW3A 4NPAA 3GW8A 1EYZA 1EHCA 3A1WA 1YBVA 3CLTC 1A9XB 2WV7A 3PXCX 3WGYA 4ZIRA 1UT8A 4KJXA 1SAYA 2O3JA 4S35A 4S1WA 3WL7A 1DIAA 3BRWA 3E7WA 1X87A 3OPYA 4YRZA 5DFAA 2YVUA 5CAEB 1D5CA 3DLAA 1ANKA 1IXRC 1D2GA 4QATA 1FDUA 3PFGA 1PLKA 1M2OB 1EEHA 3PXUA 2GK4A 3GEDA 3Q11A 4PSAA 1UBCA 4C29A 3BD8A 3DTNA 3VZSA 4X8IA 4M1KA 1L5WA 3WGVA 1Z7WA 1GDTA 4WY2A 121PA 4RULA 4ENVA 3KC2A 4CMBA 3GJZA 3TB6A 4DV1B 1ESDA 1OIVA 3PB3A 4L5JA 4DADA 2ZI3A 5KWJA 3NI2A 4JC4A 3RAFC 5CITA 4KHPB 3CUVA 4EELA 3DCNA 5HVNA 4DNPA 4YJGB 4DSAA 2UYHA 1S8AA 1U7XA 1JG1A 1YS1X 4X1KA 4ZDIA 3PXDA 4FBMA 4KSYA 4HH3C 4IIYA 3VFDA 1IZ9A 5BSGA 3WNCA 1QZXA 3ZS8A 4G1VA 3RYFA 3A4VA 1JEEA 2HHHB 3EODA 1ECCA 4WKOA 4PG7A 5CEJA 2VJKA 3JARA 4CG2A 2X0KA 1A9TA 3O4VA 1MJHA 3GGPA 2LKCA 3WL8A 3AV0B 4MV8A 2IUYA 3DTVA 2KQUA 1LLFA 1WCYA 3CCCA 1UBEA 4HTFA 3UV3A 1WP4A 4ENTA 4G5SA 5AI0A 2E4XA 4TL8A 2I7CA 2VBFA 4TT8A 3MTJA 1ZM2A 2H1OA 4QXAA 4BQEA 3P0FA 2I4MA 1QVVA 3QFRA 2F9FA 1VQ7B 3PD1A 3CF0A 3COYA 4MWDA 3RKUA 4C4TA 1D2EA 3DMPA 3LUFA 4DQXA 4EG3A 2NMVA 5J4YA 5J63A 3FPJA 5KTMA 4NH0A 5CCBA 3UJ3X 1BJRE 1RAGA 1XKTA 4HQNA 2ZJAA 3TZEA 1ZX1A 1ZH4A 3AMVA 1CY7A 3PRKE 4KGVA 4M76B 4YJKA 1XKXA 3GHHA 3RSZA 2OTLB 2D5CA 2JI8A 1ND5A 1XU9A 2YHUA 3GJTA 1EX7A 4TQGA 5EWMB 1WDMA 4XWGA 4YMUA 3U61B 4AQDA 1PIWA 3V1KA 5AM5A 3IILA 4F45A 4MPJA 3O8DA 2WJWA 4DMRA 1LNSA 2O8NA 2WMOB 2CJWA 2RGCA 4G5HA 1G21E 4Q93A 1QAMA 3O2NA 1KAEA 5DN6D 4PCVA 3RH0A 3VU8A 3NDJA 4RDXA 2PUHA 2Z6VA 4CLEA 3AR2A 2VQSA 1B00A 1E0SA 5BQXA 4MI1A 1IZ7A 5AFSA 4EJ0A 4B83A 3K8QA 3O91A 1M0EA 2JJYA 5AH0A 5REQA 4KR0A 4GOLD 1KDYA 3G7SA 5JNRA 1XZJA 1X7WA 4GL2A 3KOYA 4CCWA 2J67A 3F5MA 3OIWA 4Y2YA 1JMYA 4MDYA 1KTIA 1D7AA 4OFWA 2CLEB 4R7ZA 3EQZA 2CLHB 4PYKA 4YN3A 1JH9A 4PSDA 4RS3A 1UODA 1XVIA 2O1WA 1YUMA 1L9KA 3D8RA 5KOHA 2PV7A 2DWPA 2CMDA 4ZVTA 4HXYA 1YITB 2JRCA 2O2IA 3PD0A 1E2MA 4O5OA 1XQYA 1G9SA 4RANA 5AW5A 2W2VA 1GVHA 1GPLA 1BIFA 2W8BB 5AVQA 4DV6B 1ICIA 1FMCA 3PPVA 3UB4A 3RC9A 4DIBA 2IYNA 2B1IA 4JMPA 1WQ4A 5EP1A 1ZMXA 4ZVPA 1NFFA 4R1OA 3ZEAA 3W1WA 3ZJTA 3VOSA 4JP1A 2EFGA 1ZHOA 4PRLA 4CR6A 2QL6A 5GGYA 4PLVA 3K9WA 4LHYA 5JPCA 4MUAA 3HA7A 2XMZA 3E27A 4JC5A 1JHVA 1UD4A 1YIOA 3N8NA 3DHWC 3EE6A 2QA4B 2ORIA 3Q8KA 4MGIR 3K5PA 1K8XB 1S7GA 4LRWA 4OXQA 3RS7A 2PGOA 2GFIA 3HR4A 1YFJA 3FDJA 5KCZA 5HMMA 2B30A 4X7EA 1J56A 4ZAWA 1PE0A 2GNOA 3EWNA 2D3WA 3A11A 1SG0A 3H5VA 4A1OA 5FBVB 1MV8A 3R24A 3ZUPA 2JIZA 1OAOA 1X80A 1M6EX 1VJDA 4A9AA 3D64A 2F8LA 3OC0A 4TVOA 4F6RA 2ZSDA 4P32A 1FNMA 5H0IA 3BDVA 4AK9A 1BDIA 3L9WA 4C6RA 4KH1A 2DCMA 4AJLA 1RXWA 3FSGD 1CYDA 2VOJA 4MW6A 4UE2A 1S2DA 4R9NA 2QP4A 1ZC3A 1XJCA 3RSLA 5KQRA 4P5DA 3NH9A 3FETA 4M86A 5CLGA 2X5OA 3GEMA 4LVUA 4UZSA 2QNBA 4TYPA 5FWAA 2H92A 1N9ZA 1VYHA 1JG6A 2ZRIA 3OTHA 1YAJA 3D02A 4TLBA 1JBKA 4EB6A 4TYWA 4CETA 3ZNOA 2JHPA 4MVJA 3PZBA 2IQIA 2GETA 4EYSA 4BEWA 1N8TA 1QLHA 5JR3A 2CCGA 1E4OA 1ECJA 4L3VA 5C8YA 3DT9A 1QFYA 3T4PA 3PEUA 3L8EA 3MK31 4WNAA 4AUMA 4CQLB 4R31A 1UZNA 2BP7A 2IY7A 3G0DA 2AYZA 3HFSA 2ZSJA 3KEQA 3BX1A 3C87A 4RYLA 3E6AA 3KZKA 3U4AA 1TM2A 1ZIDA 4V0RA 4DLPA 2IZ7A 4QUJA 5HQ3B 1FFWA 2BFAA 3R6KA 1J24A 3EF0A 3HBNA 1HG0A 5C0OE 3THOA 3QH4A 2VJDA 4NF2A 1XX6A 1Z4NA 3BFJA 4RESA 4D0RA 4HAIA 4N4AA 1UM9B 3RYFB 5BW8A 2WWGA 1ZM3A 5HJEA 3TE7A 2NM0A 3JARB 1X1DA 5EPOA 2YJZA 3IL2A 2MTBA 3LPMA 4NNOA 1OV6A 5JMPA 3DL7A 4KKXB 3SN6A 1HYBA 3EB9A 2P0YA 4JYAB 2HRZA 2UZ4A 5F51A 3PNBA 3GXOA 3OJWA 3HUUA 2QTBA 1E2PA 4ICIA 5ED4A 3R4CA 3KEMA 2HJ9A 4F3KA 2XI4A 1BW9B 3OEEA 3N59A 1IY2A 4AJNA 5KWIA 3N39C 2WSLA 1XP5A 2HEIA 1HLGA 3C7KA 1P2FA 1Q0RA 2UZ1B 1HBJA 5K8CA 2AN3A 3I05A 4LSGA 1EFRD 2HK7A 2VRWA 1VSBA 4C4ZA 4ER0A 4YJFA 5IEBA 1NU6A 3U17A 5E0OA 4D3SA 3UYLA 4NNJA 1UF9A 1YHNA 3S44A 2GA9A 2GNAA 4RDIA 4M1WA 2G09A 2HJVA 4MVJD 3I4CA 4XB2A 2FWBA 5EJ5A 1JT9A 3HXKA 1NBHA 2DF8A 5JE8A 3BREA 4DBZA 3RVKA 1KBOA 5A2GA 5JI3E 5JJBA 4WD3A 2YVLA 4XGRA 2H18A 1Y3IA 2FGJA 1Y0RA 3IOBA 2JAPA 5DDIP 3ZTYA 1NJSA 3E8MA 1EJ6A 2VAPA 4KK3A 5KYVA 1M73E 3TVDA 4EQ6A 2B20A 2I67A 1VRCA 5L6MB 3SKBA 3AEUA 3T51B 3K0EA 3PI6A 5M7EA 1FUUA 5CLJA 4TLCA 1HDOA 4ZCSA 4HVLA 2GESA 2O19A 1T3GA 1UC8A 2JLAA 4OPSA 2HTFA 2O4UX 3BM5A 3E9YA 3EXAA 3HR8A 4G67A 1W0KA 1M5UA 3GEGA 2PUBA 3F1KA 5ALSA 3AEKB 1YVEI 2OFOA 2VNHA 1U94A 5J59A 4DDVA 2JGDB 1LPBB 3NKLA 1NVKA 3B6IA 3K31A 1L7AA 4Q9DA 4ENQA 5C4IA 3QVWA 5L95A 2AX4A 3I1JA 4HFRA 2WF9A 3UHJA 3VTFA 2WWYA 1TLFA 2UZ0A 4NK4A 4HUQB 5DCYA 3ZY6A 1TVCA 4FDLA 3AI1A 3SR4A 2XCSB 1N6RA 4JR2A 4M9RA 1C2YA 2VPQA 3L5KA 3AL3A 3K0KA 4D9NA 1KYZA 4WW0A 1NJ8A 4E94A 1ZO8A 2G07A 1EFPA 3P94A 1WSWA 2ASVA 2V8OA 1PS9A 4CL8A 2XUPA 4PE5B 5DTJA 5LZ5A 1E9VA 3MT0A 4H1VA 3WI7A 4ECEA 2VPTA 4PAQA 2PGDA 5F4MA 2WHEA 2HDHA 3FZGA 2ZYTX 1PVOA 4TRNA 1XLVA 4LE0A 1ZCZA 3NGXA 2QYTA 3HYRA 4EYEA 3EIXA 4WXHA 3ADDA 1JJ2B 1RRFA 2GO7A 4IG9A 1WVIA 1YBHA 1L8LA 2FPGA 2VBIA 1DHTA 1Z3IX 1BS1A 4KLAA 3LPCA 2X0DA 5EQDA 4P3XA 4QOEA 5DHUA 1JRLA 2PRZA 4C7BA 2IOFK 2RH4A 4HEHA 3IIIA 4DUYB 1BXGA 5C81A 4PFKA 4JFAA 4OHWA 5DP2A 4WZAE 3S55A 5CAEA 5KU7A 2CW5A 3AHFA 6LDHA 4P5EA 1D07A 3HFJA 2PGNA 2FZ5A 1XU7A 1YHZA 2GI4A 2O2GA 2JHFA 4OL0A 1DSSG 5A9SA 2TMGA 5MGNA 3HU5A 1EXVA 3FM9A 3EGWA 4JROA 3SJCA 1G20E 1SQ6A 2XSZD 1X7WB 3O84A 3SBEA 3TR0A 3UKDA 1D9XA 4URHA 5KVAA 1LVUA 3GJ6A 4WESB 4E21A 2GF9A 3ZK7A 3ZLJA 4HPJB 4Y2JA 3QKSB 3ZCSA 1NV9A 3WWEA 1U3GA 3CVVA 4HNVA 2WY2D 4PWYA 4LOKA 3I92A 3SIPA 2DLCX 2JLQA 3TRIA 4UBMA 4DJTA 4AS1A 1LBEA 1N6OA 4RABA 2CXHA 3HH8A 4NCXA 5F3DA 2Q5CA 3M4ZA 3P4UA 4YREA 2QV7A 5C46F 3LO5A 2FEPA 1ULUA 3JVUA 1YB2A 4BMPB 1P8JA 4ARIA 2AFHE 5DNAA 3VTAA 1QK4A 2AG8A 1T6BY 1NQOA 4PXYA 4TV9B 1ISPA 1I2ZA 1M2FA 2WF5A 3AR7A 4FOTA 4KLCA 4Y6LA 3FWNA 4DZTA 3EMDA 4G24A 4XVCA 2VYQA 3CR3C 5IDVA 4II3A 1A9QA 3HFRA 2IZ1A 5CYFA 3KPJA 1M8GA 1VJCA 3NX4A 5A6SA 1A8IA 1JVBA 2P9QA 3LWZA 2HY7A 1OBHA 1SCIA 3L79A 4CEHB 2FETA 4MCJA 1IB0A 4EB8A 4AXBA 4MQFA 1QS0A 1GG8A 3IRUA 221PA 3MINA 3CLUD 1G20B 3DYIA 1QVFB 2DHDA 1WB5A 2H2GA 1HXHA 2X9QA 3FIJA 3INTA 3JAWA 4IDNA 3S1AB 1CQXA 5J43A 3A4NA 4PV7A 4B82A 3FTCA 5B6JA 1KSJA 2HCTA 1GAQA 1P9LA 2RB5A 2GJPA 1SU7A 2JHCA 3U81A 2A9PA 3OE7A 2UVQA 1C0LA 1BWRA 3KPVA 3BVPA 1IM8A 1OPRA 2IYRA 1L4UA 5JDCA 5C5CA 1NTOA 4YMVA 4RNCA 1SXJE 2AFRA 3OE4A 5B3LA 4G2NA 1RLOA 5F7ZA 3UK0A 3STVA 2QE7A 1V7QA 2B83A 2F62A 1Z82A 4L75A 4EO9A 2AI1A 3UKOA 2D3TA 1RJDA 1OLOA 2O20A 5BSMA 1SGWA 1W34A 3OTGA 3STHA 1O77A 2FEWB 4WBXC 1D4OA 5CB6A 1NSTA 2Z2XA 3CGWA 3KZVA 4MW1A 3Q8MA 4XM2A 3PFBA 5IKPA 4OXIA 2O6LA 2QN3A 2WJIA 1Y98A 2HF9A 2HPVA 2IFTA 3DONA 3BIOA 4GD3Q 5EERA 3TRHA 5HSGA 5KYUB 3LQRA 2Q62A 3RT7A 3GJ8A 1HY3A 1LGYA 3DDNA 2VRBA 4G86A 4XVQA 4HPWA 1X77A 2R6R1 4RLSA 1E9CA 3N2GB 1GPJA 3QLUC 3ORFA 3T7EA 1N2ZA 4U6SA 2OZPA 3FPCA 1T8YA 3H5WA 5F5LA 2XNDD 2WIJA 3Q7QA 1YB4A 1LEHA 3OPXA 4GM0A 1QGYA 1R7RA 2R8OA 2C8LA 2MOKA 3GGOA 3K15A 1ZM4A 1Q2XA 1C7ZA 1EGVB 2GYYA 1AKQA 2RGDA 4QFDA 3VR5H 2ZZNA 2XQFA 2P3MA 2BM1A 1GFWA 2G9UA 3I8XA 4QWMA 2ZYGA 3GPBA 4X0EA 1K73D 1BE0A 3CJTA 2X7JA 4WLEA 4XJTA 1KQSB 2J9FB 3OQJA 2GXAA 2BFCB 3ER6A 1E1RA 1E5VA 1ZGGA 1Z75A 4GH5A 1LFAA 1N3YA 3EZYA 4K87A 3EZFA 3D1JA 2FNAA 2QMQA 4C22A 5ITSA 1OWLA 4V38A 2REQA 4B6JA 4UUAA 3MSCA 4JSYA 4MKFA 2BY4A 3F6EX 1KO5A 3BY1A 4Y9SA 1WCIB 4A8JB 4E31A 1VA4A 3L01A 2VHYA 3ED1A 3VVCA 5F3WB 1Y7TA 2JK1A 2PXCA 2FVYA 1BWQA 2W70A 1EXDA 2WUWE 3DMFA 1OX6A 1CZOA 3ND9A 5FHRA 4WVFA 4N3BA 5TVGA 1UMCA 3WJAA 1SXHA 3WG9A 1H6CA 1IG0A 2D4AA 5EQFA 1EI9A 1UIMA 1TCCA 3VPHA 3FOEC 3H2YA 4CT0A 5LZ4A 1RPAA 2VJPA 3WYDA 3H2IA 1OU4A 4KFSA 3U4CA 4CLRB 3OBBA 2QW0X 3QHPA 1NNUA 4MINA 3WO0A 3ELDA 3T5PA 2QTWB 2OBFA 1FF9A 4D0SA 4L9SA 2VJYA 3UC9A 1ZCAA 1TW3A 1UZUA 1E1LA 2EV9A 2IOFA 4UUNA 1H42A 1GADO 4W1RA 4RD4A 3KJFA 3S5UA 1T1RA 4KVFA 1J2TA 2IEYA 1YT5A 4TWAA 1B0AA 3WLQA 1YZNA 5JCPA 3MOGA 4LYYA 4M1YA 4REQA 4G97A 2WR8A 4M9SA 3IVRA 4BRUA 5AKYA 5IC4A 2FPPB 2YYZA 3Q5GA 4OUDA 5JPDA 4HTFB 4QE3A 1L4BA 1P4RA 4YRAA 3LK7A 2H17A 2C5LA 1X1QA 1A4IA 3CURA 3MWJA 2JGFA 4GMHA 4S04A 5MDHA 1JLSA 3OFKA 4B71A 4NSNA 4WBNA 2NO6A 2PGJA 3SEQA 2XPCA 3EXEA 5IAAA 1IY1A 4D0NA 4WZAB 1RQLA 1H93A 4TT3D 3ZWPA 1JSRA 1K5DA 4D6YA 2B4QA 4RETA 1L5GB 4KR6A 1L2TA 1NBWB 1V0EA 3O8CA 3EVTA 2WHXA 2W48A 1KAOA 2JFQA 5EJAA 3ISJA 5EXDA 4DMKA 2BDUA 4EJ2A 2JH9A 3QHAA 3S4YA 2XT0A 1K7FB 3DR5A 4ITUA 4CMHA 1SQFA 5J4KA 2Y4OA 1C4KA 4EM6A 3EQ2A 1CUJA 2FI1A 4ZC8A 3T35A 4ZMRA 4AP6A 4CN9A 1Q50A 4G26A 3PUWA 1LD3A 1W4ZA 1W19A 3L7CA 2KMLA 4DNOA 2QZ4A 2Y2UA 3NTUA 3UV7A 2AMVA 3JVIA 1X8XA 4XWTA 1LLUA 5HKKA 1NF9A 3BJMA 3C15C 4TQUS 3URMA 3J7TA 1ZXBA 1VE1A 3O90A 2BEUB 1U7WA 1Z6GA 3D6JA 2WVJA 4C07A 4V1CB 1D2NA 2Z3VA 1D0IA 1VPWA 1ZLXA 3T41A 3GRPA 5A3JA 1MLDA 5H68A 4Z3DA 3FMVA 3QKTA 4DYHA 1MQ8B 1MJGA 4GG1A 2Z0MA 4EI9A 1YRQA 5CJJA 3C5HA 1KKUA 3OE1A 2X40A 4B45A 1ZGAA 2YBEA 3QPDA 2J46A 1IBLB 2RGGA 3RS3A 4TUYB 4CLXA 2KHZA 2NO4A 2P2YA 4MCHA 4N5LA 2K4MA 4RHCA 5TEVA 1C2TA 1EJ0A 2IYFA 2IYAA 1Y80A 3BJRA 4IH9A 4NG5A 4PX3A 4RH0A 1XCMA 3QBJA 4Z54A 5C8DA 2M1ZA 2PK3A 3BCFA 1E6UA 3C6YA 1NQWA 3PGVA 1JVNA 5DOVA 4W1QA 3OA2A 4C0SA 3WL3A 4BNZA 3PDIA 4DV2B 4Z4QA 4DB2A 4CL2A 1Y7HA 2C2KA 2NYUA 3DAHA 2GFHA 4L0QA 3DM9B 4GICA 1OBVA 2BM0A 2I2XB 2XQJA 4MLZA 4OQMA 4X91A 4CNQA 2ORYA 1MA3A 3HKCB 4N39A 4QDZA 4ENPA 3AKEA 3G6KA 3ZBTA 1UZAA 4M21A 1UFVA 5IKOA 1JZTA 1K7EB 2HIGA 3NOQA 4G4IA 1L7MA 2H0AA 5ALRA 1NSFA 1IVYA 1NXSA 4ARUA 4G5FA 2JJ1D 1VHQA 2I3AA 2BKAA 4RYDA 3D3WA 2BGUA 4OB6A 1QX3A 2Q28A 2BFPA 1RMTA 2Z5FA 3PKJA 2XNHA 3LT0A 1B0ZA 5AKXA 1R4NA 1NLUA 3VJKA 3A1EA 4D44A 5DLQC 2EJUA 1Q83A 1GQYA 1RJFA 2BBOA 2IYUA 4LWOA 4EKIA 2OCAA 1EWRA 1WXWA 3JALA 5IZCC 2PXHA 3WLOA 3L7KA 3IT0A 1T4CB 4JEIA 3QV2A 4H1TA 5HCIA 4W4TA 1M7GA 1PSZA 2PCLA 2Q5EA 2GTIA 3JX9A 3U80A 3KOOA 1UD3A 2EX4A 3LX5A 4F85A 4MS1B 2YRFA 3I32A 3IIKA 5TGDA 1T10A 1ZVJA 2LE0A 2ERYA 3SSNA 3WZMA 3I34X 4MQ4A 3OW2B 1RC1A 4JI4B 1DBVO 5AJUA 3EG9B 1JSCA 4WEOA 2O8CA 3CG0A 1R3DA 3GMIA 2H5IA 4KUGA 5KQPA 3CHYA 2IDKA 2ZYHA 2H85A 2RHTA 4ZN6A 1WMAA 4IXMA 1L5HB 4WL0A 4IIJF 3DUWA 2Y1LA 4NJMB 4TSKA 3STYA 1NUSA 4LRSB 3N05A 3H5AA 1JR3D 2C42A 1G5QA 1CS0A 3L0DA 4RJ2A 1GL9B 3JQQA 4TT3A 3BCDA 1NRJB 1WBJB 4MR8A 4KWIA 4E5UA 1U7HA 1OT3A 4CLRA 1OA0A 1GPNA 5ENVA 1D4AA 4CGZA 3HYLA 5DKFA 3Q7TA 1OGJA 3MWYW 5JJLA 1KYVA 3GN2A 4Q3OA 4GYKA 2HA4A 3WB0A 2DEUA 1SCUB 3OO0A 2YN0A 4R9VA 2XKKA 2WU8A 1YR9A 3GD7A 3HKDA 3OCYA 4FFRA 3QI7A 4R7GA 4BB0A 2RKWA 4GR4A 5JJKA 5IXSA 3M6MD 4FB4A 2DSTA 2VDLB 3GDGA 3TFWA 3BQ9A 3BFPA 1QP7A 1U2QA 1C29B 3D6FA 4PYMA 1SUFA 1G4HA 4HGPA 2Y05A 4KTVE 3ONEA 1CZLA 2BEWB 1E3XA 3ME5A 3NJ8A 1Z26A 3FWYA 3VNSA 5BWMA 1TU0A 1CZHA 4IH1A 3C3BA 3I8OA 3RYIA 3TRKA 4DB4A 4EOGA 3MMNA 3LF2A 2W6MA 4WCFC 2Z83A 4F5ZA 4S24A 4KIWA 1QV6A 1WABA 4H6XA 2V9CA 2OY0A 4IDBA 1XMPA 1HE2A 4OI1A 1RXSA 4MV1A 2PUVA 4NBUA 5BMVB 1OI3A 1A96A 1F0NA 3GNTA 5IKEA 2GBCA 3KJEA 2FB9A 3N8DA 4PICA 2DQZA 3HDVA 3KVOA 4Z3OA 3OTIA 2HQRA 2EXXA 2DFTA 4QBIA 1T5OA 2F64A 3DEHA 3BMQA 1RRGA 1V25A 3O2JA 5EZYF 3IQGX 4H1WA 2WTXA 2RB4A 4QTXA 1UD8A 2BEKA 4IEIA 1T1SA 2I1WA 2QR2A 4RZ2A 3U39A 2HM7A 4M22A 4NJOA 5BQ3A 4LBWA 1QHNA 1GU1A 1IK6A 1GUBA 1P31A 1RXYA 1T2NA 1Q1ZA 1TTQB 4K9MA 2BEVB 1KH3A 2ZKIA 3R76A 3EMBA 3HWSA 4FQ8A 1P6UA 4Q3CA 1RAAA 3JD0A 3KOUA 4QOGA 1TEHA 1K6IA 3SJBA 4G0WA 4C0AC 1VQNB 2GT1A 1F12A 2IVZA 4H6PA 4PGAA 5L40A 3AGPA 3S70A 2B2NA 3WGZA 4UEQA 5BWNA 1QFMA 1T5DX 4UZFA 1UMDB 4HLDA 1Y1SA 3H2GA 4NG4A 4Y2UA 4XASA 4XYBA 2ZZEA 2XZLA 1NVUQ 3T5TA 3VYWA 1C3VA 1QOQB 3E7PA 4E5YA 2W11A 1PI3A 1TF5A 1FYXA 1XE3A 2AQHA 2HXYA 1CUCA 4M4SA 4M89A 2PUGA 2FUEA 4KIGA 1AU9A 1RJEA 3L07A 1UK7A 5EKTA 2W8ZA 2WFZA 3CNEA 4DG5A 5A5EA 1HORA 1Z22A 5C18A 5A5FA 4CEIB 3DZHA 3IQWA 4HZGA 4QPNA 3A4YA 2H63A 1E62A 3W2HA 2OVBA 4IJWA 4FE3A 1RQRA 1KSGA 1RCFA 2YS6A 5FTKA 1T9ZA 2W2XA 2B0CA 3F97A 1GNPA 4FIZA 4J3JA 4YMLA 1UFKA 1XTSA 1DQZA 3T1NA 5LDGA 1F2TB 1H1LA 1HTBA 2EQ5A 2HFJA 2WU1A 1M8FA 2G8LA 4RJTA 1GILA 5J2TA 3I2HA 3OESA 3V4LA 3ZV4A 1RRKA 4NS4A 1UJBA 4GP7A 4JEUA 2WNSA 3SF8B 1CTQA 4LDQA 1AVTA 1UM9A 4QQFA 2FFQA 2H7CA 3N86A 4E2YA 5DNWA 1OF1A 1P91A 1ZWLA 1YZHA 5I7SA 5IHPA 5A3RA 4WFIA 4BLWA 1T4CA 3SEAA 2OLKA 5CDUA 1BXRB 3ND5A 1N9KA 2C1EA 4N03A 2QLTA 1W0KD 2IW1A 4UEWA 4WN9B 3AINA 4EHKA 3ZZ1A 1XHFA 2YYSA 4MGYR 4Q6BA 4RVOA 2XUFA 2CSXA 4K05A 3A27A 1TVKA 3PE4A 2RHBA 2ZE8A 4FT2A 4ZCPA 4ILEA 3TD9A 3K70C 3HM2A 2R4QA 1JTEA 3ADBA 3DL0A 1VKOA 2ZJZA 1P0CA 2FVXA 1OPXA 2I3BA 1YJ9B 3OCCA 1JHPA 4OH7A 4U2CA 3UGQA 2ZXHA 3GZJA 1Q15A 4QM7A 2FFRA 4OHYA 4XE5A 2JD2A 3BWMA 5BSWA 1L6RA 2WSYB 3M4JA 3T6KA 2FUCA 4CG1A 2MWMA 4MJ3A 3RVMA 3ZZMA 1U2DC 5HRCA 1MC5A 3QEBZ 3LX4A 2AR7A 5K4HA 3K1AB 1AH2A 1JKJB 1W1IA 1JDJA 4QPCA 3ZG6A 3FCEA 4RIGA 2XZOA 2IPLA 1HPLA 3KWLA 4L8FA 4HQ0A 1F48A 3Q3JB 4ZQHA 3HM9A 2ODNA 4X8MA 1WMEA 2XX3A 1E8MA 2A9JA 2X8BA 1GV0A 4FX2A 4C08A 1N36B 3QXSA 3EOAI 1R6UA 4F06A 3IALA 1NJGA 3COVA 3KL4A 1TLLA 3IEIA 4KI7A 1VF7A 4IVRA 1GPBA 2FPPA 3SZLA 3ETLA 3T7TA 4BJ1A 3OZWA 2X8LA 4CM9A 3CXCB 2I0FA 1J2YA 3IH5A 4JWKA 2FPWA 4ZOEA 5HS6A 3NTQA 5D85A 5K3BA 5DM60 3WA7A 4ZTZB 4OLAA 3NM6B 4CV1A 5LYJB 1KO4A 2FG7C 2GZRA 3I9NA 5CT9A 4TKOB 1VLYA 2EP5A 1VM6A 3PA6A 4J7XA 2E3JA 1C81A 3WOHA 5DRTA 2XB9A 3DP9A 2LUOA 1HA3A 3FRHA 4YRJA 1R4MA 1ZJ4A 3J7AC 4AX8A 5KQMA 4PLTA 4ZHQA 1FK8A 3B8HA 1NBOA 4XEUA 3CZMA 1NFRA 2FPSA 4XLZA 2DUMA 3L4BA 1DDOA 3NFYA 4LPSA 4Q24A 1N2SA 3PV0A 1FC0A 2CXUA 3ETJA 2JIDA 3IPCA 1DKPA 1YF3A 2X3YA 3VOTA 4YY3B 1GPAA 1SXGA 2OZLB 1RQ2A 2GM5A 2LP4Y 3K71B 2JLCA 1PZMA 1VXRA 4YFYA 1NJ5A 3L7YA 3I1FA 1XAIA 3DVQX 4XYGA 3A1DA 4JV5B 3LYAA 3AETA