2V7WA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with 5'-fluorodeoxyadenosin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
molecule tags Transferase
source organism Streptomyces cattleya
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
total genus 77
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7wA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7wA01
2CBXA 2CW5A 2F4NA 5FIUA 2V7XA 2V7TA 2Q6KA 2WR8A 2ZBVA 1RQPA 5LMZA 1WU8A 2Q6IA 2Q6LA 5B6IA 2Q6OA 2V7VA 1RQRA 2C2WA 2C4UA 2CC2A 2C5HA 2C5BA 2C4TA 2ZBUA 2V7UA 4CQJA 2V7WA
chains in the Genus database with same CATH superfamily
1XDDA 5FJIA 2E1RA 3B9PA 1KS2A 4CQLB 1JQJC 4X7CA 4YONB 1QDLB 1VQ1A 1R0CA 2CVZA 3QOXA 4Q9DA 2X42A 5C32A 2RAVA 3HY4A 4EIWA 1XNQB 1SKUA 1QG2A 4RYDA 1PWYE 2ZATA 5DCLA 1O6FA 2Y0EA 1OV6A 1EX7A 4L73A 5JEEA 3AUJB 5T6MA 4EELA 2FR1A 1L8XA 5HJEA 1P33A 2IHVA 1FNNA 2H9IA 3DLBA 1X74A 1DKRA 3CTMA 2X2PA 4Z7NB 4EJ6A 5ES4B 3CW8X 2FZ4A 1TMOA 3NHYA 4OU5A 3B85A 2ZB7A 2YFKA 4NS1A 1LK5A 2ATEA 1NQTA 3FFWA 3FG9A 4S35A 1R16A 3LUBA 3FHOA 3O8DA 3NAQA 1E2DA 4HB3A 3GCZA 1VQLB 1YRAA 1L4EA 1C8BA 4KV9A 3IPAA 3IUNA 4LC9A 3JYLA 4RVHA 5K0LA 1U0LA 3BD9A 3RRXA 4ED9A 1E96A 1TGVA 3GP3A 1VIMA 1MRSA 1MXHA 1Y4DE 2YMMA 5EAIA 2G28A 1XTZA 1U28A 2N46A 4BMZA 2QQGA 4BGDA 2ZQZA 5K0JA 4Q47A 2GD6A 3E9CA 4EOGA 3BE6A 4G97A 5E4JA 2GASA 3CRZA 5J40A 5HGXA 1EE9A 1JHUA 1WB6A 2YVAA 1VMKA 4V0QA 2HIGA 2INGX 2XQIA 4AW9A 3B1XA 4G25A 3TSZA 1NMYA 3NHLA 3HS3A 1SOMA 2WIDA 2PTHA 1IL0A 1O8CA 1YULA 1Z3CA 2R1VB 3MWFA 4UAVA 5LZ7A 4C6TA 1YTLA 3KQNA 1FX0B 2BFAA 4XORA 1UBMS 2PSEA 3D2LA 4JJ7A 4KH0A 4RK5A 4W5QA 3NHSA 4YQZA 1YJ8A 4GPAA 4J0JA 3DONA 5CX1A 5LSAA 4HV4A 1P4SA 1DIOB 3SWWA 5KVSA 4ZMSA 4MW1A 4Z4EA 3RCBA 3K8OE 2ZYTX 1HNZB 2GJPA 2VHZA 3K0AB 1OOEA 2QRGA 2X41A 2K2WA 3PF8A 4IQ0A 1GNVA 1D0IA 1ZRHA 1HDCA 2P4HX 3EISA 4R84A 4WWVA 1TTTA 4L85A 2V3CC 5DSZA 1M6VB 1DQYA 2H1WA 4MQFA 5DHUA 5ALSA 4F72A 3W2IA 3GGPA 1JIXA 1K7EB 4QO8A 2AJ8A 2O8DB 4HAXA 4QXMA 2CYCA 2V9CA 4YMWA 2A9OA 4NMXB 1R0WA 2JCBA 3A9CA 4MVJF 1T9GS 4ZRMA 1Q22A 4BNMA 6GPBA 3OIFA 3UT5B 4EK9A 2H92A 2HQ1A 5KVCA 5LUAA 5AKZA 3N0WA 3U4AA 1WABA 1MHPA 3X0DA 4WFKA 1CVRA 3GCXA 1X13A 2BBOA 4IQ8A 4XCXA 3GLIB 4CEIB 1NC1A 3WY9A 2DPYA 3EZ9A 3HJAA 4QUGA 3BIWA 4TVOA 3FFBA 4OGGA 3T34A 2JGJA 4RFVA 2IPAB 4G6IA 3FHCB 3R7NA 5G0TA 2H07A 2H4WA 2RBGA 2UYGA 3KSUA 4FGUA 1N3LA 1T9GR 5CDUA 2HC9A 3OU2A 2ZL7A 3OMLA 2X7HA 2NO7A 3G82C 1WD7A 4HN9A 1N78A 3UMYA 2KWIA 4MVJM 4PLGA 4HLQB 3R44A 4DNPA 1L7MA 1RTTA 2QB5A 4C2TA 4N7JA 5KCMA 2ODQA 4PC2A 2PPVA 4KLRA 5FPTA 1ZSNA 3I56B 1QH8B 3DO6A 5ICFA 3PNLA 3VR4A 4DA7A 1JMYA 2GBIA 3K0AA 4XQCA 3RT9A 4OHRA 1GCIA 4L7VA 4Y9DA 4M0MA 3EQ7A 2KHZA 5LN1A 5CA1F 3OZFA 1V7QA 4G9GA 4XR4A 2AA3A 3F1LA 1ADJA 3O8CA 3AOEA 4AWAA 4TYYA 2PEYA 2Y76A 2G82A 2Q6IA 3CH7A 1G17A 1OXVA 1JF8A 3UT0A 2WP0A 2MYNA 3OECA 1G7RA 1TIBA 2WHXA 1QCCA 3EY9A 1JMKC 4GE3A 4W8OA 2VBSA 3KV1A 4Q3CA 1W0CA 4P08A 4C5BA 5BR1A 1KIFA 2YXBA 1A1VA 2BUBA 1BSVA 1I6LA 3E3AA 2ZANA 3G0BA 3GJ8A 4RPJA 5CB8A 2ILVA 1KETA 3LC2O 1J1IA 2DOKA 2QPOA 4FLEA 2PPLA 3CZ9A 2Z5GA 1L4NA 3EVNA 2GEUA 4UBNA 4ECAA 3HA5A 1KDPA 5EIHA 2DWUA 1EYZA 1L7QA 1SXPA 2W37A 1L2TA 3IV6A 3HB1A 1OB2A 4XSVA 3PL1A 1B23P 4D4MA 2XMDA 1X1DA 1Y48E 1MV8A 2D5IA 3IOCA 2YIDA 2FB9A 3V4SA 4MAMA 4TRRA 1DBWA 1QQBA 2XMQA 4PCUA 1L5KA 3IPYA 5GP1A 5JECA 2Y0PA 1NA5A 1G18A 2XX3A 4YRDA 5FF9A 3RUEA 3ZEIA 3IXMA 5KYGA 1K5PA 2PO5A 4G2TA 4R7GA 4RABA 2HJHA 4FYKA 1T1JA 4LAFA 2I2XB 5FH9A 3WK4A 2O0JA 3GLVA 5DGHA 1V6AA 4JKYA 4MRVA 4D9KA 1WKCA 2WILA 4B85A 3LOQA 3HJUA 2GJRA 3WV4A 1OYWA 4FEAA 3S0JA 1MVOA 1VPVA 2COKA 4CODB 2UYOA 3FDZB 2XCSB 4KR6A 2HH9A 13PKA 1V9SA 1B93A 3FA2A 4YAFA 3MUOA 3PUZA 1PVDA 1E2KA 3AB8A 2XKAA 1ZUNA 4L4SA 1RPNA 1X1BA 4XA8A 4C0LA 4EW1A 4B3SB 4RH0A 2NU9B 1MRZA 1FP4A 2XVXA 5E3HA 1XCGB 1ODFA 2BHSA 3B48A 3LI2A 3QEMB 1TQHA 2VWQA 3CLHA 4KQ1A 4X6YA 3UTCA 2PUBA 2ORYA 3L8MA 3SX4A 3K9FC 3UW1A 1FLNA 4QGGA 4RNDB 3WWOA 1DAHA 1KMQA 1GLNA 2GCEA 3RAJA 721PA 3KR0A 2QUZA 4LV6A 1XC7A 4YUXA 2OO5A 4GL4A 1JLMA 3ZU5A 2QVBA 1EP2B 4JY7A 1WUHS 5IDWA 1KK3A 2BFDB 3I9JA 1OWLA 4YRZA 5SZKB 2XUHA 1D09A 4A6EA 2BW0A 4EJSB 1WV1A 4FE4A 5FWNA 4TKUB 2XD4A 2IOFA 3V1NA 1SRRA 3EXHA 4Q03A 2G7ZA 3CQ9A 1EK6A 1NW9B 2ZIGA 1YRLA 4B82A 5HZKA 1D2GA 4PZ0A 5E9AA 1AHPA 1Z5GA 3IQFA 1QO0D 3ZWAA 3EZ6A 5JMWA 1C9JA 1TU3A 4L3OA 1LKZA 1X80A 1CEQA 3OT5A 1B8OA 3BYZA 3HBNA 4Q4HA 2GZRA 2NVOA 3D7LA 2BHNA 2R84A 2A6PA 3PUXA 3S29A 2P4QA 3MOIA 1PGOA 5COQA 3X1WA 4WZLA 1BDJA 2VBVA 3OP1A 2CCJA 1H22A 2Z95A 2VDQB 3C8ZA 3CRW1 2OQ2A 3FWNA 3OZTA 1FUUA 1MFZA 1N2HA 3H86A 1V0JA 3KFVA 4GM0A 4PW0A 5DLQC 1ZSVA 3H16A 3LX4A 1Q82D 4U2GA 4ER7A 4E3ZA 1K98A 1SOUA 3QM1A 4AJ1A 2HRCA 1GKYA 4YJDA 5G53C 1JA1A 4GVLA 1QO7A 3L6CA 4KR3A 4ZV9A 3MOSA 4FFLA 4UBJA 3T4XA 4BGVA 5K0TA 1GUAA 1NN3A 2D2VA 4V0KA 3GCDA 1DMRA 3QXJA 4RDKA 5G41A 2GFHA 3ABZA 3BAZA 2MIIA 2YFQA 5IX8A 3GFPA 1RHRA 3JAMA 2ZP1A 1H0SA 1Z6GA 2VFAA 2E4VA 3GRFA 3H6KA 1EWRA 1X1EA 2PLFA 5E38A 2FG5A 2EWWA 5DCYA 3EBOA 1QZZA 3C5VA 4ZOCA 3ZHQA 4B4KA 2I6SA 2XNCA 1U3WA 5I45A 2O3RA 1JB9A 4DV1B 3JYHA 1MOQA 1SC6A 3LMKA 3ZXYA 2BGLA 3NC4A 3P96A 1F17A 4PNEA 4LRXA 4GMFA 1XRMA 4Z1OA 5IYQA 1X3SA 4KOEC 3OLWA 2O23A 2UZIR 5EZ5A 4IS2A 4WOPA 2O48X 4J6EA 4QLBA 3WLEA 3G5AA 4HS4A 5EMMA 3B89A 4MWDA 1EUQA 3IAS6 4UZSA 5AW0A 3N76A 4NZPA 1L3BA 4KBFA 1FS5A 2OXEA 3OZDA 1E3MA 1ECJA 1D0SA 4CLHA 1FW6A 2C1ZA 4MPPA 1BDHA 1JQ3A 2BC9A 3MT0A 1QHFA 2FZWA 3ISJA 5I4IA 1W4RA 3DEZA 5JVDA 3NHMA 3DAGA 1RMQA 1U7DA 4ARZA 3D4IA 1R5JA 5EKXA 3BBPA 3GK3A 4I5EA 1QRDA 2GBGA 2LNDA 1Z36A 2BONA 1JEDA 4QYIA 1ICEA 3IQGX 2C2KA 2CXNA 2J3DA 1EB8A 2GN6A 3QF7A 5LXTF 1J22A 5AKKA 4UCXA 3WYCA 2BZGA 2DBYA 2ISCA 4GYJA 4RORA 1VJ0A 2ZDGA 1T5OA 1K3FA 2H3EA 1YS1X 2AVNA 3B3QA 1NZFA 1OX6A 2GK7A 1XXHB 2C5LA 2MINA 2Y1DA 5FB3A 3IDSA 2LD4A 2CLFB 3JR3A 4JX9A 2FMFA 3QBTA 1DX9A 4KPUB 1XJWA 4MRPA 3TLXA 4P3NA 1R4NB 4G4GA 3CF0A 1EQAA 3IAUA 3KQPA 3PCTA 3PENA 4JP8A 1J09A 1YE5A 2A1UB 2PFGA 3KOXA 3QOWA 3SDZA 5JZMA 1BX0A 2O14A 1GPMA 4B79A 3BK1A 3CBQA 4I1UA 2XYRA 4LJ4A 4UKDA 1FYWA 3A14A 1UADA 1Y9ZA 2OORA 1W9HA 2P7HA 3N2GB 4C4PA 4CL8A 2CNWA 2WF5A 2JVIA 1LV7A 4QOEA 3V6MA 2JFPA 1LSSA 4W1RA 1WMFA 3ZN2A 4YNBA 3NH6A 3OJCA 4WNAB 3RRNA 1L7BA 3CG4A 2EG5A 3MCWA 3F2VA 4AICA 3KSDO 5AVJA 1WORA 1T2NA 1IOWA 5A3QA 1P1BA 3HEAA 5HR5A 4JL8A 4MICA 2CDRA 4BGEA 3FTCA 4CV3A 5A3RA 1HV8A 3PDWA 3SG0A 2Q1YA 4BQRA 4YMVA 1NLFA 4EVSA 4MHTA 3H1GA 2P5YA 1FVFA 1NY5A 2ZRPA 3HFSA 1VCHA 3SS7X 3LL4A 4WCFA 1HVXA 3H1EA 3R9XA 4JELA 3E8MA 4LTMA 5KTMA 4R2HA 1XCPA 2ZJ1A 4OL0A 2VPPA 3N2KB 3O1IC 3NOXA 3VDNB 2OCLA 5IYZB 1RHKA 4G0XA 2YS7A 3KJEA 5TQ2B 1O2DA 3ZY5A 3CEAA 1PSZA 1XZFA 2DH5A 2VXBA 2QX6A 2AR7A 2Z2XA 1WPRA 3DV2A 3FYSA 1V47A 3HPRA 3P4YA 4NNOA 3RHFA 3FHJA 3DR5A 1JIJA 4FFMA 1UAGA 4PGOA 1HR0B 1GPDG 3WHPA 4CCYA 5FHQA 4E46A 3L7KA 4URVR 1PVOA 5CUQA 4PYOA 4C4XA 3CCSB 3GLKA 2IUSA 1L5HA 4WN9B 1DJMA 2V1XA 2X85A 3EIOA 4WFIA 5EJMA 5DM2A 5HS4A 2OCXA 3TBFA 2P9YA 4E0BA 2P0YA 2EFDB 3N0VA 3HA3A 1GG8A 3QNUA 3SXJA 4PAAA 4BZPA 1LZKA 2HL6A 3NM5A 3WOVA 4B8WA 2D3LA 5AK5A 1F14A 1ONSA 1L4BA 4RY2A 4ZREA 3CD6B 3WIEA 5JATA 4IDDA 4OI0A 1ESZA 3HKCB 1P4MA 2V6BA 1LDMA 3QJGA 5I7WA 5C8YA 4PBSA 5ECGC 2WWGA 3IURA 2WMNB 1L4FA 1XAGA 1ZOPA 1H6AA 1ZD8A 3FZNA 2GAOA 1ZX1A 2RGWA 3W1WA 4KXVA 3AVVA 3OE7D 2QR3A 1ENOA 3C3MA 2XSZA 2PVSA 4JVOA 3KHKA 4HGYA 1U80A 1ZGJA 1M6WA 2HLHA 5INTA 1VIAA 4Q9KA 3R76A 2YY7A 3AESB 2RC6A 4J0DA 1Z5NA 1X92A 1B6RA 4BCBA 3WYBA 4S1TA 4L15A 1KJYA 1SD2A 1XRQA 3GX1A 4CMJA 5CD9A 2PUGA 3FTFA 5HJ5A 1N8TA 4H0CA 2X9VA 2G04A 3A9UA 1ZXBA 3TQSA 1TA4A 5M5BA 1ETUA 3F5FA 4BGIA 1IEWA 5HRAA 2AN5A 5I4KA 5MN5A 3M6UA 5A89A 3OM9A 3ZZMA 5J35A 1AMOA 2OTLB 1KFKB 1XTJA 3B8EA 2QE7A 1D2HA 2WPNA 4PX9A 5HK8A 3RK0A 2JI7A 1AZLA 4HFRA 4RF2A 4CDGA 2NZJA 1H6BA 1SUEA 1Z4JA 3R77A 1J90A 4K0RA 3P5SA 1Q16A 1ZGBA 4RMIA 4BFCA 4JR2A 3M2TA 2B3TA 2GKOA 3A2MA 4ALJA 3PXAA 1WW2A 2QRJA 3H2YA 4WJZA 3HFJA 3UJCA 4DAOA 5IDQA 5KNBA 5CCBA 2HGSA 1ZESA 2CFTA 3C39A 5KYUA 4M4SA 3RTEA 2F62A 4H1TA 1XKQA 2QJFA 4MW0A 3LPDA 5FOVA 5BN3A 1DT5A 2CDCA 2A9FA 1HQDA 1GQQA 5FL7D 3ZQKA 4BLRA 1JQAA 3WSTA 2C98A 3TW4A 3VO9A 4YROA 1P77A 3ZZ1A 1AA9A 2JFZA 3AEXA 3PDUA 1EI9A 1U2DC 1SZDA 4NCJA 1KBQA 3I52A 3ROKA 3VC2A 4RAOA 1CZRA 3MQ2A 1OFGA 3OCJA 4Q4AA 5AWFC 4E94A 2OXRA 4EI7A 5IJ0B 5HBRA 3ZKAA 1DQSA 1SEVA 3G89A 3OLXA 4FQ8A 2QV0A 1RHMA 4E09A 3RYTC 4I4NA 3V7WA 2J6IA 2PD6A 3UOWA 1SULA 1DV2A 1J07A 2SKCA 2QQ0A 1UF9A 2XUPA 3NNDA 3NCHA 1WDMA 5BW6B 2ON6A 5CA0B 3CP8A 4PQRA 1FYEA 4UARA 3MT7A 4FI3C 3HM9A 3THYB 2NPFA 2IDZA 4I3FA 1HORA 2VJKA 3S28A 3ZU6A 4EENA 3ER9A 3A3PA 3E2PA 3EA0A 3PPYA 1X7ZA 4RD3A 3WSWA 2WU3A 2RBEA 1Q15A 2W2LA 3ZBUA 1Z4PX 3DCIA 4I5IA 4M0DA 5BWBA 1A96A 3VX4A 1EQUA 2H2FA 2DSTA 1MB3A 4RK1A 4Q18A 3IA7A 4XB6B 4CLOB 2QA4B 3CSUA 3BQMB 1GNRA 4C2UA 4MVWA 1XE1A 1RI4A 2VHUA 1VJ5A 4OJYA 1YHYA 4H7EA 2VP9A 4IBOA 5FKJA 3U61B 4XD7D 3K7EA 3RT7A 4LNAA 3N8HA 2A9RA 5A9SA 4NBKA 3PGVA 3OG9A 4EYQA 1C0PA 5P8WA 1HT1E 1RMTA 4OJTA 2GZ1A 3WGVA 3Q1LA 5JQGF 2VHJA 4DCOA 2OO3A 4HYTA 1T5TA 1WQ3A 5FOSA 3CNEA 1LD3A 3V2IA 1SB9A 3ZU3A 1U28C 1CHDA 1Y33E 3NAMA 4I9FA 4J3JA 2IU6A 4KGXA 4TLDA 1SG0A 1UBUS 2CJWB 2Y93A 2C03A 4FUQA 1BWPA 2JIMA 2MU1A 3RSSA 1M34E 4MDEA 4CUKA 1A95A 4BEVA 1IN8A 4XPZA 1GTG1 3HKCA 3OCXA 1Z82A 4LY9A 3NVKI 5TMEA 1N6PA 1SOVA 2ORVA 2Z9DA 1FMFA 1FMJA 2C7VA 3IO3A 2DAPA 5E3IA 4N3CA 1P29A 2JFNA 3AR4A 1Z25A 2WYRA 2FLVA 4MXDA 3EARA 1L6RA 2CLLB 3OPXA 4PEVA 1MO3A 2J9GA 1V9CA 3R1IA 2QVGA 4BJ5A 1GN8A 1I1NA 4KK4A 2FE1A 3QG5A 2F3TA 4C05A 2FE4A 2RIPA 3KZOA 3QX8A 5D00A 5JV5A 1F4VA 3D8HA 5LQAA 2QUHA 3PEYA 2VJDA 4LFBB 3DPUA 1JLSA 3WNCA 1XLVA 3IP6A 1O9HA 4GXTA 5KYVA 2QWXA 3HU2A 3CLTC 2EQBA 3O7WA 4V0NA 2HUNA 2NXEA 4F3NA 1AY0A 1ONNA 3DT8A 4BNJA 1MO2A 1WWKA 4V1CA 5LL6P 2O8NA 4BMYA 4CIWA 1E3SA 1XEWX 4CU2A 1ITZA 1N5JA 3KAKA 3MBOA 2BN4A 1FEZA 1C0KA 2B1QA 4RPGA 5JCOC 1XMSA 2YDYA 3NHUA 3CKKA 2AMVA 3BT7A 4IHKA 1ZSYA 2P69A 1ULTA 1WCV1 3H2BA 2DG2A 4LYAA 4B6FA 4CKBB 5KNBH 3RUPA 4M1ZA 3KT6A 3VSDA 1YX2A 5KREA 1Z5OA 1YL7A 1W59A 5DRTA 3H9BA 2JZOA 3TKYA 2CLKB 4FMPA 1UMKA 1J2UA 3C7AA 2VIIA 2RE8A 2XJ4A 1QLJA 1FSPA 3OLVA 4RIHA 5ECYA 1XDUA 2FUG1 1YD7A 1L4HA 2PSSA 2WG2A 2PKXA 5CPFA 5HCIA 2UVPB 5TSDA 2NP6A 2O5EA 2VH5R 4UM7A 3OQJA 3VZPA 4BYGA 1P81A 4ETWA 3MB5A 4L4YA 3G9TA 3WLKX 2VQEB 3C4JA 1RHJA 3KT0A 1S8NA 3UFXB 3QEAZ 4XXHA 4OOSA 3DE6X 2WAAA 2IEIA 5K6TA 5FAKA 5ELLA 5LVAA 2VHEA 5AW8A 1PU2A 1CY7A 1IUNA 3LQKA 4TS3A 2UXBB 2PBLA 1SC4A 4LE1A 4CI0B 1A3CA 2JN9A 2R6HA 1T1SA 2D1YA 1JN0A 2COUA 4UUBA 1N6RA 3HB0A 1VLMA 2JIDA 2VNAA 5A1TA 1Q7RA 1NUQA 3EVDA 2QQEA 5KU7A 3DBIA 1KAMA 1XYVA 4R51A 5IU6A 1K8RA 4P6VF 3WBKA 1UMBA 1P7VA 3BTVA 1K89A 4A2CA 4TLLB 2C9MA 2JF0A 4R01A 3ET5A 1B0PA 3DDYA 1E6UA 2BTOA 3R0XA 1FDVA 2BGKA 4WINA 2FFBA 3VTFA 4RLZA 1IG0A 1ZFNA 1R0KA 2CHFA 2Q4OA 2QLLA 3LZCA 4HY3A 4NSNA 4OQYA 5EE3A 4E1AA 3PYMA 5E1MA 2BVNA 1J0CA 4C5CA 1JR3E 2C8KA 2ZZGA 2PNFA 3KAQA 4GZ6A 2Q5EA 1EFDN 3LC7O 3OZBA 1NE7A 3SMVA 1XYYA 4DXDA 3GNQA 1G5HA 3PSHA 4TVSA 5AVZA 4KO8A 1XJQA 1KFEB 4JQZA 3MMZA 1JIVA 2DEUA 5HBGA 4TMVA 1IATA 3N3AC 4E6PA 1W7AA 3PXXA 1KMHB 2V3VA 4LOJA 2ID4A 2IEYA 2OLJA 1UJCA 2O57A 1DCTA 3DAPA 1Q19A 2Q3DA 2VCYA 1JHPA 4I50A 4J0EA 4IIBA 4M1MA 4QDOA 2ZUCA 5BQFA 1QBGA 1QZTA 4PQFA 4PZCA 2QDXA 1TLFA 1GTL1 1NATA 3BSFA 2GF0A 1I7PA 2VTKA 4LWQA 1JYEA 2Z3VA 2HJVA 1E6EA 4CR6A 2APJA 4GLJA 3AGPA 1GZ4A 3CINA 2ZLBA 1KYWA 3DOEA 3O3MB 5AR1A 4QOJA 3FKSA 3SQLA 1F20A 1QSGA 3PD0A 2R00C 4QUHA 3RBXA 4OGWA 1DG3A 1YDEA 1U98A 1VB5A 2V7EA 4P80A 1KFCB 3D2CA 4YUWA 1YGPA 2Z83A 1QOQB 2D8MA 3DCJA 3KZXA 4WBNA 4RV4A 3L0PA 5EPUA 4UTZA 1ZLXA 3F3SA 2PKWA 3DEYX 3PKJA 4EF4A 3R6WA 1MC8A 4D6YA 4DW8A 4DLKA 2Y1XA 1Z7EA 1DEAA 1WCIA 1P73A 4AX4A 4JYZA 4B9AA 1W85A 2IBTA 4AQDA 4CQNA 3T1YB 5C4IA 1PQYA 1SA0A 1XDBA 3I6QA 4Q3KA 1O5TA 5IC5A 2NV4A 5F76A 1JJ7A 3F9RA 4UHCA 3FE2A 3SJCA 2ZUFA 1K97A 2XE6A 4YO7A 3KFLA 3D4BA 2FUG6 3ODGA 3RTAA 4YCSA 3UWPA 4L50A 4MUFA 5CA1A 1VIYA 1GV1A 3CZRA 6NULA 1NUHA 5MF6A 3EG9A 3QVJA 3TWOA 1WCYA 1WBJB 1RBQA 4FVTA 4YRLA 2PGJA 1GAWA 3MHPA 2Z56A 2J6CA 3NRBA 2BHLA 5DLDA 1QGAA 3OZIA 4GX5A 5JXGA 3HKEA 3ORHA 2PZGA 3DDSA 4JWKA 2HDWA 3AI7A 2EATA 4DR7B 5CT8A 2R8BA 3Q3GE 2GR9A 5AM4A 2A5YB 3ZE2B 1FS6A 2E4AA 5TT0A 4BMOB 3SKYA 3UNXA 3MD9A 1EVZA 4FZ5A 5JDIC 1Z08A 2JHFA 2OWDA 3AU8A 4J2TA 4WECA 4ZDWA 4DV7B 3SZLA 4ZHSA 3RKSA 2BAGA 3BWBA 4GUDA 5TX7A 3GLGE 3JQQA 4XFJA 1NONA 3SC6A 3AB3A 2XY4A 4HLUA 3EULA 3ROEA 5HVNA 1P8AA 4IHAA 4KBYA 2BM9A 1IBMB 1LVGA 3L49A 4HSEA 2Z6AA 1BX1A 4R7TA 4B81A 1ZY2A 2XITA 1KMHA 1JFSA 3KTAB 1PJQA 2J0UA 4XIYA 7REQA 4RADA 2OG2A 4WAUA 1EVYA 1V96A 2G5PA 4JCOA 1WDWB 3MBIA 1OWOA 1HURA 4LZWA 3RYHB 4DXHA 5IDXA 1IY1A 2M1XA 2FW8A 4N7MA 2WMYA 2EBWA 5AI4A 4C7BA 5TY0A 3SBDA 1I1OA 2OOSA 2QVZX 3F0TA 2NUTA 2I03A 2XZDA 4YALA 5FWXA 2AKAB 1WRBA 1CV2A 3ASYA 4OOEA 2JGDA 4JYMA 2H7VA 2BHTA 3P2IA 1DDGA 3S27A 3Q8WA 4WJKB 2Z4SA 2HNAA 1DC8A 2H2AA 4EVQA 2X15A 1Y8QA 1XD9A 2P90A 2XVAA 4KWHA 5ENVA 4BO3A 2VYNA 3EIFA 3HLTA 4ZO7A 4BFXA 4Z4QA 2ZRQA 1K0FA 1XTBA 1NVKA 1X2EA 4YRJA 1Z29A 1M1XB 4CT0A 3PX7A 3NUGA 3WGLA 4KDCA 3T5BA 3TTSA 1NFFA 4HAVA 3IIKA 2FMUA 3KDPA 4IMPA 3U4MA 4TZ6A 3WGYA 1XU7A 3ZD8A 1HDGO 3LUDA 3RSLA 1ZZEA 3I04A 4C22A 4W99A 1PS8A 3UFXA 1WZIA 2O3TA 4MI3A 3WZLA 4ZEWA 1W2HA 1HE1C 3IAXA 5ULLA 2CNNA 3L1IA 3L6OO 4M1SA 4ZVKA 3H8WA 3ECAA 4YV0A 2PNJA 3JQCA 1W5SA 4EYOA 5B37A 3FNBA 1S4QA 1NI3A 3BE4A 4M0LA 1VQNB 4MQBA 1DJPA 2BISA 1I2AA 4ZANA 4BAZA 4I4LA 1CRWG 1DOHA 2H48A 4D25A 5HQJA 5EMJA 3I9MA 3LUHA 2EERA 1BE0A 4N5DA 4EH1A 4Z4UA 1QPBA 4TPKA 5BW4A 3Q9NA 3NEYA 3HBJA 4B5KA 1ZC3A 3AYXB 3H4IA 3UJ3X 4BO5A 4DR4B 4HG2A 2ZJFA 1JSCA 2HCFA 3D2AA 6ABPA 3ENZA 4IGAA 3BGIA 4QDUA 1MTOA 4DIOA 1ZO8A 1NJ8A 5FADA 1A5BB 3QLVA 4GQAA 2F9MA 3BC1A 1A76A 1ORDA 3KZ1E 1F5SA 3LUGA 2NWQA 3UMCA 1EVJA 5JH7F 1ISIA 1QLWA 3I9FA 3UHPA 2IYXA 1CE8B 5CFMA 3OTHA 3DZBA 4RGVA 1GQSA 5AXAA 521PA 1ZEMA 3QENA 4Y2XA 5FLYA 3OOHA 9LDTA 2PSDA 3KZCA 5LQNA 1XQ9A 1P45A 3QWIA 3QBEA 3ILVA 1ZNQO 4INZA 4IIHA 1MG0A 1XTIA 1ESCA 4OQPA 4ZKDA 2GWHA 5AUPB 4KQXA 4YRQA 4FBLA 2XPCA 2BSXA 5G0VA 1D1TA 2N9UA 3DVSX 3R5TA 4BNHA 4XRRA 1VM6A 3ZDFA 1VRCA 1V8PA 1A97A 3RYIB 1N77A 5K3BA 5J4KA 2NVWA 1FRZA 3MJFA 2VLIA 3M5DA 5C18A 4UTRA 2AD5A 1L1QA 1W19A 4AKIA 3KT3A 1L7EA 1U90A 3JYOA 3DNFA 2I6GA 4YJ3A 4DYVA 4MQMA 5EQTA 2P11A 3Q3CA 5KAMA 5CX1B 2XYHA 1H85A 2P9BA 2YX1A 4MVJI 3KEQA 5BR7A 3D54D 1ODLA 1PJRA 2REBA 3ZXIA 4HZGA 3UZUA 1VLOA 3C14C 3PICA 3OIUA 2TMYA 4WIAA 1XO1A 4AJ9A 4W5TA 5HK9A 2FZVA 5IXSA 1HQCA 5JSQA 1M1KD 1W4AA 1M6HA 2IYLD 3KUUA 4P35A 1J8MF 4IRUB 3Q12A 4CKCA 1VMDA 2DUNA 3U9LA 1BQ4A 4P38A 4ZAXA 4ZYUA 2NZUG 4RULA 4OHCA 4N7RA 5EFZA 1M1NA 2G9UA 1TJNA 4G36A 4BNNA 3CF2A 2Q99A 4DXAA 3CMMA 2E1BA 3ZNPA 2QORA 2Q1TA 4FDAA 3U7RA 1SOWA 1T6XA 5A0VA 3G7SA 5ALUA 3CXRA 1E1LA 2X22A 2BKUA 4JLSA 1RSZA 4Q1VA 4XWOA 2ZTLA 3BRQA 4CKWA 1R37A 1Z13A 1F6DA 4CLOA 1GRCA 2R8YA 1PTJA 3KCQA 4H60A 3T1NA 3O83A 4LJYA 3W8DA 3BSWA 3AEKB 3T6KA 1SKMA 4X3OA 5G0SA 1NBMA 2XMSA 1USWA 3CXUA 3FCXA 1FK8A 4Q12A 1DUSA 1ZZGA 4BPBA 3QXGA 4F4FA 1M5TA 5DYGA 2ZZMA 1LLFA 2HY7A 1LX7A 4M6WA 3CH4B 3DS8A 3WNVA 4J07A 4E5SA 4N8SA 1G3RA 2YYSA 1ZNXA 2VS1A 1LXCA 1J5XA 1R0LA 4UVIA 1SCAA 3J81k 1V5EA 3BGSA 3DOOA 5C1BA 2VNHA 1JALA 4BB9A 1YIJB 4G1EB 3OZ7A 4MA4A 2AUNA 4R2XA 4AY5A 4UPEA 2V3WA 3LQFA 4ROSA 4URHA 2C7RA 2K2QB 3OQ6A 4ZAWA 1YS2X 2PQ6A 2XCIA 3G2NA 1E58A 1ZAKA 3RJ9A 4D9EA 1GTZA 2NTEA 1I10A 3QHAA 2OHJA 4OFWA 3L9WA 4M54A 4P5DA 2GAIA 2XKBA 3VV3A 4J4HA 4G0QA 4MV7A 3LUFA 1JH8A 3I2GA 3KU4A 2GCIA 3FJOA 3AVUA 1H1LA 3QLTA 5AMXA 5K1ZA 3RKUA 1GR1A 1ZOOA 3HDJA 4YYEA 5C8ZA 2EJCA 4Z3OA 1IEVA 4PR0A 2CMDA 1GIAA 2BR3A 1FFWA 1Y37A 2PUVA 1AF7A 4OM7A 2XQFA 1UZAA 2W2TA 4DLUA 2C2ZA 4TKVA 1ADFA 2IXEA 4RHFA 2QTLA 2RAUA 4MULA 4PX2A 2YW9A 2PS3A 1Y8ZA 3BB1A 3OFJA 2LKCA 1TA0A 5K4AA 3ZJTA 3BB3A 1B0UA 2C5SA 5HE8A 1E43A 2OHFA 1YI1A 2FV8A 2CLOB 4GNKA 4Z51A 1YR1A 5ICMA 3GJ4A 4J7AA 2BZ1A 3AR7A 4IG4A 1OZGA 3WOHA 3K2BA 2G4VA 1Q50A 2HX1A 3HCPA 3I6ZA 4DLVA 2GJ9A 4CM4A 1EDOA 2JS7A 4X00A 1MOSA 1KQ3A 4GF5A 3X2FA 5LQRA 4RDLA 1NN1A 4LHWA 1WW3A 3UICA 2PQ0A 4NCAA 3AEUA 3HRIA 2DJIA 4HX9A 1H42A 3DDNA 4U6SA 1MX5A 1IN7A 4IHJF 1NNUA 1O0CA 2Q3LA 2Z0MA 2D5AA 3ETLA 5KVAA 4J1QA 4DFDA 4HDSB 2GN2A 2HSWA 1VYUA 2C1XA 3U6KA 3OJOA 3V4OA 1OLSB 2ZYGA 3LVBA 2I2FA 2UDPA 2HK7A 2JW5A 3EQ2A 4QU5A 4TXMA 4Z3DA 2XT9A 5I4BA 1GPNA 4P7BA 3GVJA 3QK7A 3TW0A 1P1FA 4JBNA 3KOYA 3V7FA 2X8JB 3SZGA 3HYNA 4REQA 2ZRCA 4G4SP 3ZDRA 4PNPA 3SEAA 4GW3A 2ZR0A 1O0SA 3EHDA 5D6NA 3UWMA 1L5HB 1QH0A 1G9TA 4Q3LA 2CK3D 4GHWA 4RMNA 4DQ0A 1C7ZA 1BTOA 1U8AA 2KB0A 2RHLA 3IP9A 1DUIA 1RE1A 4RKEA 4IMIB 4RETA 1KEVA 5BO5A 4ARSA 2GJKA 1H05A 1HFKA 2ZTUA 4GI1A 1NYLA 3BMNB 3HN7A 4HGPA 3UUGA 5C1DA 3OQIB 5JNUA 2B0CA 1A7UA 2I7TA 3DM5A 1LS6A 4M0EA 2HJGA 3ESQA 1NX6A 4NEQA 5JZVA 4RDIA 5ITZB 3QLVC 5CLIA 2DTEA 1ZC4A 4ZVPA 4HVCA 1DMSA 2RHTA 1PGQA 1INLA 2ALJA 2HU5A 2Q4RA 4Q9IA 2VNJA 4PZEA 2H1CA 3R3JA 2REOA 4YX9A 3JVUA 2DPLA 4WBXC 4BQNA 1OC4A 1MJGA 3T94A 5EKDA 2ONCA 1RYBA 3DFIA 3CCJB 4H1HA 3H5IA 5K0SA 5ALQA 5ALXA 2NSJA 4QSHA 3ZHZA 4ZI7F 1KZ9A 2R6ZA 4QBIA 2IL1A 3OM0A 5AW2A 3KLBA 3QVOA 1BU5A 5A2GA 5C2JB 1OF1A 2VP2A 3ND8A 3UMRA 5JXWA 5BR8B 2HFJA 1TJYA 3DBLA 1BOFA 4G6ZA 1L5RA 3V8QA 4BVEA 5JD5A 2D2FA 4F5ZA 1HK7A 3ASSA 4JT4A 5FUBA 3C6KA 1T5DX 2YWHA 1P3JA 1XDSA 3E1GA 2OFXA 1I14A 1N2CB 1VBKA 4WDQA 1KR2A 3GB9A 3ICWA 1D1QA 1CQIB 2NV0A 1BMFA 2ZSIA 3SM9A 4RH1A 1XF9A 3W05A 2ZQYA 1D8TA 3MAAC 1ECLA 3OTGA 2QTHA 1JWLA 3LGXA 4NFSA 5CT5A 4N9WA 4N9QA 1BIFA 4GQBA 1I32A 4J0KA 2X9LA 2GRJA 4GNRA 3AVYA 1Y3BE 2GTHA 1UKVY 4MGYR 4R9RA 1X38A 3OOSA 4EY6A 4KXMA 5AJVB 1PJ6A 3ASTA 2H0AA 3WGZA 5LR6A 2Y1KA 1N6KA 2HHAA 2AZ4A 2GO7A 3CJTA 5U1PA 4AJPA 3NTLA 1X77A 1W48A 3BCHA 4MWSA 2G6TA 2ZAOA 3N07A 3GVKA 2EX4A 3IILA 4C76A 3JQ9C 2KVOA 5H8WA 3DHNA 4XOIA 3ZYZA 3ROFA 4PYJA 3TL3A 1DDIA 4F3TA 3VYUB 1AE1A 4UHFA 221PA 2WG1A 4HH1A 4UDXX 2DY1A 4RPDA 4YJKA 4CUJA 1BFUA 1C1HA 1USVA 2HQOA 1X8LA 1K7CA 4HATA 1OPRA 4OK3A 3WIVA 4BVJA 5JYEA 1Z4OA 5BVHA 6Q21A 5KKNB 4PQYA 1XNJA 3TVTA 4WESB 3BXPA 3VR1A 1ATIA 1E2BA 4QYSA 1Y6ZA 1CDZA 4ZXFA 2UZAA 2O9JA 4XL9A 1J00A 2ZZFA 1UBOS 3NT5A 4O2BF 5TJ9A 3ZE6A 4JAVC 3DL2A 4DMUB 4Y9RA 3DA8A 4DMRA 5JSKA 1XQWA 2FZEA 1PR0A 2HBYA 4AWXA 1T3TA 1K68A 2J5QA 3I8OA 3PQ7A 3GIRA 2X8JA 2ZWAA 4N8EA 5HQTA 4BKOA 1QE0A 2C4UA 4WLOA 1B76A 3IP8A 1D6JA 1F0YA 2C7QA 4KO1S 1DKQA 2GUWA 4DA0A 4E5MA 2VHYA 4KP7A 3HRHA 2ZRJA 4LHVA 4EMSA 2LE0A 3KP1A 4AY3A 1JECA 4LJRA 3TLZA 4Z99A 2ZTGA 3B9RA 5M3BA 5LDHA 2GAFA 4EMTA 3IP5A 3N58A 2MSKA 2GOYA 1PG5A 5IRCD 2ATVA 3FIJA 5K7SA 1RI5A 5IKEA 5B3JC 1N5IA 1NW5A 2OFOA 2GEFA 1YDGA 5AVKA 3L7LA 1TJ3A 5FD8A 1NUAA 3QKUA 1N8NA 3VHXA 1QP4A 5EIWA 1GWNA 1O94C 3KL2A 1JT2A 4FDMA 3USCS 1QFSA 3A2LA 5L3VA 3WLLA 2ZYWX 5KMGA 3W9SA 4B6RA 5CITA 4NQRA 2D3TA 3KXDA 1HLGA 2FP4B 2C5EA 2CL6X 3AETB 6CHYA 1W5TA 2YFHA 1NXXA 3OURA 4JUBA 1W8IA 4RZHA 2X0FA 3T8YA 1VJSA 5JWRA 1O08A 2IHTA 3ZX4A 5KOJB 3RAPR 2LW7A 4BEBA 4DJJA 1KH1A 5KTRA 1VLQA 3VR6H 4HYQA 1LPAB 2YYZA 2X6RA 1XD2A 5AKHA 1YDMA 3FBGA 1SBIA 3PR3A 3EXHB 5A3SA 1ZCAA 2XGSA 1NDUA 3O2NA 3DLTA 1L9KA 1CC1S 1XAIA 3QXXA 5JMTA 5I3CA 4DRZA 3ESBA 4ZT2A 1C7FA 3WQRA 3FZEA 4D0RA 2HHJA 1NBIA 4KQEA 7MHTA 4G81A 1SUCA 1CZLA 1O57A 2DM6A 5KWVA 1YUMA 3CCQB 3HACA 5IHPA 2Z6VA 4CQMA 3RADC 4W63A 1UKEA 2V7WA 2ZRNA 4HDQB 4JI6B 3B20A 1BQ3A 3E9RA 1S7GA 3SYRA 3OSZA 4MW7A 3BXOA 5JANA 1NZDA 3IAS1 2E1PA 4B35A 1B73A 3H9NA 1JLLB 2X1VA 2FW0A 2XYQA 2YYYA 3KOZA 4QASA 4ZZIA 3T35A 1KEWA 5TRTA 3JWGA 4K6GA 1WDKA 4UM9B 2IUFA 2J0EA 4LWZA 1AQLA 1GNLA 5CT9A 4DNQA 5JBNA 4UDYX 4I6JA 5FFNA 4G24A 1YRHA 4TWAA 4JEIA 3S68A 4A1FA 5I9NA 3G3EA 3QV2A 2PL3A 4H0FA 4L6CA 4LRTB 3CX4A 1K92A 1M2HA 3FTPA 4PX5A 3H8SA 4UULA 1SQ5A 2FZGA 4F85A 3ESYA 5FEMA 1WHSB 3N7AA 3IIIA 1UD8A 2IRWA 3O8QB 1MPTA 2QPLA 2B82A 2QSJA 5F2NA 2O8CA 1LF5A 2V4UA 4QM7A 2XE4A 2ECQA 4GBJA 2GZAA 3NKVA 4L78A 1WHSA 4L0QA 4ND3A 3JQGB 5D3KA 5F98A 5KB3A 1JIKA 1YBMA 4NKRA 4FWBA 4HBGA 1M7BA 3JZFA 5JNWA 3A6FA 3KSZO 2C2XA 2FPGB 3NHKA 3EIQA 2DKNA 1XRPA 1NBOA 2EJVA 2WAYA 4NC9A 1HFJA 1YI8A 4YV1A 1M1NB 4BX8A 1FNBA 1GJRA 3KHUA 5CW2A 5KVVA 1JU4A 2WU4A 3QELA 3OD5A 2WHRA 3ZIDA 4EFKA 4JUFA 4O59O 5EPOA 2WJVA 2WINI 4YUYA 5KNDH 3LC1O 3IT2A 3AOEC 2X3UA 1L5YA 5EXSA 4Z1MA 1YCGA 3FLMA 3IKLA 5HDQA 3RIEA 3S2YA 1EWVA 2GWRA 1UPUA 3M81A 4B73A 4RSRA 5C51B 2YZ7A 4MR9B 3MTBA 3PXDA 4MP6A 1YR8A 3D6AA 4UU7A 1TVMA 3FKQA 1H9AA 5DNWA 1UJBA 4W8GA 3L0DA 1Z7GA 4ZQCB 3VR3A 1P1RA 4KYVA 1V6SA 3DL0A 4PC6A 2FA9A 3P9RA 1C3OB 4UUMA 3T7KA 1ES9A 1N9GA 2Q8QA 3N2YA 4F56A 3UAWA 3VVCA 4AMZA 1AKNA 1FMLA 2PX5A 2X8WA 5HF9A 5EJ4A 1Z0AA 2A8YA 4YIKA 3K72B 4RO0A 2JGEA 2VUSA 4DZTA 2HF2A 4UVEA 3ZHTA 4UC0A 1E2UA 1NGSA 3DTYA 4L28A 3LKDA 4EJFA 1PR6A 4CLRB 4GDFA 2PFKA 3E0QA 1DKUA 2X2EA 2BEVA 2CZCA 3ZCTA 4D99A 3L05A 5FL3A 2VTBA 5H5JA 1QHHB 5A6VA 1XZMA 4FXPA 3DXFA 1ZGGA 1C3XA 1OIWA 2O0LA 4X85A 4YV2A 3IJRA 4RK0A 4ZU6X 1SCKA 4PO9A 5HPYB 5JSFA 5KMGB 1PX0A 1KZ1A 1NVUQ 1ZA2A 3C97A 3H19A 1I0ZA 2B6HA 3ONVA 5SY6A 4A4DA 1GG9A 3RJMA 3WJAA 5CBPA 3Q88A 1JFTA 1K06A 3RYCA 2D8AA 3WWYA 4LJ6A 2V6GA 3QOYA 1XVIA 2VRWA 2V7QA 3ANLA 2FPMA 2RI0A 3IOMA 4KQKA 5DP1A 2GPTA 4YAIA 3KR9A 1LBHA 1THGA 5I8PA 5AVWA 4PG8A 5SZJA 2HYIC 1PJLA 5KWSA 4B6EA 3BS4A 1IYZA 1CE8A 2I4NA 3OX3A 1PQUA 5IUNC 4ZCTA 2N75A 2Y1OA 1N3BA 5JFOA 4ZGQB 4XX0B 5B6PA 1CU1A 2FH5B 5KQSA 2XAUA 1N6NA 1OWMA 1VMIA 3MRXA 4GZLA 5ENZA 1MDFA 2J9XB 3IT1A 2BKXA 1U2GA 3O8RA 4FILA 3UJ9A 2RAPA 4YLEA 1YWGO 1JKFA 1FTQA 4KMRA 5DRYA 5JAUA 2IW1A 4WERA 2C88A 1G2IA 2H5JA 4XQ0A 5K0NA 1T2VA 1RC0A 2VNKA 2W6ID 2F1RA 1F48A 2OHIA 4PTZA 1AKQA 3CNNA 1Y6JA 3OKCA 4D46A 2O3UA 2P68A 4KQFA 1JDUA 3EGEA 3PRKE 1LV8A 1TD1A 2OZLB 1G9XA 1M90D 1MB4A 1R2QA 1EB9A 1PYOA 1UT8A 2PWBA 3RWMB 5DIZA 3NO4A 3SEQA 2ZRGA 3KTDA 3GLHE 1L8OA 4MDYA 2YVKA 5BUCA 1NVDA 3I04M 2QR5A 1OH5A 3D8NA 4M98A 3W78A 3GLFA 2O8EA 1F60A 4E32A 2JFHA 4NZMA 4MEBA 3VR2A 2REQA 4DRXB 5GV8A 4R83A 3EEBA 4IXWA 2JLCA 3N2NA 2X4DA 2WF7A 3AHGA 1SVKA 5D7NA 1RZVA 2X5KO 1UBEA 1RRVA 4NTZA 1N06A 2YRXA 2YCLA 1LDGA 4MKXA 5AVUA 4PE5B 4YCCA 2NW6A 3TVDA 3T12A 1AGRA 1NXSA 1YIAA 2JGRA 3GEHA 4Q7MB 3D8TA 2OEPA 2H17A 4L5CA 2YJTD 2NSYA 4HGRA 2ZYAA 4G0OA 1QVVA 4P4NA 3CJQA 4JT9A 1Y9JA 5CXSA 5FUYA 4GYWA 3W2FA 1B6GA 3CWZA 4LMRA 2M6SA 4OHBA 4E2WA 4S1PA 4YRCA 3KDSE 2QL6A 4MW4A 4NNPA 1M2KA 1PCXA 2C8LA 1YAHA 2JAHA 3E9DA 1YZHA 2HLNA 3JVDA 2RKWA 2JEYA 3QUTA 3T9EA 3A1UA 4YJHB 4DWOA 4K9KA 2BV3A 1EA7A 3HY3A 5DHFA 5LNK6 1J33A 3NFRA 3AI1A 3FBTA 1B6TA 1NVGA 4DM4A 2JLWA 1G6OA 3CCCA 3L0CA 3AGQA 2FJUA 3AV3A 3HBAA 1TXGA 2AN3A 4YY3B 1KE2A 2C4WA 4KU4A 1B41A 1X7YB 1VLHA 1GZSA 4M0CA 4I8XA 3LNNA 2CBGA 3AY0A 4ZU3A 2OZEA 2OYCA 1TJ4A 2I6XA 1DIBA 3BIXA 1T9DA 2MOKA 2PUJA 1E2HA 4IIJF 4PGFA 2G09A 3AI2A 1K88A 4TVBA 3BHIA 1RNLA 2OYRA 3LWBA 1SKAA 3BQNB 1SKYE 1PKVA 4JP2A 4UW9A 3NM4A 5LYJA 2BMAA 2A88A 3KTOA 2Q2QA 1Z16A 3WWPA 1AKRA 1TEXA 1TM1E 4Y7CA 3KYDA 3KEMA 2RI1A 4XN3A 2AYYA 3SYLA 3LK7A 1HFEL 4K9SA 4JKIA 4XGQA 2LCQA 4KR9A 3EG9B 3F47A 3KJIA 4LOAA 2GJ8A 3I83A 3PQCA 4TS9A 3U17A 4B1FA 3NJ4A 3GV0A 3M82A 2V65A 1BKYA 3ZU2A 3I2JA 3OPYI 3I5MA 4WK2B 1HOXA 1PN3A 3D5TA 4IJVA 3CT4A 3JV7A 3KHSA 4RVSA 1L1EA 4Z4ZA 3ROXA 3CIFA 1Z39A 1AQNA 4QVJA 1DEXA 1E1QD 3V46A 4LXGA 1NP6A 1XMXA 3H3JA 4PPQA 3H8JA 4F86A 1MIOA 3RODA 1T35A 1TU4A 1R6BX 3C6YA 3ELUA 2HXYA 2AFIE 1EK2A 4PFSA 1PJTA 4JWTA 3A04A 3ZCRA 3ESCA 4PYLA 1LB1B 3GD5A 3NWOA 2FPXA 2PJUA 2OORC 4HKTA 1HTWA 3ACCA 3ZJ4A 4C03A 3UK1A 2WYVA 3F5DA 3ABRB 4UTOA 5KTKA 2PYIA 2ZB8A 3CLKA 3ISTA 1ULUA 1J8YF 2R44A 2ZE6A 2LZ0A 4G41A 3ZJVA 3L0YA 4KUHA 1GA6A 3ZI7A 1OAOC 3N5KA 4PHGA 2RIRA 3QA3E 1GYRA 3ESDA 1P1HA 1GQRA 3TSCA 1RVV1 1SA0B 4X7MA 4ZARA 3T3PB 1TYBE 4PONA 1GZ7A 2C3OA 4JT8A 3GG9A 1U0EA 3ORYA 1X8XA 4HWKA 2JJYA 3Q0EA 4MYCA 1LPBB 1FBTA 2JJ8A 3BJMA 3E58A 2O0MA 3GRYA 4FHGA 5F4BA 1G20E 1E2LA 1TJ5A 2G1KA 2VC2B 2W5UA 3Q7RA 4KHZA 1AZWA 2IHJA 3N5CA 3QH4A 4KSYA 4LJKA 5JWHA 3URMA 3ZOZA 1U31A 3UIEA 1LNQA 2R7LA 2Z5FA 2BF4A 3ETJA 4QVKA 4Z3KA 1PE0A 1T5HX 1VBNA 3LFTA 2JFXA 1J5PA 3JQBA 4NYIR 9LDBA 1WPXA 2YVUA 3GMSA 2YV5A 3K30A 4PO3X 4ARUA 2IS1A 3RYFB 1DJOA 4ZVMA 2HNKA 3T4EA 4CMGA 2DBRA 1EU1A 1PS0A 4S24A 3GIWA 4CFSA 3ADKA 3ONDA 3ET4A 3EDMA 1IBRA 3NAGA 4W4TA 5AXBA 1OLOA 2W6ZA 1KO7A 1NXVA 2CL0X 2DUWA 1HYEA 2XMZA 4EUNA 4UXJA 3FH0A 3E05A 2Q1UA 3KVOA 3DZJA 3H0CA 1TEVA 1OBCA 5JO0A 5KYWB 1G8MA 3IEKA 1H1LB 1QORA 4RGYA 1CY6A 4DMGA 4QZVA 4HRXA 4FKBA 5IZCA 1I4EB 3ESRA 1ZXLA 4PLCA 3T54A 4DV2B 4C4RA 1QANA 3ZLVA 1R6UA 3CEHA 1N2SA 3HN6A 4M9UA 3LG2A 1UXGA 3JQ7A 4IIUA 1XJ5A 3EA4A 2JB9A 1Y5IA 1XEFA 2HI0A 4B33A 2Z6UA 3R9KA 1GZDA 3MCZA 4G84A 5T67A 4AJJA 1I3MA 3B36A 5E6SB 1QP7A 4RTOA 5CIWA 4Y2PA 4QUDA 2B7BA 1G5QA 2WYWA 2Q62A 3HJRA 1S96A 4YCAA 1QZXA 2REQB 3PDHA 5EZYA 3I9KA 1KJQA 1Q77A 1H2ZA 2Y67A 3D3NA 5H9VA 3W5HA 2FUKA 3GLFB 2O8EB 1U8FO 3OPYA 3TB4A 3AZQA 2YUTA 1UDWA 3W3AA 4M6WB 1CTQA 2D3NA 4QX6A 3KM0A 3AUSA 1B43A 1TAHA 3NASA 1IK6A 1HM5A 1QH1B 1UBSB 3B6EA 3F73A 2IITA 5IH7A 3D59A 3JCZA 1PR3A 2UYQA 2ZOSA 1VG0B 3K8YA 2G4CA 2QYSA 2PGLA 4R8SA 2QROA 4PF1A 4OYYA 4IIVA 1D1NA 4GEKA 4CL0A 2DHRA 1DHTA 1O97C 2VDNB 4EUKA 4N03A 1U4NA 1WXQA 3ZQUA 5ABPA 1ZGCA 4MZXA 1B2LA 1QCDA 5TV2A 1TF7A 2HA3A 2IXDA 3EH2A 5DHSA 5AOAA 3W5AA 4J1TA 1EGAA 1V7ZA 1DFIA 2A9VA 2NO6A 4ZO9A 5E0KB 5FA5A 4ZQIA 3UMVA 5BNIA 4J7UA 5EE1A 1JJAA 3DDOA 4ND7A 4MUNA 3RR2A 3VYVA 1N08A 1W581 1KPHA 1E77A 2H8KA 1YJ5A 4JQOA 3U7HB 2OD9A 4OBXA 4UTVA 4V2UA 1QOPB 3ZDYB 3DJYA 1LJUA 3BX1A 4LYHA 4IQ4A 3T41A 3LUJA 3GPBA 4S05A 4C89A 3L8HA 3Q41A 2ZIUB 1GN9A 4D2IA 3TMKA 1HG1A 5IC4A 1WB9A 3L7CA 4ID9A 4RCZA 1QIEA 3K1YA 4OQDA 3M3HA 2VPWA 1L5ZA 1P5FA 4IIJA 3RK1A 4FB5A 3O5AA 1NIJA 4A03A 4PGGA 1BS1A 4DCVA 1W0KD 3VA7A 1C3JA 3LU1A 4X1KB 1ISJA 3PHGA 3ZY3A 1GDDA 2Z2IA 2CUZA 3EXEA 3K8ZA 2VJCA 4GO1A 3A6KA 4QDXA 3SBXA 3PVSA 3WGJA 1F38A 1H3NA 1MAHA 5DLYA 3CBGA 3ONEA 4PZZA 1U0GA 1KO8A 4NU8X 4UTPA 4OMDA 1M8GA 2WVJA 1H0RA 1J49A 2GVDC 3NYRA 2PIAA 3EK2A 4UD6A 2MTBA 4WY5A 4XFKA 3ZZNA 2DXIA 1KC3A 4K6MA 5H3HA 1DIGA 5T4BA 3A3KA 1X1TA 3TIIA 3G2OA 4ZZ3A 4MH0R 4GAEA 4ZWNA 2YMLA 2JA1A 2M98A 4J2OA 4M60A 1BHSA 4N54A 5A3VA 1BGVA 3ZCSA 4EARA 4AKHA 2CXQA 2WJAA 4JASB 4YLGA 2C2WA 1TUBA 3IVGA 1C3OA 2L17A 3S2UA 3WQBA 1VYHA 1NWHA 4E4RA 2OWEA 1C8LA 1S2IA 3FLAA 4L75A 4U6NA 4Z8YA 3SHQA 3V9AA 1KF0A 3EBLA 4Q4LA 4HAYA 5LLTA 4YR7A 2OTCA 4V2IA 5LP6F 3H9GA 3FRJA 4JLWA 4F12A 4B74A 5I9BA 4LHYA 4XVUA 5K3FA 4BB5A 2HCJB 2OESA 1DQRA 3VSEA 1W0JA 4TV9F 2CJWA 2VJMA 3W9YA 3NP9A 3PJGA 5JLAA 4RD0A 1M2JA 4H35A 4PPGA 1NVXQ 2GFQA 3LRTA 4EW6A 4RCVA 2B8JA 2BDUA 4QUZA 3P1JA 3CGWA 4NMLA 2R8RA 3TB6A 4MKIA 3VPHA 1OU4A 4TMYA 3KQLA 1T5EA 1QFXA 2XLCA 3WLSA 3FPGA 1Q0RA 4U0JA 3VTZA 2OCBA 4EJSC 5I7FA 2QPAA 3H6GA 3TQFA 3I1JA 4FNAA 3FSJX 3H3XA 1P4HA 3SDBA 3L0BA 1COZA 1R6AA 2BSQA 4I9UA 2IZ1A 2WLSA 3FLEA 1M72A 1PDVA 1MENA 2VTVA 2WJ4A 3DOIA 4L16A 4OSPA 1D9XA 4R4JA 2ZBGA 1ZM4A 4E15A 3OIWA 3HKDB 5HKOA 1NKTA 2NVBA 3OHMA 3W5IA 1KI9A 3O8QA 1WXFA 4OKSA 5IUKC 2R6DA 3Q72A 1U7OA 2C04A 1YMVA 3H5LA 2OL4A 1E6MA 3HU1A 3I3SR 2B35A 1R4MA 2RGXA 3CLTD 4JNKA 5YASA 1IOZA 1FVXA 1KEUA 1QHXA 2QJWA 1U0SY 4DMHA 1M2OA 5C5CA 3AR5A 4X6LA 3PQ8A 1WTAA 1XEAA 2XADA 3L0ZA 1OW3B 2GXQA 5CJ2A 1KK1A 3IQZA 4DY4A 1NU6A 1M8KA 3E23A 3DVAA 4YC7A 4WH0A 2BFBA 3B38A 3GZJA 2JAQA 1ZVQA 2O0KA 2OQRA 1N7JA 3S2EA 5ITVA 4TTPA 4M83A 4NDNE 1CRLA 4NEGA 2K7ZA 4HD8A 2CFOA 4LMBA 5KYWA 3BFJA 3K9WA 5DNEA 5BY2A 4JEUA 4RYLA 4Q4AB 2YXLA 3RLFA 2C61A 3GGJA 4U4AA 5AQEA 4LC0A 3RVMA 4ZYVA 5EWLA 4FXUA 5K8LA 1U2GC 3L6UA 1WETA 3B1KA 1IBKB 3A4LA 3FHTA 3DKPA 1JHOA 2FMTA 1WKBA 1GCAA 1NSFA 3WWDA 2C7PA 5LU8A 4ZV4A 3EZXA 5BN3B 4JOCA 1DAFA 5DH9A 1F8UA 1VSUA 3RVSA 2IEAA 1O5OA 4I1YA 5B7PA 4XCVA 4CYMA 2GUGA 1NULA 1A4IA 2HCTA 4QYTA 2FFJA 3ZWDA 3BFVA 5L53A 5JAPA 3LY9A 3AKDA 4LY0A 5JMOA 2Y4NA 1V5IA 3FOEC 3VYWA 1NLYA 4K26A 1N0WA 4CLXA 1G3MA 1IBLB 1NMXA 4P25A 3ICQB 4JHXA 3CEJA 3UOGA 1ISFA 3D6JA 2O07A 4ZCMA 2B5WA 5E9JA 4CKYA 2P79A 3KZMA 4QRIA 4M9ZA 5BP7A 2DFLA 4R1QA 5A5VA 4CEJA 2ZS8A 1RRMA 1Y1SA 1T0UA 5E8JA 5G40A 2JHPA 3MB8A 1SPBS 3HCEA 5REQA 1KI2A 2PMBA 2ZIXB 3HWSA 2B21A 4RZUA 1P72A 3V2GA 1VPEA 1S3GA 3FR7A 4L08A 4A9AA 4I81A 2VAXA 3ASVA 3EGOA 4LZJA 3QPWA 1TUBB 3QI2A 2IYOA 2P6NA 3ICCA 4B09A 1AHNA 1ZVJA 3UV6A 2HEIA 1OLUA 2FFHA 2CJFA 4UBKA 4IRMA 3CPJB 3BL6A 3EAFA 1RAIA 4ZVUA 1K9SA 2W4MA 4IUYA 3T7SA 1JMVA 2VJOA 3GVLA 3MWDA 2AMYA 1NXTA 3C24A 3L0SA 4EPWA 4FC6A 2IIPA 4C6HA 2WPDA 4EG0A 2IP2A 4KKXB 1FUEA 3QVMA 2HMSA 1TUGA 1QKIA 4LDAA 1Z63A 2XCLA 3ZV7A 1OJ7A 3K5IA 3DQPA 1T8RA 1QF6A 3A37A 4GZ3A 3MQ4A 5E1DA 1KJZA 3NGLA 1WMAA 4JZKA 5I9TA 3ANNA 3JD0A 2ZVQX 3DZKA 3I45A 5JWOA 3R3YA 1RQ7A 4WBNB 5LWQA 5J23A 1P7ZA 4LJ8A 1ZN2A 5IC6A 2D0OB 2H51A 2Y1FA 4DR1B 1CJMA 2E4WA 2ZZQA 3IUEA 5ILQA 5C1PA 5FTLA 4HN4B 3CH6A 4IHJB 3RC8A 4TMFA 3RVBA 2J7PA 1T0JB 4EM6A 1QAMA 4NBSA 1H8HD 3DDHA 4F46A 1OXBB 1JBEA 5IEJA 3CF4A 2Y1LA 2JD2A 3T7JA 4EAAA 1KWKA 1C0IA 1HO3A 2VKQA 1Z17A 2GZDA 2ZSFA 4FGWA 4NFLA 1QFJA 3EUFA 3VMFA 3GLRA 1TM5E 3PQEA 4OXIA 2PZFA 1KY4A 2TMGA 3GRVA 4RHUA 4YRSA 4FUTA 3TYXA 4HEHA 2CGEA 1T3HA 2Q45A 1BAPA 3FUUA 2ZWOA 4Y8VA 4BJ6A 2EJUA 1R88A 1KVRA 3W90A 1MW8X 5ALYA 3ZJ5A 4DTIA 1GEGA 3EWNA 3ZDCA 5JC8A 1FYDA 1Z4NA 3M33A 4QBKA 2A58A 1ZONA 2M5SA 4N39A 3C48A 4OP3A 4KRFA 3TTXA 4WEOA 1UOQA 4DJEC 1BWQA 3A27A 1U2TA 1ECCA 2R6JA 2WY2D 5HHTA 2QL5A 1R9MA 3PWTA 4RUKA 2A35A 4MARA 4U3JB 3CKMA 2XT0A 5EZYB 5FXMA 3HXMA 3HZOA 3ONUA 3IPLA 3NR2A 5B1SA 3DLIA 1RWXA 2Q9BA 4FU0A 5HXAA 4OHKA 3DBLB 4P3OA 2ZXEA 2R4TA 3C98A 2EW8A 2F9FA 3R7DA 3DSRA 2IV7A 4YCNA 2PGIA 3BZWA 3PEUA 1VE9A 3SJ7A 3W1EA 5KBYA 5FPPA 2PAAA 4O2RA 4G7XA 4P12A 1WD5A 2WM8A 1YHNA 3LA6A 5CFOA 2IY9A 1VJ1A 4HDOB 4RACA 3WNBA 5FBHA 2IUYA 3FPPA 2X7JA 1Q1QA 2EKPA 3EWAA 3HE3A 4QWWA 5EEGA 5EXDA 5JAQA 5LOVB 3S55A 5LOVF 1ZCZA 1A9XA 2ZWIA 4OOFA 4BO8A 4IJKA 4HH4A 2IYUA 3TL2A 1FX1A 2X23A 2IYTA 4UM5A 3B3JA 3GSIA 1O1YA 4TMTA 3N8GA 4L95C 4P7JA 5AI8A 4D80A 2QEXB 4XLTA 5I9MA 4WXMA 2V9ZA 2DUMA 2GZHA 4XYGA 5IASA 2GN9A 4ARZB 1IY8A 1AQUA 5DWDA 2F43A 1BDBA 4EPXA 2J07A 4NYJQ 3VAYA 1WP4A 1VFPA 2IVZA 1Z34A 2H00A 2ZI3A 3GRKA 1B2RA 4DBLC 2J09A 2YJGA 1WHTA 2J7KA 1JWAB 1T91A 4LF7B 1VCMA 2JPDA 3JYNA 4Y2YA 4CKBA 4O29A 3L8CA 3DEAA 4F38A 4CETA 4WCVA 4KJXA 4TKZA 4X20B 4OHWA 4HDNB 1O95C 2I76A 2HT6A 2YJ6A 4ODIA 2MSCB 3OFSA 1Z5PA 2B9EA 4FFPA 1O0BA 3RRBA 4XLLA 5JAIA 3SOPA 3MJHA 1WM1A 4OHUA 2QE6A 3ZNNA 4D79A 2WT8A 4Q39A 5CDFE 1J0EA 1E0JA 2JAUA 3K6RA 4AYTA 1YUBA 3NRJA 4OY3A 4KLCA 1CDOA 4Q3NA 2BI8A 4MQEB 3QTLA 2O6HA 3IKVA 4X61A 4AY2A 4ND2A 5AW7A 1YL6A 2HA0A 1VHWA 3K32A 4DA9A 1AKTA 4Y2JA 4DAEA 3RGWS 4KITB 4FKMA 3CVYA 5TS3A 4JSTA 1D2MA 4CLRA 3LT1A 3L5KA 2ODEA 4E22A 1HYHA 1Y98A 1V48A 1XT6A 2AF3C 2YOHA 1SEPA 3DWIA 4RPBA 3NGXA 5GPBA 1BCRB 5C7IO 2QZPA 1SBCA 5KHLB 3IALA 5BYKA 1W4BA 1AZSC 2J3EA 3HVKA 3NHZA 1LPOA 4LDNA 5AVVA 4X8OA 3Q6IA 3IAAA 3DC7A 1J5EB 3WLJA 1ZCFA 5FPYA 1Y6RA 4IZHA 2FW7A 2RK6A 3OLCX 4RA9A 4S1VA 2JHCA 4U7TB 1SVLA 4G8CA 1FQWA 1QRAA 1RZRA 3IEVA 5FA6A 3U3DA 2B4YA 1KY3A 2YV4A 1NJID 4N0QA 4B4WA 2QD2A 2C9CA 1VYTA 3ZDBA 3ORSA 5DM1A 1EH5A 5B1EA 4PY2A 1DELA 5TEWA 5EWJB 2P9JA 2O19A 2Q8NA 3A31A 4G0MA 1GPAA 1QPZA 4RDJA 1WV0A 1A8QA 3WMGA 4F9TA 3HBFA 2RKOA 4O3MA 1E1RD 2WMOB 3GRRA 2GHQA 2V6MA 4LYGA 3CC2B 4MMYB 4AXBA 1QVZA 3IFSA 3V8EA 5A03A 3C6BA 2PJRA 2FK7A 5BQPA 3COSA 1IM5A 3WV5A 1WOSA 4LIPD 1VQPB 3U09A 2PUCA 5JROA 4BECA 3ABOB 1VG9B 1BH2A 3I1FA 1MQAA 1BEZA 2YUIA 5DX1A 2C4HA 2B8EA 3G8BA 1T2DA 3R3VA 5HKAA 3P0RA 4Z4WA 3E5MA 3EFHA 1RJFA 4P31A 3TBKA 1GU7A 4MUIA 3JQGA 4N12A 2Z5LA 4C07A 1UM8A 3P2JA 4AO6A 5B2ZA 3ND7A 1E5TA 2YWCA 3HYTA 3O26A 2W6QA 4F5DA 4RPKA 3E2IA 2IYRA 4FCWA 2FHPA 2PU5A 4IGEA 4M0PA 5H02A 4CDMA 3NOOA 5CB6A 1XZLA 3MLBA 3WYAA 4JBXA 4PZ9A 5EYPB 5F9FA 2KW5A 1H5QA 2AXPA 3LLCA 4RIEA 4F3RA 3HR8A 3FMVA 1P4GA 4FOSA 2LZJA 5JFTA 1PJ5A 4I5GA 3OJLA 2H5LA 2FSIA 2EFJA 2WWTA 2YOGA 1GITA 4LXUA 3SBOA 2FGJA 3QWBA 2F7SA 4OYLA 3U49A 3P9YA 2UU9B 4GGPA 1LBEA 1H2YA 3K0KA 3KXPA 4QOGA 4AMYA 3UAYA 4BVFA 3ADBA 5J4HA 5GVSA 2JKZA 4PFKA 2IH4A 2Z1DA 3I4FA 2WSSD 1ZYUA 2C4MA 5F21A 4L6IA 4CKWB 3HWRA 1HYQA 2CUNA 4D3SA 5CIQA 2HIHA 1CK4A 1V26A 1YL5A 2KS6A 1JYSA 2WIBA 4UUOA 1Z6YA 5DDIP 1I0LA 4WNYA 4XWYA 3MJCA 3RJZA 5KNCA 1S8FA 3A70A 3V5NA 1AQJA 4IPTA 1KD1D 3KXLA 3FPLA 2NU8B 1FOEB 3QA9A 4GBMA 4AKEA 2P9CA 1M2GA 4J94A 3CLRC 2VP3A 3BXXA 1QWSA 5C81A 3BXGA 4AFNA 3JYPA 3IO5A 1GU0A 4J0GA 1PUXA 4QQ8A 1YFZA 2JAOA 1Z9BA 4PS0A 2HF7A 3TTUA 5EP1A 4K9OA 1XROA 1XV5A 2AYXA 2YC2C 4JL6A 3H7AA 1VHEA 2H2IA 4MUBA 5DM60 4C4ZA 3BIOA 2G70A 5B58C 5LKAA 4YRMA 2GQFA 3TKAA 1KJNA 5KOJA 5IK2A 1JEQA 4C0BA 5LJLA 2BMEA 2EWMA 1P9WA 4J0FA 1TI7A 4JQYA 5K2MA 3JZIA 3FAKA 3N6VA 4QATA 4EAQA 2HPVA 5ALNA 1C0LA 3IVXA 5F23A 4RPCA 2VF4X 2ZTMA 1QP0A 1H1TA 3E18A 4N01A 5T4EA 1OXXK 4B3FX 1RKUA 5K3FB 3OAAA 4U2CA 4GOND 1HZEA 1HT3A 3KK0A 3KLNA 4TTVA 2IV2X 2EKDA 4V02A 4F91B 1FDOA 3QYPA 1NPTO 4GMDA 3I42A 1Q20A 3RYIA 4UVHA 4YACA 4MSUA 1PWEA 5ECDA 3RSCA 4QGSA 1IY9A 4HMPA 2F8TA 2HWKA 3T51B 2QEQA 3CA8A 3C43A 5C4GB 4G5XA 3U9TA 2GVNA 2CJYA 4ROXA 2FPKA 3UENA 3MTQA 1EBUA 2W7TA 4JSYA 1UPXA 1U1DA 3FDJA 3I3OA 3FYUA 4UE3S 2RB5A 2WABA 5GIPE 1BRMA 2PZLA 2V7QD 2GMWA 2J0VA 2W22A 4RFLA 3NBXX 4RZSA 1DI0A 3VSCA 2W8BB 2R96A 3A7DA 1XCBA 4PPNA 1CR4A 1R4ZA 3ROZA 1BVUA 2AX3A 4FR0A 7ABPA 4Y1RB 2UUPA 3QFRA 2B34A 1GUFA 2ZSHA 3R24A 1ARZA 2W0MA 3TPCA 2WWRA 2OG1A 3SLRA 1PEDA 2FJPA 4KYUA 1L7VC 4A8HA 2WSLA 2R1VA 4C6TB 3RFUA 4GP9A 1M76A 3MTEA 3IIEA 1ESMA 3O8OA 1PNTA 3OCWA 2J0SA 3A25A 3A8TA 4QEDA 4R40A 1XTSA 4B34A 3U4IA 4B46A 2WUDA 2PKYX 1BX3A 1OE0A 2D0IA 2OCYC 2AG1A 2RHBA 2W6OA 3MWLA 3PXUA 4G5HA 4BMVA 3QUAA 3WE7A 1SCJA 3AI3A 3E7FA 4K6HA 4LZPA 2PMEA 2Z2JA 4XYLA 1W4LA 3GVCA 1LBSA 1V8BA 2HDOA 1SHZA 1CUYA 2EZUA 4WCFB 1US8B 1I51A 4XR6A 3IE2A 3N74A 2AFHE 4W5RA 4AF7A 3MRTA 2JK0A 3O8BA 1WTCA 3GU3A 1DQZA 1L8QA 2GGSA 3PQ5A 3FDXA 3VOBA 1JG7A 4LHSA 1Z15A 3HGTA 1NF3A 1U99A 5T41A 3T9BA 1A8SA 4F9GA 2VXOA 2UXCB 1VTKA 3CMCO 3RIMA 1T3LA 3LQQA 2FUEA 1VQ4B 2Q0HA 4N5NA 4RM3A 1VKRA 2R6AA 1PKXA 1A69A 2FWRA 2ZJOA 1P7YA 3JRNA 4UM9D 1OA1A 3ISVA 1YVUA 1CQIA 1M67A 3ZG6A 4NCNA 1MC4A 1E9SA 4P3XA 4YCDA 1G42A 4H08A 2AKYA 3CLRD 3P9IA 3DV0A 4UEQA 1T4CA 4EGAA 3NG1A 1XN1A 2XYVA 3MM4A 5EZSA 1XUOA 3RREA 3TIFA 1U8CB 4HVAA 4IM7A 1NJSA 2QM3A 1MJGM 3M1AA 2I4RA 2WFMA 1ECFA 1PLKA 3EVZA 4IOMA 4Q34A 3R8CA 3WSVA 4L74A 4EJ2A 3PHBE 4DCJA 3UQYS 1C9KA 2J45A 1XSEA 2GNPA 3IQHX 3V4RA 1BXGA 2BY4A 2RCNA 1VQ7B 1PT9A 2HADA 2SNIE 4HXFB 3WGKA 1QRTA 3VPSA 2QY9A 4XLFA 5CD1A 1Y1LA 1DIRA 2CXOA 1Y7LA 2JHGA 2Y8EA 2ZDHA 3F4LA 2GEBA 4TL7A 5I3ZA 4D26A 2II6A 5I7HA 3C3DA 1UMDB 3IAEA 2IZ6A 2JZNA 5DK6A 4EG4A 4PLHA 3A6EA 1P4AA 5EHQA 5CVDA 3ETHA 4JA0A 1JEOA 1JQLB 2QVCA 5K6AC 4HE6A 1K6JA 3HHPA 3BERA 3L8FA 1JAYA 4QICA 4AS3A 3INTA 1CUDA 2R7NA 1Y1QA 1Z68A 1T26A 2D1TA 2EW2A 1A9SA 2YICA 4C3VA 4EX6A 5ILOA 4JUIA 3EY4A 2QUAA 5B4VA 1KI3A 2QD1A 1F1BA 3NORA 5TVGA 3V1TC 3BMNA 4HJRA 3F8SA 1NI4A 1R18A 5IBQA 4B8YA 4HWGA 4NONA 4DJFC 4F2GA 3KOOA 4YCLA 4WZEA 3QSYA 1RI3A 5BQOA 4A2WA 1GTVA 3BRSA 3UV7A 2YVQA 2CWDA 2NT3A 5GJVC 3FYHA 5KTYA 1XF1A 2AJTA 1VL2A 4HX2A 3W6ZA 2RFLA 2SBTA 3M1YA 3D0RA 5FULA 4YP6A 1EHIA 2WUEA 3EVEA 4KNYA 4UFNA 1PDOA 1KQOA 3I6IA 4TWRA 2JIOA 3QLJA 5GJWC 4AK9A 3I0ZA 4JUAA 3DZHA 2D4AA 2PS9A 2GEDA 2Q6OA 3A4NA 2XBLA 3NBMA 3MF4A 2J08A 1PLLA 4DJTA 4IF6A 3EEOA 1WNFA 1EXDA 3FJ1A 1FQJA 2OXCA 2OCAA 2WT4A 2VP4A 2J1LA 3IS3A 1DSSG 5C34B 2CUTA 2Z9BA 3C3YA 3NJRA 1NQOA 4RF5A 3RS9A 3T53B 4OHYA 1W49A 1VGRA 2NLOA 4N65A 1CS0A 1E3LA 3I01A 2ZIAA 3J80A 3VR6D 1M1UA 3H1FA 1WG8A 1P18A 2O5CA 2OAEA 3EXHC 4M49A 4E33A 4RIFA 2G9ZA 1CZOA 1FRFS 4AT1A 1N9ZA 1JPJA 1R8SA 4Q7JB 2HK9A 3OPNA 1S0UA 3TLBA 5KX5F 2ZUEA 1T9CA 5IBPA 5B1IA 3UK7A 3QFSA 2NZXA 3GARA 3UXMA 2W71A 1P2SA 3BJZA 1RWWA 3PGJA 4TTSA 5L6LB 1Z4LA 4NHOA 5IARA 1BH6A 1H2BA 1TMKA 4RVGA 1ZN8A 2OB2A 3LO5A 4S0ZA 4XJSA 1LH0A 5K0BA 1SBHA 2H1FA 4RZIA 1GAQA 3KEFA 4PRLA 5K3CA 3RS8A 4DA4A 1Z37A 3PC3A 1V5GA 2DBZA 2ZRBA 5DBHX 2AJBA 1JL3A 2FX5A 2HIMA 3LP6A 3QV1A 3ETDA 3KSBC 2PEZA 3JZMA 4F9EA 4IYJA 1T6YA 4TWJA 3D3JA 1SXJB 5U4XA 3IEUA 2KQUA 3RBZA 4HXGA 2AFHB 2HCRA 3LQ4A 1GUDA 2CNLA 4I9GA 5CX4A 5KI6A 2VDWA 4S0XA 4O1MA 3HCAA 1PEKE 4HNHA 4NZZA 1ZK2A 2WHEA 3WL3A 1DKNA 1RBYA 1UMDA 4JJ6A 4RVDA 1Y6GA 1PR2A 1R9NA 3M4YA 4H6VA 2XTNA 1YZFA 5EP2A 2I3AA 4OP2A 1JX6A 4QHTA 2ZYDA 4RMJA 3O4FA 3VBCA 4MLDA 4ZZ0A 3JTMA 3VZDA 4TZTA 1BJRE 2BL4A 5BW8A 3CE6A 5EIOA 4GP6A 1TECE 3TBHA 1JZSA 4R5HA 3RNLA 4QNMA 3WIDA 3EQ9A 1T4CB 2DF8A 3KO8A 2FQWA 4MO9A 1CT9A 1TT5A 3V4VB 2XB6A 4OQLA 4EF6A 1HKHA 3RBVA 621PA 2ZB3A 5F7OA 2VQ6A 5KDDA 2QRMA 3MWYW 1O95A 4BCDA 4CTOA 4LF6B 5EWMB 2GEVA 1BXGB 3F7OA 3UQZA 4Z7OB 1SU7A 2P3SA 3MD0A 1GFSA 2HJWA 4DMLA 2VUUA 3CMAB 4GXRA 3QLEA 1X7XB 3L92A 5DU2A 3Q7SA 2Y1EA 3VPXA 3AEKA 1DJLA 3G6KA 3PFHA 2OGWA 4R1PA 4LSWA 4OHMA 2YNMA 1PJ3A 3ZZTA 5EZ6B 2XRZA 1HNNA 2XUKA 5CM2Z 4LDZA 3V9PA 3LDUA 4DKJA 2JANA 1SXIA 3QKSA 4FDLA 5H16A 5IJWA 1C1YA 1QYWA 3KB6A 4JIMA 1MT3A 1T8YA 1V1JA 2W6PA 3ZLJA 4CCAA 1W25A 1Q6YA 2H1LA 2HPAA 3SFTA 4KXFB 4ZYLA 3EZFA 4G85A 4DANA 4ZC1A 5C80A 4YRKA 3VDRA 3WNDA 1ZK0A 4HGQA 3H94A 1MH9A 1DAKA 2H2WA 3JASA 5CYOA 4EB6B 1P3Y1 2WJHA 1XNRB 5CCXA 1WXWA 1G1MA 3KVYA 2X86A 2HF9A 3FPCA 4TXNA 2X2OA 4X93A 5CNKA 3G2QA 5GV7A 4ER3A 4AJIA 3BSYA 2QRVA 2C9BA 3C87A 1IQ0A 4R69A 3ZWBA 1V0EA 3AWDA 4IDGA 4F2PA 1RHUA 4QJ3A 2IIBA 4GLBA 4IG9A 5FX2A 2VG8A 3BGWA 1PWXA 1SB8A 4WACA 4AY4A 2IZOA 5BR4A 3DAOA 2V5VA 4YDSA 2VL7A 1J99A 5SYNA 2F48A 3KJFA 2P9ZA 2EJWA 4C0JA 3RSZA 4LI3X 2C99A 3ZWQA 1GKUB 4JMPA 5EVCA 1S6YA 4HHEA 4TYPA 1VGVA 3ILYA 4L1KA 2CHVA 3PE4A 3PR2B 1L5NA 3DLHA 1BE6A 1KPIA 2JFWA 4NPHA 1OLUB 1SQFA 4JMQA 2XQGA 4IS3A 1AOXA 1KO4A 4LJSA 3TNLA 3GJRA 3EC1A 3SJAA 1JE0A 1FSZA 1NKVA 1U0FA 1W9XA 3DEJA 2R00A 3FPKA 1NLMA 1AKEA 4DY6A 5EE5B 3DDCA 3D1VA 5GM2A 3X1KA 4E1VA 5F4ZA 4YP9A 4Z2YA 3GRZA 1CIJA 3BRWD 3I5AA 4MRSA 3AKYA 4LRUA 3F2IA 5I9LA 4A92A 3W4IA 4NOLA 1P5RA 1MFPA 4CHTA 1X8JA 1DBIA 3UT5A 3IQDB 4RY9A 2VDUE 4WLFA 5ESXA 3N86A 4FDVA 1KZHA 4NPCA 3URKA 4MP3A 3II6X 4BASA 4CMEA 4DGSA 5I7OA 2ZM6B 2OCPA 4N40A 3KELA 3VTKA 5AJYA 4KE6A 2Q4DA 1OZAA 5BOVA 2NT4A 3TCXB 5IBCA 4KN5A 4E5YA 2ZJ3A 2QZJA 3PUJA 1KOGA 4MAAA 1UT6A 5DGTA 3Q6QA 1HL7A 3BGVA 2H9AA 3ZHXA 4K6FA 3H9EO 5F5LA 2GX6A 1GR0A 2I78A 3VPAA 2A92A 2JDID 4TV8F 4XDYA 4N0DA 3LKZA 2YJZA 4HPJB 2DB3A 2BGTA 4ZXPA 1GPYA 4E51A 2YCBA 4I9HA 4Q00A 5HMMA 1OROA 5ALEA 2OLKA 3D0KA 3KU1A 2QN7A 2RG1A 1LK0A 3HCOA 2GM9A 4TRJA 3TR0A 4WUVA 4HDMB 5ED4A 3T1QA 1RPJA 4F71A 2WJPA 2R60A 2R8PA 1II9A 1O97D 1U8ZA 2CHGA 1JDJA 2WI8A 2V97A 2WYOA 5A6SA 1WF6A 4M7RA 2R47A 2R8ZA 4UOEA 1VE5A 3HVUA 2D1SA 3MJTA 4OQFA 1ECBA 3UK0A 3MTAA 5T3UA 1ESDA 2DTDA 3IVCA 4ASUA 3AQ4A 1Z62A 1IBCA 3O1JC 4I4TB 1Z0UA 5CA0A 2B4AA 4L5YA 3LHSA 4BNUA 5A04A 2EL9A 1JR3A 2I67A 4JK3A 3VO1A 5COBA 2WSBA 5IYPA 3QUCA 4Y6QA 1GT91 1QV6A 2IYZA 4JJZA 4XGRA 1L5GB 4BV2A 4LJ5A 1ZI8A 2LUOA 1U9JA 3VX3A 3BDIA 1R4MB 1ONPA 1IMOA 1ZIOA 3M7IA 4J49A 2ZJ2A 1S02A 4YEDA 5EZYF 5HMLA 5LUBA 2FEWB 5FV4A 4WPGA 2GT1A 4TXHA 5ARBA 4ZHQB 2R4QA 1QHYA 1QVAA 1ILWA 4TL8A 3UT6A 3H9JA 4QT4A 4UOZA 1Y6QA 1HLFA 4ANFA 3PNVA 2XNSA 4YAEA 4GVPA 4ZZ2A 3P97A 3TPFA 3U3MA 5BMOA 2A0KA 2ZITA 1XG5A 1ZNZA 4CPDA 3E03A 4O25A 5IG2A 3LJKA 3CPXA 1DXQA 5M29A 3NYQA 1RJGA 1NIPA 3DL7A 4RTLA 1LWNA 4WVFA 4KPFC 3STUA 4OI1A 2CFCA 5J58A 4RC9A 3PA2A 2BM8A 2A3NA 4OREX 4DMKA 4OGLA 1PFKA 1EG7A 2C8VA 4R1MA 4V0ME 3UKDA 3E7WA 5JADA 2JJQA 1U2DA 2YBDA 4NR0A 3BBLA 4B4DA 1NVAA 1U65A 3CZCA 2OSVA 3RIYA 2ATIA 1IEQA 1FSGA 1V95A 3PUHA 4JYAB 2QTZA 1IY2A 3O2QB 3I37X 1WLYA 1QFYA 3AK4A 2PU7A 5FFMA 3R7FA 2C96A 4RHXA 4A6XA 5COAA 1Z3IX 5E7QA 4U5QA 5I7SA 2TMDA 3SU8A 1ZJWA 1V8FA 4KUGA 1G38A 4NBRA 3J7AC 1MH1A 5ILGA 3ZU4A 4RA9B 5LYYA 4IFIA 4TLAA 2ZZNA 3CVWA 4M53A 4K6OA 2VATA 4U9IS 5FRDA 4OLBA 1AO0A 3GT0A 1EVKA 2XCRB 5JJKA 1QRUA 3IERA 4CKCB 4JUCA 5DTEA 2DLCX 3LHDA 3A8IA 3ASPA 2I33A 1H2XA 2IYEA 3NHBA 3FPBA 5EXEA 1T8SA 2EGHA 3RRZA 4U7PB 2AMLA 3S7TA 3C41J 1GGEA 1O94A 4PAQA 4F97A 2WTEA 4UBOA 1XPRA 5DN6D 2QM7A 4LGCA 5H4GA 2YNMD 4FPXA 5CIYA 1CX9B 2R97A 3J81A 1O6BA 5C8YB 1WXXA 1N0HA 3CZ4A 4KHPB 3VJKA 5AHRA 4I1RA 3AETA 4E07A 3LK6A 4P0PB 3HGMA 3KXIA 3KEGA 5FI5A 1UFVA 3QMWA 5C8DA 2R6R1 2QNBA 3ZLUA 5AFSA 1YUNA 4BE9A 1BCRA 4EO9A 3WWEA 4IV0A 1WQ1R 2J8ZA 2XMRA 4RE5A 5LQSA 2XD9A 1U63A 1CYEA 5FO0A 1SD5A 2BRUA 1TQ2A 1RYEA 2BMDA 3D7NA 4CCYB 4EHJA 2XUFA 1PJSA 1CR2A 2PE3A 1WMBA 3CCFA 1HE4A 3GJ5A 4FE7A 6YASA 3TN7A 1IOLA 5E9WA 5THXA 3V76A 1K6IA 2SICE 3A1SA 3D3KA 3N2IA 3ZH9B 1ODCA 2ZULA 3CH5A 4WA8A 1RQXA 3T52A 2C77A 3S8YA 3U37A 2W43A 3WC4A 2XYPA 1UBGA 3M6MD 1DVRA 2JLYA 4RV5A 3CTPA 2EYQA 3PA1A 2EJBA 5AW6A 2WE7A 4RNCA 1QB7A 2P75A 2OE2A 3SAJA 1WDLA 4YRIA 5MGBA 3M4NA 3TW8A 1RYMA 4CEHB 2Q4EA 4KZPA 3HL0A 1CWUA 1WUKS 1E2QA 3IE0A 4YP0A 4CKZA 3LW8A 1PX2A 3ROMA 1XZCA