2V7XA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYAREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7xA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7xA01
2Q6LA 2CC2A 2CW5A 2Q6IA 2F4NA 2V7TA 2C5BA 5B6IA 2Q6OA 2ZBVA 2C4UA 2C2WA 2V7VA 5FIUA 2V7UA 2Q6KA 2CBXA 2WR8A 1RQPA 2C4TA 1WU8A 2V7XA 2ZBUA 5LMZA 1RQRA 2C5HA 4CQJA 2V7WA
chains in the Genus database with same CATH superfamily
4I4CA 4C0LA 1NNSA 2ZUFA 3T34A 2RARA 1M2FA 4GRIA 4K81B 4QHSA 1JDJA 3R20A 3RU7A 2C96A 4COOA 2IBTA 1OH6A 2RH4A 2FZWA 1N2GA 2RGGA 1HA3A 4RKRA 2MSLA 2QEXB 3DZHA 2XCQA 3NGMA 1Z0KA 2PZBA 2ZI3A 1HNZB 3B1FA 1DINA 3IP1A 4IDGA 3IESA 3SZ3A 3A4MA 1U2TA 5HEKA 3A6JA 3UKJA 3GLFA 1G21B 1SXPA 3BB4A 3S68A 1C80A 5DCLA 1SKQA 1NOKA 1T5SA 4Q3BA 1NM5A 2FMHA 2GEJA 2HWWA 1VLOA 4QQNA 1UDWA 1QC5A 4Z4CA 3GT0A 3OM0A 1CIJA 1LX6A 5KKAA 5SV2A 2XTZA 4E03A 4KK4A 2PU5A 1TRHA 3AWIA 3QVUA 3WGYA 2CXOA 1W6UA 3FMIA 2CWWA 1VC2A 3RRZA 3UJAA 2GZRA 1NBAA 4A2PA 4BVEA 2Q45A 2VHVA 4CETA 2NZWA 2WJPA 3OHMA 1ATIA 4LYAA 1MOZA 1TT5A 4PAWA 1L7AA 4ZEWA 2I78A 3K5PA 1VSVA 3WWEA 2UYQA 2YWHA 1C3EA 2WI8A 1BDMA 1ODSA 1RI2A 2ZTVA 4QSHA 4BZQA 1T4MA 2XXAA 4M60A 3RIXA 1Q50A 4OJTA 1NMQA 4UAJA 2HRQA 2PBLA 1XZCA 3STTA 3HFRA 4AAYA 2I3BA 4I5IA 3BTUA 3H97A 3TB4A 2J3IA 3Q15C 1TAHA 3FPCA 3VO1A 4KR7A 2VC2B 1A5SB 1JXOA 2O8VA 4AWXA 4DG9A 2IITA 1TO2E 4AP6A 1P2VA 4UNIA 3TX2A 1IN7A 1S2NA 2PZKA 3MPUA 5EEGA 1KEEA 3AVYA 1PEAA 4MMYB 4ZGBA 2OCBA 1ESCA 3MTBA 3TW8B 3IMKA 4GM4A 4BFCA 5EZYA 1YR2A 3G17A 2GD1O 1FPQA 1FSGA 3VPHA 3HY3A 1UDBA 1UT6A 4D97A 3LT2A 1WSAA 5C51B 2IYEA 1UODA 3SOPA 2FVYA 1E2HA 5HG0A 3L6BA 4X7FA 4B0PA 3G8YA 3AKYA 5BO5A 5JHGB 1BQ3A 4D1YA 1A5TA 1V8PA 4YCMA 1W36C 3W34A 1QO0A 1YMUA 1Z7GA 4IX9A 2VYND 3V8PA 2XZDA 3T94A 1P45A 3TGLA 3HVUA 1NLZA 1KEWA 4MGKR 3W7BA 5AW5A 4G9EA 2CNOA 3IUJA 1SBIA 2WIKA 4FGLA 4UBNA 1YBFA 5AI9A 3GLIB 1BHJA 3JQ6A 3HN2A 4CQLA 3CMAB 3Q3IA 4WFIA 1O4VA 4BBAA 3QWAA 1PV2A 1NKTA 3L4SO 4OPVA 3OESA 4NJMA 1IJBA 3KETA 5LP6F 4PCVA 1PP4A 2IPXA 3TI9A 4ZCPA 5T7BA 1Q12A 3FNHA 4G67A 5K8UA 3PQ4A 4JP5A 2IDJA 2XUJA 1AVTA 5F7JA 4QLBA 3PWSA 3PGMA 3SX4A 1Z6AA 4HL6A 3UNXA 4X8IA 3WLKX 4GUDA 3IHLA 2R8PA 3NHLA 5ITZA 1BE1A 1I4WA 3QVKA 4O2AF 1KJZA 5T57A 1QUEA 1CHNA 1NQUA 2FZVA 4KIJA 4YRCA 1QPZA 1ULTA 5I3CA 3EZ6A 5FOWA 3UJPA 2EZ8A 3ROFA 3KV1A 4X92A 4BFTA 3W5BA 2RE8A 5B36A 2P9EA 5C18A 5KWJA 3ETNA 1GGMA 1JLRA 4YLEA 5ANRB 3B89A 3ZC3A 3IFSA 3LDUA 2NADA 4IVQA 4BP9A 3A1VA 3KXPA 3PIIA 4L3WA 2W8ZA 4GYJA 1JKIA 3NYRA 4BOYA 1QFXA 2AKYA 2OHXA 2C0PA 2Q3CA 1YLOA 4L5CA 1CJCA 1SCIA 3L6CA 4GLJA 1VKJA 4DWVA 4Z1MA 3KYJB 3LCCA 4MKHA 3OEED 4F3YA 1EWKA 2A7XA 4YRGA 2DFPA 5C4IA 1R16A 3PFIA 5CK5A 2ZZQA 1XTUA 4B6QA 5GJBA 3UWDA 5LMZA 4C7BA 5JS2A 4LWPA 3IC5A 5AVZA 2O5CA 2OAP1 1KYXA 4E09A 1XPRA 3K70B 1SD2A 2VCYA 1XWIA 1EJBA 1LK7A 3FD8A 1GL9B 3OIDA 1TIPA 5AOBA 2DKFA 3ZGNA 3CNBA 1S2LA 2CC2A 1ZXXA 2NZXA 5KI6A 4HV4A 2IVFA 2C31A 3FPBA 4U2GA 5T3YA 2VATA 3T1NA 2ZUUA 1ENZA 2R68A 2HT6A 1T24A 4TWZA 5EIXA 4MQUA 5SYAA 1JW9B 4DSZA 1DEHA 4B7AA 3BY1A 5J4YA 4LXQA 4WWHA 5DGXA 1DRJA 5E7MA 5JSYA 4BGIA 3T1TA 1PFKA 2LIPA 4X44A 4YC7A 3UT6A 4EVIA 3TX6A 5GJWC 3MRTA 1SC4A 1W93A 3CVJA 3ITEA 5CFQA 2IV2X 3KZVA 1PZNA 2WYWA 3F7OA 1SK8A 3LCVB 2BCJQ 2F3TA 2ISQA 3NHMA 1ES9A 2JGRA 2JI7A 1YKFA 2YZNA 3R44A 4ONEA 5HS6A 4OHZA 3LVBA 1NSTA 2CXXA 3KEOA 4FSDA 2VTEA 4JYCA 3TPCA 2HCBA 1QP8A 1MVLA 3HWRA 1IH8A 1XZ8A 4PRYA 1SRQA 1XEXB 4RO0A 3I6MA 4OBXA 4ZJUA 1QVAA 1ZSYA 4OKIA 1HE1C 1XZPA 3BWYA 3CPSA 1C1XA 3IBCA 4WFKA 4OHWA 5DJ5A 4CM9D 2HJHA 4CMJA 5BSGA 5JTTA 5LYJF 3WGMA 5AW0A 5BNFA 4BO6A 5ADHA 4G0MA 1TYZA 2H31A 2Z98A 1H2YA 4P4GA 2COEA 4UMFA 1JQDA 2P90A 2PG3A 2V7UA 1PJAA 4JWKA 3MPOA 3DM5A 2QTRA 3BCDA 1TEZA 3PX2A 4YV1A 1EFVA 1ZOIA 4RPGA 3HJFA 2Q8QA 3IOYA 1Q1BA 1ZFNA 3OO1A 5FTNA 3NVDA 4E07A 1TPZA 2BL4A 5G4LA 4DDTA 2ZRIA 2JD0A 3AR3A 3SGLA 3D8UA 3H5RA 3KP1A 5AI8A 4W9MC 3H1GA 5A06A 4BAUA 1Y9JA 3NTUA 4WEOA 1XTQA 1P1FA 2VTVA 3FTFA 3DULA 4FE3A 1YIAA 3SHVA 2GASA 1JXQA 3F9CA 3T6KA 4KGZA 2HTEA 3ETHA 2R8OA 1E6EA 1MJHA 4N3BA 4RETA 5EVJA 3OFKA 5DI3B 1J42A 1KNXA 2JGAA 5AESA 3MWYW 3NH6A 4QRIA 1DC3A 1L5QA 2SBTA 2CLCX 4LJ6A 2ZT8A 2WJ6A 1H05A 4OM7A 5E0KB 5JNLA 4NTZA 5CCXA 1U31A 1ACLA 4WE3A 2G1JA 5FUXA 3VKWA 4YMIA 1A8PA 2XIJA 1QNLA 3QVLA 5DBEX 1D7OA 1UDXA 2W4QA 1Z6PA 3WP1B 3X43A 4HX2A 3UXMA 4S1WA 1NBMD 1RHJA 1P60A 5FI3A 1Q1NA 2BAGA 1BRMA 3QEKA 4AFNA 5HIAA 1E96A 4E6PA 1MH9A 5BQ3A 1D4FA 3ADPA 4Q47A 4V24A 4BGVA 5KJFA 4NEHB 1YS4A 3N05A 5CB0A 2ADOA 2VDWA 2QV0A 4B1FA 3A3NA 3VX4A 2GYUA 1X7ZA 3FBGA 3I9JA 4PLGA 4R2IA 1I2BA 3JAMA 3THWA 2CNKA 4UNQA 4EUFA 1AKEA 1DX6A 5CIYA 1UKCA 1G0OA 1FX0B 3ZUGA 1RHQA 1NFQA 2C00A 1GPMA 2Q5FA 4IWNA 4R3UC 5AXAA 3HJNA 1OAAA 2BGJA 2O0KA 2XMPA 4XSHA 2X3YA 3UUGA 3SJBA 1SBCA 2R6R1 1XRRA 3GJ0A 3IAM1 1XYYA 4FB5A 4GWGA 5IULC 2B4RO 2PRZA 1PGJA 2X4IA 4KVZA 3D3WB 2QXUA 3SQOA 1RXSA 3L7YA 4GLBA 4JITA 3VDXA 3NBYC 3BHMA 1OLSB 4ZCIA 4HOYA 3R3UA 4KKXB 3V1NA 1NZDA 1PJSA 3GGPA 4L74A 4OU4A 3RE1A 1MTZA 3G0IA 3KSMA 3MB5A 1LTQA 3B52X 4TWAA 1FFSA 5IFLA 2GCIA 1HF3A 4PAQA 2AC4A 4I14A 3K0FA 4PZZA 5IJXA 4B2PA 4ZZ3A 3FW1A 1P4RA 4AX8A 4QTYA 3LTEA 5I48A 5MN4A 3LH5A 3WMFA 3HQ4O 4EF6A 1J1UA 4BFYA 3C1TA 1T5LA 3FF4A 2I34A 1BQEA 4KVGA 1AQYA 1MB0A 1VXRA 3IEVA 3CCSB 4LFBB 3CTMA 4G2TA 3CEMA 3SMQA 1U0FA 2X6QA 3USCS 3ZQ4A 5CTJA 3AY0A 3QVVA 4WASA 5I47A 1XFOA 4GI2A 2QX4A 3IPXA 2DPHA 4OP2A 3DKVA 5EQJB 3K1JA 4UVIA 4EFMA 2N0SA 3D54D 5K20A 4HFRA 1M6YA 3PFBA 1CUSA 2BFWA 1KPGA 2FW9A 4E0BA 2HJWA 3EASA 3EOBI 3OCZA 1SQ5A 5BPHA 1F8XA 3NYIA 2C9BA 5K01A 3OEYA 1JVNA 4DV3B 1A1VA 1JE0A 2AFHE 4O4IA 4WUVA 4ASUA 2BEUA 5EERA 3RVSA 1CTQA 2FEKA 1SUFA 1L8XA 1ZEMA 1M6VA 5G53C 3MUOA 4NLLA 2F1JA 4CQNA 3MTEA 4OO3A 4R1NA 3CX7A 2MCFA 1UZAA 2OAQ1 4I2NA 2DWPA 2FDXA 4CR6A 1JHAA 2P3OA 1RU3A 4GVLA 2O2YA 2AF4C 3LUBA 1AD2A 5ENVA 4TYWA 5IX8A 3Q72A 4IXWA 4O0LA 3TR5A 3PTLA 5DDIP 4Y2UA 3PR3A 1PL7A 1VL6A 3ZU4A 4KLCA 4JK3A 3LI2A 3HG7A 2JIOA 4KXVA 1WAMA 3KKMA 4URVR 3OJEA 1A77A 4MULA 4KYTA 3FYCA 4L08A 5EE0A 1E6UA 4P1VA 1RHMA 4MROA 4C7VA 5TMDA 3ZV3A 3LYAA 1PNTA 1XTKA 2WG0A 2YS7A 4Q39A 4X1KB 1TF7A 2B36A 3CXUA 4RGQA 2ZXUA 2OFWA 4UPEA 3V8QA 4MKRA 4B83A 4IH1A 4XSVA 2YJTD 4RGVA 3MTIA 2WAYA 1QHHB 3TW0A 5GM2A 4U0JA 2FMIA 4NE9A 3DTVA 5CVTA 1Q1ZA 2Q1SA 2VPXA 2X9QA 3HB0A 4N47A 2X0EA 4MA5A 3WO1A 4AZ3A 2QTNA 5JJIA 2Y2VA 4FOTA 3FMOB 1EK2A 3JQAA 4UE6A 5E7JA 4BO5A 1SXQA 1CY7A 3GRZA 1Z33A 1WSVA 1Z4QA 4GM1A 4KPUB 2J41A 4KN5A 4G25A 1QS0B 1YR1A 2FOXA 4GYYA 1J1IA 4MPJA 5U1PA 2YNMA 5HXAA 4EUNA 4JI2B 1NYTA 4IXTA 3T5DA 3QUQA 2BDEA 3E3LA 5DGIA 2IHUA 4OMFG 1H9CA 3GZTB 2FPLA 3VR3D 3CT6A 3R6DA 3L1HA 4E1BA 4FZ5A 1E0DA 3CZCA 3Q7QA 1OAKA 2Y1XA 4EX7A 4MUJA 4NBNA 4TXJA 2PMKA 4WLFA 4NS4A 3VC3A 5FA5A 5DNYB 1NT4A 4UD2A 4BTEA 3JVDA 1X94A 2C2BA 3DO6A 3ENNA 2BI7A 1XIVA 3V1LA 4RHEA 3P2JA 2OZVA 1BXGA 3GLHE 4CM7A 1W2WB 2UXBB 1NMXA 3PA2A 1WDLA 2VBIA 2B1IA 2NGRA 2J48A 4QUIA 2WR8A 2O5RA 2OAEA 2BF7A 3W4KA 3G5MA 2BIFA 3VAZA 4DNRB 1NJFA 3QPDA 1DLJA 5AXDA 1P7CA 3CZAA 4EATA 3CLHA 4QICA 4EJFA 4S1TA 4AZSA 2IE8A 3I5YA 4OTZA 4L8LA 4Z9AA 2GZDA 3RUFA 3GL9A 5IYZB 4AQ7A 3AUYA 1OMOA 2I1VB 2AN3A 3B9BA 5JRZA 1X1EA 5ECGC 4IV5A 2CVFA 3W5AA 1E3WA 2F43A 1H93A 1P1IA 2MYPA 4CKWA 5KC9A 4PZLA 4OL0A 3I09A 5DLYA 1SULA 1Q91A 4LXXA 5MFPA 1SBHA 1SU8A 3LT5A 1IHYA 3ROKA 3F2IA 4BLPA 1F9AA 1BHSA 1V8DA 3PP8A 2XVAA 3NUQA 1A4XA 3VJLA 1J0XO 4GGOA 2JC3A 1OB5A 2OP1A 3AB3A 3ROQA 3OEWA 3KOWA 2PUEA 1D1QA 3EXHA 5KSYA 4G0UA 2BI8A 2Q4RA 4J3JA 4W1SA 4R1MA 3IQDB 5ECDA 3S5UA 2Q5JA 2J9XB 3CZPA 1F60A 5G41A 1IEQA 4WXMA 4C0KA 2ZATA 1EB8A 1XT6A 1XZHA 3UGJA 4CEJA 2CJPA 1WKBA 1Y8AA 5K45A 2AUNA 5DN6D 3NNNA 3PD1A 1CF2O 2AEEA 2NTEA 3DT9A 2IWRA 4F38A 2HLDA 2C82A 4PWYA 2D3TA 1KAMA 1T2NA 4BLTA 5CNKA 2R60A 3AXTA 4BRWA 4R8MA 1K1EA 2WFAA 2LCFA 1EFKA 1N2JA 1O9HA 2QDXA 3U17A 1O0BA 5JZMA 2EFYA 3BD7A 3L06A 3BXOA 4XOTA 2O2CA 2EJBA 2FN9A 1B8OA 3IAS6 4FYMA 4RMIA 5K0JA 1KQPA 1DCFA 3TLZA 3EC2A 1LB1B 5AVOA 4KRFA 4EEXA 1CLEA 4I6JA 1OKKA 3QX8A 3IE1A 1E99A 2VT7A 1PHPA 4MCJA 4PGGA 4A6EA 4OXRA 1R00A 5EXXA 2P4QA 6ABPA 3BCHA 1C81A 1FVXA 4II7A 4Q9KA 3O7WA 2YINC 3O95A 3KOMA 4A10A 3R5FA 3D1JA 3E8XA 1ODKA 2VZEA 4MWTA 4XYGA 4M1TA 5IDQA 4YJKA 1TQ6A 4G1BA 2IH5A 1Y5RA 4RC9A 4YRQA 4GMDA 4XEHA 4PLZA 3VKUA 1U94A 1YULA 2E3JA 1HX7A 4KKVA 1YJ9B 2DE0X 2GBGA 2OV2A 3OT5A 4U9HS 4ZO7A 2HOQA 3M34A 3L8ZA 3OA0A 5I4BA 2PMCA 3L8YA 1WLSA 3Q8XB 1Z6QA 3OFNA 3C3MA 3CE6A 3HMQA 1VJCA 3DD5A 1ZK4A 3QKTA 5G0TA 4W5OA 3VU9A 1N07A 3MHTA 5ALIA 1RJ9B 2ONZA 3QE4A 2JD1A 4DWWA 5BYKA 5JZSA 3WFJA 1XX6A 2I03A 1V0JA 1JJ2B 4JB3A 3ESRA 3ZVLA 1GGHA 1YBVA 2OQIA 4Y2SA 3H94A 5GZ6A 1BU8A 2FETA 1WBBA 3HL0A 4RZXA 1G5PA 2BWJA 3DKPA 1V3VA 4NNOA 1FTGA 3WGNA 5DF1A 2UVPB 4MAMA 4TVSA 1XK6A 2GD6A 2J3KA 2X5JO 2BMFA 2QL6A 1SOMA 3N58A 4RK7A 4BP1A 1VBFA 1JDBC 2CLIB 3SEJA 1HURA 2AMVA 4LNAA 4OUDB 4U7HA 3UAXA 3SQXA 4EY3A 2JIPA 5ELMA 4X05A 2HMSA 3ANXA 3KT6A 1PJTA 3NEYA 3IIJA 5BWBA 1G3UA 4XL9A 2JGNA 3NONA 4D9HA 4CCAA 3T9FA 5AW9A 5BSXA 2W98A 4IGFA 4TV8F 4RCYA 3C3JA 4TLDA 5CR9A 1E89A 5JDIC 4W5QA 1U8AA 3D0OA 5IDWA 1M6HA 1Z0AA 2WJZB 4MO2A 4MR7B 3NRCA 1SJ9A 3JYOA 1LA2A 2VDNB 3QPCA 3QTLA 1POWA 2G8LA 4LEIA 4NULA 3WYNA 5IBCA 2HPZA 3IO3A 5BWNA 4ZOLB 2CV1A 1KYQA 1ULZA 1PS0A 1Q74A 2X8LA 3GLUA 3KYIB 1WVIA 2ZUEA 2O1SA 3DC7A 4BDTA 3PF8A 4C07A 5AVVA 3ND8A 4IDAA 2XDWA 5JY1A 5J2UA 2PBZA 1T4CB 4HBGA 4LHZA 4ROSA 4Y9TA 3SC2A 3SJUA 5CCEA 3BEOA 4E0FA 1QH8B 2PM8A 4DZRA 2I1QA 5IWCA 1NPYA 4MIOA 2C1EA 4WACA 3KQHA 1M2VB 1RQPA 1NR7A 2RGDA 3DUFB 3OE4A 3QPAA 3W5IA 4QX6A 1OH8A 1FW8A 4KKUA 5ALRA 2H4XA 3UWPA 4X1YA 3OCUA 4DA9A 1M8GA 3T3NA 1BFDA 1FVOA 2WJ3A 2JD2A 3OOSA 5G2OA 2WKSA 1JZTA 1TZMA 1M8JA 4HFNA 2E6UX 2H0QA 3VISA 4EAAA 3QEAZ 2HYIC 3ODPA 2QLJA 3K71B 2BZSA 4M53A 2NOAA 2B2CA 4TTSA 2OLKA 4YP5A 3UF0A 3TBKA 3L4EA 3M33A 2OHOA 2D7DA 1TZCA 1GHTA 3AUSA 3WDMA 3C74A 5KYUA 3EGIA 4BQEA 1X1QA 2Y1LA 2G82A 3WGGA 5EPUA 3ZDEA 4R3WA 3IP9A 1DPGA 1V2GA 2I4MA 4FI3C 3NVMB 2V6JA 5C4GB 4RE5A 4LJLA 3WYGA 1TECE 1A2KC 4J0QA 1SKYE 1TFUA 5CLIA 3U44A 3IILA 1E3TA 1TCCA 3GZNA 1U3VA 1QTQA 4XVQA 1IB0A 3AF4A 3G2PA 3W9SA 4ZVUA 1Z0JA 2G80A 3AEQA 4Z1OA 2QTBA 4L28A 2QMUA 1T8SA 2QM8A 4WUTA 5ESDA 3OZBA 2ZBQA 1PT6A 3CUWA 3OLCX 1L4EA 1MIOA 1SXHA 2AT1A 3NNDA 4JBIA 2HBQA 1UMBA 2O5VA 2ZB7A 3L3BA 3NXKA 3NWPA 5BYBA 1Z8HA 2VSNA 2X5XA 2ZLBA 1GU0A 4FEEA 4O25A 1L8QA 3IMFA 2FPXA 2W5UA 3OZCA 4UDXX 5A4IS 4LF7B 5H0IA 5TGDA 3MGBA 1V1JA 1TA4A 3W3AH 2HGSA 4BFWA 4N0QA 4DLNA 4EA6A 3G2LA 3W90A 4DQLA 5SICE 4QPPA 1XPJA 3U5TA 4MVJA 3TLGA 5IVPA 5TXGA 4I1RA 1D2CA 2BTQB 4L0DA 1Z6ZA 2CVPA 4OXNA 2IRWA 1CRLA 1HLFA 2ZYRA 5F1YA 5ICFA 4YS6A 5ARCA 3FPAA 4XIGS 3UJCA 3B78A 2Z1DA 1QYXA 5H7XA 1EFCA 5IS2A 4G0XA 1ZMOA 5E6UA 4EO9A 3THXB 3D6VA 3IKMB 9LDTA 3M6AA 4OI4A 1ESNA 1LWNA 3AZPA 4HE5A 2A5GA 3LCJA 3TUIC 4AN4A 1PG2A 3K8ZA 3B9RA 5IF3A 1OZAA 3FOWA 1AJEA 3NC0C 1DIOB 3IJRA 2EKBA 4QTUB 1M6NA 4NCHA 4REQA 1E8MA 1VRWA 4I46A 2FY8A 2JHAA 4JSYA 4O4LA 4C2TA 1VP3A 2JJYA 4R0VA 1SBQA 2CZCA 1VQLB 2VJIA 1YJQA 2Y9MB 5JAOA 2GPBA 4UFPA 1G9TA 1P2SA 4E21A 1WOPA 5KYWA 1XKLA 2IYNA 5I9BA 1UP7A 1ZI8A 1XNRB 5EVCA 1ARZA 2C78A 2D59A 3NV9A 5E0OA 1O0CA 3IQZA 3WGUA 1KVRA 5K09A 1AMNA 1U9IC 1RYFA 2DULA 5JD4A 4ZYXA 1VPWA 4YQFA 1RCFA 1J2RA 1EX9A 4K7JA 1LBEA 4Y18A 5CM9C 1BKDR 2IY8A 1MEEA 5A4MS 4MWOA 3AR9A 2WUDA 1K8XB 3LBAA 4WY2A 2FU5C 1HORA 2VP3A 3TJMA 3U39A 1Y1PA 2JDID 2QROA 2AG8A 4M0CA 4P3YA 5C3UA 3S7ZA 3BC9A 2JHGA 3U1VA 4FEAA 4L4XA 2Q41A 1AKWA 3IOEA 3STYA 2PKYX 3B53X 4GNKA 4GSYA 3SE0A 4ALKA 5A3RA 2X2EA 1EEHA 4PXSA 3BAFA 3RSLA 5LQAA 5JRJA 2QZ9A 5JH7B 1WB4A 1EK5A 3EIHA 4AMZA 2HU7A 2XTNA 1J39A 2WB2A 2DFNA 4RHTA 2YMPA 4TM8A 1J8YF 3BIJA 4PEVA 5AVRA 3BHIA 1YU6A 2BBSA 2CVOA 2GZ2A 4AECA 1DG3A 4DIBA 3OIVA 2HTFA 2NN3C 5FBVB 3AHHA 1M1XB 3DH0A 1P4MA 4IH4A 1X8JA 1NE2A 1JG2A 1UXGA 3AINA 1C1YA 3HKDA 4LYJA 3VH4A 5F3WB 1J7JA 1AV7A 1NOJA 2ZSJA 2CLLB 4DJTA 1CEXA 4N8DA 4Z99A 4DMCA 1R64A 5HQ3A 1IBSA 2Y6VA 3BCUA 5HCNA 4WK6A 3WL4A 3EPJA 3FKSA 4DT1B 4DCGA 1HE3A 1RTKA 2QQ5A 2V8OA 3E3MA 2PXAA 4L5JA 3VR5D 3HACA 4BXOB 1PGPA 4KG7A 3R7AA 1EFAA 4FINA 1B74A 4BVFA 1T5BA 2HSZA 4BO2A 4MITA 1S3GA 1R5OA 2D54A 3ILXA 2YW2A 2Q4TA 3OAAD 4DN6A 3ASYA 3DWEX 3BQJA 4XE5A 2WSLA 2FEWB 4K5QA 5EI5A 1OT5A 3C8DA 4NONA 4RFLA 5JXWA 4HSGA 3PT5A 4WLOA 1G6OA 1NVUQ 2PV0A 3HPQA 4TV9B 4ZQHA 3V4OA 3CIOA 3D6HA 4WXHA 2YKGA 3T5BA 2BFCA 5ILOA 3GLFB 3RRMA 5D1NA 3U3KA 3TN7A 1GZ4A 1X1DA 2JCGA 4PTYA 2DLCX 3QIAA 1QC5B 4TUYA 5A5EA 1YZQA 3L4JA 5HJ2A 3CP8A 1ZHOA 3E48A 1UF9A 2WLTA 5B3AA 3CO5A 2LCQA 521PA 4A36A 3M6WA 3JCZA 1WL8A 1ULBA 1NDQA 3JQ7B 1QRUA 3E82A 4M7RA 3OF2A 3W4JA 1O58A 3IBFA 4QPZA 2OQVA 3MTAA 1CXZA 3FGOA 2HSWA 1QAOA 1TT5B 3RKRA 4WZBE 3DZCA 3WGOA 5CDYA 2NNLD 3LECA 4OMCA 5EHNA 1FK8A 3IVRA 4A2WA 1A9PA 1ESZA 1YOVA 2CLMB 2XXAB 2C2WA 1A95A 3P9PA 3CC2B 4K26A 2QUKA 3VXKA 5JMOA 3SC4A 1G17A 1GKYA 1PUXA 2OORC 2VP4A 5LMCA 2PKXA 3OCYA 1MO2A 1KY3A 2JFWA 4QBIA 1XD8A 4X84A 4TKLA 3O26A 4S1PA 4U2BA 2VDRB 5FDFA 4FCWA 5LSAA 2ZJ6A 4CFYA 1JA0A 1K89A 2B8JA 1TUEA 2BR5A 3SNKA 3J80A 1KEEB 5E4YA 3A3PA 4WXYB 5KHAA 3ZH2A 4JJ4A 1U7ZA 4MZXA 1YCFA 3TSYA 1F06A 4U2DA 4W8OA 5P8WA 1G63A 4Z5XA 5C9ZA 4INOA 5EZYB 4FNMA 3AF1A 1P74A 5M34A 2QVLA 2XWJI 1NKSA 5FHQA 2YJ3A 1QHFA 4E1VA 3HJUA 4S1VA 1X7WA 2G28A 2IPMA 2ZXEA 5TPWB 3X2FA 4C3UA 1JZSA 1R6UA 2YTZA 2BKAA 2QGNA 3D43A 4EI2A 1BFKA 5DB4A 4LFAB 4XCQA 5D8DA 3NWBA 4TLCA 4W7IA 2H7CA 3VO8A 1HDXA 3A4VA 3A9CA 2QVYX 4RZ2A 2HUNA 4CQLB 4F3NA 3PX7A 1P6UA 4Z3OA 2O2ZA 4NJMB 4DCNA 2OE2A 3EF0A 4WKOA 4NE2A 4KSBA 1PIWA 3RVPA 4BU1A 4OOFA 1ZDMA 3DNFA 4ND4A 1C0EA 1WUIS 3PCXA 1TA9A 2OD2A 3I32A 4ZC8A 4B76A 5D01A 2WJHA 5E8RA 3ZLJA 3P0EA 3CUEF 3O4FA 2DFVA 1YJCA 1TF5A 3H0CA 2AE2A 4NARA 4WZ6A 4ARIA 2B8NA 2RGXA 3SBDA 3STUA 3UT5A 4AG5A 4CMCA 2N75A 5JD5A 2CCGA 4LZWA 5ITZB 3Q7RA 1K6XA 4GD3Q 4UUQA 4RTPA 1QLJA 1C50A 2JF0A 4UHCA 2VJAA 2W71A 4CG3A 1Q7YD 4RS3A 4CKXA 1Z26A 3TZEA 4C4OA 3F46A 4OP7A 3E58A 3GDFA 4ZAWA 3TIVA 2ZRGA 3T7CA 1X38A 1WW2A 2IHVA 3S40A 3S8YA 3Q8MA 2A4KA 1L3BA 4INPA 4U7FA 1OBCA 4P32A 2OUIA 5KTMA 4PXYA 5J4VA 3PNPA 2B8WA 4HF7A 1B2RA 3FSRA 5EJ7A 5K4HA 4YHBA 5BQPA 2JFGA 3RU3A 1OVGA 3GUUA 4Z4TA 4EG0A 2P3QA 3E9EA 4DMLA 4HZIA 1DO0A 4YPVA 2L18A 1YQDA 1W34A 1KMNA 2CHVA 2XDAA 4FNAA 1HNXB 4FDLA 3CW2A 2PS1A 1R66A 5FI1B 4BVGA 2ZJAA 3EMBA 4KLRA 1MH1A 2CVHA 3DW1X 4CL3A 4EW3A 2XUHA 1UIMA 1P5RA 2HA4A 2ICAA 3C6KA 3P0RA 4ZEVA 1E3DA 5I7OA 1FYDA 1Q5PA 1M8KA 3CRRA 1RWMA 2J5BA 2VJBA 2OWEA 1RABA 3FROA 1RQ7A 1KNQA 3U7QA 1QQBA 2LKDA 5G0WA 5AN9A 1ZW1A 2LDBA 2H3EA 3V5NA 3FAZA 1ID8A 5FR2A 1NP7A 3GP8A 2PPVA 1GUBA 4A0FA 5AKKA 1MPXA 5JS7A 1MP0A 5JXGA 1VLZA 2ZJ7A 4LV6A 2C07A 1CR1A 4TS3A 4ALLA 2V58A 2H48A 1D2MA 4O4JA 4QLOA 3UAZA 1IM8A 1XDDA 4BZZA 4KXWA 1NAIA 1E1CB 2I2XB 3AUAA 4QVJA 1IMJA 2DHCA 2EKPA 4NX2A 1CY8A 3GVIA 4ZAZA 1K5PA 1UZLA 3EIWA 3K4HA 3KB1A 3UMSA 1NATA 4R9RA 4URYR 3ZZTA 2D2EA 4AJ9A 3LQFA 1T8RA 2GN1A 2UZ3A 4UOEA 5F1KA 3TCXB 3PQ6A 4R9UC 3QLUC 3PCTA 4KAAA 3Q0EA 4W7HA 1PJ5A 4MRRA 5TNXA 4I19A 1XLTC 3ZE9A 1XZKA 4EAQA 2LZ0A 2QQGA 1O08A 1CF9A 1OFVA 2NT3A 3OHSX 3TZKA 6NULA 1XDUA 1FBTA 3GLIE 3OU2A 5MGNA 4KI0A 2K87A 2GPWA 2IU3A 5BURA 3CCMB 4ETMA 4TMKA 3IT1A 1XCMA 4PZPA 2I9KA 1FTWA 2B92A 2ZRJA 1LQ2A 1QVGB 3VUEA 5AVXA 3BDIA 1TLTA 1KYTA 3VV3A 2NVUA 2XMSA 2OCDA 1C1XB 1T91A 2QL5A 4H3SA 4C4YA 3UW3A 1K97A 3IT2A 1EQAA 1QO0D 4HP8A 4KFTA 2EDAA 1B0AA 1E94E 2LWIA 2C3OA 5H59A 2J33A 1ILEA 3OURA 3AHCA 3R6WA 4QDOA 2C7QA 2OYNA 1EFVB 2WM3A 3K31A 2DWUA 4D9FA 4YRSA 5KCMA 1IXYA 2UUOA 1E9EA 1E69A 3OKCA 2FTKE 3CUYA 5DYWA 3CKLA 3TF5A 4QGSA 3NHSA 1QV6A 1ISMA 3NCHA 4QDTA 1OFUA 3I30X 3RVQA 4DRXB 5CG2A 1QR6A 4TVOA 4K88A 4Y30A 1GKUB 4GIBA 3CBQA 4MIYA 3WRXC 3E81A 5BR1A 1U3GA 1E2LA 4H6XA 5L3ZA 5K0EA 3VR6A 1T0IA 1P9WA 2C29D 2CL5A 2I6QA 3H5WA 3MQ2A 2FR8A 1MQ8B 3C7AA 3PYLA 2W6JA 4KGXA 4DQUA 1FFDA 1T2AA 1MG0A 3LY8A 5D1HA 5JCOC 1HGXA 4L51A 3V3KA 1T5EA 2VBTA 3ETLA 4HK4A 4Y2PA 4YJFA 4BUZA 2W6IA 5CYGA 4TL9A 1DELA 2YV5A 4OQPA 2ZYWX 3T5TA 4BLVA 5FLEX 3D4BA 5CM2Z 3MRXA 3ZWBA 1NI4B 4QASA 5HUHA 1U0LA 4FX5A 4FIDA 2WF8A 4DLRA 4GKAA 1U6KA 4AKSA 2VRCA 1OXSC 4RF5A 1FCJA 2AMYA 2VA8A 1H1DA 3RRYA 4OQFA 3V2HA 1ULHA 4JP1A 3DDNA 2VDWB 5B3KA 4QAJA 5FA6A 1E7MA 1IOZA 1GPH1 2O7NA 2CXNA 1JSLA 2FH5B 2Q5EA 2YZGA 1X15A 1X1AA 4FE7A 2VQSA 2YWDA 5DT9A 3LC2O 4FX2A 3ZJ5A 4EF5A 4MHSA 2NV4A 4GOLD 5LQUA 5ETJA 4JUBA 1GJRA 2HMUA 2P9GA 3VTFA 1JKJA 2OQ2A 1YQXA 2FPMA 2WJYA 2IPLA 2Q5IA 2ZTSA 3LOPA 4EW2A 2PXXA 3N0XA 1E7QA 4BLRA 2CZQA 3EYWA 3OQJA 3A0UA 2A57A 4G4GA 4LGMA 3ROZA 4RMJA 1P1KA 3GZ4A 4BX3A 1AKYA 1SD5A 5BNWA 1L8AA 2Y8EA 2BY4A 1GCOA 2H9IA 4N9QA 4LF4B 1XTPA 3LFHA 4RA9A 4WMLA 4LQDA 4NFHA 2JKYA 4C1BA 3NYQA 3B13B 3PE4A 1VI5A 4NCJA 3KWLA 4D0RA 4ZYLA 2ALJA 4OOSA 3HHPA 1N6IA 1IG3A 3JQBC 2W7TA 4GM0A 4HB4A 1VSTA 4ED9A 3DBLA 2O7RA 4HS4A 1ULSA 2CBGA 5AIAA 4H4DA 3SBXA 4A5OA 4ZK6A 1MZVA 1Q83A 3CMCO 1NRJB 3NP9A 1E3QA 2X0IA 2Z2ZA 3V8MA 1IL0A 4M0PA 2L0XA 1VSQA 4ZYVA 2MSKA 4EPTA 2DLDA 1YZKA 3EDYA 4XOIA 1EP2B 3GQBA 3SLNA 1V39A 2JAUA 3H9GA 2ZYIA 2WV7A 3PRKE 3MF4A 3AU8A 3I34X 3GAMA 4IP0A 5D84A 5EXSA 5G1NA 3SC6A 5E3HA 4LRYA 4FLFA 5JI2E 2ZBFA 3P5BA 2B7LA 2R66A 4IEEA 5CLGA 1KQSB 2ZIAA 1I3KA 1QX4A 2PXCA 4OGKA 5AW7A 6ADHA 4OHMA 5DZSA 4PLPA 2JJ8A 3PJRA 2QUIA 3HCBA 4EGSA 3G23A 4ZC1A 2YRFA 3U26A 4DLPA 4UE3S 1ZUIA 1GNVA 1TAUA 4TSFA 3NT4A 3M83A 4PU0A 4TMFA 2J1LA 1V45E 5FUQA 3K6SA 1TU3A 1UD6A 2PGJA 2CLSA 2D5BA 3DL2A 5J1SB 2I4OA 1Y7TA 1B6RA 2A14A 4O4IB 4HQFA 4IUYA 4UPDA 3L40A 4YUXA 5ICGA 2IX9A 2Q7OE 4LJAA 1VIAA 3SG0A 3QXGA 1M6VB 1XF1A 3GIRA 1ZD9A 5IYZF 3L7JA 1GILA 2GEDA 2ZQYA 1AY0A 1QG6A 4GICA 4XDHA 4XOUA 1TFRA 5BVGA 3GZJA 4W5NA 4YCAA 2ZS9A 1W2HA 2H9AA 2R1TA 4LRSB 1L4GA 3U3XA 3WE7A 3DBIA 1PJ7A 5ILGA 3FSGA 3PDUA 2C9MA 2A2ZA 4IDBA 4I1VA 5LB2A 2HJVA 3PFHA 4JVMA 1FSSA 4TMYA 1TMKA 3AGQA 3LX8A 1L0BA 2YY6A 3R5KA 4IYJA 3RJZA 3WJ2A 1OX6A 5AUOB 2PO5A 1TEXA 4BLUA 4ZO6A 3MYRA 1JA9A 1XZJA 3L7NA 3ZDXB 1YVUA 3O75A 1LJLA 1SU6A 4IIBA 3C87A 4LY3A 1K4YA 5K6AC 4GSKA 5CEFA 2WAXA 1VLJA 2RC5A 1NJ6A 1XZBA 3GXOA 4TTQA 2DIEA 1KIMA 1Q7TA 2FUCA 4DLKA 2JFZA 4R2WA 3H9JA 5IUJC 1DC4A 5FTWA 1DBIA 1EA7A 3O4HA 1TKRA 3DTVB 4L85A 3E18A 2OOSA 2CDNA 3ASPA 5TGTA 5CDFE 2HK9A 2C9YA 4AZ3B 1DQSA 4E13A 4YT2A 3JQAB 5FKJA 2NXEA 4RTKA 3C7KA 3K5HA 1K3UB 3VYSB 1V5VA 4Q6BA 4J1QA 2DOGA 1C8VB 2JGDB 2ZDGA 3QYAA 4LYDA 4TN1A 5SY9A 5F4MA 3A7EA 2ZSHA 1DAEA 2E6KA 1YAHA 3C5CA 2RAUA 2DLNA 3IO5A 1OWNA 4XM2A 4C0HA 2J5KA 4HWTA 1S2OA 3RC3A 1KP9A 2HI0A 3LUFA 2X42A 2BRUC 4N03A 2X1MA 1ZUHA 3IHTA 2R6AA 3SPXA 5FH9A 2OV4A 4QODA 3M2TA 3KSRA 2Q1WA 5L7WA 2PMWB 3MTGA 1FDIA 4XNFA 1PX2A 2ID8A 3IAS1 4RLFA 3RT9A 1E8NA 2Y4OA 1AQLA 4U9UA 2C61A 3A10A 4FR2A 4JGBA 4Y2JA 3ZGVA 5IANA 4X6UA 1AHPA 1IOVA 9ABPA 1BXGB 5B6PA 1T0UA 2O48X 4KUGA 3HJAA 3DZIA 3HRHA 3MIIA 5EUMA 2FWJA 1T15A 4J1NA 1BNCA 5F4ZA 1IPEA 2G5PA 1W73A 4ETNA 4YV2A 2PX0A 4Y0NA 4YRTA 2XKKA 4KFCA 3QJYA 3VPAA 3TVTA 1DEOA 1YZFA 3GPBA 1Y8CA 5EA2A 5JDIA 1VQMB 5FV7A 3QOWA 5DGHA 1E1QA 4HGOA 3BWXA 3QW2A 5B1DA 3PE3A 4Q37A 2QI9C 3X1WA 1KMIY 4BMCA 4MDYA 2FAXA 3I4CA 4ILEA 3MT7A 4FDVA 4Q3DA 4CKWB 3T3EA 2O0HA 1ADCA 3FXAA 3CZQA 2AD1A 2ZRFA 2D74A 5GZ3A 3AF6A 3JD4A 3PGXA 4J0JA 5EZ6B 4CLRA 3IPCA 1K66A 4GKBA 1FRVA 4OHCA 5ITSA 4C4XA 1IIRA 5JYCA 2W90A 4RWEA 2VBGA 4H1HA 5FPYA 3LKDA 1K5GA 2EHDA 1V7PC 3EXHB 4IQGA 4QREA 4ZVKA 3VZCA 4A0HA 1Z5VA 4M46A 3DEHA 2X3FA 3MHPA 4ENVA 5KC8A 1NI3A 3REOA 4RTJA 2VT3A 3FTEA 4QOJA 3R8CA 1QH9A 4BO1A 1IN1A 1W5TA 3C6QA 2DYKA 2DJIA 2QSJA 2GVNA 4IQFA 4CEJB 4ZOLF 2VPYA 3P94A 3TUZC 2PMBA 3ICEA 3I0MA 4WTOA 4KH0A 3AETA 4RIGA 4P0TA 4QWMA 5KNLA 5B2ZA 5J4KA 5TR9A 4PIPA 1QWSA 4ER6A 1EXVA 2R751 3M6IA 1O94C 2A9KA 2YHAA 4DYVA 1F7VA 4KAJA 1CJKC 2EF0A 3HCFA 1IJKA 3SZOA 1QHXA 5IJ0A 1FMLA 3IDOA 2UUCB 3DEAA 1OY1A 1WY5A 2XYHA 4DB4A 5A88A 4Q9AA 3HH8A 1JKFA 1QG0A 1OC2A 1UD5A 4ZANA 3JR7A 5TC4A 3WB2A 3ZI7A 4N1AA 3SJAA 5ICSA 4P6VF 4OHBA 3VYWA 2IFTA 1NF9A 3RSFA 3DTVD 4CTNA 2PIDA 1NB9A 1NFRA 3LDGA 4BLOA 3RYFB 3ILSA 1IWBB 1ORTA 3JQAD 3Q7TA 5IZ4A 2ZJOA 3NGLA 4EPVA 5JAPA 2Y99A 1AQJA 3GJZA 3N8NA 3ECAA 2HRDA 2VJKA 3OZDA 1GTRA 3EVDA 1D1SA 1DZIA 4DJFC 3COJA 2QQEA 3AERA 5DXJA 2WILA 2ZTNA 4JLWA 4F2PA 5CVDA 3I9OA 1IN4A 1JHYA 3WGQA 4RULA 4X3PA 3ELBA 1OROA 4B6FA 1P3JA 4W1QA 2IY7A 4UCQA 2QLFA 5HP4A 3AG6A 3VU9B 2V3VA 1ND5A 5FOXA 3RTCA 2OHIA 3HJCA 1N5KA 4C06A 5GV7A 5JALA 1E9SA 1XQXA 5EZSA 5KQRA 1UXOA 4D98A 1DWUA 4JC8A 2ORWA 2M6LA 1PO7A 4Z8XA 1QIDA 2II6A 1E18A 4DBLE 2D1FA 3DQQA 1LLQA 1EE1A 3AL2A 3WNCA 3N2EA 4OHUA 1W581 4N01A 1CNMA 1U1GA 3L82B 5KNBH 1TPYA 1QCDA 1JFFA 1MRNA 1GGFA 1IAQA 4PN3A 2QTFA 1QX3A 2BGKA 3CX6A 3LWDA 3CH5A 3L7DA 4WNIA 5AK3A 4EMTA 2O3TA 1WMFA 2XEDA 3KQUA 3TIXB 1RWQA 1IM2A 1ZC4A 5EKUA 3DTNA 1Z29A 2WUGA 3KOXA 4DDWA 3ZQUA 3DB1A 2ID7A 4RQTA 4PNHA 4CL8A 2O8CA 2J9FA 3T54A 1U8ZA 2WFMA 4CQMA 1IRIA 4DW8A 2DPLA 5E1DA 1H2BA 2WOOA 2EOAA 1HRDA 1SK9A 1U9IA 2FEMA 2IP4A 2JATA 3WAKA 3IVCA 1H2RS 1P29A 3EBOA 2E7ZA 3OKFA 1T2DA 2CJFA 4NBRA 5A4FS 2VH2A 4PX5A 2EEPA 2P6MA 5J2UB 3LQEA 3B1KA 4C0AC 3GFQA 3QV1A 3B82A 2CMGA 4HAVA 4Z4WA 2ODEA 2AOTA 3SC2B 4C1NA 2H51A 4EG4A 1KAOA 3T1YB 1FDRA 1Y63A 4KQJA 2JRCA 1RXVA 2XBUA 3IULA 3DCYA 2BHLA 2IZ6A 4P08A 2P2GA 1M3SA 4EA9A 2PQMA 4UEJA 3OF3A 3B6MA 4QBFA 3CLTC 2H1SA 4X1YB 4AUKA 4BYMA 4UUPA 2E55A 1WMAA 4B09A 1JYFA 1X8XA 4WCDA 1Y4UA 2C58A 1DKLA 2G1AA 4RVNA 3VYRB 2Q2QA 5BSRA 4P58A 3AVXA 2NO6A 4LNUA 1ORIA 1SO8A 2VF8A 2WF5A 1G6HA 1QFJA 1SVMA 3K20A 3LP5A 1X3SA 3FB1A 3BGIA 3H2BA 2JJ1D 2W2QA 3Q5DA 2TSYB 4HN2A 1E4OA 5KYUB 1E5DA 1ZK1A 3CNHA 4UJ5A 2O06A 1L6RA 1RJWA 3B6IA 4GRDA 2Q9BA 3NG1A 3FIJA 4DIUA 5ABPA 2IZ0A 4JSRA 3UT0A 3U44B 3A6ZA 5JH7F 2VKTA 1CDOA 3GZNB 4WKNA 3GLGB 3UYKA 3QFRA 1LPPA 1U81A 1OKKD 1R6VA 4BCBA 1NVGA 4ESHA 1UJ4A 1YXMA 4DEYA 4XWGA 2OA0A 4EHDA 3AEQB 1HNWB 2DR0A 4JJ6A 3AI7A 4S05A 1MIOB 4HVTA 4Q4JA 1EM6A 2GT1A 3VH1A 3HO6A 4JVNA 4F2DA 1YTUA 1U6IA 4F06A 5D7BA 4EEZA 1IC6A 2VWHA 5D3ZA 1JHZA 2YXLA 2L42A 4XD2A 1XKXA 4D80A 4IGKA 3I04A 3A8JA 1E3EA 2I8CA 3OJLA 4F5ZA 5ADUS 3FFAA 2C5FA 4DV2B 2BLLA 2CL7X 2Z8YM 3N74A 3ZH9B 2WMYA 1GRRA 1NFFA 1YJ8A 1ISIA 2WZBA 3IURA 4KPGA 1CT9A 1DCKA 5LC1A 3CRW1 2DMRA 3TLGB 3NM6B 5ECWA 5CP8A 5FYQA 3IMGA 1TRKA 5KOJA 1Q15A 3GY0A 4L6AA 5BN3A 4NH0A 1QRSA 4FOSA 5LIRA 2OHJA 4YYEA 4FQ7A 2HMYB 3DLBA 3UH0A 4LHVA 3PSAA 5AHXA 2RBEA 4EGFA 5HIMA 6YASA 3CUKA 3K0AB 3W9YA 3KHKA 1XVLA 5E6UB 4BLQA 4CKZA 2XJ4A 2HK7A 4IOJA 4ZI7A 2Q29A 3MD9A 3PA1A 3GFVA 4JXJA 1MZPA 3QEOA 3X0DA 3BMCA 4CV0A 4ESOA 1ZL2A 2PT9A 4M4SA 1J8MF 2FCRA 2OORA 2RGUA 3LCRA 4NY1A 4OAPA 4Q7QA 3T41A 3VKGA 4YXWA 4YK7A 2RI1A 4B5LA 4MH0R 2FQQA 2M6SA 3AR8A 1KRWA 3G1UA 3G0BA 3ZHXA 1Q0SA 3NJRA 1ZVVA 3H2SA 2F7SA 3PWKA 5KYWB 4IRMA 1WPCA 1FE8A 1UC9A 1L5SA 3F8WA 3H6HA 1Z9BA 1L5OA 4PLCA 1LC0A 1THTA 1Z38A 1PQ4A 4Y1RA 4AZWA 4CM1A 3QHPA 4HX5A 5C80A 2PS0A 5AVSA 3PXBA 3U3RA 4G89A 4CIDA 1FNNA 1LSSA 1YGYA 1P2GA 5GOZA 4HVCA 1X2EA 3AB8A 1IEXA 5CVVA 3SR3A 1KDOA 1U8FO 4I6EA 4IEIA 1L1RA 3PTZA 2HF7A 4MTLA 1U9YA 5JEEA 5MN5A 1N9GA 3ZU2A 1ECPA 4BRZA 4G0WA 1DRVA 3DMYA 2GX6A 2PSSA 1NVWQ 4QQRA 1RAGA 4A2QA 1KI2A 1Q0RA 1I7DA 4KYVA 3LRTA 4KHZA 1JPVA 5KVQA 3ZCSA 1SVWA 3IQIX 4C0WA 1WKVA 3MXTA 3U7IA 1EUCA 3QLVC 1M1KD 1XSEA 5DCWA 3IDQA 6GPBA 2HCJB 4KO1S 3W8DA 3WL5A 1HFEL 1KYYA 5JR3A 2I71A 3HDHA 4WJKB 2IJGX 2XGJA 1PNQA 2P6OA 4C0QC 3RHFA 2NZ2A 1Q3TA 5E1OA 1I18A 4K6CA 1XAHA 5EZYF 3EUEA 3RUPA 3Q7PA 4YCNA 2BYTA 5B2FA 1E59A 1JLSA 1PT5A 5LMUB 2HWXA 5FP0A 2WE7A 1N36B 2Y92A 1RACA 1ZIYA 2D5AA 2X7HA 3HKDB 3NORA 3V8NA 2H2IA 4MINA 4ZVQA 2O2GA 5EIBD 1A98A 3CJTA 4JS0A 4N5NA 5I3ZA 4OOXA 3N5CA 3P2EA 4E3WA 4MYHA 3T61A 3GFSA 3WP0A 1F0NA 4AROA 5FJIA 3M1YA 3IEIA 5IDVA 3H4IA 3C8HA 1YO6A 4OKSA 2LKCA 3W7AA 2H07A 3G9ZA 3O2JA 1AGYA 1X70A 5AKJA 1SD1A 1JVSA 5TF0A 1SWVA 2NO0A 3VYTB 1W7AA 3KWFA 4HEHA 5K3BA 3RVOA 1G2QA 3AEKB 4JQCA 3ISXA 1I6LA 1DKNA 2QAGB 4GR4A 4R2LA 4ZVPA 2JK1A 2XV1A 2XVYA 3WLAA 5KMGA 4KSYA 2QRQA 4YRKA 1QRAA 4NBWA 1OCEA 3VTZA 1ISJA 1YQUA 3JTEA 1UADA 3LYLA 3R3YA 4K3UA 4V03A 1G98A 1XZAA 5TGZA 5JBIA 3KAPA 4RWZA 3AESB 3ZK8A 2WC1A 2O7QA 3FMFA 1RM4A 2C4VA 4N18A 4JL5A 5HCUA 4V0SA 2ZR9A 4EB6A 3DYVA 1SKBA 3P9SA 2BFCB 3CVVA 5AM1A 1Z16A 4LDRA 3SS7X 3BSFA 9ATCA 1QIMA 1Q0TA 5DI9A 4QEDA 3CS3A 2BVNA 4RW0A 4WX2B 4EA7A 1ZNYA 1T6XA 1YUBA 4BU0A 3AUKA 1EVZA 4M7WA 4BNFA 5LZ8A 4G07A 3OTQA 2AG6A 1GDDA 4JYAB 5JBNA 4C4ZA 3AM5A 2I8AA 5JOQA 4DR7B 1IM5A 4R71A 4IDPA 3UATA 2ACVA 3ICVA 2BGRA 2Z56A 4Q9HA 3BRWD 2QRUA 3UJHA 1EBBA 1AS0A 3MMXA 4KQEA 1KRHA 2DT5A 2QL9A 3JVUA 5JLJA 1QTNA 1KMCA 3ER8A 3RYCA 2E37A 2AQIA 5D5HA 5T4FA 2AFVA 3VHLB 2VN8A 3CYFA 5BPFA 2IYWA 1U7OA 1UKYA 1SA0A 1ZH0A 1MVNA 2C7BA 1JEAA 2RGBA 2R47A 3QLUA 4JHLA 1H6CA 4Q4AA 4EPXA 4OX9B 1ISHA 2ACEA 2AS0A 3E9NA 2F3PA 1XLTA 2Q2OA 4X97A 2GEFA 1OLXB 2IHKA 3P9XA 3E7XA 4F4HA 2E49A 5F73A 1PJLA 5C1DA 3A28A 2QJTA 3F8SA 1E62A 4TKOB 3F96A 4MR9A 5H1YA 2RHTA 3EOZA 4G7WA 4I1UA 2QUAA 4IFTA 5FOSA 1YE5A 3A25A 1YUNA 3FUTA 3OE5A 2WJVA 1JG6A 2HCTA 1RXUA 3I9NA 4G24A 4IRXA 4UHHA 4I9HA 3I61A 5FEUA 1X7WB 1VHDA 1W4CA 2YZKA 3AP2A 1V0FA 1Z4LA 1NY5A 1RWVA 4I1YA 5BVGB 1XNQB 2GA8A 4P98A 4UHJA 3N1UA 3PVCA 4OK3A 3PWZA 5JVDA 1DC7A 1GY8A 1S2MA 2BFAA 4RHUA 4M0MA 4URUR 5CCBA 3THSA 3T99A 1AZTA 3IIKA 3WTCA 1Q1AA 3ONYA 2CMDA 2KPOA 1HE2A 1VYUA 3E9RA 4RVDA 3GRCA 2QWXA 3P4UA 4JCCA 1E6CA 3ZOZA 4PINA 4INJA 3CNOA 1C9NA 4P80A 4KDEA 2P3SA 3TIIA 4D82A 3O2QB 4N3NA 1XQBA 2RG1A 3UAYA 5JRDS 1RCTE 1PNOA 3HI4A 3LHDA 2J9RA 4I9FA 3UKOA 4KKSA 4BNUA 1Y1TA 2CDAA 5HKOA 2XQJA 1K08A 1WOMA 2VSYA 2VXYA 3FYTA 1E4VA 1DSSG 2NTVA 3VSCA 5FX2A 1Y3HA 1YDGA 4WK2B 4X7EA 4PC1A 2EDCA 4I9NA 1Y6RA 1E9AA 3KELA 1T6NA 2Z8ZA 3QPVA 5JCOA 4AJLA 2OB1A 4AS2A 1X0VA 2R8ZA 3FKSD 3W3ZB 3GX1A 3GLFE 3O4IA 5L45A 3K30A 3ESBA 5AHRA 2B69A 1MW9X 4RH0A 3R5JA 4FFVA 2I87A 4O33A 1L3CA 1N0VC 5CB6A 2FV8A 4ALIA 4DA8A 4HFJA 5FTMA 1J9EA 3M81A 1CDDA 3KVNA 1CK4A 3QEMB 3RJMA 2ZROA 2BMVA 2NU7A 3GGGA 4EY6A 1MJGA 4OJYA 3IHKA 1CUDA 3PHLA 1F6BA 2WA1A 2HJGA 2WG2A 3CZ9A 4L57A 1E9VA 1H8ED 4LXGA 2DFTA 1CV2A 4AU1A 2O8DB 4HLQB 2B8TA 1M2NA 3K9LA 5T6BA 5CYPA 1NQ5A 1K3TA 1YBMA 4EFNA 2X5KO 1ZIDA 1RPNA 2QZSA 5E9WA 2HZBA 2PMEA 4FDAA 3U7QB 3GB9A 5ALWA 4CF3A 5DBFA 1VPEA 2ZJZA 1TEHA 4DABA 1IDN1 1SG9A 5IH7A 2E85A 2GBPA 3C14C 4IXMA 4MQBA 4R84A 4TQ9A 4Y2RA 1V1MA 5C81A 3N2LA 4UUBA 5J40A 1EH5A 4A15A 4GZ5A 4YN3A 4F1KA 2B5OA 4J0DA 1E1RA 3K8QA 1VSBA 3C3AA 4O4JB 1M2KA 3JQBA 2AZDA 3EARA 3A26A 1KBQA 3KK0A 3BDVA 1YB1A 1YZLA 2JFYA 3HCNA 2BEJA 3E1KA 2D3LA 1R8SA 1YGPA 3PXEA 1KE2A 4LI3X 3CG0A 5DHPA 4CTJA 2V65A 1INLA 3VVMA 1Q44A 4AULA 4M9SA 4OATA 2JIBA 3GFGA 4CCYA 3RIMA 5A03A 4PCLA 4WECA 1ZY2A 3IB6A 5LXTA 3AI1A 2UZ1A 4HTAA 1C8KA 1W88A 4QVAA 1T3SA 1T9ZA 5A05A 4L72A 1S96A 1KWGA 4B73A 2JK0A 5JFTA 4GEGA 3SY8A 2OR3A 3F47A 3K72B 1EP9A 1TX4B 3ODGA 4NMWA 1TQ2A 1Z56C 2Z5VA 1CP2A 4XKJA 4NHOA 4ZVOA 1LLFA 4OYLA 1QWOA 3KUKA 2NVUB 3RD5A 3VI3B 4DCJA 2JGEA 1G9XA 1ZJWA 2PPLA 3C5EA 2OO3A 4H27A 2DWQA 4LJ8A 3WK8A 1L8LA 3OICA 1NR1A 1FZQA 1EK0A 1DQNA 1BD3A 3KEMA 3L9XA 3QKRA 5KTNA 1YR9A 1XB2A 1X77A 4ZMBA 1NMZA 1JS1X 1N8TA 2ACKA 2EKDA 2PYZA 2XCUA 3DOIA 3F1KA 4YUZA 3CNLA 2A86A 3KOOA 4BUJA 2PUCA 1II9A 2VCEA 2XRMA 2P4UA 3GUCA 5EXTA 4ER5A 1TM2A 2IIQA 5C4MA 2NV0A 1Y7LA 2OGZA 2V54A 4TS9A 3JVEA 3I2HA 3QUAA 1PVOA 2CT8A 4BMZA 1P75A 1SVKA 2H85A 2VJJA 3A4TA 3IH5A 1QK4A 3OKPA 3R0XA 4KAXA 4R3NA 3R3VA 5L7TA 2QM3A 1VE6A 1YRHA 2AWOA 3AKDA 2H1OA 4B3MB 2OXCA 3QJ5A 2XBMA 3ITKA 3EEYA 1N05A 5E4FA 1RQLA 1ZIPA 2XHZA 5IABA 5D3KA 1EVQA 4P36A 4Y2GA 3GA7A 1ESMA 3EGEA 1OH5A 4HJXA 4YJFB 4B4WA 1IU9A 3PUKA 3CVOA 5H83A 2WHPA 3BY2A 2QJFA 4ZPJA 3ZTWA 1FQOA 4XQGA 5A1TA 1W8IA 3Q2IA 2C5GA 2YX1A 4O4IF 4WZAA 1X14A 4DPLA 3CCUB 1DAOA 1MJNA 1NU6A 2C3MA 1UJ2A 2HY7A 1H3EA 1FUEA 4IH9A 3LWZA 1BROA 1BZYA 1XD9A 4QL3A 1T3HA 1Z4PX 5K6AA 3AVWA 1ZPDA 1YFJA 1LLUA 1CQZA 1EKXA 2IUTA 2QX8A 3FNFA 4FU0A 4NZMA 4QUBA 3LA6A 1QZ3A 2ODAA 3CB4A 4K46A 5FUVA 5KQPA 2QN2A 2Y68A 5J4LA 1QGZA 1RJGA 3A8KA 5DXAA 4E4TA 4NZ9A 1G4AE 5J58A 2XZLA 2IC5A 3EOAI 1ZITA 4JJIA 3U48A 3OEHA 1CUCA 2D0IA 4J8PA 4TVBA 2HRZA 4MYSA 3UUWA 1JKJB 5K8TA 1KZ7B 4Z53A 1D9ZA 1JHQA 1FFXB 2HCFA 4TZ6A 2WVGA 1QVFB 3HE3A 1YHZA 4LF8B 4QYXA 2XRYA 3U4GA 5KWIA 4ZT4A 3RK1A 1MORA 2IZOA 4DEXA 3W8NA 3H75A 1PT7A 1QBGA 3CCFA 3GROA 4OG2A 4DVGA 4UBKA 4ZEMA 1EFDN 1RMQA 2YXPX 2BRUA 4MUYA 1ZOPA 3QYFA 4RA9B 3L7MA 1UFKA 1DUVG 4ZA2A 2CHUA 3SHFA 4Z3DA 1P1HA 4YCSA 2NO7A 3IJEB 1FP2A 5ELLA 3UY4A 4Y7DA 4K86A 1V9SA 1IJFA 3OM9A 4RTQA 1PYGA 2GXSA 3EQZA 3G8CA 4IX1A 3EIFA 2OZLB 4BO7A 3DJFA 4ZEOA 1GR0A 4R1PA 2W83A 2ZUTA 4BE7B 1N1MA 2GBIA 5A89A 1PL6A 2ZDHA 3R0ZA 3R5TA 1OGIA 1FNDA 1NVEA 2V4MA 3HKBA 4A5SA 3DE0X 5BSYA 5DK4A 1MC5A 2AN1A 1G7TA 4KQWA 4YP0A 3UIEA 3VPBA 1FYFA 2XDYA 3I05A 3ZHZA 2X8JB 2ZCVA 1A9ZA 2J6HA 1G19A 1K92A 4YEJA 3PKZA 4HWOA 1MCZA 2W6PA 4MW6A 5C34B 3SAJA 2OPHA 4YGYA 3H11A 5H4HA 1A2BA 5EN4A 2GAFA 3NKFA 1UK7A 1B7GO 2OD9A 3E1GA 3ZPXA 4HRVA 4L4ZA 1PLKA 4QJBA 4Y0AA 1NUQA 2V8BA 4L22A 5IJZA 1KOLA 1NXVA 1J20A 3NDJA 2X0DA 1GEEA 2DHDA 2EAUA 4B45A 1ZM9A 4ND3A 4DNOA 1UBLS 5GGYA 4FP9A 4WV3A 3K6SB 2XVMA 4PAMA 3VVCA 1WMDA 1JHUA 1J09A 1BX3A 2R7KA 3AOGA 1I7NA 1AOXA 1NF3A 1LVHA 1OJ7A 3H87A 5FQNA 3IQXA 4L5YA 3AUUA 2I99A 3QOFA 4N12A 1A9RA 5ERXA 4A8JC 1XN1A 2YMLA 5CH5A 4OGFA 3EHDA 2JIZD 3EYAA 1E6LA 2P3MA 3KTAA 1YHQB 3DCIA 2GBLC 3N8IA 1RC0A 2YIMA 4AKTA 3AI3A 4UXIA 5KS2A 1O95A 1G3MA 2QG9A 1M2OA 4TKVA 3SQLA 4WN3A 5KOYA 4PBRA 1YAJA 5IU6A 3QTBA 5KWSA 1YONA 4ARAA 3O3NB 2QX7A 4KQXA 1W94A 3H3JA 1S4QA 1GGJA 3GNQA 3SSNA 1O94A 4DLVA 4G8DA 5AHOA 1L5FA 2BCGY 1LPAB 3VQTA 2IEBA 2CMFA 3FVRA 3PI6A 2YVKA 4V0KA 3STXA 5B3JC 2FVGA 4DV4B 3FB4A 2P41A 4KOAA 2HQBA 4ZJYA 4NHEA 3NDBB 1VQKB 3K5WA 1EWYA 2VRCD 1OE0A 4Q3AA 1RYDA 2VNHA 3KLPX 4Q9DA 2BC9A 5ALOA 3EX7C 1PKXA 2NUTA 4F84A 4IBOA 3ASUA 2AJTA 1IN8A 4FOPA 4GYKA 3ZNQA 5KTSA 3DNPA 5LNK6 1V8OA 2GKGA 3D4IA 1NLUA 3PUHA 1DQZA 3CSDA 4JJGA 3U4AA 3HHEA 2ZULA 4O3MA 4FN4A 2IUUA 4Z7OB 2REOA 1Y6QA 3TINA 4EHNA 1KC3A 2DU8A 4IPTA 2AHRA 2RKBA 3GN2A 1KEPA 5HCIA 1CQIA 3RSQA 1ECGA 2UKDA 3B8EA 3GT3A 5AJUA 2NXCA 3UENA 5JS8A 5LNK1 5KJ6A 4WLVA 3KEWA 4BASA 1HC7A 4U8GA 5DMXA 4C7KA 3B48A 5IT9A 4JLOA 4CRWB 4LRUA 4ZGNB 3KUDA 1IZ7A 4K6HA 1TM1E 3MBOA 4KDCA 1C9JA 4V0RA 2H0AA 2BBWA 2H59A 1KI1A 4ZRNA 3EEBA 1V25A 2BR3A 1R27A 1WUJS 1ZGCA 1RJEA 3C6MA 3F3YA 4EG7A 1FSPA 3ZNOA 3WV5A 3ZHOA 3IELA 4CHGA 3UOWA 1TM5E 4ZCTA 1QVVA 3UJ8A 1B0PA 3I5AA 1T35A 1K98A 2PWZA 3CHYA 3KB8A 2HL6A 5EP3A 5C31A 1M10A 4DE5A 3PQCA 4B3BA 1OYWA 3M8KA 1M2HA 4B79A 5AUQA 3I01A 2O50A 5CG1A 3HR8A 2V0NA 3WL7A 2YBDA 2J9YB 2PL9A 1XRSB 3C43A 2YWRA 3OI7A 4Z0HO 3O8RA 4ZDKA 1ULAA 3B60A 3M6MD 3ORFA 4TTRA 3RRNA 3K9CA 4BVLA 1PAUA 2B5WA 3LQYA 3RT7A 1FNBA 4BV2A 4UU0A 5J5CA 3IS3A 1KI9A 3CLRC 5ED4A 1NMEA 2QTLA 2JZCA 2VAPA 3MJSA 4YRJA 3K2IA 3RHZA 3TL6A 2OHVA 2VTBA 2R2GA 1XMPA 1BVYF 3CBGA 4IO0A 2QBYA 1DIAA 4IR7A 4B44A 3LF1A 2R5NA 1E9CA 3L4BC 1JJFA 1QHEA 1DDGA 1K2VN 1DKQA 2WUWE 3R5HA 3KVVA 3U6BA 3HBAA 4WZTA 3L9WA 4AO8A 3AR5A 4BO0A 3GCDA 1DEKA 3N8KA 3ZWAA 2VJDA 4EG8A 3C41J 4ZOBA 4JJEA 3VSDA 4LY9A 4PYOA 4CLRB 3PFWO 4NBSA 2AK2A 2DQ4A 4W82A 4ZU3A 3RG2A 3S4YA 3TSWA 3WK5A 4GE0A 5KTTA 4TKUA 4U7PB 5DP1A 1DT3A 1P72A 3WMXA 1ONNA 4TKZA 3CH7A 5DIFA 3FCAA 4LYYA 1K75A 4AT1A 4N5HX 2ZZNA 1VYTA 1X7GA 3GDHA 3TXAA 5BUSA 3KAKA 7MHTA 1GGKA 4UD6A 5SZHB 3UICA 3NO4A 4KREA 2VHXA 3R3JA 3ONVA 4Q5IA 1F8GA 5FWXB 3BJZA 4NG5A 3QFHA 4LRQA 4F4IA 2NTJA 1W0JA 4I4NA 2F67A 2QRKA 4FFLA 5J2UF 4CMBA 3X3HA 2NG1A 3H16A 5DH9A 5SZJA 3Q98A 4DUGD 2WPDA 3AW9A 4RFVA 2JJ2A 3U2QA 1ZKDA 1I4EB 2MINA 5DISB 1QKIA 1M76A 3GMTA 5D7NA 4LJ7A 3V55A 1EHCA 4NCIA 2P6PA 2L69A 4O8CA 3KDSE 5DLPA 4AY4A 5IVHA 3DR3A 4X8MA 3G85A 2D2IA 3A1SA 4HRAA 1V43A 2WUFA 2ZJ4A 2ONJA 2WA2A 4YIKA 4C29A 1T0JB 2OBMA 1MB9A 4JENA 5BMVA 1RM0A 4TLMB 4U5QA 3ENKA 5C0OE 4JDPA 2C88A 1T5HX 2BTOA 1HE4A 2QL7A 4LTMA 3BBLA 2W42A 2F1RA 2WDZA 2JNWA 3RIEA 3LXRA 5JCJD 4D9BA 4UE2A 2WM2A 3R3HA 1TMOA 2H5JA 3KB2A 1EMDA 4LGYA 4LG1A 5MF6A 3SIPA 5GONA 2J0SA 1F4VA 2C1XA 2VHWA 2A33A 5HW0A 1RRVA 5SY4A 1DP4A 1XHFA 3AERB 4GBGA 4NAVA 3IEXA 2ZBDA 3GEEA 4FFBA 4E31A 1VB5A 3H5OA 3STHA 4XLAA 4HQ0A 4J3NA 1O03A 4MRPA 2ON6A 2XMGA 2VTKA 1GWNA 4LC1A 4MO9A 3WO0A 5C2JB 2IYUA 4BLWA 5JCXA 3QUBA 2CV0A 3AVQA 4DDKA 2O8BB 1UBMS 3F6CA 1N3BA 1J2EA 1MNAA 1EZ1A 1TYAE 3SM9A 3ZE1B 1N6NA 5JUWA 2ZVJA 5B64A 5KVVA 1LSOA 1V3UA 3P7MA 2RHLA 2HIMA 3FZNA 1JFFB 2WKQA 3OFSA 1WVGA 4HLUC 3W79A 5B58T 4CV1A 1QIGA 4DYHA 3K6KA 4JT9A 2G5GX 3FPEA 4UEQA 4CIAA 2FDCA 1UBSB 5JCPA 3CRNA 4HNHA 4MQEB 3TRJA 4MVJF 1W49A 1XEFA 3Q9SA 4N0MA 1KZGB 4F5WA 1YTLA 4GGPA 3DBOB 1J8FA 1DFHA 3F6EX 3M1IA 4RY8A 1LQUA 4IIXA 2YVUA 3S5JA 4CGYA 1T8TA 3W78A 4CQMB 3CCJB 1S3FA 2VHQA 5CFMA 4CT0A 1E3LA 4M9CA 4AJIA 1T25A 2R4QA 4XWTA 5DYIA 1OX5A 3R7DA 4C2BA 3F5MA 4IZ6A 2C3PA 5JDCA 3GYBA 3MGKA 2ZE6A 3F1LA 2P4SA 5AK4A 5FTLA 2ZWAA 4GP6A 1XVUA 3RTEA 4O63O 2G06A 3ANNA 1KSFX 2XUGA 3FETA 3KZ1E 3MGGA 4E5MA 3LX5A 4XPIB 1X0XA 1KJ9A 1UT8A 2CNWA 3A1NA 3L79A 2I3DA 3FH0A 1QHSA 1S72B 3ZDYB 5JJBA 3KSAC 4WAUA 5KCZA 4CFZA 4EGQA 2QIPA 7ADHA 3BD8A 1EXMA 1NMYA 3VH3A 1PWEA 1NUSA 5DHQA 3QLVA 1UBRS 3GRPA 4IINA 4OQYA 2WQ7A 4PICA 3VFDA 3NM5A 5KTPA 4D4LA 5GVRA 4L6CA 1WF6A 3FUXA 3EZGA 2BSAA 2XT0A 3EGOA 5IDXA 2Q5LA 1N0UA 2XE4A 4RAOA 4LNUB 1A27A 3E23A 3SXPA 3ECCA 3WLFA 1IG0A 4QD3A 3RSCA 5AO9A 3LHIA 1G3IA 3W5UA 1ZH4A 4RQUA 2RD2A 1GRCA 3VKHA 1U90A 1Y48E 2C3UA 2VJNA 3CE9A 1DBPA 3LZ6A 4IXDA 4YRRA 4KPYA 2ZJ2A 2Z1MA 3TD9A 5E9AA 3GWGA 1M8PA 5TV2A 1L5MA 2AR9A 3TEMA 2XMBA 3I8SA 2XMCA 3CNEA 3GG9A 2NZ8A 1GGNA 4HQLA 4FEGA 2A67A 4M88A 4PZUA 4C6RA 4TGLA 1QTIA 2R25B 1X9IA 2AXPA 4JI3B 3TKYA 3EWIA 3MAJA 2YZ2A 3NTRA 3N7UA 3D02A 2QG4A 3R5SA 1VA4A 4Y8VA 5G4KA 4RDXA 7MDHA 3N2ZB 4JC5A 3WLRA 4AYXA 4JBWA 3JQPA 2B20A 5GJCA 3G7NA 3HZHA 4YQYA 3T5MA 3KS9A 2IGBA 1N75A 2XJ9A 3BWMA 3EG9A 4WGFA 3OVMA 3W4IA 3QFFA 1KI6A 4WXRA 1LFAA 4M6WA 4F6CA 4POOA 4C7OA 4Y2VA 4C7MA 1A8QA 4KLNA 3WSVA 1HLGA 3LSTA 2J4DA 2GZHA 2V9CA 3MS2A 1NVAA 3ANTA 3GFRA 4JA2A 1YDHA 3EB9A 4X06A 3EF1A 4LOIA 1UPCA 4C2AA 4K0KB 1U99A 1IN6A 3MJCA 4NMLA 4HUQA 1W5FA 5KOJB 1IVSA 1SG6A 2JGLA 3NHYA 5F1OA 4F71A 3V7YA 5C1IA 3ME5A 4LZJA 1IZ9A 1VHTA 2X9LA 4P92A 4JFRA 3S44A 2GO1A 4QGBA 4F7DA 5HMLA 3ASRA 1OW3B 1T9CA 2VPQA 2BD0A 2C97A 3G8AA 3H99A 4KR9A 3KQLA 3GBSA 4QUJA 1JNYA 4MV3A 2M32A 5FAKA 4FFNA 5HMMA 3U37A 5L4SA 2WWIA 2GJSA 2V98A 1PJCA 1X7XA 1CZHA 3HLKA 5JNRA 3I3OA 4TQGA 1KZ6A 2VNKA 3VOBA 5AVYA 3N2YA 2JVKA 1C9DB 1J5PA 4KO2S 1NQWA 4OP3A 1T9GR 2NWQA 2QN7A 3LQRA 1RLJA 3OT4A 4TXHA 5AK6A 3OUTA 4EB8A 1DCMA 4TUYF 2XGGA 3D8NA 1G55A 1U3TA 2VLBA 4RH1A 1XEAA 3JSXA 4CQMD 1MAVA 1BMDA 1D0SA 1ZJ6A 3FCOA 4GX1A 4PPYA 2Q6LA 2OBNA 1WEHA 4OJKA 4U7GA 5CMLA 3CPEA 2GD0A 1YVRA 2FW6A 1P4SA 1ZMBA 1QFMA 4LOLA 1ZRNA 2OY0A 1WOOA 2RHRA 2IW3A 1ZRHA 4IVNA 1G18A 1SIUA 4PV7A 3B2EA 3MILA 4GKVA 4RKFA 1ZBDA 3VPGA 2CF5A 2FEXA 2ORYA 2ZFUA 3I6ZA 3IKVA 5K9ZA 1RZRD 5DSZA 4UASA 3JASA 1JPNA 1I9GA 2KLBA 4XGQA 1N9GB 3RASA 4D4IA 2MYUA 2ZAYA 2J0QA 4HYYA 4B35A 5LL6P 2QYSA 1U04A 2A78A 4H17A 4B0OA 4UM9B 2VK2A 4K40A 4RDHA 4XH9B 2APJA 3KEFA 3K53A 1EFHA 4MYCA 4K1LA 4RF3A 5KYGA 3GLGE 2R8YA 2EWWA 1UJBA 1PJ4A 3I1FA 3KQSA 4P35A 2WE8A 4OFWA 5T64A 1YACA 1LK5A 3IUPA 4FJ0A 2X6XA 4RNCA 3I2GA 4RACA 3OWOA 1BXZA 4IIVA 4MW7A 3BGWA 4EMUA 2YWXA 1TA0A 2XOKA 1O6FA 1AQNA 2HLHA 3FWHA 1Y6JA 2ZWVA 3BXGA 4G01B 1HFKA 2FMKA 4J7CA 3QSGA 5EQFA 4YECA 2CY0A 4FMBB 1GZSA 4Y6RA 5DE3A 5LYYA 3STWA 4C21A 4C89A 4ZVVA 4L3VA 5LLSA 1HWYA 3MS7A 2H1FA 1FS4A 1XXHB 3I2IA 4B80A 1VHJA 3UJBA 1CYEA 1N57A 4XLEA 1R0LA 2ZIGA 4FHGA 1FPMA 1YZNA 3HN6A 5KMGB 3ELWA 1Y4SA 4EGCB 4AL4A 4KMSA 3GD7A 3UWMA 3FA2A 3JQ9A 1LTHR 1KTVA 1FMJA 1Z0ZA 4I4LA 4XB6B 3UO8B 2G6BA 3EDRA 1Z2EA 2EP5A 1QYWA 2LTAA 5LLTA 1GUDA 4BS9A 3H9NA 1P9NA 2OZKA 1EAYA 4JC4A 2P5TB 2XCOA 3U0VA 2H3HA 3WWYA 1HZZC 1EXWA 3D6NB 4AJEA 1F8FA 3L5OA 4JT8A 3OQBA 1SPBS 2X9VA 5CXXA 3LDFA 5FFNA 3V2GA 3OPQA 2VWPA 4S1OA 3NPAA 4HAXA 2FPGA 2WKWA 1CD5A 1D8AA 3Q11A 4EHIA 3IQGX 2EW8A 1H2WA 2OV6A 1QP7A 1I0IA 3N07A 4GMGA 1DJMA 1DGQA 5FI0B 1LPMA 4GOXA 4G5RA 4M9UA 3V48A 2BFBB 1OYOA 2GVZC 4RK4A 3USES 1LFDB 3DO5A 3ZY5A 1QVWA 2ZOSA 1OXVA 3AX6A 2FUKA 3WJ1A 1D03A 2X8WA 5EKDA 1EP1B 1P7YA 3RVNA 4L9AA 4UMVA 2QE7A 1SA0B 3H5TA 2XWQA 2NUPA 3G8BA 4NYIR 5F77A 2N3ZA 3G2IA 3KD3A 3S8EA 4NU8X 1T2CA 5CB4B 1PKEA 5ALPA 2FQXA 2ZI6A 3KXIA 3OTIA 3QTTA 4DCOA 3OQ1A 4QDXA 1EWVA 3ZDQA 3G0GA 2W2KA 3D4LA 3VNSA 2BMJA 2J09A 5L3SA 5KPJA 2RBGA 1XRJA 2XLCA 2AUMA 4MR9B 3V8RA 2UXCB 4RD2A 2BGLA 1SCUA 1C3LA 1JIKA 3BYZA 1VE5A 3D8RA 4O4JF 1E1DA 5CPFA 5KSWB 3DLAA 1Y42X 4RM3A 2I76A 1ZM3A 2O6LA 1U5AA 2CE7A 4U4AA 3PA8A 2C5AA 4FYVA 4PGAA 3USZA 1Z3IX 2XZPA 4BE4A 3GYGA 2PH3A 3F2VA 3EVBA 4MKXA 3A6PC 2R87A 4UM9D 5JVDB 1UOEA 3CB2A 3O8NA 2C5HA 4HZUB 1BD4A 4MV9A 3TIGA 4DLAA 4M1WA 1ITZA 1ZQ9A 2Y27A 4PANA 1E77A 1QANA 2QX6A 3LA8A 2BGUA 1KH1A 5I7UA 2QMOA 3GVCA 3FOEC 4E7OA 3OZVA 1OOEA 2AW3A 1B16A 3S6JA 5ALZA 4R1UA 2PDAA 1XN4A 1G3RA 3NZEA 2PU7A 2JFHA 3D31A 3O82A 1BOFA 2X0JA 3Q2KA 4XONA 1QO7A 4KO4S 4JLJA 3ROXA 3EVNA 1WSRA 1LSUA 3R7NA 1NV9A 3OMXA 3K0SA 2W9XA 3AF0A 3KUUA 3LK6A 2H9YA 2A30A 2XTMA 1R88A 3BFPA 4LDAA 1RHUA 2GCOB 1T4BA 4F1JA 2VS1A 1RAHA 4JC0A 1X1RA 3H0EA 4ZVTA 3LD9A 1XTJA 2IZ7A 5HJ7A 3ZVMA 2ZRQA 2DR3A 1M67A 1RHRA 3OZRA 4RDCA 3ICCA 3L0ZA 4ENWA 3B3FA 1AX9A 2W22A 1RI3A 3QQPA 2A0FA 4CFSA 8ADHA 4KV9A 3DDYA 1Z08A 3SJ7A 2XB9A 3ZS9A 4Q24A 4Z4HA 2P9HA 3BMXA 3IKJA 3WLMA 4LJ5A 3PHBE 1Z5ZA 3FLMA 1W1WA 2ORVA 3CN9A 1SOWA 2HQ1A 1FC0A 3PT9A 4P38A 1GNQA 3KSDO 4JLSA 1W0CA 3PQFA 1YS9A 1F2UA 3QENA 2GVDC 3CX4A 4IV8A 3F9RA 4BNIA 2NU7B 4ZYUA 1MT3A 4V0NA 5L3RA 3CCBA 5MHTA 3A32A 1KDVA 3TZCA 1HTWA 3CNQS 3EZ7A 1VL2A 1BU5A 3G89A 1FFEA 4J0FA 4PYMA 3SQNA 5GINE 5LD2C 4FN5A 3NEAA 3GUYA 1YI8A 1Q7GA 4I4IA 1DJNA 2GYYA 4FS3A 1AB6A 3PUWA 4EJSB 5M5BA 2GFQA 2X8AA 3GRFA 5LDDC 2EZUA 1JR3A 3SDZA 3M1LA 1X1TA 1N3IA 4O0MA 4EG1A 2F8TA 4C6SA 3AEXA 3FWYA 1V1MB 3C98A 3O83A 3VOSA 1U0TA 5REQA 4QYTA 3ETJA 4GECA 2XXBA 1VHWA 4TYPA 3S2EA 1BW9A 4FS8A 3T38A 1XDBA 1UJ5A 4DAEA 2HUPA 5KYYB 4ID3A 4HYEA 4C7XA 1I7LA 4K0RA 4Z0NA 3ZHUA 4LGCA 3EZYA 2AC7A 5FQOA 3K05A 3ETCA 5AKEA 4ADSG 3R7WA 3OLYA 1Y33E 4RLSA 3PUNA 3R23A 1NE7A 2NAPA 4ZOEA 2OBYA 5HXBA 4CCYB 5LXTB 4Q0MA 4QOEA 2K6GA 2UZ1B 1W88B 3IT3A 2JCBA 2P9ZA 2X77A 4R4JA 5BQOA 4MVCA 1AK2A 1KI4A 3LL4A 1GAQA 1RXYA 2QR5A 3DF7A 4YR7A 4NAUA 4OH1A 1I10A 1HKUA 2QRPA 1QHNA 4MIKA 4G97A 2AOUA 3RWMB 3DMNA 1XKTA 5IAEA 3EPHA 3GVLA 2Y0PA 1NONA 4E08A 1JAHA 4IILA 4GO1A 5HFAA 1BE6A 4ARUA 4L8VA 4L0QA 4PHGA 1L7XA 5JFOA 3UOGA 3QKRB 1N2OA 3S0JA 1QCYA 1H65A 1MEJA 2Q3MA 1CY0A 1G9SA 4ZOCA 4BO4A 1OV4A 2GF0A 2DP4E 1EESA 3B6ZA 1RJDA 1RYEA 4QYIB 4X7RA 1WHTB 1SZDA 1V5GA 3L49A 1WORA 2WU1A 3DP9A 1Z28A 3O5AA 1QE3A 5TIIA 1S2GA 3ADDA 2ZZEA 1H2XA 2Y2UA 1V6SA 2ZU0C 4LRTB 4NMMA 5EEHA 1QE0A 1T6YA 3D0KA 2Y77A 5FPTA 1KQNA 3RQSA 4YIHA 1RKVA 1AZWA 1U7WA 2EL7A 2UUPA 4TLLB 4PBSA 3UAVA 2GBLA 1V95A 2Z3ZA 2ZXHA 1ZH6A 1Y0RA 4M98A 1ST3A 1L5LA 3T12A 2JASA 1DRUA 1Z8FA 1QP4A 1PG5A 2XPCA 3RAPR 2IYZA 1KHTA 2IL1A 2QN9A 4GPIB 4RZQA 2J5QA 2ZE5A 2NQ2C 2WHPB 3ZCUA 3MMPA 3DGFC 1DRWA 2VSOA 3LRXA 2E4VA 2GQFA 1XQ6A 5B3JA 3OETA 4CODB 4CKCA 3PFCA 4GBMA 2XE8A 3NOQA 1RC8A 4ZDWA 2I66A 2R1UA 3VGPA 2V9PA 3L1UA 4IIHA 5TB5A 3CPWB 1GCIA 3C3CA 5HGXA 4MI3A 5HPYB 4DKJA 2J7PA 1J2TA 1YRQA 4RJIA 3SFVA 4LJKA 1A71A 2I4RA 2J5RA 4UCXA 3K70C 4UZUA 2B82A 2PVSA 1SIOA 3LC7O 2FOLA 3ZG6A 1ESEA 4WBSA 4D92A 3BT7A 2F6RA 3NCTA 4FGKA 4G0VA 1VL1A 4C4PA 2AX4A 1CX9B 1K7SN 1SEVA 1XLUA 3ANSA 3L0CA 4OHXA 4EGAA 4MRMB 4F8YA 5I6DA 4DSAA 2ZITA 4ZMRA 4L5IA 2EWMA 1Y1KE 3HM9A 2PJZA 3Q3GE 1GAXA 5FTKA 9LDBA 1ZUWA 4BKUA 4MRVA 5IC4A 1ZQ1A 5FBKA 3KTDA 3QKWA 4KNWA 4U63A 3MUEA 3IOCA 2ZGVA 5IKOA 4DA0A 1CLUA 4Q02A 5C5CA 2QMQA 4F4CA 1LX7A 1QYDA 4QQ8A 3IPRA 1U7XA 1YZTA 4IVPA 3A6FA 3KEQA 1DG9A 3CMMA 1HI9A 4YI3A 3FKJA 3KXDA 3C48A 1F20A 2ZL7A 4U2FA 3UB3A 4DREA 1VTKA 1XC7A 2W6QA 3GPCA 4X65B 3HXKA 1ZAYA 3UGQA 4HDQB 1V5WA 1KFKB 2HQRA 4JJAA 2WG1A 3RS3A 1AB5A 2QA5A 1U3CA 4Z9FA 4LNHA 2V6BA 3THYA 2FQYA 3B7GA 2UYGA 3WOHA 4J0KA 2FF7A 3HYCA 3HKBB 1WBDA 2DAPA 4M22A 3D6UA 1G7RA 1NY6A 3OECA 4LZPA 3H83A 5BSUA 1W75A 1XV5A 5E2AA 3I83A 1OB2A 3B3JA 2NXWA 2Y4NA 3OC0A 3TW4A 2VTDA 4DLZA 3II6X 5DO9A 3VX3A 4CKBA 2AVNA 3D7NA 4MVJI 4WHMA 3H11B 3S81A 3VDQA 3MMNA 1V47A 1KJWA 3L4BA 4FXPA 4OB6A 1A9YA 4R01A 3ICOA 5AVJA 3JW8A 3ZHQA 3G49A 2BUBA 3RH0A 3UJ9A 2OCXA 1ZESA 4RPHA 4BFVA 3DM9B 4YASA 4C2UA 2NYRA 3Q4GA 2V3CC 1BXRA 3L0DA 1TCAA 4XDYA 1IY0A 2QYTA 5FUYA 2WZQA 5C53B 2J45A 2YMMA 1YVDA 3TAUA 1HG0A 4UXHA 3ZW9A 3V4SA 1H0RA 1XL0A 2P9FA 3DEFA 3F74A 3I9FA 3DFKA 3EPPA 5ALKA 2BH2A 3BE5A 1HQDA 5F9MA 5FULA 1BMFA 3RC7A