2V7XA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYAREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7xA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7xA01
2F4NA 5B6IA 2WR8A 2CC2A 4CQJA 2Q6KA 2V7UA 2V7TA 5FIUA 2C2WA 5LMZA 2C4UA 2CBXA 1RQRA 2V7XA 2C5HA 2V7VA 2Q6IA 2V7WA 2ZBUA 2CW5A 2C5BA 1WU8A 2ZBVA 2Q6OA 2Q6LA 2C4TA 1RQPA
chains in the Genus database with same CATH superfamily
5DBEX 3RC7A 1LTQA 3MA0A 5D7BA 3V7YA 2GPAA 2G9ZA 5TEWA 3RAFC 1GQYA 4IJUA 4CMGA 1HF3A 3VM6A 3F90A 3JAKA 1L5MA 1U8AA 3B5IA 1R0LA 3P9QA 5HUQA 1YRLA 4UMVA 3JAWA 4X61A 3IOMA 4ZAZA 3UMFA 1E89A 1BA2A 1BX3A 1WDKA 3F73A 4RDHA 1DT5A 3NDPA 4G0ZA 5JSUA 4HQRA 3UV6A 1NQAO 1JDBC 1N5MA 3AR2A 2YKGA 2BGWA 2VZLA 3TW8B 4LFAB 5KX5A 1E77A 2NUAA 3AUAA 4KRXA 1MHTA 2ZB8A 2CDAA 5HG0A 1OY1A 4HYTA 3FA2A 1TUIA 3PC8C 5DRYA 1M90D 1JHQA 3QVGB 4LRUA 4URYR 2CLHB 2IDKA 3W9BA 4EHIA 3M4NA 4MQBA 5F2OA 1HLDA 3BTOA 4GC5A 1M0TA 1SCBA 2G36A 2OGTA 4PZ0A 4QD3A 5LMZA 5HF5A 1U4NA 1AHPA 4GXNA 2O1EA 2AHOA 1ZNZA 4OP2A 1W34A 1F6BA 4ZQBA 1ENZA 1UFVA 1P9LA 2PPLA 4RSHA 1IZ8A 4MWCA 3WHPA 4WDQA 2Z4SA 4AUMA 4TSRA 3WIDA 3WLQA 5E4JA 2WT8A 3RV4A 2ZSIA 3MMXA 2HCFA 2I7VA 1XCJA 1NXQA 4HEHA 2ZB2A 2WU8A 5DJ5A 2RGEA 3ZU2A 3VR4H 5I7HA 1ECCA 1S8NA 5C8VA 5CG1A 4ZZIA 4KQ1A 1QB8A 4XLZA 2OFPA 1GU1A 2E4ZA 3JD3A 4NOJA 1IOVA 4RD0A 3RUPA 4D6XA 4OREX 4ZGGA 1YKSA 2K7FA 1PK7A 2H1VA 2D7DA 2VWQA 5MN5A 3ZZTA 1ODIA 2NV6A 4NJMA 4UUQA 4F11A 4MR7B 4OXRA 3MGCA 3O73A 4NHOA 4NHEA 4P3PA 4DA4A 2Q50A 3KVVA 1CDDA 3B12A 3L49A 4MA5A 3GBVA 3WLHA 3E3OA 3L8HA 4PYQA 1G21E 1SCNE 4PG7A 1YGPA 1YQ9A 1S3FA 1GG8A 4O5AA 2IYNA 1XDWA 2PO7A 1OFTA 4EF6A 1R8YA 2SKDA 4O2AA 3MOIA 1JT2A 3PNBA 2O06A 3L5KA 4RKFA 2WJ3A 3PZRA 3STUA 4II2A 4AYTA 4CMEA 3TLMA 3Q3EA 6YASA 4RZIA 2RMKA 2X9GA 4MP6A 1U8ZA 1WL8A 2AF3C 2I4TA 1P1RA 5IC5A 9ABPA 1NW9B 1PDWA 4R1PA 1QGAA 1Q6ZA 1Q86D 4FOSA 4DGSA 1CY1A 1YRWA 4GMFA 4K6KA 221PA 4HNUA 4L8GA 1YIJB 5LBIA 4DQXA 2I9KA 1D07A 1X1RA 3BE5A 4YLGA 4FLEA 2XZOA 5F1KA 1AUQA 2IY8A 1XP5A 2ENUA 2PM8A 3FVVA 4NDZA 1ILWA 3IDAA 1UD5A 4E51A 2C8LA 2I3BA 5CDUA 3PFKA 2NZUG 2BE7A 3B53X 3IPLA 1SXHA 4C3VA 3ZWNA 4BN0A 2CNWD 1L7MA 1BPLA 1VP3A 2OB2A 2WKSA 4PXSA 1VE3A 2CJWB 4L2IA 1U9IA 1VLJA 1VSQA 2NTEA 3EGDB 4H4DA 4I1OA 1S6YA 1SXJE 4TWJA 3SIXA 5BN4A 4JD5A 1WSWA 3OLWA 4WLEA 5BT9A 2VBIA 4MRSA 4RD6A 3T9AA 4YRLA 1SBNE 1GTG1 1RAGA 1QH8A 2OCAA 3AVUA 4H3VA 3TIGA 1K5GA 3F3MA 3KYDB 4Q3NA 1A4RA 3KT3A 5IBPA 3PXUA 2E4WA 3TZKA 3AONB 5AUNB 4MW6A 4YNBA 3P2JA 5A05A 2R85A 3QBJA 4F3KA 1W30A 1P0IA 1Q77A 3OZBA 2NPIA 4TWIA 4X8LA 2NVUA 3A2LA 3ASRA 5DV9A 2VUIB 5T8KA 3TAHA 5J4VA 2JW5A 3SEZA 1BS1A 4EGCB 2OY0A 4GMKA 3HO6A 5LCXA 1QQ6A 3JQ7B 3HCAA 4RV9A 4HS9A 4X7RA 4LDPA 1I4WA 2NTVA 3ABQB 4HR7A 3EN0A 4GM1A 4OLJA 3TTWA 1Z2NX 2F9FA 1ULAA 2EWWA 2HDHA 3MIIA 3NHBA 3IHKA 1XFOA 5ALLA 4QOFA 5B7QA 5CD9A 1XNRB 3UMCA 3W9SA 1LK0A 4UATA 1ISJA 1E5LA 1Z2DA 4G1CA 1M6YA 1O4WA 4IQ4A 4L76A 5H81A 3AVXA 5UKDA 4REMA 3WTBA 3STVA 4BB5A 2IELA 1EUCB 4BNTA 4EW2A 2OP1A 4RHYA 1HSOA 2B36A 3ZNNA 4BXOB 2IXTA 4NEQA 3KSAC 4YP1A 8MHTA 3QRWA 1UDAA 1C0EA 1Z5PA 4W9NA 2OVBA 4XLLA 3BHJA 3E03A 2FW7A 5K6AA 3UPDA 4DBVO 3CR3C 4DKXA 3OTIA 3M6MD 2PIAA 2H5EA 1DBWA 3PNYA 1CQZA 4AWXA 4TLEA 3BVPA 3OQ6A 3GRCA 1LNZA 3TQRA 4WDRA 3KFVA 2LKCA 1ZIOA 3I53A 4RKEA 4Y0VA 4CCSA 3BJMA 5J2UF 3JAMA 2P41A 2DFNA 4YRNA 1X39A 1T9KA 3ONNA 1KO7A 1QGUA 5A3RA 1XTJA 2QRUA 3CVXA 4GZLA 4JB8A 4G0UA 1UMBB 4BKOA 1IEWA 1AXEA 1VKHA 2QJOA 3D02A 3MTAA 4FMDF 2OZEA 4CEHA 2JH9A 4BPRA 3I64A 4FZ3A 1AB6A 2EZ9A 4QTZA 4G9BA 4F6LA 3R77A 2CJXA 3KZ1E 2C5HA 4UQOA 4TGLA 3SF0A 1MHPA 1CUDA 2XBUA 5ALFA 1X86B 3ELWA 3QVWA 5D51S 1LQUA 1UPUA 3A4YA 3GH1A 5JATA 3LQYA 3FJOA 1AOXA 3FMOB 4RDIA 4Y6OA 2JBAA 3D2AA 4K8RB 5FFFA 1V8OA 1V6SA 1P4RA 1ECBA 4IDDA 2QX4A 3HCDA 3RG8A 1YHQB 1KRXA 1FS6A 1NNUA 3V1KA 1NYTA 2FPGB 2ANBA 1XDGA 2Q2OA 3V2GA 4ZI2A 2VYNA 2YWRA 1QLHA 4MICA 3HWWA 4EG0A 2OMEA 3HEAA 5CIYA 1B6SA 2AJ8A 3DBHB 1BJTA 3ND5A 3PB3A 1SMKA 1PYOA 1XCOA 5G2OA 5JYBA 3H75A 4Q3CA 5FOTA 1GQOA 1S96A 4U7JA 1DQSA 1T4DA 3HCEA 2R6HA 1HBJA 1WKCA 3KXPA 2HLNA 4YGXB 5A71A 3P2EA 3BE8A 5JQGB 2PDAA 3DE4X 3FGOA 3OMWA 1TQ8A 3GDOA 4JYPA 1R64A 3WGMA 2FWRA 5A2GA 2W6JA 3G2OA 3I9OA 4WXMA 3ST7A 4AJNA 5EJ5A 2R25B 2ZGVA 1OIWA 4WBNF 1TB4A 3L0OA 1LI7A 5JBIA 3EWSA 3FSGA 1VIYA 3TI7A 3BWCA 1DMSA 1IK4A 3BQMB 3RU7A 3FWPA 2ONJA 4OPSA 4UM7A 3D3JA 4AN0A 2ZWVA 1DCTA 4MRPA 2ZJ0A 4GO1A 5DYWA 3ROEA 3CESA 1J2YA 5JJLA 1URPA 4U00A 3COWA 5E9WA 5HR5A 2RSLA 2FR0A 4QKQA 2V5UA 4JB3A 4M9XA 3T61A 3L6EA 2WG2A 2VQDA 1Y4ZA 4KRYA 1N8TA 2ROQA 2HYIC 2O2GA 2WQZA 1YJ5A 3LBYA 2P65A 3N8NA 1GAJA 2IXFA 4MGYR 4HAVA 4OKIA 2BKAA 4JGGA 2IY9A 1L9XA 1AGRA 3BWDD 3JARB 3ZV3A 2QN6A 1ZM4A 3MJDA 3DE2X 3SFTA 3AEKA 4IO0A 3NHWA 5JJKA 2YWCA 1W46A 4BC0A 4ZEMA 2ECPA 1JBEA 2HDNB 2W9XA 4I2VA 1VQ5B 3VISA 5AJWA 1FVOA 5ICCA 5EUCA 3KTFA 4HFNA 3ZDAA 4JHXA 4J7AA 4JJ8A 3T34A 3ENVA 2NXCA 3FI9A 2NTYC 4RY8A 1CJKC 3QA9A 4M38A 1U7DA 5T6BA 2C58A 2XNJA 4NFHA 2QAGB 4BFSA 5JSFA 4WWVA 3NHAA 3QHPA 1UJCA 5I9IA 2UUBB 1X7DA 3IB6A 1M2OB 2ZJBA 3SX0A 1R9GA 2GS9A 1PL0A 3LW8A 4KQFA 4BMOB 1PJAA 4LXTA 3SD7A 5IFKA 3ZK7A 1M3SA 2EBHX 3IALA 1GV1A 5DBFA 3FPBA 3L3BA 1XQXA 3QYJA 3ORQA 2A5DA 4HBGA 4KQMA 4YAWA 5C7OO 3FMGA 3MWEA 4RA9A 2WIJA 2O0HA 2Q0QA 4C9BA 2Q3MA 1HFWA 3DP7A 5AP9A 2Y1OA 4F1WA 3H4VA 4PRLA 4P92A 4GG1A 4YP0A 1UFQA 4L3VA 1MAHA 3WJAA 4ATNA 3QU7A 4MW7A 1L8LA 2K5UA 2ZVDA 4YT8A 2WWVD 1NVXQ 1BQ3A 3B38A 4YB8A 1ZCFA 3BIXA 4JIMA 2MINA 2KVOA 2XDWA 4HGQA 3L4JA 4C43A 3D5EA 4JP3A 4GOLD 2MSDB 2PNJA 3WV5A 4YDSA 1UPXA 1S2LA 1EAMA 3KJXA 5IYZB 3LU1A 1TU4A 4FCCA 3K71B 1KI3A 3ZWAA 4LWPA 3TCKA 3OHMA 3B3JA 3DMFA 2CMHA 3FFXA 1JX6A 2E4AA 3HXTA 2PJRA 2G4CA 5FORA 1C9KA 2VJLA 2QJFA 1MX1A 1G5RA 5ALIA 1V11B 4MS3A 1ATIA 2PYIA 2ZIXB 4GGOA 5TXGA 2X76A 3G02A 3QE0A 4F4FA 1FC0A 2X3UA 4B7UA 2WF8A 1TW3A 2XMSA 3PQ8A 4KQJA 4YDHB 2P6OA 3T9EA 5C3MA 4OD0A 3MAAC 5H68A 1YL6A 1KK0A 2A14A 1X3SA 2AN1A 3COZA 5FEMA 3H94A 1CLEA 1EEHA 1EZ4A 1IH8A 4QDZA 3R2JA 2HA4A 1O87A 4RD1A 2KS6A 3UJ3X 3LIIA 4PYJA 3FHTA 3H9GA 4J16C 1MENA 3IPXA 1TM2A 2NN3C 2VAVA 5K3CA 2IX9A 4JJEA 4LJKA 2BC9A 4BVLA 1A5BB 1II8B 2TRSB 2XKJE 1BHSA 5JLJA 1ORTA 2GAAA 2WINI 4M36A 1IB0A 2VQEB 4TUYB 1JYEA 4P0TA 1I2BA 4UTZA 4DB2A 2P3LA 4RF2A 4A03A 4CTOA 5DB4A 4YAGA 3LBHA 4QQ8A 4LQ4A 4C4ZA 5KKNB 4D42A 2IV3A 3O8RA 1G20E 4D9FA 1N9GA 5HZBA 1P72A 1ULBA 1BXGA 3GDFA 4YRIA 3VR5D 1UKYA 2YVLA 1XD2B 1WXDA 3A6KA 1LPBB 4XCQA 3ACDA 3JATB 4OXNA 2R1TA 4RLQA 5K2MA 1I1NA 3G71B 1T24A 3RASA 4E7PA 1VG8A 2R6DA 1MOPA 1FMLA 2B99A 1UT5A 4FFBA 1C7ZA 3R41A 5FB3A 2G28A 3REQA 4CU5A 2O8CA 1L5KA 2RCNA 2EV9A 4HWTA 3Q39A 1V5FA 3GQVA 3Q7IA 1SCKA 4KSBA 5TQJA 4LNUA 2OBTA 4LXGA 1P33A 3RAJA 1PR6A 4BVFA 2ETVA 2CLCX 3JD2A 4D9JA 3EVCA 5WRFA 2ZT5A 1NC1A 2PK3A 3ONYA 2O2IA 3THXB 1R8QA 4NZPA 1YTUA 1S8AA 1L4UA 4HFRA 4R3UC 2VZ9A 3OE4A 2YFYA 5IM5A 3DAPA 4O4IB 2C57A 1W49A 3GT0A 4FGLA 2JFWA 1BNCA 1HSZA 4NG5A 3ND8A 3HPQA 3RSOA 2HK8A 4DV2B 2D1QA 3BXFA 1J8YF 2HNAA 1JR3A 3ICVA 4LJ4A 1D1QA 2C4WA 5L4NA 3RFTA 4KN9S 2N0SA 3L4BC 4IFBA 1GL6A 3ROXA 1YZHA 4MQLA 4AT1A 4TSKA 3BKWA 3L0YA 2YC4C 1TZCA 1TMKA 5TMDA 2A8YA 1EK2A 1MNQA 1DX9A 2HF7A 3LHDA 3TX2A 1KSJA 1LRKA 1ND5A 2FF7A 1V16B 1UEIA 2Q28A 3IE0A 1YBAA 2ZAYA 4HSGA 4PPGA 1G60A 2H4WA 4ZVVA 2V0GA 1C8BA 2M5SA 1A9SA 1OXXK 4Q03A 1Y1KE 5E4YA 4CLRA 3F6CA 1O97C 1RHJA 3QGMA 1EXVA 1U65A 5JNRA 2AKAB 1XMQB 5CGQB 1SBQA 2JCBA 3A4TA 2ZUDA 4TTIA 1OF1A 2ODWA 1XEWX 1XXLA 3C1UA 1QQBA 2NUTA 4PSDA 4J94A 3AVYA 1XRSB 3HLKA 4MWDA 2YHBA 1W5FA 3SXPA 2ATCA 1WW3A 5LZ4A 2X5KO 3V1NA 1E6MA 1QGZA 3RWOA 1Z18A 5GPBA 2WV7A 4P0QB 4C0JA 1JXMA 4DB4A 1KOJA 3CF4G 3MJVA 1TVMA 4JSRA 2M6KA 4TS9A 1PR9A 3ZLJA 1RM3A 3T7JA 2C00A 1JHDA 3B85A 3K8QA 2JIOA 4EY3A 1SKUA 3G9TA 4QULA 1JBQA 4FYIA 5C7YA 1SCIA 2I6XA 4K2AA 1FMTA 1W2WB 3JYOA 2G4VA 3TOSA 2QJWA 4I5DA 4J3JA 2JD0A 1X1CA 2Y1CA 1J99A 5F4JA 1B42A 2GZSA 2ZRJA 3BDIA 4JLNA 3H2HA 4JXKA 4ZQEA 2CUTA 1XRPA 5IHPA 2AL7A 3EX7C 1OFHA 3OCVA 1OKKA 4OI1A 4I4TF 4B80A 3MTBA 3LFTA 2C96A 3GXBA 4YO8A 1DGQA 1Q0PA 1WOMA 4FGWA 1RWMA 1RXIA 2G9UA 4IUDS 4R8LA 5KWSA 5KHLB 2RHBA 1KSHA 4IVRA 5HBRA 2QTVA 9LDBA 1N08A 1LBTA 3L40A 3U4QA 1EP1B 1XIVA 1V41E 4AJEA 1G8HA 2NU7B 3ILYA 3W1EA 4EFLA 2HIAA 2W8BB 4ZYXA 3U1BA 1NI4A 4M1EA 4Q15A 1HGXA 4BEJA 1RRVA 4D99A 4CF3A 3EXEA 3HSKA 1B8VA 1Y34E 2V4ZA 3DKRA 3QPCA 3SAJA 3L1JA 1F8FA 2QIOA 2JRCA 1PS8A 4K6OA 3IUBA 3OJOA 2DHEA 4GLFA 5F23A 4NNOA 5HYVA 4NYJQ 1B6GA 2JFHA 1DT3A 2O3QA 5EZ5A 5G0VA 2GZ2A 2HLDD 5KTMA 4Q5IA 2CNLA 3JQRA 1GPKA 3L0BA 4ZZ0A 1GG2A 4LMBA 3NH9A 1ONOA 1EE1A 2WFMA 1E5QA 2OBSA 3HY6A 2XADA 1MW9X 2VDWA 5DN9A 1B6TA 3LT5A 2YFKA 3PRYA 2B9VA 2XTMA 4DPMA 4AZTA 2GBFA 5DNDA 3S28A 1T25A 3SSOA 2D5LA 2BT4A 4LNHA 1R74A 1KFCB 2B69A 4O4JF 2CB9A 1N2IA 3JQPA 2FSUA 3B9PA 1DKOA 1QH1A 2PV0A 3IP8A 4PLCA 2ZWMA 5DKFA 1K8ZB 1OZGA 2KSQA 3GDGA 4MYTA 3KHKA 5MHTA 2G9VA 1W35A 2BE9A 1YLOA 2PUVA 3RRJA 3W1VA 2L42A 3VOAA 1I5EA 4DLUA 2GJ8A 3GEMA 3CQ9A 2P9HA 3U7EB 1T15A 1IN5A 1QFSA 4HN2A 1G8SA 1Z36A 1OD6A 3OOWA 3V3KA 3X1KA 3M34A 5K4AA 2GD6A 3ZCTA 4DDMA 1ZH2A 1XXHA 5JCJA 2XA2A 3L8EA 2CNDA 1T3SA 3GZNB 4L74A 4P7JA 4OSPA 1Z5UA 4N8SA 2XQFA 4KGZA 4UUOA 2CBGA 1MZPA 1G63A 5I4KA 4UBJA 3V34A 3HSSA 3M1LA 5F7ZA 1FTYA 4B74A 1M1YA 1TM7E 1M66A 4CLDA 1T10A 2BLLA 2HYDA 5CX4A 3N2GA 1S01A 3B6EA 2QM7A 3A2MA 3FTNA 2YBEA 5AMXA 4ECEA 1UC9A 3O90A 1JG6A 2Z57A 2ZZMA 3TR6A 3A58B 1JDBB 1UM9A 2XBMA 5B3JA 2P5UA 2F6RA 3X1JA 3E5MA 4UHKA 5BN1A 3RYHB 1JEDA 4XD2A 1T3TA 4HGOA 4Q1BA 3TK1A 1LD3A 3EZXA 5P21A 4DCVA 3OQ1A 1P29A 3PUZA 3MTGA 4G5QA 1L7OA 2XX3A 1I7NA 5LBTA 4EGAA 3CCFA 1Y6FA 1DAEA 4I8DA 3MCWA 4N3NA 3RROA 4BEVA 3AUFA 4YJFA 5GVRA 2YV2A 3DZFA 3KC2A 3LDHA 1IN7A 1IFXA 1CIJA 4BWYA 3L92A 4IDFA 5CPFA 1A9OA 3ESRA 3OI7A 5ENZA 3FYUA 2P9FA 3O91A 3K5HA 1KQNA 1MB3A 2OSVA 2XHEA 5LYYA 2ZYGA 3T51B 1NQOA 2O3SA 2P69A 3M6LA 4YH1A 3WLIA 2Q4DA 1JTFA 3FLAA 2IYOA 2XYVA 3EIHA 2IYYA 4EGFA 1T0IA 3R6LA 4H1WA 2HBYA 2ZL7A 4KAJA 4O4LA 5JC1A 3KQKA 4Q39A 1TQ6A 2O8BA 3C70A 3FKJA 1OSNA 4MQMA 2C5FA 3TTTA 4HXYA 2XMBA 1QMPA 5CLQA 2WZBA 4EGQA 1Q1BA 2VNAA 2CCKA 2LWIA 2AFHA 2EZ8A 3B6JA 4L5BA 5LJLA 2CNBA 1IEVA 2VL7A 3Q3IA 3RI3A 3UFXA 5A4AA 2O8DA 2QTTA 4CT5A 1ZOSA 4TX1A 3QU2A 3QU4A 2QE7D 3RC2A 1Y37A 3TRFA 4GKJB 3PFWO 3PFCA 5C7IO 4IEFB 1B0PA 2Z4TA 4PS0A 5COBA 5DOVA 4A23A 1N05A 4JI4B 1U2PA 4XMYA 3DVRX 3GG2A 5U4XA 1R0BA 1D0VA 1PL8A 4I50F 2PMEA 3TFOA 4JYZA 4MP3A 4KI7A 2X1MA 4CEJA 4JXZA 1QH9A 1R2QA 1Z45A 1IY0A 1QGYA 1QAMA 1OGYA 3BILA 4MLDA 3CRNA 2OD7A 4MV5A 1TRKA 5JO9A 4DR2B 4IMPA 2IZ5A 3CKYA 2A1IA 1V9LA 1Z7WA 3IXQA 4YCSA 2PU5A 1ZCAA 2BFCA 5FX2A 5LM3A 4LTDA 3JD1A 4ABTA 3DZDA 1UPBA 4Y1RA 5KO2A 2BMFA 3C0KA 2C7BA 3FIUA 1JV2B 1EGMB 1HE8B 3S29A 3IDQA 5BRAA 1CP2A 1TTPB 1DIOB 1N3YA 2GWRA 3K09A 3PA1A 1EFLA 1L4GA 2HO5A 4IIXA 1CZNA 4BAGA 2OBLA 1MJ5A 4RLZA 2VSYA 4RJ2A 4DQVA 2VSQA 1GARA 3M2PA 1K89A 1DJPA 2FCRA 2J0VA 2JJ2A 3QEMB 4U7TB 2JHAA 4C2AA 2FPLA 4DG5A 2WYRA 3CT6A 4P5DA 2YXBA 3ZJ5A 1TM3E 2PSEA 4DE5A 3UGJA 1ZW1A 2XCIA 3S5UA 3FVRA 5CT9A 5JXHA 3W4IA 4ABYA 3DDNA 1WD7A 2VH1A 1N2SA 3LRXA 4U3JB 4Z9BA 1A5TA 2Q2QA 4CETA 3BKXA 3WK7A 4EPVA 3PENA 3CVOA 2VLIA 4JJ7A 1U0GA 3H9BA 2AS0A 3OKFA 4HXFB 3I9KA 2AB0A 4JP5A 4MUAA 4PYIA 1MOQA 4UFOA 4WIAA 3ZDEA 4OPOA 1CY4A 4CI9A 4F9GA 3QEBZ 1M83A 3TBFA 4HB3A 5ALDA 5KYVA 1G9TA 2J32A 4R8RA 1ISGA 5H1YA 4ENUA 1RI5A 2PAFA 1IVSA 3KEMA 2I3GA 2FDXA 2DPMA 4OMFG 1XPOA 3DKIA 1MRSA 2JNWA 3BD7A 4OQ4A 2E0IA 5CXXA 4NEGA 2EDAA 1M1ZA 4J43A 4LYGA 4IX1A 3QUCA 5D5HA 5AM2A 3SLDA 2IOFA 2Q1XA 2PVSA 2YWJA 5EJ9A 3K3PA 4Q3OA 4TTRA 3H3JA 1O8BA 1QF9A 1UDRA 3FBWA 3N59A 4RF4A 1QTQA 2H0QA 5F51A 2IPLA 3LA6A 1FNSA 1XDDA 2WIFA 2RKWA 3BN3A 2HMWA 2BGMA 4LTNA 5T4FA 2OBYA 3CA8A 2BLNA 2CLKB 3PX2A 3KV3O 4KO1S 4CQMB 4YXFA 2MMGA 1NPYA 1PZNA 4JP8A 1KORA 2B6HA 2NXEA 1FL9A 3W3AD 4NZZA 2WLTA 2WOOA 3OM0A 3EDQA 2WG1A 4G56A 1R4NA 2BFFA 5AK0A 1IULA 5IKPA 5JANA 4CMJA 1UBGA 5JMTA 3PDWA 2V6GA 1T5BA 5E7JA 3K70D 2FDCA 3ID6C 3PL1A 5DNEA 1YZQA 2FW1A 2EGUA 4MARA 1ZK1A 5JXJA 1EG7A 3EDRA 2C20A 1KPIA 1NR7A 1TUGA 3PUHA 7REQB 2BV3A 1RMTA 3DDYA 1CBUA 4YMHA 1FFWA 4R9RA 3LZCA 1YBFA 5T3UA 4YALA 4Y2HA 1H9AA 4Y6PA 5B3LA 2A3NA 4BV8A 2H63A 3EOZA 3O4VA 4QEDA 4D81A 3GLIA 1EVIA 1Z35A 2QQ0A 3QJYA 4L0CA 2HAEA 3HYTA 4P7KA 2GJPA 3A4MA 3TLJA 4E94A 4EAQA 1TO6A 1DOZA 1TKRA 2JIPA 4W8OA 4HMPA 4MDFA 3F9IA 4JBGA 3NX4A 3TQTA 1BDJA 1Z5NA 3RYTC 2YVAA 3LZDA 2WUVA 3OCCA 1M6VB 5ABPA 5AW1A 2QQ5A 2ZE7A 2ZDGA 1VZ3A 3HYSA 5CHEA 5IVHA 3KQLA 4NFLA 3WJ2A 3M9XA 4HGYA 1BSVA 2ET6A 3MCZA 1KWKA 2NUPB 1NDHA 1C3XA 1Y8CA 3AILA 2C77A 4EJMA 3RS3A 1TMYA 1HZZC 3GVJA 3JWJA 2X8JA 3NETA 2H9IA 3A6JA 1SC9A 3GF4A 2E18A 2PWAA 4HFJA 2Q6KA 3P0EA 3HCNA 1V5VA 5EINA 5IBCA 4Z9FA 3UAWA 4Q7EA 2HR1A 1K92A 5DEOA 2C5SA 2DPXA 2PMCA 2ZZQA 4BKRA 4DHWA 3FOZA 5LQMA 2FSVA 3ZD6A 3RSLA 2JLAA 4BJ1A 1U7WA 3WMGA 3BMQB 3FVQA 1X13A 3D0RA 3MJTA 2O8EB 2WJJA 5CDFE 1RS0A 1RYDA 3GEEA 1FNNA 2DQSA 4MW4A 2XUDA 1GL3A 1Z88A 3E8SA 1ZN2A 4N6GA 4DPLA 1PK8A 2AXQA 2PS1A 2YJNA 2PT7A 2C9CA 3AZQA 1DC8A 2ZULA 1XQWA 3EISA 3I1JA 5JHGB 5AJHA 1V45E 1EWTA 2P11A 4L07A 4PPYA 3TLEA 1ONSA 2XT6A 5HA5A 3L0SA 4A8PA 3ED1A 2UZ4A 3PUYA 2RARA 4JGBA 2IA5A 4AVYA 1MP0A 1KI6A 1C0PA 3IAS1 2IYSA 3I1IA 2QUZA 2IGBA 1YD7A 3L6OO 3GGSA 5DYNA 3OUZA 2WPNA 1BJRE 1MUUA 4XJVA 5FL7A 1Z2OX 4BQRA 1NOJA 3HEMA 2O57A 2C7GA 2DBQA 5LOVA 2R6ZA 4JLPA 1JJIA 5AVUA 3HH8A 2PZJA 5DCLA 3LVQE 5AW2A 1MB2A 2WUGA 5CVDA 1ISIA 5IM4A 1RC1A 2ASVA 4GWKA 3OKXA 1P0PA 2XAAA 4CVNA 3E2PA 4POAA 1SOWA 1G3RA 3KL4A 3KQQA 3R0ZA 4CDMA 3IV6A 1KZ6A 3ZS9A 4DLKA 4GMXA 4O59O 2OM2A 1SKAA 3G13A 2O3JA 4GQBA 4CG2A 3WHKA 4E09A 5IFLA 3HRIA 3QYAA 4OIMA 4DBZA 1QK3A 3KLMX 5KSWB 3LX5A 3EF3A 4Z0NA 1K73D 1J23A 1A9QA 3L6CA 2C3PA 1Z5VA 2WVGA 1X7WB 2YQ4A 1KIFA 3SEJA 2C94A 4P80A 1CJCA 1IAVA 4RE5A 1LBIA 5E4FA 4W63A 5AUQA 3ZOZA 3ZWOA 2C3UA 1MJHA 3AP1A 4D96A 4E5SA 3OW2B 2OZLA 4N9QA 3GJ7A 4DMFA 1SZJG 1SZDA 5KX5F 4ZP1A 1PJZA 1R18A 4YROA 8ADHA 1P2FA 5IAEA 4UREA 1JHXA 4KPGA 3M7IA 2XWQA 4J3FA 4WLFA 5DM60 4A16A 3A9RA 3BMOB 1KRWA 1PT5A 1D2MA 3BZUA 1XSEA 4DV4B 3R7BA 2H0RA 4PNHA 1ZVKA 5HP4A 2VJDA 4E5PA 4KYIB 3V7WA 3U7HB 1YS6A 1VCHA 1YBVA 3CBGA 1A9XA 1RPZA 2W7TA 3HDJA 4ID9A 2RGDA 2BFOA 1XRMA 4LJ8A 4UAVA 4XTRA 1MTZA 3PIDA 1OLSA 4LY6A 1Y33E 5ESRA 2G1AA 3UG7A 1T6BY 4H15A 1T5SA 1BC5A 1WY5A 3F1KA 4G26A 2XF8A 4L4ZA 4M87A 4MWOA 3MJEA 3N05A 3OP4A 3W4KA 1GSIA 1VP9A 2C9YA 4F8JA 1UP6A 3VAYA 3NVKI 4M88A 4FKBA 3O47A 4F3TA 3O8QB 4IFEA 5IDYA 1PYDA 3SKYA 1AKUA 3LUPA 3V4FA 3OAAA 1RVV1 2VPTA 3KQWA 4K9RA 3F71A 3R3HA 3TINA 2P75A 3D31A 3AR6A 4TZKA 3MSCA 4LJAA 3UG6A 5IJ9A 4N54A 5BW4A 4A73A 3CM0A 3CF6R 3PEUA 3NHSA 4C7VA 4ZZ3A 5IVKA 2FZEA 3L01A 4PPFA 2OECA 3JQ8B 3L7CA 1YITB 5SZJA 3IAAA 3PGVA 3WRVA 5TT1A 3N76A 2XUFA 3P4XA 4LHSA 2O48X 3AHDA 2DEUA 4OOXA 1NBWB 4BAUA 3HU1A 1OYWA 2C2YA 4XZ3A 5K3SA 4YLEA 1RC8A 2FQYA 2PCJA 3IUJA 4TWBA 3BC9A 1XZLA 4M99A 1TC1A 1M6EX 4O2AF 1IMJA 13PKA 1TKCA 3H05A 2BUAA 5SYMA 1H6DA 3OZ7A 1E3QA 1EVJA 2FWBA 3KB1A 3ELDA 5K09A 2APJA 4JKYA 1Y82A 1TF2A 4E4RA 1T13A 2CXSA 1YSCA 2WP8J 1EBFA 3A1FA 4WN9B 1SA0A 2W6MA 1FNDA 1NMYA 1E6WA 2P5YA 2X5XA 3C3MA 3HA3A 2ZE6A 2C7VA 1Q95A 3C3CA 4Y67A 3U4CA 5F2NA 3Q8MA 5I7FA 2H2IA 2Y67A 1U94A 1UD8A 1XVUA 3KKZA 2JZNA 2YJ5A 2C7RA 1ZIDA 1JAHA 3KOMA 1K28D 3K6SA 1J21A 2RK3A 4G1BA 3R3UA 1G9SA 4OQYA 1Z5OA 4FGZA 5GONA 1W5SA 4XSVA 2OILA 3CMAB 3KT8A 1XL0A 1XX6A 1H2XA 3WLNA 4ESOA 2V8OA 4J29A 1VI5A 5B7PA 1XNJA 1WXIA 1X74A 2ZE8A 1P7VA 4OHZA 1B0ZA 3TN7A 3QYPA 1CJVC 2IF0A 3FOEC 1M76A 1YK0A 2PVCA 5HDBB 5IXSA 4HDSA 2JIDA 1P5HA 2ID8A 2Y2VA 4Y8VA 1SUDA 5LIPA 5BRJA 1RQRA 3UXHA 3HXPA 1R6XA 2Y99A 2H11A 1Z82A 3D4NA 4EUFA 1Q0HA 2GETA 3FMIA 3IT3A 5LN1A 2C7QA 2O7VA 4MQUA 4JL6A 1D4AA 3IA7A 4BZPA 1B16A 3FFAA 4OSEA 1IUPA 2ZT6A 1C4OA 4JMQA 1IONA 1XU7A 4QUEA 4RMNA 3OW7A 1FRVA 1FSFA 2I1VB 1OX4B 2VK2A 3TUJC 4IOLA 5HKKA 4F1JA 4HE5A 1QHXA 1TLTA 3B3GA 3PJRA 2EJBA 5K0NA 1CEEA 1HYEA 1YDGA 1ZJYA 4TVBA 1Q74A 1AF4A 4I4IA 4RPCA 3I9FA 4KIUA 5DMXA 1JHYA 1CUHA 5BOSA 5KYYB 1MA3A 3LY9A 4DM7A 3E81A 3WWCA 4NTZA 5PNTA 5BWCA 5ALNA 3U4IA 1QDEA 3BX1A 2G07A 4YV1A 1HORA 3QTBA 1LZKA 2YMMA 2GSDA 3H5LA 3T94A 1ZM3A 2YUIA 1HRKA 3GUHA 3L46A 4DQKA 3PNOA 3ZIUA 2H1OA 1YDFA 4ROSA 2BW0A 2YMLA 2FZGA 4NDNE 1F17A 4NS4A 4W7SA 3WL6A 3FSEA 1C14A 3GJ4A 2EBWA 2XR1A 3IKLA 3F96A 4WW0A 2J9FA 3IAS6 4LJ9A 1SQ0A 2C9OA 1U0BB 1H9BA 2IUSA 4R5MA 2OBMA 5HSGA 3WISA 3REGA 2EVWX 3OEYA 3SXJA 3GU3A 4KNVA 4PZDA 1R6VA 4BNLA 4RX1A 1L4MA 1ID8A 4B6FA 2IP1A 1KVTA 1YB5A 1D4ZA 2AZDA 4TXMA 2PS9A 4CM8A 1ZONA 1U2EA 4EPYA 1M8PA 4D43A 1ONBA 1V43A 4QFBA 2AEFA 3DTVD 4FXOA 2A3RA 2NQTA 1PE0A 3VTZA 4N49A 4PCLA 4H6VA 3DL4A 3PC2A 4S2EA 3CLUD 1OU4A 3IRUA 4DCUA 1GAQA 1TK2A 4EG1A 2CCGA 3RVSA 4HNAA 2RK6A 1OE0A 1V7ZA 1SCAA 4R2HA 5AQEA 3WGLA 3ZQ4A 1QVZA 3M33A 4OHMA 2JG3A 2HNBA 4CKBB 1SKYE 4YV2A 4M1KA 2H54A 3QNMA 4FFLA 3U19A 4JI7B 1Q1NA 1WBBA 3U09A 1G3UA 1XVTA 4C2TA 1NYRA 3Q4GA 4QU9A 5TVKA 1FRZA 1DEKA 1MORA 2VDUE 2XGMA 1G1AA 3FZNA 2PRKA 4HHEA 1VLLA 3KKEA 3H13A 3NM6B 4MYHA 1D4OA 1JTEA 2IZOA 4EW3A 3FNRA 4LX0A 1CUVA 2QG6A 3PD1A 4RYLA 3QOWA 1MFPA 1JJVA 4M60A 1FP2A 3OLVA 3GYBA 1KPGA 1CK4A 3I9V1 4ZCPA 3KR0A 4UOQA 1I5RA 2OCPA 2GD0A 1QYIA 4ZC8A 2XEDA 3UT5B 4PLVA 3OPQA 1AV6A 1C7RA 4ZMBA 4RF3A 2CJYA 2YX1A 4FGUA 4I5IA 4WLUA 5BSKA 2PUFA 4RM0A 3SNHA 4DNOA 4R5HA 4QTYA 1J24A 3L6RA 3OICA 5IHXA 1DAKA 1DZIA 1UP4A 3KOUA 1JGTA 1POWA 4J1TC 1KBQA 3IJ5A 4PSAA 4QJ4A 3RUEA 3ZX5A 4B73A 4D8VA 2PLFA 3LWNA 3MJCA 4RIGA 5DHAA 3G0OA 5ALXA 2RHLA 4PQEA 1PR0A 1OXUA 1KIAA 2ICAA 3LI2A 1OYOA 3GFRA 3FTFA 3HRHA 5EMMA 4BEWA 4QBTA 3Q1KA 1CSEE 3IA2A 3ASQA 2LDBA 5ITZA 4PLTA 4GDFA 2WA2A 1SPBS 3G0DA 5ER9A 4LXXA 3OOHA 4RPHA 3WI7A 2IYXA 2H51A 2IEGA 3NGXA 5AW9A 2FZKA 3IAUA 4RIIA 3C48A 3K15A 5KOJB 2PCLA 3PFNA 2HW8A 5GADl 3KQSA 1KEKA 4YT2A 3P96A 1T8TA 3M0EA 3SHVA 4CXMA 2MSLA 1XTIA 4NCNA 2WTNA 3ILVA 1FVHA 2Q4BA 4JROA 4YELA 2KPOA 3MJSA 5D3KA 4ERNA 3ODGA 3PS9A 4TV9A 3WL8A 2CY0A 2WJYA 5IT9A 2CVPA 2BIFA 1VIMA 3R40A 4UM5A 4G1VA 2BRUA 3MERA 5A3JA 1QVVA 4EY7A 1CY6A 3C7AA 3MM4A 3VYUB 3DLAA 4U7HA 1BH2A 3SJPA 3B2NA 5EP3A 4YQFA 1RAFA 1E32A 4CMKA 1D5WA 2AOUA 3NV9A 4YLYA 2VDOB 1PNTA 1OFIA 1OASA 1W6RA 3V8BA 5C5EA 1FDSA 5BUSA 1UD4A 5KUTA 4RK0A 5EJFA 3OZXA 5BNWA 5HM6A 3OD1A 5DM2A 4JT9A 4I2NA 4KXWA 2HRQA 3BWMA 3CCJB 3N87A 3R5JA 4B81A 3LFHA 4DA7A 3CMMA 2CVQA 3NS7A 4GSYA 5M29A 3EVGA 5HIKA 1C3OA 2C0PA 2Y1WA 2R0QC 2FMHA 3VC1A 5B5SA 4ZAYA 2AOXA 3BSSA 4HZIA 4K28A 5A0TA 1HK7A 1YVRA 4QUAA 4V2IA 2OYCA 2CV1A 2WSSA 2Q45A 2FP4A 3U3MA 1N2GA 2FRXA 3G5MA 3OIYA 2GCOA 3ORYA 3DG9A 4INJA 2OCGA 1QVWA 4PFKA 3NBFA 4XDZA 5DLPA 4BNYA 3UW1A 2HO4A 3WYAA 4I46A 4M1SA 3L4SO 3WB1A 2FPWA 5JDIA 4KYUA 2RHMA 1M6NA 4AG5A 4CG3A 1OWOA 3KDPA 1SVNA 5J2UB 4AUKA 3RK4A 5HK9A 5LU9A 2O1WA 1WB9A 3G17A 3D8BA 2G82A 3LCMA 4UE2A 2R7NA 2IUTA 2VPQA 4N5NA 1XQBA 1Z74A 2XWSA 4NMLA 1VB3A 4ZVKA 5LDGA 2DG2A 3W90A 3WDLA 1CS0A 2Z43A 4O2LA 5FOUA 3C7TA 2H52A 3QXGA 1REQA 3N39C 4FMDB 4J8PA 4UHJA 4ZZ2A 1DC4A 2KE5A 3CXCB 1L9KA 1M2VA 1TT5A 3D6AA 1L5SA 1JG2A 3V8PA 2ZR0A 2AYYA 3QU5A 5A0VA 2VXYA 2OBFA 1NN5A 3COSA 5K3DA 3QPDA 3TE6A 4AQYB 4XB1A 5ALZA 3CISA 1GUYA 1QXSA 4CM4A 3UBTA 1VI6A 4RZQA 4GYKA 1DUVG 4PHHA 1O96B 1NW7A 4B82A 4W82A 5DEIA 2E3JA 3U17A 3D1VA 5BSVA 4HWSA 1UMCA 3QVJA 4TKVB 4XPZA 3HACA 3NWEA 3ETEA 4HQOA 4IIFA 4I1SA 3X1MA 2FUCA 2H29A 4UUMA 4GOKA 2XCUA 5KJ1A 4KQKA 1XLUA 1LPPA 1Q7GA 1W4CA 1K86A 2EL9A 2R65A 1P44A 3P7MA 4I3HA 4MUKA 5HFAA 3WLMA 4ZCMA 2X9LA 5EXXA 2NZWA 4A10A 3A3GA 2CL7X 5BMVA 5JC8A 2C2WA 1S89A 1LS6A 3BCSA 4U6SA 4B0OA 1J25A 3OUTA 4JLKA 1U7OA 2VBVA 1LVUA 4OOSA 4GDMA 1R6UA 1PFYA 2PX6A 3K8OE 2WTXA 3PDUA 4WBNB 1Q7BA 4JUFA 2RHCA 4C6HA 2H2FA 4RZSA 2J0SA 3UK2A 2D3NA 1CRPA 2UUOA 1FYVA 5BP7A 4BMVA 5AXBA 4AF8A 3R6JA 1J49A 4JB0A 2B1JA 1QZXA 3Q6IA 4L7QA 5AM1A 4ROTA 3S5JA 3UMRA 5DT2A 1VLZA 4OQLA 1KP2A 3DOHA 3P5SA 4YRPA 3D7NA 4EPTA 5CCEA 5EHZA 3TMAA 4LFBB 1QJ4A 2MYPA 4F8YA 1UKAA 3U4MA 4UNSA 4N5LA 4Q9IA 5AIBA 4JI0B 3IUMA 2GYUA 4KXXA 3GRZA 2PZKA 4PTZA 5IH7A 2DUUA 3ZGZA 2ZI6A 3OD5A 1YZNA 2WHYA 3KEQA 4PLYA 3TTXA 1AQYA 2ZUTA 3U4HA 2PUAA 1TGYA 2NT3A 4GVPA 3R7WB 3KJGA 3ZI4A 4KZPA 3I5XA 2R3SA 3ZNPA 4TYQA 4WBXC 2GRJA 4MQ5A 3ZIDA 1KP9A 5JAMA 1EMDA 2BN4A 3I12A 2X5OA 1Z38A 2L2QA 3ZE9A 1C9DB 2NVWA 3I9V6 2Q41A 3S8YA 1OXKB 3B1KA 1ZVVA 1E3XA 3H4IA 2XYRA 2ZTSA 5AVOA 1RWBA 4C0KA 2FX3A 2CLLB 2Y1FA 4FZ5A 3U7JA 3DLBA 1BWSA 1ESEA 3OQPA 3T54A 3QUTA 4Q4DA 2QP4A 3AEXA 3TBKA 3QELA 3NTUA 5L4SA 1B3BA 1I2MA 5F2EA 4RM2A 3FRHA 3OEHD 3VYSB 3WADA 1TZMA 2HV9A 3B3AA 4U9UA 1YVEI 2XHZA 3OUUA 4FFOA 3T3IA 4Z4UA 3WGKA 3RIGA 2IYLD 1KAGA 2CLFB 621PA 3I2JA 2QMUA 1CHDA 1P8AA 3UMBA 4QGSA 3BRWA 3O83A 3QOXA 1ECPA 5C1OA 1X2BA 1Z37A 1KZGB 1XN4A 2WDZA 1WULS 2ZJ1A 2HIHA 3EZYA 2WZQA 3DC2A 4M0DA 2C5BA 4K9PA 3ZV4A 1KRHA 2N47A 1JN0A 5DSTA 4YRFA 2ATXA 5TMEA 1J0AA 5BQXA 2X6WA 4D4HA 3FF4A 4QHTA 1Q44A 4XH9B 4QQKA 3VH3A 3OHSX 1TT7A 3CVVA 2DLCX 1EVEA 1KEWA 2IBMA 2Q3LA 4XR9A 2VJAA 1KZ1A 5FWXA 3OESA 4J7CA 5D3MA 3GLUA 2FEMA 1CE8B 1JJFA 1BKSB 2QRLA 1WKBA 1DO0A 1JIQA 2B3TA 3A31A 1JA0A 1U0RA 4EB6A 2GBLA 3DVQX 2WE7A 5ADHA 1E2UA 2AR0A 2QA4B 1RSZA 2ZYUX 3BFKA 1KEPA 1ZD4A 3DPIA 4P3IA 1ZIXA 3OTGA 3QOFA 4LDQA 1VQ4B 4OAOA 4ECAA 2G6BA 3BM5A 4EABA 2O8EA 1FFXA 2QSUA 4EQZA 3FLBA 1N9KA 5AUPB 2EC5A 1HLGA 4XNFA 1F2UB 4GH5A 1UJ6A 3JVUA 3NCHA 4Y2QA 5D00A 3CB4A 4QOHA 4PGGA 1IBSA 3PQDA 2BR5A 3OIVA 5MN4A 2P5SA 4W1PA 3V8QA 1NLYA 4TPKA 5CX1A 1G0NA 2PYDA 3AETB 4TVSA 1RP1A 2A58A 4HZGA 3FPKA 3QMWA 3WSWA 5JBQA 3TLYA 4PSVA 1AUVA 4X3CA 1CZHA 3I04A 3HO8A 3IR6A 3IIMA 3R3VA 4A1FA 5CT8A 4B40A 3DOOA 5K4HA 2BGUA 5IRCD 4G4IA 3W06A 3CX4A 1JU3A 1Q16A 1OAOA 3GNQA 1JQDA 4V1CI 4NXMB 3BY1A 5K3EA 2QR5A 3K2QA 2A78A 4IQFA 3IAXA 1R3DA 2C83A 2KJQA 1ACMA 2Z0MA 4E6PA 4CMCA 4HDMA 2QNBA 1LXCA 2I6TA 1ZKMA 4N47A 2ZTMA 2JAPA 1A88A 2MR5A 4XLEA 4TKOB 3VKUA 1KQGA 1EINA 1GNPA 3ANXA 2CXXA 3EG5A 4WSOA 3WS7A 3WYEA 2WKPA 1T3HA 3GVXA 4PZPA 4C29A 4ZVOA 1GPDG 2Y9MB 1AQLA 2ZIGA 3O9MA 3ME5A 3NW9A 4RY9A 5E9JA 1PT7A 5AJZA 4TT8A 3AJEA 1AQNA 3CGGA 3DZJA 1YOVA 4UU7A 3HXKA 5DF1A 3U4GA 2W5UA 1JVSA 1XMSA 1V35A 5K8UA 2QUHA 2BGRA 3ISXA 1I5OA 2HV8A 1W9HA 3H1AA 3QI7A 4N0DA 3ETCA 2WM2A 2I76A 3LTEA 4G8JA 3Q0TA 4FDAA 4X9XA 3JALB 2J3IA 4K9KA 4R01A 1DWOA 2W6IA 4GM4A 5TGDA 3LPNA 1T2NA 5ITVA 5FUVA 1J2RA 1K6IA 2Q2VA 4GYJA 4NBWA 1ADCA 2WVHA 3WHIA 3MRVA 1W36C 4LF4B 1UOOA 2O3RA 2JAXA 4AF6A 1PLKA 2V58A 2VHQA 3BTVA 2BONA 1UWLA 1T29A 1G41A 2B7CA 5L46A 2GCEA 4FBGA 2VS1A 3PX7A 4RNDB 4G5SA 3TG2A 5KJCA 3OOSA 4YHHB 5KCMA 1B8NA 3LT4A 2FPMA 3SR4A 1IZ7A 2FUKA 2OHHA 4JN6B 4GU5A 3ZWXA 4DF3A 3HKBA 3IJEB 4CLXA 1GD1O 3R5FA 3JQBA 1DQYA 5IBRA 2WIKA 1WQ4A 3JQAD 4JLDA 4LFCB 2JI7A 4FXPA 4X44A 4G86A 2Y9PB 5HJ2A 3GH3A 2R7KA 5T8KC 4N76A 4FR0A 3NHKA 3HGMA 4C4TA 2ILVA 2ZRCA 1QYVA 4MIKA 1UC5B 3OIUA 2VKQA 5B58C 1HQYE 1E5TA 1PS9A 4FCTA 1UWCA 4BO7A 3E4CA 1JDUA 3OOCA 4LBYA 1JZQA 4GX2A 4MAMA 4BNZA 1IJFA 3RRBA 2VLBA 3FPHA 1NF3A 1TYZA 3TLGA 2CRVA 1CRQA 4ZCRA 3HFRA 4N3BA 4DR3B 1KMNA 4X7EA 3IEXA 5INTA 5LMUB 2B2NA 3KKQA 1DKQA 1VFNA 3SFVA 2DTXA 3OFKA 3ANMA 7MDHA 3BUSA 4RSMA 3AESB 5FO1A 4Q1EA 4RD4A 4KV7A 4BOYA 1D6JA 2FMKA 4IGIA 3TQCA 1LI5A 3VR3A 3EWAA 4CKXA 5AM3A 4XWAA 4HWRA 5JEEA 4W9NC 5LQAA 2IS4A 4DRZA 3KCQA 2JDID 3HCFA 4J90A 4U7DA 2CLEB 5K6AC 3H84A 3AY0A 3IEUA 1NXPA 1IXYA 3CY6A 5KNDD 3WL7A 1OVGA 2CXOA 3DXYA 1QB7A 3CC7B 3SVTA 5EIOA 3IQXA 3ROTA 2EBFX 2OO5C 1UK9A 1H3NA 3IQWA 3UC5A 4G8CA 5EHNA 4DV0B 2TYSB 2W6QA 4O4LF 5JMWA 3D64A 4BCDA 4RFSB 1NLZA 3BGVA 2FPIB 2PNFA 1QRRA 4MV3A 2C7OA 2HEIA 3IIKA 5AOBA 3QKUA 2A94A 3G2KA 4D74A 1K2WA 3OZIA 4YCBA 1DTSA 1Y3HA 4G1FA 3R6WA 1D5CA 5JXIA 3W5SA 1SUCA 2O8NA 3BD6A 3I01M 4Q93A 5CFMA 1EJ6A 2BFMA 2OE2A 3CUKA 1SJ9A 3KAKA 3MBIA 1Y6ZA 2UZ1B 4GW3A 4Z1MD 3DB1A 3A14A 3DEAA 2GM9A 3M1IA 4KPEC 2I71A 1NJ1A 3A26A 3GCDA 4JOCA 2UYHA 2QSYA 1QWSA 2X8LA 1VQ8B 2HHHB 1G5IA 4XYMA 1BWQA 4MYRA 2G1PA 1LRJA 3D8NA 5I3CA 1Y9JA 3V4VB 4GGMX 4LHEA 3GA7A 5FBHA 3UF0A 4MUMA 4XONA 3ZUPA 4C4RA 5KKAA 5BVGB 4CN9A 3Q3GE 1E2IA 4EYSA 2JI8A 4GX0A 4LRYA 3FR7A 4LY3A 4U0KA 1R50A 2CNKA 3OE7D 5L9AA 1EE9A 2PT6A 3LL4A 1LX7A 3PGXA 3NI2A 3WG9A 5CLLA 2CT8A 1NVMB 3MW8A 4RWZA 5AI0A 4TL8A 1OZAA 1YZKA 3MELA 5KSZA 1WLYA 3AHGA 2IUUA 3AUUA 2RAVA 3R9XA 3GFVA 4G65A 1SHLA 4MV7A 4C76A 1IK6A 1I33A 4DMCA 3HVJA 5KCZA 3JSXA 4X97A 5CFRA 4GMGA 2NOAA 3VVLA 1Z6XA 2WQ7A 1DTWA 2XKBA 2HBQA 4CJXA 1RAIA 3H7AA 2RHGB 2ACEA 4L3OA 1L5HA 3H5NA 1QVRA 2I2XB 4MLPA 3W9UA 4L27A 3ZDXB 1A7KA 4R8SA 3WRXA 4EG4A 3CKMA 5LXTA 2ZPAA 4O4JB 4C7JA 1ZOPA 3UJAA 3S8EA 1RYEA 2D0DA 1FMCA 1R7RA 2QGZA 3GGGA 4L9RA 1Z4PX 1SNYA 4K26A 5C5CA 2QTFA 4UARA 5J59A 4CLOB 1G59A 2QN3A 1RKUA 1UL1X 2J9GA 4I6JA 3W8NA 2H3HA 1QOPB 3FKSD 4QBFA 3A6PC 3C3BA 4PQRA 5T6MA 2WMOB 4C04A 2VJMA 3OZCA 4U4AA 3OOYA 5F4BA 1LDEA 4AZ0A 1PSZA 2ODTX 3QXXA 4OMUA 1ND6A 2O0MA 3ONFA 1RPNA 1JQJC 1VLQA 2Q3DA 4FDUA 3WKDA 1BVHA 2JFBA 2JIMA 4LY9A 3U13A 4HAXA 3NKFA 1XAGA 1YZUA 4F6RA 3KBOA 3F6SA 1OFUX 1X1SA 4BLQA 5KQMA 1X0VA 2ABWA 1NASA 3HN2A 2N46A 4R31A 3ZOKA 1N33B 1KDTA 1P5FA 1FW8A 4XWOA 3GR6A 2P2CA 3E3NA 4RGVA 3PXXA 3NRCA 4X1KA 4LV6A 5SZHB 4XRRA 3DR3A 2I67A 3K8ZA 1BCSB 1Q1QA 1UKEA 2JJ1A 1Y3FE 4DRXA 2X0RA 2CZCA 3NE5B 1MJGM 3A7EA 1MF7A 2IH2A 3WGQA 4NBSA 1H9CA 1XVIA 3QW2A 4JC5A 2X7XA 3ZPXA 1UPCA 1Y1RA 1TQ4A 2IHUA 3TTVA 2WHQA 5CYFA 5FPKA 3T95A 2OGUA 2RH9B 2PX0A 4INZA 3GIRA 3AR5A 4X94A 1FW6A 5H3LA 2RGBA 2ZJAA 5CBPB 3TXAA 3AEUA 2F1RA 1ADJA 2LGJA 2YL2A 5SY9A 1E9AA 5GZ1A 3E6AA 4LDJA 1OTHA 4Q3DA 5AKYA 1NSYA 4JMLA 3E3MA 2CEKA 3UJNA 1LPAB 5T41A 1MQ8B 4MIEA 3UJDA 5G53C 3E9MA 5IYPA 3B48A 1IC6A 3K30A 4GLBA 5ALWA 4I36A 3Q7EA 3RKUA 3VR2D 3CNBA 4RESA 3FD8A 4OHRA 3DB2A 4CKCB 3AEZA 2FEWB 3LBIA 4UTXA 2H57A 1QUEA 4ND1A 4ZHQB 2OCIA 1P7CA 1E92A 5K6TA 1SHJA 2KM1A 3LC0A 3HABA 3NHLA 3IUSA 4OOEA 3TCXB 5BYAA 3MPUA 3TO5A 4KX5A 4C05A 3IVAA 4HQNA 4MW0A 2GXUA 1CV2A 1VGRA 2XT9A 3ZYCA 2D9RA 2XTAA 2OLEA 3FUWA 5F3WB 1O6ZA 1L7RA 3BDVA 2IY7A 3CCLB 4Q82A 5AI4A 1N5LA 3H99A 3VR4D 4X1YB 3ZD9A 3E3AA 5JZVA 4G0MA 4ZVRA 4ALMA 2I91A 1IN6A 2QX8A 4AJLA 3ICOA 4I50B 5HZMA 2XSZD 4F4JA 2Z2KA 3H97A 1XE3A 2XD4A 4FILA 4OHCA 1J7JA 1NI5A 3GNTA 3I8SA 4I7EA 1X7HA 4FD2A 4YUXA 1BE0A 1JJ2B 5BN3B 1YI0A 4ML3A 4CFSA 4ZWNA 3QHAA 2OENG 5TE9A 2XV1A 5DWVA 5K8JB 3NHUA 3WIVA 4QDTA 1M8GA 5IN4A 1KO4A 2YCLA 1NE2A 4GE3A 4DM4A 1HG0A 1EM8A 1RLMA 4U2BA 2Z9DA 4EHBA 3VHXB 2BD0A 4XYLA 3GPBA 4RDCA 1A7AA 1ZZGA 4MW9A 2PH1A 1B8OA 3GFFA 2YWHA 1YE3A 3O0TA 1TPYA 3QMMA 4QDUA 4A0GA 5KOIA 5GJBA 5FIUA 4XDYA 1NYQA 1Q92A 1CUAA 1EZ1A 2NSHA 5JRJA 5K99A 1QYWA 1V5IA 1VL1A 3NDIA 2I22A 1JEEA 3PHHA 1EFPA 1AUXA 2WD8A 3EZFA 3VI3B 3V6LA 1Y89A 4ZVLA 4F38A 4E1BA 1NVVR 1PTJC 1U8YA 2XCTB 1VI2A 1KEZA 5HPYB 2JLZA 1U28A 3OE5A 1F9AA 5H80A 4DMGA 4M21A 2ORED 3EOAI 3VAAA 4RAOA 2QBYB 3LT0A 2J45A 1XZNA 3PP8A 3E9NA 4P4SA 3SR3A 1XI2A 2HZ7A 4II3A 4G8BA 5CA0A 2F4VB 3TLBA 3G2PA 2XYGA 1GQ2A 3LGAA 2VP3A 1M72A 4JBHA 4P54A 5FWYB 3T3DA 5KNBH 1WZ2A 3TSAA 2QTAA 4FIDA 5ALSA 5GY7A 821PA 5J23A 3MINB 4LE1A 1NMSA 4MDEA 4E30A 3DE6X 1PNOA 4D4IA 3DV9A 4WZKA 3UTCA 4PYNA 3A8TA 4X7MA 2ZAIA 1DFHA 1FRFS 4F85A 5IM4F 2VPXA 1K08A 2H1HA 1I6WA 1LC3A 2XXBA 3MUEA 1IAQA 3Q41A 4JX8A 3ZHOA 2D8AA 2VJNA 5J58A 5IT4A 2TMYA 3OX1A 4KGDA 3DYIA 4XE5A 1I3CA 5ARCA 2VSXA 3I4CA 1GY8A 1BKYA 4MV0A 4ZJZA 2Y68A 2AUNA 3C4QA 2HC9A 3RSHA 2VXOA 2IU3A 5EP2A 3AKYA 4IDHA 2B78A 3JV7A 1BG6A 4CV3A 1DNPA 1W5AA 2QRVA 2JVJA 2OMKA 2FEXA 4FOOA 4HN4B 4IQ8A 1H0RA 4YQEA 3TPCA 3K20A 2E1BA 3ISVA 1ONNA 1PU2A 2X9VA 1Z4LA 1BXRB 5SZKB 3IILA 2VSFA 3AJ8A 3R23A 1VA5A 4MPDA 2BBOA 2F3UA 1MV8A 2XOEA 4JVSB 5TEVA 3N28A 2V1XA 3KXLA 3H2ZA 5JWOA 4Q18A 3ECCA 2C2XA 4C6RA 2I99A 4B5LA 1H22A 1FLNA 2EWVA 4GVXA 3CC2B 2XQKA 2Q7OE 2EARA 3N8DA 3I58A 3NTRA 4Q1CA 5EGNA 2XQVA 4MYUA 3IEMA 3L7JA 4MW2A 3HCRA 1OWMA 5JAIA 3ZWPA 3C97A 3DEJA 1FP1D 1BQ4A 4RH3A 4YRJA 5K05A 1QLWA 3UJCA 4KRFA 4MHOA 3W7BA 2DC1A 4YMVA 1OH7A 3SJAA 4XOTA 1KMQA 4FSHA 4PXYA 3FSJX 5EUMA 5C2JB 4JDUA 3OO0A 1KZHA 2J0UA 3AM1A 2G76A 3BBLA 1L8QA 1PL6A 1RQNA 3PVZA 1Q7YD 1RE1A 5A03A 2FQXA 3N0WA 5J5VA 2J3KA 4E33A 4C03A 1FTGA 1E6LA 1G7SA 2PQMA 5B2ZA 4BZZA 4M9UA 4Z4CA 2OXCA 2CXHA 3SF8B 1BFKA 1TJPB 5JFGA 5BW6B 5JAUA 3UWDA 4UTPA 1QH0A 2PN1A 5AD1A 2ZWPA 4JB2A 1N0VC 5LL6P 2ZSDA 1H2AS 3JQCA 4J4TA 3ZQ6A 4BMPB 4R2KA 1QRSA 3I72A 4MEBA 4P7GA 1E98A 3OEEA 3QPUA 2X6XA 5LD2B 4E5KA 2QI9F 2UZIR 3C1TA 4NLLA 4E5YA 1Q7RA 2JHCA 4B4UA 2J30A 5DBHX 3OLYA 2JIZA 1QDLB 2XPCA 1QO0D 3IT1A 4BUCA 2XMQA 3MQ4A 1CQIA 1EEXB 1NW6A 3NTQA 4WAUA 2JLRA 1INLA 2H2HA 4R8VA 2N9UA 5FA5A 3WL3A 5I51A 5T7BA 4KOEC 1JH9A 1BAPA 2COUA 3KAQA 1NWHA 1KXZA 5HM8A 3EAGA 4LTMA 1X1BA 2R97A 1Y1LA 3OFVA 4OGGA 2D2IA 5G1NA 3R7FA 2OAGA 3W5IA 2DU8A 1M5RA 2QW1A 1USIA 4NV3A 3DKVA 1Q22A 4Q66C 3PBKA 3S0JA 1U5CA 1T6NA 1Y7LA 4ES6A 3SEAA 3U3DA 1EFDN 3TXXA 2ZRAA 4Y7CA 3Q3CA 4LJ6A 1KH3A 3EGWA 1P9WA 2VHEA 3PA2A 1XCGB 3VR5A 4OYLA 5EYPA 3GJ3A 3I2HA 3RHFA 4TMYA 1XKQA 1JDZA 2GEKA 1W9MA 1DO8A 5HW0A 1IBCA 1Z12A 2IHKA 2AGVA 1MRZA 4LC9A 1CNFA 2EDCA 3FWKA 4B09A 4RE6A 2IYWA 1VJ1A 1JFFA 2W11A 2ZR8A 3NGMA 3QMPA 4NZMA 4UVDA 3LQ2A 2ISCA 5F4OA 5IUKC 3RVPA 2GXQA 4JA0A 2NG1A 2SBTA 4UTOA 5FF9A 4R8KA 3S6JA 4BQPA 2PA0A 1V7CA 5BV7A 4I8XA 1QE3A 2AFIB 4HDOB 2EFGA 1ICEA 4UZSA 4M0PA 4D0NA 1OJ7A 3GPDG 2QLFA 3VYTB 1N92A 5HHTA 1PCXA 3HXOA 4RKWA 1FJ2A 3GLHA 1EXMA 1UJBA 3OJ0A 2E48A 4EKNB 1DG9A 3E7XA 1E20A 4ZOAA 3UICA 1W5BA 1JKXA 5LA6A 4EB0A 1YJBA 2M1ZA 2YJGA 3KIPA 2MSNA 3LWZA 3IKJA 1IM8A 2ZZGA 2JLUA 3H1FA 3JAWB 1EUYA 3SJZA 2PUHA 1VLYA 1XC7A 4CQLB 4AS1A 4PNPA 2PXCA 4JVLA 1VYVA 4UKDA 2Q1WA 1T2UA 3NYQA 3P45A 4FZVA 3BDAA 1T4CA 3ROZA 4YTEA 3EXIA 3QJ5A 3VFDA 1E4VA 1EFRD 3LKVA 2NUAB 5B3JC 5AW6A 1NBEA 3T5MA 4QVIA 3AX6A 2CUNA 1JJ7A 2XUHA 4WLOA 3L0DA 2R8EA 5EZYA 4ZVQA 3ZCXA 1HOTA 1J0DA 1GT91 3LQEA 1ODFA 3GJ6A 4WZBA 2NU9A 4QV2A 2ZJ7A 3ZXIA 3WTCA 4ZHSA 1G2PA 3P0FA 1LQTA 4R40A 2UYQA 3NR2A 3RF7A 1GR0A 4TTTS 4FCWA 2E2WA 2CXRA 4QRHA 5E3IA 4KR9A 3RVRA 4F93B 2XH8A 2YJ6A 3BSYA 3NC0C 2W22A 5DSXA 3FMVA 2ZR9A 3GHYA 1X2EA 3KVNA 4QREA 3KYCA 4YP5A 2OAEA 4KFUA 4V0LA 4O3MA 3X2EA 2FXVA 1C4KA 3F78A 3A2KA 3M4YA 3V55A 1JFSA 1QFZA 1Z2PX 3AF5A 3PF9A 4WH0A 4HJRA 3CEJA 4GRAA 2H5IA 4HY3A 2ZSHA 4HZUA 5IC4A 3Q9SA 5ILOA 5L6LB 3R0JA 2Y1EA 4P31A 2NO4A 4YY3B 2HIMA 3VU3A 1Y5NA 2TMGA 3PQCA 4FINA 4OAQA 1CT9A 1XKXA 1DBSA 3OQIA 2GPBA 4G89A 1VBFA 5HQTA 3A1SA 3GB9A 4MRMA 2ZI4A 5DTQA 3B82A 2CXPA 1P3Y1 3PUKA 1DXOA 2PH5A 3PYXA 1YRQA 2I6UA 2VEDA 2I2FA 2XNKA 4YO7A 4JJ4A 4ZV4A 2H1LA 1F9EA 1RKXA 3I5UA 4O0MA 5KNCD 1QM5A 4IGEA 2ACWA 3IUQA 5C1BA 2A5LA 1XHEA 3IC5A 3V1UA 1Q3KA 1X1QA 1E0AA 2RJNA 4Q1VA 1PZMA 4DREA 4LOKA 1BGXT 1SULA 2B25A 5C31A 2HPZA 1BDMA 2DIEA 3NPMA 1LQ2A 1W75A 4Q4HB 4ZALA 1GNSA 3PIIA 4XJSA 5LMNB 3ZDDA 4FN5A 1T36A 3GUUA 5DI3B 3K09C 5A9TA 4DWVA 2J48A 1CUUA 4CI0B 3IEKA 2EERA 1SC4A 2IW3A 1AN9A 4UBKA 2TMKA 1SKMA 2QZ9A 3RUFA 2HLDA 4PNEA 3H87A 1NQ5A 2FJ0A 2P62A 1JRLA 2EGHA 2GZ3A 3NDRA 1PZHA 4QG7A 1DDOA 4ZRNA 3SHQA 3TXYA 5B36A 1SVOA 1P8JA 2R6GA 1TEXA 2DUJA 3KM0A 3DYVA 2PGOA 2WKQA 4DC1A 3O4FA 4MMYB 1J9GA 4X71A 1VJ5A 2XMDA 4DR6B 1W36B 1K3TA 3SHFA 2P9CA 2W6NA 4L2IB 2I87A 3FMFA 5BW5A 8ATCA 1EWYA 4MDYA 5A9SA 3ZVLA 5DXFA 4JBWA 3U3OA 1VIAA 1CTQA 1LX6A 1SZPA 5J2TA 4UDOA 3ESQA 4B3JA 2OYRA 4HQ6A 4B3FX 1QH8B 1DAFA 2AQIA 4P3YA 1J8MF 2P4EA 2ZS9A 1X7ZA 4TMVA 3C8ZA 1S3GA 3G49A 1HFJA 5FI5A 4MIOA 5TQVA 5H3HA 2QU7A 2VUUA 1UD2A 3FHCB 4G63A 1NZFA 1HY3A 1MVOA 4MKRA 4TV9F 4QVJA 1XTBA 4KP7A 2GHQA 1ODTC 2Q3FA 1P6QA 1GGMA 1AZTA 3JRWA 3MWDA 4PGHA 4S2UA 1Y6GA 2FHSA 3DZKA 2M98A 3L7IA 4G5YA 4JBIA 4BV9A 1KFEB 4M8SA 2IWHA 2X4IA 2JGFA 1PKVA 1EA7A 1ZINA 5KINB 4MR8B 1OR8A 3OT1B 2WJWA 4CKWA 4X0EA 4J07A 3RHZA 4BASA 1B74A 1V8ZA 2FFRA 4UULA 2I4MA 3PEWA 4J2HA 4P58A 2ZSAA 1GPWB 1TO1E 2O7RA 5E7MA 1NRKA 2DYKA 1AKWA 4QUIA 4DYHA 4YR7A 5KW9A 3TSWA 5JISA 4NBRA 5JRZA 3D0QA 3A0UA 3VVCA 1R0RE 1ZC4A 2O0LA 3LTNC 1U0SY 2VTEA 3IO5A 4JEUA 4FEGA 2PL5A 1HZJA 2X4DA 2TECE 4H3SA 4XB2A 4MVCA 4CM6A 4E13A 5FD8A 3I9NA 4YMLA 4HNSA 1NFRA 4KTTE 3ZCRA 3BTSA 5KHOC 1H5UA 3UAXA 1X9HA 2P4QA 1LF0A 4KBYA 4BFTA 2OAQ1 2R60A 1EK6A 1XD8A 2ZTHA 4G0YA 1XWFA 3CZMA 4EECA 3QVUA 3CWQA 4Z5XA 1T9HA 1YFJA 4C30A 2B4AA 2IYRA 4G67A 1E2JA 5AT1A 1PR2A 1LKZA 3RS8A 5DBGA 3BMCA 3HBLA 4OTZA 1WZEA 5HKLA 4F72A 2VAXA 3CVJA 1GU0A 4YONB 3IKVA 1QGUB 1J0XO 4IWYA 4M0CA 3JYNA 4EYOA 2FWJA 1N2BA 4BV3A 4DDUA 3GZJA 4TV8B 5KWVA 3UCFA 2I4NA 2X0EA 1YIOA 2VUHB 4R7ZA 2GD1O 3RKSA 2GVZC 4HX5A 5CEFA 4FONA 3EVBA 2P68A 3Q5EA 1YNSA 1AQ6A 1G291 1LSOA 1XDSA 4X8OA 4XWTA 4AIIA 2O2EA 1Q11A 2XE8A 2JGAA 3ETJA 3S40A 4POOA 3DXZA 4QUZA 2J9YB 2AG8A 2EHJA 1N0IA 3VOBA 2QE7A 3GJRA 3EEFA 2EJWA 5A6SA 1L1RA 4DMHA 5FHRA 1AMNA 3P97A 1L4HA 5CYOA 3X44A 2JGMA 1Y8ZA 1JVNA 3EC2A 4BKPA 4WA7A 1I80A 1ABEA 2G5PA 5DW0A 3RS9A 2XNHA 3KQUA 3LE8A 3H5TA 3NJ4A 1LLCA 3WKEA 1VSVA 5DMHA 5A4MS 3QYFA 2FSVC 8LDHA 5DM70 1ZAYA 1JWAB 1V8FA 1Y42X 2PUTA 4IF6A 4QTUB 2A5FA 2HBZA 3HB9A 1NSFA 1V47A 1XB2A 3KOZA 3OZEA 3P9XA 4IQGA 5DHSA 3DNPA 4PNZA 5FOWA 1T5OA 5BMVF 2YZ2A 3A37A 2R5NA 2ZRGA 2XKKA 5CIWA 3UKOA 4CMIA 2HWYA 3PHJA 4H6PA 2HQRA 1YA4A 4LJLA 1Y1QA 1E9SA 4HSEA 4V3BA 2RBKA 1W7AA 1N6HA 5EOVA 3T12A 3IAM1 3UUWA 4Z2YA 1ESNA 2YASA 4HUQB 3W5CA 2PBFA 3IP1A 4P7BA 3R09A 4EI7A 3F9CA 1RWWA 4DMMA 3T5CA 4EBFA 3SBEA 5D01A 4Z9YA 2ZJFA 4U63A 5LZ7A 1V39A 3OBBA 4UD2A 5JVDB 3GLQA 3NC4A 1S2DA 2QMHA 3BQNB 3L8FA 3OKPA 3LA8A 4QYIA 4U6QA 1VQNB 4ZGWA 4HDKA 3P1JA 3DOCA 5BSTA 1WP9A 1A8QA 1TLFA 3CMEB 2GO1A 4TZTA 1ZGAA 3LDFA 2EIHA 3ZV5A 4A6PA 4EYGA 1K63A 3Q8WA 1EFVA 3LUHA 3QFHA 3UYKA 3AIOA 3DFFA 1ZCBA 3G59A 4P4TA 3WXMA 3VH2A 1DJOA 2IF2A 2J5QA 1D2NA 2D2FA 5M5BA 2QZPA 4MJXA 3I62A 4O4HB 3NH6A 4PR3A 4YFVA 3E35A 1IIRA 4G5FA 4EEKA 3RD5A 1JR2A 5DT9A 1CP3A 1E0KA 2ZRKA 2A4MA 1PLLA 1XD9A 3D8SA 2R7LA 1JR6A 1XG5A 4C0QC 3W5UA 2C2OA 2J6CA 4W5HA 4DUGA 3U48A 3T41A 2VYND 3NHYA 2J4DA 3OTQA 4RDKA 4DNXA 4YX9A 4ZGNB 3T3NA 1ODCA 5EJ4A 1FQWA 1TAQA 1ZUHA 1ZESA 2GK6A 3G4SB 2Q27A 1YI1A 4LVNA 4OHOA 1U3UA 1KMIY 2HDWA 4O1IA 2F3RA 3AQ4A 2PVPA 4HAIA 3LF2A 4FSXA 3AUTA 1I2DA 3HO1A 3GW8A 4E2WA 3VR6A 2OHOA 1FXWA 2OUIA 2UYOA 3M9LA 1WUKS 2X4LA 4KR0A 2PZ8A 1E3LA 2IYQA 4LSMA 1IN8A 1NRXA 4C88A 3OJEA 4GMDA 2YZKA 3MWEB 1JDVA 2C5LA 5J3OA 2JCGA 3IIEA 3RHSA 2WOJA 3EJ6A 4ESEA 3FSGD 2GBIA 3L05A 1WAMA 3VR5H 2NAFA 3KL2A 1OCEA 1RLUA 1HNXB 5HOQA 4GRIA 2RAUA 2H07A 3O6VA 3ASVA 4GR5A 1GPMA 1O95C 2AG1A 3FHOA 4PQGA 5JZSA 2O59A 2HF2A 1SR8A 3AYXB 4FQ5A 1N8NA 1OXVA 5T64A 3SJ7A 4GYWA 2P4SA 1Q14A 3Q3AA 1OC2A 3NEYA 5HOEA 4RK5A 5JD4A 4ZYVA 1IVYA 5KWIA 1XZGA 5JPDA 5FNVB 3H6KA 2IFTA 3D7KA 6NULA 2QLMA 5ULLA 2UZ3A 1RDFA 5B53A 3CW2A 1V3UA 3D81A 3TZEA 3ZX4A 5DX1A 2CNOA 2FSFA 2AFIE 3F49S 3ZDYB 1U2GA 4G0PA 1JA9A 2B1QA 1G2OA 3A25A 4I19A 3ANSA 2HCBA 3L7DA 4HG2A 2C2ZA 4MS3B 3TZQA 3C16C 1G17A 2WWTA 3LLSA 4RDLA 2Q3HA 2GA9A 3OTWA 4L28A 4CF4A 2BM1A 2O7SA 3KK0A 3VUEA 3CNLA 3O3MB 3DDOA 3Q2KA 1XR3A 1NVWQ 4NYMQ 4C7XA 1EB9A 2AZ4A 1TVKA 3KKNA 3LQ1A 3HCWA 2FE4A 2QI9C 5JCOA 2X53S 3RSGA 3SE7A 3ZD7A 2CVOA 2BKEA 3AY7A 4XQEA 1N2CA 1OI2A 3MQ2A 4YCAA 3WIBA 2JLCA 1IWBB 3CN9A 3DEKA 3TZBA 3MOSA 2M6RA 2REOA 2EU8A 1B76A 1WXEA 2XWPA 3EXHC 1ORIA 2DFDA 3EMKA 3QLVA 5IYQA 3R1IA 3FBTA 3NUZA 4BO5A 1N77A 1JHMA 2GPWA 4IVNA 4QE3A 4F0JA 5IX8A 3LXMA 1M34A 3W78A 4GWGA 1PJTA 2HWUA 1EM6A 2DH5A 2Z1NA 1T0HB 1TAGA 5EKTA 3KRTA 1C9NA 3CX3A 3HDYA 1P3JA 3WC4A 1GZ3A 2Y3IA 2ZWIA 2JD1A 4QUKA 1U11A 3EHEA 2ZSBA 2Q4RA 2G88A 2RB4A 5JHHB 2E6KA 5KSOA 6CHYA 2FOXA 4X20A 3SC6A 7MHTA 2YDYA 1N7JA 1UPTA 2R1TB 3TOXA 5JAPA 1EAYA 4WOCA 4PAOA 4JJGA 2V55B 2Q6LA 2PRZA 1DS6A 3GEDA 2OHJA 1BOFA 1UXGA 1GCUA 1WTAA 4KW7A 5KYGA 2ZIWB 5F21A 2YHSA 4RKYA 4JU8A 3IB3A 5KU1A 1FUUA 4IIHA 3QEAZ 4PF1A 1NBHA 3W05A 1G2QA 5DLEA 3D26A 3NBYC 4IEEA 5ADWA 1C2TA 2F1KA 2XUZA 2X14A 1E9DA 2JZOA 4PYMA 1IATA 3GFOA 3PC4A 2R6R1 3IH5A 5KVQA 1QHYA 2P91A 4TTAA 3CEHA 4ALLA 3EYAA 1A8UA 1G6KA 4YCJA 1SXIA 3K0KA 1CUCA 1A4IA 1J97A 4CEIB 1DKPA 1BTOA 1X8JA 1ZGZA 2BP7A 4WZLA 1CQPA 3EFHA 3HZRA 4WY5A 5EXTA 5HMLA 5CEJA 3X1XA 1DXHA 1YRBA 3O31A 4MUHA 4WCVA 2XGOA 1GUDA 3BNWA 2WAXA 1NXVA 2C1XA 2XOXA 5KYWB 1STOA 3IBSA 1C2YA 1CXZA 2N1BA 3B20A 4I4LA 4QATA 4RZXA 4BMZA 4HGPA 1DEAA 4D0RA 2E82A 2PXAA 1RZVA 1FQKA 1Z3IX 2C1EA 2SNIE 4L73A 2XGJA 3IAM6 4TN1A 1CEXA 4KTVE 4EVQA 4LE0A 1ENOA 5MGNA 4CLRB 2BFNA 5KBYA 1R66A 2XB4A 2YWEA 1UXKA 5FPPA 5JTTA 3KQNA 3SQDA 3SK0A 2ZCJA 3FB1A 2NZ2A 3NT5A 1T9GR 1H4VB 1NMXA 4UQLA 2Q7XA 1WABA 2FAXA 5DGTA 2DUNA 2JJMA 3UWMA 3D54D 3GCGA 5BURA 5JPCA 2Q0XA 1MVLA 3RSSA 3AF0A 4LYJA 4I99A 4PONA 4YAJA 2WVJA 4MQEA 1G2IA 2FEPA 1KGSA 3CEPB 4P2GA 4XCVA 4G84A 1A4UA 2YN4A 4UXHA 4FMBB 2IDJA 5BQOA 2VK8A 5MN6A 1XCLA 4M7OA 4HGZA 3L1IA 4HDRA 1CUXA 1WPGA 3U9LA 3VDQA 2P9QA 1YBMA 2CVZA 2AW3A 3IEIA 2C88A 2G8NA 3PQ4A 4TLMB 3E5NA 1E9CA 2JLSA 4HAOA 4ARVA 4IO1A 3GHHA 5EIFA 2YV4A 2O3UA 1PR3A 4YJ2A 3KHSA 4BX8A 1TRHA 2FYTA 3HK2A 5HTKA 2V3CC 4RQAA 4IGFA 1A27A 3DZIA 5JYEA 4G8DA 3V1MA 4JOBA 4WI1A 2PLAA 2QR2A 3SKBA 1E1MA 2WWYA 4OX9B 2EAUA 3NANA 1N4DA 3Q7SA 2FHPA 1EH5A 1MA0A 3G6EB 4HK4A 1GV0A 1Z3CA 4AN1A 3WNBA 1XPJA 4R1LA 4X63A 4BFCA 1FJGB 3LAWA 5T57A 3R5XA 1ECJA 4I9GA 5KPDA 4XGQA 4Q16A 1EVZA 3BBPA 3ZK8A 4EUHA 1R0CA 1UJ4A 4JP2A 1SRQA 3QF7A 4BMYA 5ADVA 5K8VA 1TLLA 4KSYA 3KJEA 3HKCB 1PKEA 3KXDA 4Q7QA 2CZGA 5HILA 2OFXA 4JUIA 4ZAGA 2WSYB 1GGKA 1NRIA 3DXFA 3KNZA 4NU8X 4JJIA 4MXDA 2EQBA 1UT8A 3EULA 3FCCA 4LYAA 4N12A 3CR8A 2O1XA 2XNDD 4FHEA 4X60A 3NTLA 3LQQA 1L3IA 4C6SA 1BHO1 3R6GA 4L02A 4K88A 1JDNA 4OYYA 1W6UA 3RRYA 1U3CA 1S9DA 3EPJA 1UXIA 1FUKA 4ZDIA 2OV4A 1RXCA 4B4VA 3NPAA 3G2QA 4MB2A 1PJBA 3NXKA 4HS4A 4DSUA 1ZXLA 3CWZA 4A92A 4US0R 4I9FA 5A88A 4U2KA 3ONEA 4OXYA 4M9SA 5F3RA 1YVPA 5JOQA 2C4UA 2DR3A 4WKGA 1ZVJA 4PG8A 2XYPA 2C4VA 4OMCA 3ZDBA 3GRRA 3BPSA 1DU4A 4WKPA 3VHLB 1JLLB 1HWYA 1SC6A 1W44A 2OTCA 1CUSA 1VHQA 2R8BA 5LXTF 4AF7A 3AR9A 3P9PA 1R00A 3ED5A 3FTDA 4L5CA 4WESB 3ABIA 1M1UA 3KWFA 4WVFA 5JZMA 1F1BA 1JWBB 1YDHA 1ZDMA 2R2GA 3M82A 5KYXB 2IEDA 1EZZA 1OC4A 1OKKD 2IHJA 2Q8NA 2H2WA 2VG8A 3MJRA 3IP6A 1IPEA 4JL8A 4S1VA 4ZO6A 1K1EA 3KUDA 1FX1A 3Q7QA 5F78A 5ECGC 4GPTA 4KKSA 3GT7A 2HUPA 2J3JA 3P9ZA 4ANFA 1SVMA 4M8IA 3DCNA 1ULUA 5F1YA 1ZMBA 5CB4A 5FTJA 5TSDA 4P82A 5FTLA 1NNSA 3K9GA 2HK9A 3TM5A 3QLUC 4BWGA 3DBLA 1Y1SA 3L7YA 3OY2A 5KVAA 1XLTC 4RFLA 3F4KA 4IUYA 2VYCA 4JP1A 5DS0A 2AX4A 1FY2A 1L7EA 2XUQA 1OPXA 4J6EA 3KB8A 2DQZA 5JZ9A 2I6GA 1V2HE 4RDJA 4N5IX 4XM1A 1Z08A 3GAZA 3UWSA 2QEXB 1AQJA 1MABB 2HHJA 1L5LA 4G7WA 3VZCA 2GUGA 2IHVA 2GTHA 3FWYA 1K7FB 4O0LA 1UBCA 3WGYA 3ZCUA 4XTCS 4BNNA 3D3KA 2AFRA 1XVLA 2YY5A 2DPYA 3T3EA 1EUQA 2CYAA 2NTJA 1QNFA 1I8TA 4H3KB 3WKBA 2ZUBA 3CO0S 2WNSA 4RACA 5B1SA 3OFJA 1GAEO 1ZO8A 3CF2A 2CKMA 2B4KA 3AP3A 1P60A 1FTNA 1TA9A 1PHRA 3NV7A 4HNQA 4QXRA 4LJ5A 4RA6A 4C6TB 1VSUA 3PHGA 2G83A 1VLOA 4I66A 4ARZA 4GKVA 1DMRA 3RYFB 3QKWA 3UWOA 3X3HA 1Z2EA 4KK3A 2Y0EA 1M7HA 1ZGBA 3ENNA 4L4YA 5AK6A 3ZLUA 3BTUA 4KGXA 1P7YA 3J81k 1ZIPA 5E6RA 2VP6A 1OB2A 1D6MA 1Q9SA 1IB6A 2CSUA 3K1YA 2JAOA 2J3DA 3ACCA 2G5TA 3I52A 3L0IB 3L82B 3BQ9A 1OI3A 1IHYA 1UQTA 2QTNA 2YNMD 3MQFA 2RGNA 4JA2A 4OJYA 3S27A 1NUHA 3CX6A 2QA5A 2BMJA 4MKXA 5FBKA 4O4LB 1H6BA 5ECWA 3JQ9A 4YPOA 3HHPA 1FTWA 1B1AA 2C98A 2AXPA 2A9RA 3DTVA 3AFOA 5L7WA 3MWFA 3P2YA 4NZOA 4R69A 1U9ZA 4XYGA 5JECA 3UMYA 4X90A 5JEDA 3QFFA 5ICMA 1N78A 4WEQA 4E1AA 1P91A 1YR6A 5JCJD 3L7AA 4RM3A 3LYLA 3VH4A 1GEEA 2O2HA 3CX7A 3ZHQA 2D2VA 5BPFA 3KYBA 2IP2A 1L3BA 1M73E 2HBRA 3DDUA 3I39X 4KIGA 1P9OA 1OXSC 1QIHA 2BELA 3OT4A 3OX4A 3WWZA 5EEGA 5A4FS 3GFGA 3UJ9A 3GLGB 4EO4A 2QQFA 4YCLA 1IXZA 4KKVA 4ZVUA 1PWXA 5JAOA 1R6TA 2IUFA 5EE0A 5LMCA 2XYQA 3GK3A 3OOJA 1W88A 1YR2A 3VR6H 1B1CA 1N6OA 1W48A 4OQPA 5IG2A 1JEAA 5IU6A 2J4FA 3ONDA 2BFCB 4QASA 5DHQA 1LPNA 2D1TA 4X7BA 5DTRA 3CE6A 4KLCA 4JUBA 4Y1RB 1OW3B 3X2FA 4G9EA 3ZLVA 1L7PA 3NORA 4LYEA 2FPPB 1H1LA 1VPEA 3H65A 5HK8A 1K7SN 3O9VA 2HKIA 2AJLI 5DIZA 4DT1A 5K5EA 4JUCA 1N2HA 1WPRA 1EFTA 5TR9A 1S2MA 3NT2A 2UVPB 3KQTA 3NEPX 4AKIA 2X8KA 3IV7A 2BMDA 3PHCA 4X54A 3TF5A 1PVDA 1J1UA 3TMKA 5TB5A 4DNTB 4ZVTA 4F3NA 5KU7A 1PSDA 4PSUA 4BJ6A 3RFXA 1HT0A 2F64A 2OHVA 4NOMA 2CZQA 1RRFA 3HUTA 4K5QA 4OHFA 2GI4A 1Z7GA 3EQ7A 4NBLA 1TM5E 4A6XA 3ITEA 5EMHA 4X3OA 4LUCA 1ZUIA 4DTIA 4B17A 3T7SA 1OGIA 3U37A 4ZYYA 2JGIA 2HPHA 2I62A 5TQ2A 1RZ3A 4B83A 2WF7A 1J22A 3CZ5A 4QYTA 4UBOA 4ZRDA 4H6WA 5JSZB 3ABZA 4KB5A 5BXQC 1IQPA 4TKUB 2C3MA 4B7ZA 5C4GB 5L7TA 2VH2A 4YIHA 1DCFA 1CS4C 4FR5A 5CA0F 3IBCA 3OC6A 4DVGA 4GBED 1HQKA 2FDRA 2XDQB 2ADOA 2GEDA 2V3VA 3QKIA 4KFSA 2QUBA 3O3NB 4H31A 3RRNA 4H9GA 1PT6A 2G7MC 4EI8A 2LZJA 1NMQA 3AEYA 1ESZA 3SDZA 3SS7X 5CUQA 2GESA 3FPSA 1H42A 1MC4A 1XZ8A 3EGXA 1R9NA 3HL0A 1AKMA