2V7XA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYAREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7xA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7xA01
2V7WA 2C2WA 5LMZA 5B6IA 1RQPA 2CW5A 1RQRA 2CC2A 2WR8A 2V7UA 2V7XA 2V7TA 2C4TA 2C5BA 2Q6LA 4CQJA 2CBXA 1WU8A 2C4UA 2V7VA 2ZBUA 2C5HA 2F4NA 2Q6KA 2Q6IA 2ZBVA 2Q6OA 5FIUA
chains in the Genus database with same CATH superfamily
1OFUX 1NNI1 2Y0CA 4NI5A 1JSZA 2GK3A 2J67A 3DYVA 3GNTA 3Q9LA 3LYHA 1KJJA 2NUBA 3GNQA 4C3UA 3FBWA 3DMPA 3UV6A 1S2LA 3NXSA 1FNBA 1VQ7B 2XOKA 3FWKA 2IF2A 4R7ZA 4Z9AA 1MHPA 5FQNA 5CX1A 1ZU4A 2X2OA 3EPRA 3UW3A 1EIZA 2KJQA 3DHVA 3GJ0A 3IAFA 5ALVA 3KOWA 4ALIA 5KWEA 2BI7A 4ZREA 4TV9A 2HA2A 5C1BA 2I4NA 5LZ9A 1PIWA 3Q39A 2LW7A 2XCIA 4Q9DA 2YNMA 6GPBA 1FYXA 2OYNA 3DL2A 4G8JA 1FE8A 5H59A 1ZUHA 3GCWA 2Y76A 4NBVA 2R97A 3JY6A 4ZOLF 1Z6AA 3QE9Y 4CEIB 3PKIA 5MGBA 5ER6A 2AK2A 2CGEA 3EZ6A 3KS9A 2I65A 4QX6A 5IG2A 1CF9A 3DW1X 3NHRA 4ILKA 3IPRA 4XDHA 2JDID 4A0RA 1KYWA 2FRDA 1HYQA 4YEJA 1QFXA 4DIMA 5JZ9A 2DBRA 3OJCA 4ZHQA 1VKNA 5E4YA 2AC2A 1E3QA 4NG5A 4O3FA 1J49A 3EC1A 3W1VA 2Q3JA 3BGVA 2RI0A 1V5GA 4PLPA 4UMDA 4LFCB 4E11A 1JXQA 2PKEA 3K94A 1Z5UA 2FSGA 3A8TA 2OK7A 1NZDA 2ZT5A 1QYCA 3OY2A 4YLGA 3E18A 5B2ZA 2AQKA 1KMHA 2Y6VA 2XTNA 3TI7A 5IDWA 1J42A 4K03A 3TM5A 3ZK8A 2HW8A 1B42A 3CCSB 1SEPA 3DLCA 3RS2A 2ZSUA 4D8UA 5KCMA 3IMGA 5E6SB 2WYOA 4MI1A 3IQZA 4WEOA 2E6UX 5CXXA 4X1YA 5B7PA 3T61A 3FPSA 3UMVA 1CS0B 4BX9A 1FQKA 1DLJA 2PD3A 3PI7A 3NAQA 1RQNA 2FSPA 2XCQA 4JLSA 1DHRA 3GGJA 3T7DA 4WBNF 1PJTA 5K51A 3T7IA 2OHJA 3KO8A 1ZMOA 2AMJA 2DUMA 4RDCA 1P0FA 1K88A 4L07A 5B1SA 4YXWD 4N3NA 4JLJA 3UXMA 3PC7A 1TC2A 4GEGA 4S04A 4DADA 2IZOA 4OHCA 2CF4A 3IR6A 5D1NA 1KJ8A 2EW1A 2ZVQX 5FWXB 3OZGA 1R4NA 2FEAA 4B43A 2IHBA 3OFND 2C2OA 4KNYA 2ZVDA 5LLDA 4JP3A 2WNSA 1MB3A 2WT4A 3MWDB 3QMVA 4QEDA 3TLKA 2FEMA 5T41A 2V7UA 3AEQB 1M73E 4OVKA 3RF6A 2BAGA 3AJEA 3P52A 5P21A 3F71A 1G64A 5DHTA 1NWHA 1O1YA 4G3XA 4PPGA 2Z83A 4DJJA 1CR2A 5IAOA 3WGTA 3GZTB 4RGBA 4GX0A 4BO6A 2ZBUA 2O7RA 3WY9A 3OZSA 2PS0A 5JZMA 4X64B 2XNDA 1R0LA 1YVUA 2DPLA 1DBRA 2Q6KA 1ZGAA 1QYRA 2JANA 2QU8A 3PQ2A 5BN4B 3EIFA 1XQ1A 2F8LA 2DAPA 3MFYA 4EY4A 3QKTA 1CUDA 4JKYA 4RM2A 3QEAZ 4KVAA 4RVFA 4F72A 4F6CA 1ZVQA 2J9FA 1FFGA 1EVYA 4UVDA 1FUEA 4RKFA 1SH7A 4HGNA 2X8WA 1L1EA 3HY4A 1QQBA 4OQQA 4EHKA 1QGYA 4YRLA 2I33A 4C06A 4PZYA 2CHFA 1JT2A 4AS2A 4DCJA 5BPFA 1T5TA 4Z4RA 4HGRA 4BB9A 3CC7B 1FMFA 2QA5A 4ZV7A 4J07A 3H2HA 4BU1A 2V98A 1SWWA 1Y98A 4O4JA 1XAHA 3KBBA 3BKWA 4O4IF 1T3GA 4E5VA 3LXRA 1GFSA 2ZSHA 4FINA 1E2KA 1SBNE 3SKXA 2CXOA 4K81B 4MW5A 2DHQA 2G9QA 1NI4A 3VYRB 4EA7A 2W93A 3AUJB 2UV8A 4FBGA 1FRNA 4UAVA 3RTAA 2PWBA 2VYVD 3S29A 1GT6A 4MIEA 1NN3A 4MQLA 1RQPA 2VSXA 5EESA 2CFOA 3WNVA 1UPBA 2VRCA 1GPLA 3KVRA 1Z3CA 3LIPA 4U6NA 1LWNA 5DJ5A 1W49A 5JJBA 4BEJA 4PFJA 4HYYA 1UBHS 2N42A 4JLDA 5GJBA 2V1XA 3SMQA 1IAQA 1Y3IA 1MB4A 1P0IA 2O0JA 4KPGA 5PGMA 4EW1A 5CDUA 4Y2VA 4F9GA 5F98A 1SHKA 2C2YA 4DANA 4HLCA 1O95C 2IEGA 5A8AA 2C5LA 4RIIA 1LQTA 3H9QA 3FGPA 4CM8B 1KZ1A 3CFYA 4KN5A 3CLRC 4MLZA 2A9RA 3VJRA 4Q37A 4ZT5A 1U2RA 2D7DA 4GBGA 3QKWA 1LSOA 4FW9A 5AVVA 4F4DA 4HFNA 1N33B 2IYPA 4P2BA 3FLEA 4GE3A 1TCUA 3RR2A 4JQSA 1B15A 2YRXA 3X1KA 1RC8A 2B34A 5TRTA 3S1SA 5IUJC 4Z4ZA 2O8BB 4FQ8A 2KLHA 10MHA 4DQLA 2B35A 4BCCA 3A9TA 5DCWA 4HIZA 1JFRA 3NQ41 4DE5A 3LT1A 1T8TA 2HY7A 4EI2A 3JRXA 4LYYA 2BGTA 1NP7A 3FYTA 4QHTA 3D3NA 5ITVA 1G59A 2D5IA 1E3EA 1VSTA 3VPSA 1VLZA 1G5TA 5LA6F 2XV1A 3KSUA 4X91A 1WMFA 4UPVA 3TCNA 3G2QA 3DWIA 2BUAA 5HILA 1ZOIA 4FR0A 3HJCA 4J49A 2Z5GA 3EUEA 1OYWA 5TMEA 1CUHA 2Q0HA 4UJ5A 1QSGA 1TEHA 4UQPA 5COQA 4UE3S 3U81A 3LRXA 3FCAA 4O0LA 1K8YB 3N0RA 1JPUA 3ZLVA 2GHRA 1H6DA 4P7BA 4RDIA 4EG5A 3BFKA 1EDEA 2HUPA 3QV2A 4Z2YA 1FVHA 2FPUA 4N54A 3QUBA 5CFOA 4KH1A 2JN9A 5IAKA 5IP5A 1IYZA 1Y8RB 3LFUA 3NUQA 1GPH1 1U2PA 4Z51A 1Z37A 4U63A 3TIVA 5F64A 1KEKA 1SUDA 3RS0A 1DBIA 3ZBPA 4F9EA 4QJ3A 1G38A 1OGJA 1Y1RA 3L6CA 1YE5A 2WYVA 3NS7A 3UMCA 1SUBA 2KWIA 3H3JA 4ZQEA 4NVRA 2WTEA 4OOEA 4XUCA 3GJTA 1QDLB 3OFVA 2VT7A 1P81A 3KM0A 3ECAA 3E58A 3HNRA 3AL2A 4NZYA 3WNBA 1DKUA 1YU6A 4P5EA 5KMGA 3P9QA 5FJJA 3RS3A 3BMOB 1DHTA 1QRTA 5AKZA 2CC2A 1AT1A 2IP4A 3QTBA 5AI5A 1A98A 1I80A 2B5VA 3AY6A 4IVNA 1J0DA 1PUXA 4CDMA 4LF6B 1ONOA 3HKDB 2ZKIA 1VQ9B 4X20A 1YZVA 2VUHB 4D0RA 2A0UA 3KELA 5FL3A 1SK9A 1E1MA 4PM4A 2ZRAA 4TVKA 4CJXA 5AK5A 2QRHA 3MTGA 1YK1A 3PHJA 3BN3A 2NU8B 1VQMB 1PWEA 4GUAA 4N0QA 4YQEA 2E4UA 3BPSA 5CNJA 1VE6A 1PR9A 5FOWA 2Z3WA 5AM3A 1CYDA 2PLAA 3E9YA 3BMNA 3MERA 2OHOA 3K5WA 3S99A 3CG4A 3GUHA 4D0GA 1AF4A 2RCYA 4WLVA 3ZZ0A 1GQQA 1JWBB 2CNLA 3PUNA 1ZJJA 2EDCA 3S2GA 4PEVA 4DVGA 5CYFA 3RVMA 4BV3A 1CCWA 4HNTA 3KVYA 1UD8A 4LXXA 1KFCB 2CDNA 3EVBA 3CWCA 3H1GA 5TS2A 4AP9A 2YHIA 2OXTA 1ECJA 4A92A 2CNWD 3Q5GA 5K6RA 1SPBS 4BZQA 4QATA 3U3MA 1AA9A 1J1UA 2GPYA 4B31A 1BDIA 2JIOA 1EVEA 3B9BA 3ZE0B 3ZNOA 4M49A 1QAQA 1O89A 4ZVNA 4BEBA 1KC8D 4H7EA 5AJUA 4WY2A 3D3JA 3WAJA 4Y1RB 3GA5A 1C7QA 1XCPA 3PXUA 5GWXA 1X8LA 3NM6B 1FDIA 3KETA 2VJAA 1U2GA 1I3MA 4RETA 4J16A 5JI2E 3MD0A 2RHWA 2VSYA 1UWKA 5IVIA 4FT2A 1P74A 1G9TA 1QCYA 1UDRA 1VXRA 1ZA1A 2CY0A 1N0HA 1A9PA 2PM8A 3Q0TA 5AKYA 3U44A 1U1CA 2KYRA 2ZETA 5CLGA 1DO8A 1DTWB 4OPMA 8OHMA 2NZVG 4RVOA 1VLHA 5GQSA 1YBVA 2JPDA 2RG1A 2ZTNA 1XMQB 1I3LA 4P1ZA 3O1IC 2QPTA 4UEOA 1Z5PA 1FJGB 3OLZA 1P9WA 5EPOA 4UARA 4TZTA 2OECA 3N8GA 5BP7A 1NAIA 3DDUA 3ZXUB 3OD5A 1YWGO 2Q3LA 2VXBA 4FS8A 3EBPA 3SC2B 4ZDJA 3ODGA 1KJZA 3OJWA 1D6JA 2AF3C 3OG9A 4O4HF 1J0AA 3NGLA 4V3CA 3A1UA 4DSAA 3JATA 3ZYZA 1DBQA 3QVSA 1BKSB 3WFIA 3ADDA 4H27A 3PEUA 4JJEA 5CFZA 5E7QA 2GVDC 3GA0A 4GI2A 2WJZB 1LH0A 5FHQA 1VE3A 4ZCSA 1C7IA 3SCZA 2VYFA 3W0LB 2GBCA 4X84A 1OXSC 3GN2A 3TKLA 5REQA 2JA2A 2MJLA 3D3WA 3DULA 4OA5A 4EO7A 5KX5F 2JLYA 2Y8EA 4J90A 3EGCA 1GWNA 3H0KA 3CP8A 5AVXA 1AVTA 1CJUC 1M6NA 2F43B 5G1NA 4RTSA 1JLHA 1ZVVA 4HNAA 2AFVA 2GREA 3MELA 5TF4A 4LJYA 2A92A 3UYKA 4LW8A 3C1UA 4ESOA 4L76A 4X1IA 5ENDA 5AWFC 3U61B 4JT8A 2QMYA 3ZK7A 1ZK4A 2BH2A 4A27A 3CF0A 3EWNA 3FKQA 1TKRA 4PLFA 2OZLA 3JWEA 4X7DA 1BHSA 1EM8A 3ACDA 4FBLA 3GP8A 2Z43A 4EO4A 2NUPA 2AW5A 4RKEA 5TQ0B 5KSZA 2FVGA 2XGGA 3OQVA 1WPGA 3OSZA 4OPSA 4OXYA 5AUPB 3T1HB 3WG9A 2QV7A 1IATA 3GHYA 1AH2A 1EK1A 3KLNA 4ZOLA 3BCUA 1AV7A 4BVEA 5KDDA 3K9CA 4GMDA 4BIIA 3E48A 1KQNA 3IHKA 4C5BA 4MEBA 1R37A 4K2HA 3K9WA 4L5BA 1D8TA 1WZNA 5CURA 1Z38A 4LX8A 5THQA 2O0LA 4P58A 4CKWA 5HNKA 3ANNA 1LK0A 4RHCA 4RVDA 2B8NA 1CJCA 5AK6A 4XVRA 5AW3A 5CCXA 1MT3A 3U3JA 4W5RA 3ELUA 3L7JA 5AK4A 2YWJA 1YMUA 4GQAA 3CRZA 1KYZA 1XHFA 3BIWA 3WMGA 2H7XA 2ZYSA 4D4KA 3N7AA 5DI9A 2OZPA 1H8EA 5E6UB 1XZFA 2ZJ7A 2W2MA 3KXPA 4CXMA 5K2OA 4LEIA 4HKTA 1J8QA 2P4QA 3WHPA 2C42A 2NXNA 3IA7A 2F9FA 1EAYA 4GKAA 1ZDMA 3F5MA 3RADC 3KJHA 1Y9EA 3H87A 4S1OA 4I9UA 5D3MA 2C8LA 3EA5A 2H11A 3QHAA 4WNAA 1Q3HA 4Y2YA 2H5JA 4YYZA 5MF6A 1W8IA 2EKLA 4JL6A 5I8ZA 3VV3A 5LFAA 3OT1A 4M53A 2IYNA 2V3VA 5DU2A 3MS7A 4PRZA 5HK8A 5AW4A 4G0WA 2PL5A 1FDWA 1USIA 4IJUA 1NRXA 4Q9LA 3TLXA 3SHTA 4CCSA 2VH2A 2P6RA 4NZOA 2NUTA 2BKLA 4KIUA 1JB9A 5B1YA 2RH5A 3JTMA 4G8DA 3RS7A 5YASA 2BP7A 2VPYA 4C5CA 5TR9A 4WBNA 2OGSA 2B4RO 3OX1A 4MO9A 3B2NA 1XDGA 3THWA 1QH1A 1YGYA 4DK1A 2WE8A 1Q7CA 4P9NA 1Z68A 2PXHA 4DLXA 5HJ5A 4EPWA 3QMPA 1LV7A 5F9MA 1N7JA 5EHIA 2OCIA 3QFSA 2WWRA 1SHTX 3SIRA 5B58C 1GLVA 3M9XA 3ENNA 1YZ3A 4KI7A 4PY2A 2GAOA 4WMLA 3SQLA 2A5DA 5A3JA 5A5VA 4LGVA 1WCV1 3TB6A 3QEJA 2FX3A 7ADHA 1MRNA 3M4JA 3NBMA 3HVRA 3GT3A 4W4TA 1KWGA 4O3MA 1HNNA 2FSUA 2ZULA 5C1PA 1U5CA 4Y7CA 1TQHA 2WUDA 3M49A 2GBLC 3LHKA 4F2WA 3DFZA 2FK8A 3P0FA 4L4YA 5KNLA 1K92A 1R5OA 1DX6A 1US8B 3MUEA 1KQSB 4RY9A 3HYSA 4DNFA 5CXSA 1KC1A 2E48A 1Z26A 1HYBA 4G0YA 3HS3A 3ED5A 4YJ2F 1ULZA 3J81k 4U02A 3L8HA 4L0DA 4X65B 3JWGA 4LHEA 4IJQA 1WU7A 3PFCA 3U62A 4BUJA 3TF5A 2V6FA 4BMNA 4N5LA 2QYOA 1RBMA 3HZRA 5CA1A 3K1ZA 4Q1CA 2WVHA 1A4IA 3I37X 4FUQA 2TRSB 2G6TA 2I6SA 5CVJA 2JCSA 4MULA 5AW5A 3ZE7A 3F6CA 3FZGA 4D5EA 4L1KA 1GRQA 3P4XA 4G0UA 1PN3A 1YA8A 2OXFA 1YR9A 2P6MA 3GGDA 5ADUS 3ICCA 5F4MA 2DU8A 3QLUA 2R86A 2DPYA 4U3JA 3W5VA 1P72A 2QTWB 1M5RA 4M9SA 2FN8A 5EVJA 1PP4A 3IRVA 3QI2A 4XCVA 1H22A 3BMQB 3VI3B 2JRCA 5H9WA 3LA6A 5BWCA 2ZYIA 2HD4A 4OSOA 4BZWA 4N0PA 3RI3A 4IIHA 3PJGA 1WHSB 5FO1A 2HTEA 5NULA 1G18A 5ECDA 2QRKA 3LXUX 1EE9A 1YFJA 2QUHA 1ZICA 1KD1D 1L4YA 1IY8A 1YQQA 4FMDF 4BQFA 2ZAIA 2OILA 5DYNA 4OD0A 3M0EA 1XMIA 4B47A 3R6TA 4OLJA 4R9NA 3ZHVA 3U40A 1Q0SA 3KOMA 4KWEA 1E2GA 1KI6A 3C6MA 4JJKA 4YEDA 3LE8A 1XCBA 3QLVA 4X7RA 3VR4D 4R1OA 1AZWA 4TQGA 1RWOA 2OV2A 4V0OA 2QAGB 3JQ9C 5JAIA 4JITA 3J80A 4DV6B 2X1MA 2Z8YM 1JHXA 1GTMA 2Q1XA 3EOZA 4IUBS 4NZPA 1RQRA 3KQTA 1NMZA 2PZFA 4PGAA 4LK2A 1ISMA 3DE5X 1B74A 2A33A 4XFKA 4CTNA 4KRFA 4BO5A 5EUBA 3NFYA 1AHNA 3WS7A 3ZLBA 3P0IA 1AGPA 4KYUA 4D0SA 4PSCA 3BCDA 3TE7A 1X13A 1CRZA 1KH2A 3INTA 3RFFA 4ALJA 1DZ3A 2UKDA 4JBIA 4MWGA 5BOSA 5JRDS 4LJRA 1GCIA 1GRVA 1JKMA 2GA9A 2FMKA 4KYIB 4I5IA 1MV8A 1CNEA 2GDJA 3BM5A 2BL4A 5DHFA 1EUYA 1LEHA 4DLLA 3CONA 2Q3HA 5JXHA 4AS3A 4FHEA 4M22A 2PT9A 3FD8A 4B84A 3OEEA 4M38A 5IJ9B 2QRJA 2GZ3A 3L6RA 1YKSA 5KB3A 1E0KA 4MA4A 1QG2A 3ONUA 2Q7XA 4TV9B 2RJNA 3QEMA 5A62A 3BREA 3OKCA 4G9EA 4BASA 1QFJA 1ELOA 3KJGA 2FHSA 2AOXA 2C00A 5EGNA 5H3HA 5FV4A 1E5XA 2ZIEA 2Y0DA 5DF1A 1ESMA 3F78A 3PGVA 5DN9A 3U7RA 1FFDA 5KNBD 2P1ZA 1AUVA 5KWSA 3GEGA 4RY0A 3V7UA 4S0ZA 2GUWA 2LBPA 5EJ6A 1ML3A 4QYIB 2QPOA 3R3YA 1V4BA 5DLYA 3WL8A 3PNYA 2DLCX 4O2LA 5JE8A 3ANLA 2Z2XA 5K3FB 3WVNA 3F6BX 3ZKWB 2B36A 1G5RA 4Z4GA 1M10A 3O1LA 5BQXA 1PJSA 2I9PA 5AIBA 1BFUA 4ZD6A 3P9YA 2P90A 1EGAA 2J3DA 2JJ8A 3KT8A 4TTRA 4ZHQB 2J9RA 1ODLA 1Z16A 2XSZD 4HNRA 5BQOA 3VOBA 1HO3A 3QBVA 1U28C 3KTFA 3JXEA 3WADA 4KLAA 4PSDA 2JI6A 3RC7A 4YJ3A 2C5BA 2VYND 4ZGWA 2QRLA 4UFNA 3TBKA 1KMHB 4CIBA 3O8OA 2MYTA 3LP6A 3LWNA 1PTJA 1J09A 5IK2D 1YZUA 2FI1A 4CMIB 3L18A 4FZJA 4JI1B 1X1DA 4X1YB 3N70A 4X0EA 2IZ1A 4DCCA 1KFKB 1JJAA 2BM0A 4NHOA 3IUPA 3K8QA 4CF3A 3QEKA 1JZTA 4XLEA 4OGFA 5EWJA 1VJSA 4OI1A 4P6YA 1ZL0A 2VNKA 1SBHA 3DV9A 1YR6A 2GZAA 3RIMA 1QX4A 1QGOA 3DYIA 3WB1A 1W29A 1YULA 4M86A 4B8ZA 3K0SA 4H1TA 1GV1A 1RBZA 3KG2A 5HCUA 3B52X 1KSGA 1RZRD 4OHOA 4Q1VA 2YWEA 2IUEA 3GLUA 1Z07A 2YXNA 3B12A 3DTVA 3PQ7A 3SFVA 1DT5A 1EVJA 3AKEA 1IBLB 1M8FA 4ZVSA 5BSXA 5C52B 4XJVA 1NBMD 1PFWA 1R4NB 4TTSA 3FTEA 5HR5A 4RH1A 2NPIA 5FUQA 2PUDA 1Z28A 3K70D 1JL3A 4W5JA 4X8LA 4LMAA 4FXOA 3FSRA 4D1YA 2YV5A 1OU0A 3P2EA 1Z2EA 3BMXA 5AMXA 3Q40A 4HUQA 4E6PA 5HHTA 2D8MA 4Z54A 4AKEA 2JBAA 4R2MA 1WUIS 3RC2A 1FS4A 1CUGA 5I9SA 1KBZA 5IFLA 1OVMA 3CN9A 1I5RA 2RHTA 4HAOA 1H8HA 4AN0A 1LDMA 1XVIA 3NT4A 1ZGHA 2BFAA 4P12A 5A9TA 5ELMA 5DGIA 2IPOA 1JA1A 5TLSA 2DUNA 4FEGA 2FN3A 2DHDA 4EY3A 3A1FA 3VR6D 5JH7F 3HJRA 3OIWA 3E03A 1Z9BA 2AXQA 5AI6A 1IM8A 1THZA 1K08A 3R3HA 5BV8A 4L50A 4AAYA 1N34B 3USES 4A6XA 1N3LA 3ZVLA 5DGXA 3WGVA 2O3UA 1C0LA 4G9BA 4DMRA 4EY7A 1RJ9B 1BGVA 4URVR 3CESA 3T1VA 3WK6A 2YOFA 4BY9E 3OKPA 1BH6A 4S1TA 4LI0A 5LC1A 3W8NA 4BMZA 2G17A 2ZTLA 3I58A 4XGKA 5BUZA 5FRDA 3K1AA 4JFAA 3ADKA 2O07A 4PZLA 4PGFA 1UADA 2L2QA 2ZSIA 5ALNA 2D06A 4Q5IA 1U0SY 1KC3A 2BZ1A 4FQ7A 4JP1A 4REOA 4O4JB 4H1UA 2P41A 4G65A 4IIYA 3KSZO 4A8JA 5FBKA 4EI8A 3MTQA 3NDJA 3QF7A 1OASA 2H51A 2QZSA 2BZGA 2G1KA 2QZ9A 2FFBA 4V02A 1LS6A 3R6LA 1NI4B 4NJMA 1D03A 4X45A 1CJSA 1CX9B 3J81A 3LX6A 5AVKA 1M7BA 4PRLA 3ECSA 3SIXA 1PEYA 4EELA 3VU8A 3FPKA 2B8WA 1I36A 2P9FA 2R8OA 5DHPA 2XUZA 1W36C 4U7FA 3IAEA 3ZQKA 2QGZA 1Z5WA 2G25A 2H7VA 2F9MA 1DQYA 2FQQA 3QVJA 1VQOB 4GEKA 2F8SA 2BMEA 4EFLA 1PDWA 2NW6A 2CMHA 3L0DA 1YHNA 2W43A 2RHOA 2A5FA 1ULTA 4HMPA 1NU8A 2RAUA 3WYEA 4C01A 3PDHA 2FPSA 4P7JA 4LC0A 2GWHA 3D0QA 1PR0A 2XOKD 2D2FA 3KU4A 2JAWA 2QN8A 3T53B 4RIFA 5B3AA 4FQ5A 4AJIA 4BOYA 5CT9A 1E58A 1YT5A 2C82A 4JBXA 3Q0IA 1RAGA 4JY7A 2DP4E 1BQ3A 3DVQX 1ZIXA 5IM5A 1MTZA 1MG0A 2YNMD 3E4DA 1ZJ4A 4GGOA 3E9MA 3VZSA 3WTCA 5BMVF 3UW1A 5BR1A 2NO5A 2P6NA 1G21A 1T6XA 3H4VA 1QCDA 5DBOA 1K7EB 1BDHA 2ZZKA 1KXJA 2RKWA 4X63A 1T8YA 1Z08A 2WJAA 4BMOB 4JMQA 3IAM6 3QITA 2FRXA 4P08A 1OBFO 4I1UA 3S2ZA 3VZRA 2XMSA 2GKGA 1OAOC 1PL8A 2FR0A 1H5UA 1ND5A 2X7JA 2QB5A 2M6SA 1BH2A 3B20A 3DL4A 3F5QA 3PNOA 3KQLA 4GKJB 4PIPA 2H4XA 3F5DA 4KO4S 1B76A 4RFLA 1N8SA 4I1YA 5F51A 1Q6ZA 3ZE6A 1YJ5A 1JYEA 3EGOA 4XIGS 3TQOA 3A27A 3OQPA 5LXTF 2G5GX 3DCIA 3HR4A 2Z9BA 3VYWA 3L4JA 3W3ZB 2AKYA 3Q85A 3PR2B 4WZEA 2DY0A 2X6TA 3C6KA 1PT5A 1LI5A 1UC5B 4D9KA 2ZUBA 1TGVA 1U1FA 2WIBA 4FHDA 1PJQA 4DUPA 1YBMA 2FPWA 1BA2A 3EX7C 1A4XA 3FPAA 3OTGA 2NUAA 3DP7A 2E5WA 2QJWA 3EQ9A 3JAKB 3MWYW 1PQ4A 1DAKA 1AHIA 2BE9A 1UC9A 1IY2A 2HA0A 2OCDA 3COZA 1VQKB 2NG1A 2Z04A 3CINA 3VC1A 1ZCBA 3L7MA 3PUWA 3U09A 1UBSB 3OP1A 3W06A 1A7JA 1HZZA 3N6XA 3NGXA 2JLXA 2HR1A 2AK3A 3KXDA 1Z4OA 3FB4A 2W90A 3NVAA 2P65A 4JS0A 3MAGA 4GOOD 1QONA 1QO9A 3BG5A 2B78A 4PLTA 4R1PA 2CKMA 3FHCB 1WULS 5HFAA 3W7BA 4J6FA 2CLEB 5KMGB 1U98A 4L72A 5CB4F 2FLWA 2VJBA 2X2PA 5AKGA 3BWMA 4J3JA 4JP2A 4EPVA 1LTKA 4KKVA 1UJBA 3O90A 1ZMTA 4TT8A 1A8QA 4MVJE 4Q3DA 4IXTA 1NUAA 3DFKA 4X20B 2X58A 4YCBA 3V8BA 3UJAA 4JYAB 1JHDA 3F46A 4OHXA 2JBHA 2VJNA 2H92A 2WR8A 2LP4Y 4LYGA 3PFNA 3TXXA 2CWDA 1UJ6A 2DR0A 3MOGA 2KBFA 3LPMA 1XU7A 3KKOA 5K3CA 2CFSA 2I03A 2Q4DA 2QM7A 3HR8A 2WF7A 3N07A 4UASA 5G53C 1MZPA 3KJEA 3SJ7A 16PKA 3BMNB 1QYXA 4R1NA 5I8PA 4D9GA 2V4DA 1P2DA 4QQKA 1IZZA 2E4AA 3KB1A 4URUR 1ESZA 2JIPA 8GPBA 4OHKA 2BI8A 4YAWA 2C4MA 4NFHA 1XRRA 4MX8A 4E08A 2PKCA 1U7OA 3BFXA 3CH5A 2BD0A 3M6MD 2YHIB 4RYLA 3BBLA 5LBUA 3HM2A 3T3PB 3LQRA 4UE6A 4LXHA 4RY8A 5B3JC 5CEJA 1XTTA 3EQ2A 4D3DA 3AI3A 3IC5A 2ID8A 3NVKI 4EW6A 3C4JA 1WMDA 1IN7A 1EQUA 4CYMA 5BNWA 4XI9A 3ZU6A 3CNLA 5ICGA 3Q11A 5JY1A 3G2KA 4G84A 2EZ4A 2X5JO 4YRZA 4JI8B 3O03A 4HDRB 2AW3A 3B1JA 4NCIA 1FF9A 1P8JA 5B4UA 2VPWA 3K0FB 3PXEA 3HH8A 5HM6A 4GM4A 4QU0A 3RBAA 2WZBA 3T5TA 221PA 4J0KA 5H4GA 2BBTA 1UD6A 1J90A 2B4TO 5C5EA 1DTSA 4DF3A 4TZ6A 2YWHA 4YRCA 1DMRA 2CLFB 4A8HA 5AOAA 1L5WA 4PYLA 4J4BA 5EHQA 4XGRA 3DGEC 3H9CA 4A10A 4BVHA 4CEJA 3A11A 3QENA 1MORA 1L8LA 3A9RA 3GRCA 1U0FA 3T3MB 4MYHA 2Z3ZA 3GDHA 2G9ZA 1GZ6A 4GR5A 4I14A 4KACA 5CBPA 4G5YA 2P9YA 1M5TA 1E2PA 1I6KA 1KYTA 1XU9A 2DCMA 2HSWA 4HS9A 2M6KA 4DM3A 2C8JA 3CC8A 4EYKA 4ZGBA 2AJBA 1E7MA 1ZJWA 1G1AA 1TUBA 1JR3D 3Q7PA 1FJXA 2EIXA 2D3LA 1AC5A 4NEHB 1QHHA 5DOVA 2F4VB 4N12A 2YL2A 5H4HA 1SCQA 1VCOA 4J4HA 3E8SA 4PIVA 3SKBA 1C4OA 4Z86A 3UMFA 1BDBA 1Q7GA 1QG4A 1SHJA 4JVOA 3UAYA 3BF7A 2VDMB 1HT1E 4HADA 3WC4A 2ZZGA 4RXUA 3KLBA 4DQDA 3OCUA 4XQFA 1A9TA 1IBSA 2ZFUA 3IUQA 4KO8A 1SZJG 3D3WB 4QYMA 3VR5H 1GG8A 3UMSA 4WJLA 2VHCA 1P4RA 3GPIA 2P7HA 1B6RA 3BDAA 2ZJZA 4HNAB 1PJRA 3RIYA 5LMNB 1PZFA 4HEQA 4JP5A 3THYA 2C1ZA 4JENA 3DWFA 4JHXA 4C0LA 1GFIA 1E3TA 3PCRB 2HHJA 3FMPB 1J07A 3LQKA 5CX4A 4UPDA 3WBFA 4Y6OA 1C9YA 3C4QA 3LCMA 1NW5A 3Q0EA 3SQDA 3H2KA 3PIIA 3UN1A 4BE7B 2XMPA 3EXAA 3FRIA 5M2QA 1DQPA 1EM8B 2AC7A 2AQ8A 1GNVA 4D41A 5IDYA 1M1XB 1JIJA 1WMEA 3AEYA 4M60A 1M8PA 1H23A 1RQ7A 5C8YA 1P4SA 4BVLA 4LBYA 2XWPA 3K9QO 5JPIA 3KTAA 1YBFA 1GQSA 1FSFA 1JTVA 1T2CA 1ITZA 1WMAA 3N6RA 4TQAA 5E9WA 2II6A 1T9AA 1WDTA 1P0QA 4MMZB 3WHKA 2HA6A 5B7NA 4CKWB 2L0XA 4QEKA 3UAGA 2R87A 4QXRA 2V7TA 2O2XA 1MOSA 1V37A 2DFKB 1JAXA 2OC9A 3AHEA 3B6KA 3I23A 4KZPA 4DEYA 3BFJA 4TLEA 1NSYA 2WU1A 2XUAA 3LLVA 4YN3A 4KMRA 3EULA 2R8ZA 1HURA 2IDMA 3NTUA 4RH3A 3OQBA 1OLOA 1U2DA 2PUBA 3IVCA 3JVEA 1MQAA 3GX1A 1CEYA 1KK3A 1CDDA 5BSGA 1R8SA 3L04A 1G60A 4DY4A 2E3JA 1CS4C 4AWBA 4G4IA 1ZI8A 4S12A 5D3MB 3QW4B 2JIMA 1R15A 2XYPA 3D6TB 2Y1WA 1LRJA 3E4CA 2BYTA 2O6LA 4ZJYA 4WCDA 2WU8A 1FFHA 3OT1B 4BQQA 1NMXA 4NFLA 1J56A 1ULAA 4C4YA 3GROA 4C4OA 4HDCA 4HATA 1PYOA 4Y2GA 1I2ZA 4ZO6A 1P2GA 2AUMA 2CLKB 1QDEA 3BH0A 3MMZA 5DRTA 5EHZA 2XZTA 1NVAA 3VOAA 1FFYA 3SZLA 2BP7B 5IABA 4RMJA 1XCJA 4X61A 4CM3A 5KC9A 4GQBA 3THWB 1GJRA 1KVRA 1QH1B 1XGKA 3ZZ1A 4Y0NA 1Q12A 2G63A 3OE7A 1KI8A 2REQB 2WHPB 4NBNA 5E2BA 5G0TA 3ESRA 4RK5A 1H9BA 3U0VA 1YE3A 5JI3E 1NT2A 3TPZA 2JKZA 3LXXA 4INJA 1QM5A 2BI4A 3GVXA 5AKIA 5IBRA 4CDGA 3QFRA 1N5RA 1VHQA 3JYHA 1JJVA 3TB4A 3PNPA 3EGEA 2ZDHA 4MI6A 3C3EA 3TKYA 4W5QA 1MO2A 3ZE8A 5HRAA 1JIKA 4DDKA 4LMPA 3AXTA 1ZA2A 1HGXA 4I99A 4P7FA 4F71A 2IIBA 1HR0B 2H8GA 2P0YA 5G4KA 5K4HA 3GMTA 1TT5A 2VEDA 4F4FA 1JKXA 4YAGA 2VTBA 2VHTA 5CVVA 4UTXA 5ER9A 1XPJA 2A2ZA 4B76A 1Q7EA 4G5GA 3B78A 3ZWQA 4Q24A 5KYGA 4IIVA 1B0PA 3OCZA 2WUFA 2H5LA 2WDPA 3AJRA 5DNUA 1W94A 4KHPB 1BGXT 3N8KA 3AH8A 5CA1B 3OJEA 4DR7B 1NOKA 3E7DA 1GD1O 4LPKA 2BM8A 2EX1A 2I8LA 1WXEA 4JLUA 2WYIA 5EIHA 4B7ZA 4TGLA 4ICIA 4ILEA 2ZYTX 1ATZA 1XN1A 2OEPA 2VP5A 2CVHA 2VXYA 4JOCA 1TAUA 3AR8A 1NRKA 3NHUA 2ZXFA 4U3JB 5BT8A 5AHOA 4BQOA 4LYDA 2D8AA 5IDXA 2MYUA 3CCCA 4FYJA 4FXUA 4B8YA 3E1KA 4AY6A 2LD4A 3UMRA 3NWBA 4ZICA 2O8DA 3VMFA 3F6PA 4CMHA 2V7WA 4RHTA 4HNUA 4EARA 4M83A 1NMQA 2JK0A 3RTDA 1LBQA 4X8IA 1OI4A 2VT6A 3KSDO 2QYHA 2GCNA 2OUKA 3Q5EA 4FGUA 4DT1A 2HMUA 4FDAA 2BFBA 2HK8A 3NIFB 3TK1A 5HUJA 2XRMA 5JY6A 2V0NA 5F76A 2FF7A 3AT1A 1O94C 2P6OA 3K31A 1LTHR 3EYWA 2VUIB 7MDHA 1TZJA 1M8JA 1W0KA 3IELA 1HE3A 1OJ7A 3OZWA 3W5DA 3RS5A 4JIMA 4BGDA 3M89A 5LUAA 1NBWB 4Z4CA 1RM5A 4MV3A 3R9XB 4HWGA 3DVLA 3DZHA 1YJNB 2F1JA 1RYHA 3AVTA 4WIAA 3LVBA 3PRJA 4DOMA 5A9RA 1KAQA 4K9MA 3O7WA 4KDFA 4I2VA 1A76A 1QGUA 2PRZA 1J22A 3Q87B 4NOLA 3SHFA 4L5AA 1ADCA 2ODAA 1DJNA 1EGQA 3UWMA 3FNHA 4MUGA 4R3NA 3AOEA 3NONA 1KI2A 3DMFA 2XZPA 1PV1A 1ORDA 2V7XA 1WAMA 3PQ6A 4Y0AA 3MOSA 4NYIQ 3CZRA 3PICA 2M98A 3W6OA 2WJ4A 3GVCA 1IQUA 1WU8A 3K15A 3R3VA 3WLSA 1LD3A 2JVJA 3W2FA 3MAJA 4M54A 1IM5A 3IOMA 4WK2B 4G85A 4PICA 1MAHA 5A4DA 1V6SA 4N3BA 1YUMA 3L79A 4G09A 5TMBA 2GO1A 3LSTA 4NZZA 4XAQA 3QEMB 4FDVA 4RIHA 1K3TA 2JC3A 2ZRGA 1DAPA 3OPVA 4EX7A 2PBLA 5J4HA 2VO1A 4G0PA 2ZITA 3WZLA 1XLUA 2GLUA 2WF6A 1WEKA 4IIJF 1W5EA 4HQ0A 2G67A 2KBEA 1ZQ1A 3QE0A 3LDAA 1VRCA 4PXAA 2Z1MA 3DMTA 4REQA 1E6CA 3P2KA 4LJ8A 1L4MA 3NIWA 3T1NA 4ASUA 3BXOA 3KKEA 4E2YA 5KKCA 2P5SA 1SAYA 2Y1EA 3GSIA 1A7AA 1TA4A 3EVCA 1OYVA 3OZTA 4KKSA 4I36A 5G0UA 1BMFA 4TKVB 1RXWA 2R7MA 2V5VA 1IOZA 4W5WA 3JRNA 3FETA 4W1SA 1Q84A 4WACA 1CF2O 3UQYS 3V42A 5LP6F 2G1PA 4RXMA 1GGMA 5BUQA 1E9DA 2X85A 1ZD5A 4Q7MB 5I7OA 1O2DA 2FMFA 3N0VA 3USCS 1ADGA 2PKXA 4NHEA 4AD8A 1KIMA 1V9LA 3DKVA 6LDHA 4DIKA 3F7TA 1DPGA 1A2BA 2AV6A 2O5CA 4ER3A 4YJ3B 2CYAA 2JHCA 4OMDA 5D87A 5IM4F 3OICA 3ZPNA 5KYTA 1TLFA 3OZEA 2PAFA 4BP3A 4RDJA 5DXAA 3LAWA 4UUMA 4HDSA 1SR8A 1RXYA 4BP8A 3ILYA 1AN9A 3PWZA 4BVJA 1ZUD1 1FUYB 3WQBA 4K9RA 4L16A 4RL4A 3VYUB 2IEYA 2DECA 3F67A 2Y1CA 4QYSA 3RVSA 4EGSA 1W7AA 2Z2ZA 3TMKA 3HBJA 1E6UA 4HN9A 4R31A 1QX3A 4JVLA 5EWJB 3OJLA 2CLHB 2IYEA 4L9RA 2Z6VA 2HIMA 1WR8A 2O2HA 3DFUA 3R8CA 3DBVO 5ALTA 1KO5A 3N2YA 4TVSA 1DARA 1M2OB 2QEXB 2XKAA 2V4UA 4MQUA 3CW2A 2R25B 1TE2A 4UBJA 1FSSA 4AJLA 1YZQA 1FVFA 2GBIA 1T10A 4PANA 4YCJA 2W71A 4XLZA 3DTVB 3ZE9A 1N36B 2GRJA 3H5AA 4JLNA 2QTTA 4A36A 3OQ1A 1G9SA 4KMMA 3SHOA 4OXRA 5LU8A 1CIPA 1EESA 1GM5A 4A26A 1WV0A 4FC7A 1TK9A 2F00A 5EIBC 3OOYA 2IH2A 1Z12A 2WWGA 5HIJA 4P4TA 7GPBA 1V8DA 5F9HA 5C46F 4PG7A 3V1NA 2X9NA 1N9GA 3LUKA 4P4GA 1KOLA 4LFAB 4JI4B 2JBAB 1W75A 2H65A 3BTUA 4HWKA 5LYYA 5F78A 1N8RD 4JL8A 1Y4SA 4NCXA 3Q6NA 4IZIA 4OXQA 3BX1A 1U3FA 2OCLA 1PZMA 4KJZA 2ORWA 2J41A 3MOIA 4BO2A 3T3NA 2CT8A 1NWCA 4DNTB 1OR8A 1XMVA 2ZYUX 4N03A 4MW6A 3BQJA 5D6NA 3E84A 1N5OX 3WZ2A 2PSJA 3FVVA 4E46A 3L06A 4CODB 2BSQA 1GXSB 1XHEA 1WPQA 4JJ4A 4EAAA 4JLOA 5BXYA 4PNZA 1MNAA 2HCBA 1Y8ZA 3L3BA 3K09A 2HZBA 4QLOA 3R7FA 4OHYA 3F3YA 1TJNA 5ULLA 4E2FA 1YQGA 4EKNB 5E9QA 3EF0A 4FD3A 3NJRA 4LCJA 2CJWA 5FYDA 1OWNA 3W5SA 4ZGQB 1WW8A 1ZN8A 4XDYA 2RGRA 4FE3A 1PL7A 2QORA 4HP8A 3RU9A 1NV9A 3E2MA 2QMQA 4DSOA 3JQAA 5TC4A 3KZOA 4EH1A 1N92A 3KEQA 1C30A 1RHMA 3DOHA 1QIIA 1T1RA 4A8JB 4BGEA 5LSAA 2FN4A 4OP7A 1HE4A 5FUXA 4HFMA 1S1CA 1N2EA 5L3VA 1R0WA 5F52A 2G8NA 3T9EA 1GUBA 2GD0A 1O6CA 2XGMA 4YLEA 1BAPA 3F5SA 3IULA 4BE4A 1TJ5A 3GRVA 1V3QE 5CH8A 5AI8A 3FFXA 2A14A 1V45E 2PR2A 3G0BA 3EIOA 4KWIA 4Q9HA 3PDCA 2HSJA 5CJPA 3HWRA 2KQUA 1XTSA 3T5CA 1AO3A 1V8PA 5E0KB 5JD5A 1JB1A 4TVOA 5KVSA 2VJJA 3LECA 3GCDA 3TIXB 2RCNA 1T9GR 5EC8A 1T3HA 2Q0SA 1T2DA 3TINA 1R9JA 3FSGA 1QF9A 1PD0A 2PQMA 4MRVA 4AS1A 2VJKA 2XA9A 4XJSA 1N1GA 1ENYA 1V41E 3JQFC 4WN9A 4IIFA 1LI7A 1HYEA 2JGJA 2D0PB 1RTKA 2QTGA 4MKIA 3OEED 4QUHA 5CG1A 4R8MA 5JLJA 1LC0A 1YH3A 5BSRA 2PL3A 4GWGA 5HJEA 2FAXA 4U8HA 1SVWA 2VQSA 3ST7A 2FPGA 1B73A 3BF8A 1VYHA 4FGLA 1NRWA 1EQAA 2FYTA 1BWSA 3GVIA 1PW7A 1R0ZA 5ALJA 2O59A 4NC9A 3W4KA 4M55A 3HGMA 4KJXA 5F2OA 5C1DA 5LWHA 1WORA 3CCLB 4FMCF 4AMBA 1ABBA 2I1QA 4G4JA 1TRKA 3WNCA 2EATA 5DE3A 5AW6A 1CPYA 4WESA 1DAOA 2R11A 3CE6A 1O54A 3MRSA 1SIWA 2CXHA 4C05A 5BUSA 4GOLD 3TQSA 3DLBA 3FXAA 3DDOA 3F1KA 1C7ZA 1EXMA 2X8LA 4H0FA 4ZKEA 1U11A 3EDQA 4LYEA 1R6VA 1U90A 1HVXA 1U3VA 2HIAA 3FHOA 2PZ8A 2XE8A 4RHXA 3SVZA 3WLQA 4B3BA 2ZPAA 3DEJA 2D7CA 5K3BA 1XYGA 4Q05A 4PHHA 3X3HA 4C4XA 2CBGA 2IHNA 1KGSA 4MJLA 5I9BA 4DMFA 3RHTA 4NMHA 1EWTA 5IU6A 2O50A 3KZ1E 1NOJA 4EQ6A 4LJSA 4E14A 1EB9A 5DN6A 1ECPA 1I1HA 1Y8CA 2OCPA 4JLPA 5HF8A 3LUGA 4DLNA 2J1LA 3KSAC 3OZIA 5B1HA 4QOJA 4RGVA 2IH5A 1P7VA 4OMCA 4R81A 3DM5A 1VLYA 5BR7A 1SUPA 1W4RA 1XAJA 3EXFB 4EB0A 1V1MA 1PYGA 2Z56A 3Q9SA 1T2UA 1V11A 4YX9A 4AJHA 1MQSA 2DR3A 2OY0A 2ZRKA 4ZMRA 3RSFA 2JB9A 1B7GO 2XE7A 3ZVNA 4RA6A 4H35A 3T4PA 2C5GA 4KO2S 1XTZA 4B6RA 1PVVA 3EMDA 3P9RA 5FAXA 3RSHA 2Q29A 2FZCA 2Y3IA 3L7OA 4ZPJA 4S0XA 4U4AA 4AZ0A 1P7CA 4DPKA 2GM9A 3UAXA 4YMGA 3ZIAA 2EERA 6CHYA 2HRDA 1DIBA 5AIAA 1ZD1A 3LUFA 4ZCIA 2I4LA 5K3EA 1YB2A 1Q22A 5EP2A 4OF4A 3D0OA 5CK5A 2I66A 4HS4A 4CM7A 2EYQA 1CUXA 2FEPA 3EOBI 1IXZA 2BJVA 1BC5A 3JD4A 2NYRA 3U1VA 4P54A 4P81A 4AZVA 5CCEA 1GITA 3LKVA 4US1R 4QPZA 3G85A 3MQ2A 4UMVA 2PMDA 1RHKA 3QPUA 3GJSA 2RH8A 1D7AA 1RSZA 1XVTA 2VR1A 2QAGC 3OX3A 2Q8QA 5TPZD 2N47A 3A3YA 3GT7A 2PIAA 2R0QC 3HKCA 3KOXA 1WCIA 3PL5A 4Z0TA 2Z3VA 1P75A 1NXXA 5EFOA 4CW7A 3NPMA 5EINA 3F1LA 3SI7A 2ZT6A 4G4GA 3ET5A 3PUXA 2K4MA 5JDIA 1WVIA 4PZDA 2ZJ3A 3WNDA 1G5FA 1RPTA 4R05A 5LYJA 3GLFA 3A26A 3VBCA 3EG9A 5CEFA 1U8EA 3UAWA 3PQ3A 2MCFA 4LF7B 3Q7TA 2A0YA 1QG6A 1VP9A 1DB3A 4OP1A 3QXJA 2Z4TA 1BWRA 4TN5A 1KAOA 5K6TA 1GPYA 3JQDA 2X3UA 3KYBA 4EL0A 1N75A 2XIJA 4IAOA 3QBEA 4FILA 1ZH8A 4QGFA 5KVAA 3DL7A 2H0QA 2OCGA 3CMEB 3AR5A 5KTRA 3K9BA 1MW8X 1C2TA 2IOFK 2XMRA 2ZUFA 1FYFA 2P77A 3A04A 2IZZA 2QRQA 1P6UA 4R2HA 2JAHA 2G71A 4CEJB 1N7GA 2FEOA 3MT0A 5KNCA 4BNFA 3Q10A 2REXB 2J0QA 1FFWA 2WT9A 1XD8A 1ULUA 5ENVA 3WBKA 1CV2A 4IVQA 1E62A 2VNJA 2G08A 4KP7A 3DDSA 4PFSA 4PSVA 1VHEA 1OLUA 4R6XA 1D2MA 4OGWA 5HMMA 3OVMA 2OFOA 4Z53A 1IUOA 2ZBRA 3ENZA 4ZC8A 1QVRA 3ASRA 4OI2A 5DV9A 3RNLA 3EA0A 2EJUA 2P9HA 3NBXX 1TUBB 5SYAA 4GOXA 1NOIA 3ZNPA 3VI4B 2PVSA 3MVEA 3QVUA 1RBYA 3I8OA 2XOXA 1EU1A 2ZDGA 4ZTZB 5JNSA 1NVWQ 3HRHA 5I4CA 4IQ4A 4KL8S 3Q6QA 4UUOA 1RMTA 5GIOE 1TC1A 3HXMA 4JFRA 2QI9F 2ZDQA 4MKRA 2V6IA 1U7WA 4WQMA 2HTFA 2FF5A 4M8KA 1G1MA 3IEMA 2GEVA 4FFOA 4RZQA 2DSNA 3UGKA 3V2GA 3W05A 5C81A 2QIOA 4OAQA 4EVSA 5A3QA 1CW2B 1EK2A 1QLHA 1WHTA 2P75A 4NH0A 4UXHA 3THSA 3UJPA 1P7ZA 1Q7RA 3VZBA 4G1EB 2BKUA 2VDRB 4ZI7F 5C1IA 4ZZIA 4NXMB 5EZYB 4ENUA 1PYDA 1CRLA 2BMDA 3MYYA 4AWAA 5B37A 4HC4A 1SNYA 4YH1A 5JALA 4ITUA 4AK9A 1GCGA 3ZBUA 5C8YB 1FLNA 4YUAA 4PHTA 1SB8A 1TQDA 4DLAA 3KTAB 3P32A 4CU2A 2HXYA 4BWGA 2GM3A 2YMLA 3ZWXA 2XI4A 3U39A 3EEOA 4ND4A 3VSBA 1QJCA 2ADMA 4A3SA 1MR3F 1F6BA 5JRZA 3NKLA 3X44A 5K0ZA 4TWZA 1U81A 5CLIA 4QG3A 3CUYA 4ARZA 1ADFA 2ZE8A 3GWZA 2HPAA 4N7JA 4JN6B 5LP6A 1FOEB 1Y82A 2BFPA 4C3ZA 4DY6A 5LMCA 2Y9MB 5I7WA 2IODA 3IDOA 4TYYA 1H4VB 4HI0E 4WECA 1YIDA 3PTAA 4G1UC 1UDWA 1TECE 1OX5A 1Y9DA 3CVJA 2JJYA 3DJFA 4OQMA 4D9IA 4G36A 2BBSA 2QY6A 2Y0BA 4OQEA 2CK3A 1S8OA 1I10A 1J6UA 1RQXA 2XDYA 5PNTA 1AUOA 1P6QA 1L3IA 2FH5B 2OWEA 3I01A 4L6AA 3NUGA 2W2LD 4PPFA 4XGIA 5CTAA 3SK0A 1XZ8A 3HZHA 1OA1A 5AR1A 1VIMA 1UFVA 3A6EA 3ZWKA 2BGRA 5I9LA 4H16A 4JSRA 1M0SA 3EISA 2JIRA 3UICA 5K0GA 2CLCX 1S7GA 4GL4A 1Z5OA 2AVNA 3AERA 4TOIA 1VL5A 4LMRA 1OMOA 5JT1A 1ZQ9A 1K6JA 2OV8A 1T3TA 2XZDA 3Q3VA 3WRYC 3CZ4A 3EG5A 3ACBA 4ZFNA 2PPLA 3V00A 1P3JA 1CRWG 1PK8A 1QV7A 4RMHA 2GYUA 3H11A 3PRYA 4X94A 4B9AA 3T54A 3AW8A 1Z4QA 1OX6A 1TF5A 4G5OA 4Q1DA 1OH6A 2Q6TA 2HBQA 1B8PA 4KI0A 1ZN7A 3V3KA 1Y1LA 1JI3A 5IBPA 1AKQA 2QSYA 2WMYA 1Y8QB 4EYGA 1H2AS 3M3HA 3UHOA 4BBZA 2PX4A 3ZQJA 1U8YA 2OHVA 3BC1A 2C9ZA 2ZIUB 3BRSA 3CR7A 2YS7A 4R8LA 2ZJFA 1W4CA 5FFNA 4D80A 4Z4TA 1EK5A 1UDCA 3SIWA 1AKEA 5KBYA 3B1FA 3LNTA 3SDZA 1Z6YA 3TW8A 1GR0A 5KYNA 1R3UA 2XKJE 1R8JA 2QMZA 3FVWA 1QHYA 1R0RE 2QN1A 3DUWA 4TTQA 3SBOA 3BH6A 2F9LA 1TT5B 3EZ2A 5CR9A 1X8XA 2VTBB 1ZVJA 1CFZA 2X7HA 3WYGA 3EH2A 2O8EA 1OFGA 2E9SA 3PA8A 3G8DA 4KNVA 4TXJA 3U7IA 1TZMA 1E4EA 3D4LA 3ZV5A 4EA9A 1BSVA 2WU4A 2WTUA 2QSJA 3FOFC 5BORA 1MX1A 3CJQA 4W8OA 5AHRA 3O26A 4CTJA 5LD2C 1DU4A 2ZS7A 1JA9A 5ANRB 1VBKA 4MEAA 1P77A 1RYFA 4MGIR 5B6IA 1UPXA 3W6UA 2E49A 1I7DA 3GVHA 5DMHA 4K28A 4LN1A 3ND8A 3SFZA 2IYOA 1L3CA 1OZAA 5AFSA 4EUHA 2F62A 2O2EA 2QZZA 3NRJA 1YL6A 4LRTB 2YJGA 2Y27A 4N47A 4GMKA 2JHAA 5KSWB 3R1IA 5CH5A 4ZO4A 4ZEXA 4WD3A 3TRDA 2QM0A 4OU4A 3GJRA 3PHGA 4DR2B 1W52X 1PNQA 1H69A 1N0UA 3EW9A 3I09A 2E4WA 5CDYA 2C5EA 4QIHA 1YI8A 2F48A 2IU6A 4OKNA 3IEXA 4XM0A 2M6LA 3VXKA 4BEVA 1N0WA 1ZJ5A 2ZKLA 3A05A 4ALNA 1FBNA 3DEIA 1YSCA 3W9SA 2CMGA 3KWMA 4P1VA 1NJ1A 3OOEA 4WZKA 3RTBA 5HKKD 2VDJA 1KF0A 3O21A 4DT1B 3AR4A 1XEXA 2BFBB 3BDVA 3DOFA 1CFJA 4TN1A 1TTHA 2FUEA 4WZBA 3O9ZA 4KW7A 2O8NA 5DTQA 1T8UA 3OM0A 5TB5A 2HX1A 4FCWA 4GGMX 3H86A 3RVJA 4UNIA 4CVNA 4FSHA 3PP8A 4UHCA 1C7EA 1WD7A 5NLLA 2GJPA 1I9GA 1I1NA 3WSTA 5E4TA 1WOOA 2YZGA 4BFLA 3K8OE 4XA8A 1SULA 3N5KA 1GDDA 3NU1A 3Q1KA 3Q3GE 3N8HA 1U7HA 4EKDA 3H2ZA 3QYJA 3OIVA 1ZR4A 4ZZ2A 1UF9A 3CCUB 2WTNA 4C0BA 5ALUA 2J33A 2X7XA 4O2AA 2JAUA 2ZRIA 1QGUB 3VO8A 4JH0A 2WE7A 3GRUA 3U4IA 1SQGA 1Z7GA 2W37A 4I4IA 4V39A 4CCWA 1JLLB 4LSGA 4D98A 1W73A 3KP1A 4QOIA 3Q4GA 5BQPA 2HHHB 1O5OA 1MTOA 3QTTA 4M1KA 1DP4A 2IXEA 3ZWOA 1GPNA 2HT1A 2Z09A 3OU2A 3KLOA 2PJDA 4FOLA 3E5RA 1R6BX 3SZOA 3L7NA 1E2QA 5DGDA 2PT6A 1FSPA 4N3CA 4NULA 3VO1A 3KNZA 4LVOA 3ABQB 1OGIA 5TVGA 2IFTA 3E9QA 3T99A 3W77A 4RJJA 4CM9D 5CDFA 4DLPA 4N48A 4COOA 3MS4A 1X8KA 2WOJA 2NZXA 1DRUA 2C5FA 4KG7A 5C31A 1N2CB 1TVMA 2WYWA 1AX9A 1IIRA 1ODSA 3BH4A 1PU2A 1SOVA 3H75A 4HJXA 1OU4A 2PNJA 3I2YX 2JGLA 4IBOA 4LRXA 4JEMA 3ROEA 2GJKA 1NBHA 1GQRA 3BIXA 3QOWA 4J43A 2WM9B 2IUFA 1A9QA 4LJAA 4JGIA 5J2UA 1DV1A 3O8QA 3BMCA 3EW7A 4S2EA 5J40A 5CXQA 1NW6A 1W2WB 1QZUA 3WLLA 1O0SA 2B0CA 3MUOA 2RAVA 4OPVA 2IIVA 5TGZA 3IMKA 3P9KA 4ML3A 3W2HA 1RZUA 4TLBA 5KO2A 4OSEA 3L6OO 3KCQA 3H19A 2NSDA 4FJ0A 4EF6A 2KMLA 4XX0A 4O59O 3WWCA 4HBGA 2GZHA 3ZWCA 2MTBA 2V65A 4RHUA 2GD1O 1Y1TA 3D8UA 3VM6A 2FPPA 3JSXA 3OEWA 4CMGA 3QPCA 4YV7A 2C31A 3DTYA 4AQDA 2IHYA 4BLTA 1Y81A 3E8MA 1ZXLA 2AFIA 4MLDA 1JU4A 4POOA 4Z4YA 3TEMA 1REQA 4O33A 1Q1NA 2AC4A 3EWSA 4A2PA 1KMCA 4HDSB 1V5IA 1SHLA 4FVTA 3CSUA 1NSFA 1DX4A 3KZVA 5KSOA 3UGQA 2XQIA 4MGZR 1DWOA 3IR5A 4W1PA 2JJ1A 1U2GC 2WAOA 3LQ2A 3SMVA 3WIVA 2VF7A 1IJFA 1AKYA 1AS3A 1I7NA 1UPTA 4LAFA 4X6YA 1BTOA 1C9KA 3VPXA 3MRXA 5ISMA 1U6JA 3TVTA 4DA0A 2ZJ1A 3R74A 2ORED 1NQUA 2W6QA 4PFQA 1ZX1A 5KTOA 3CMCO 5HOEA 5LKAA 4FONA 2VTEA 3G2OA 2BFEA 1TRHA 1WNTA 1EGMB 5E0OA 4ZARA 4DIEA 1CUVA 2FUG6 4QODA 5E7MA 3S3TA 3RS8A 1CB7A 5DW3A 1CQPA 3PYLA 4ZIRA 1MZVA 5LPNA 1BEZA 1U0BB 1T13A 2ZBQA 1HDYA 2X0JA 3ANSA 3ZE2B 5HS4A 1ZM7A 5JISA 2IY7A 2WJ6A 5DYWA 2JLZA 5TV2A 5KQSA 2F2TA 1EIWA 1KDVA 3K1JA 5H02A 2VOJA 5AKJA 5E95A 1O0BA 2OQRA 3PE6A 2GVZC 4F60A 1GZDA 1B8OA 2QDKA 1FTYA 1RRPA 2ZJ0A 3OPNA 2ZUTA 2WU0A 3E22A 3C70A 4Q3CA 5CB6A 1W6UA 2PCLA 1IHPA 3DW3X 1LPAB 5CDSA 5CLFA 5LQMA 3PJDA 3QX3A 3VH3A 3QBTA 2RD2A 4DW8A 5CEEA 1GDHA 2YOGA 3WL6A 3HPRA 3W6ZA 4AYWA 4F2HA 5BURA 3RFTA 4IM7A 1E6MA 1JHOA 2P9QA 1PX2A 1JHRA 2IZ6A 2J31A 5DDIP 3AKZA 3DVAA 5LQSA 1NF9A 4PZCA 2EXXA 3RAPR 5TNXA 4LE0A 2FFJA 2VJCA 2HPHA 1K66A 1ZZGA 3CC2B 3A8KA 1ISHA 4MR7A 4K9DA 3HNPA 1B00A 1XDSA 3FY4A 3SYKA 2OXEA 4D4HA 2VZEA 5FPKA 4DV1B 1T2NA 5HKAA 2MMCA 3MWLA 4LZLA 1MC8A 5JNTA 1K98A 2YMQA 4YO8A 1C30B 2GB4A 5F4ZA 4Q4HA 3AKCA 3C3DA 1C1DA 5IHPA 1F06A 4GXNA 2WP0A 4XZ3A 1A27A 1WE2A 3FLAA 3MWEA 5LOVF 2CLMB 1KORA 2PVPA 2O7SA 1OXBB 1JILA 4GLJA 1YIJB 1PF7E 3UV3A 5FTLA 2IYXA 2Y99A 3E3MA 3OAAA 1N2JA 3VR5A 3ONDA 4TMVA 4XMYA 3G2HA 4JASB 3MJHA 4E03A 1E5DA 3WX0A 4UOEA 1E2HA 3FTCA 1ZM4A 4PPYA 3O2NA 3L93A 3MGKA 3FKSA 4GKVA 3LLSA 1N5IA 2QKYA 1F8UA 4J3NA 4NARA 1OWLA 2FZLA 1JDBB 2X9LA 4MWCA 2OMEA 4IO1A 2CNBA 4WN9B 1VQ1A 4C6TB 3GUYA 4FMPA 1FXWF 5JXIA 1E89A 3V4PB 3WGMA 4HQOA 4DSTA 1A72A 2YXBA 4ZI7A 5L9AA 2AN5A 3I30X 1ZITA 2FPGB 3B3FA 2GTHA 3T5PA 4MTLA 1GPKA 1A97A 5J1SB 2WB2A 4BCBA 1EVLA 1NRJB 4X71A 2ZBFA 2R65A 3QXGA 4ZAYA 4JQZA 3ROXA 3NYIA 2FPMA 2W6IA 4E7PA 3MB8A 3DE1X 5CYGA 4FCVA 4JX8A 1ESCA 1OYYA 1U1DA 3C3BA 1MAUA 5BWBA 1VG0B 2FR8A 3AIKA 4JJ8A 4WESB 4UCXA 2B61A 5EIWA 3W3AH 1N3BA 4P26A 1GRCA 1IPFA 7ABPA 2QMHA 4RULA 5ALKA 5FULA 3L4SO 1WPCA 2R9VA 3AJ8A 5AJTA 4ENSA 2ZATA 4ETWA 2IZ7A 2GN8A 4P3PA 3U7JA 2PQ0A 4KLNA 4W9NA 4GBMA 3A2NA 1BG6A 3WLOA 1A7UA 2FWIA 1XE3A 3GFGA 4RACA 2XXJA 4EQ6B 3DAYA 3IIKA 4TRNA 2EFJA 2W11A 3OBBA 4JSTA 1EXNA 1GYPA 1WOYA 3ZGLA 3NR2A 1B3BA 2B82A 3PPYA 4YQYA 3ROFA 3U17A 4UHEA 3ZWVA 1PJCA 1JWLA 2QNBA 4LRWA 4HE6A 2J5QA 3A70A 3AUYA 3IJEB 3OM1A 3UJDA 1E9SA 3RJTA 5JZBA 4D8WA 4EGCB 1RZVA 3K0CC 5JFTA 5CU7A 4J7CA 1G3MA 3DE7X 3Q7RA 4U2KA 4C0HA 1V1MB 3ZZNA 3REQA 5ALGA 2OV3A 3SJAA 2CXNA 4XOUA 6ADHA 2PO5A 2HREA 1E0SA 2Q5OA 3QSYA 2XT0A 1C41A 4PNHA 1ULSA 3K4QA 4RA6B 3GY0A 4BU0A 4Z6KA 3ZNNA 5JQGB 3RYCA 2D2EA 2COKA 2F7SA 2HLNA 3M6UA 2ZS8A 2CXPA 2QL5A 4H7IA 1DC6A 2WUVA 4UVEA 4ABYA 1RWWA 1PLKA 2AEMA 2BBOA 2DWUA 1K3UB 4V0ME 3K6SA 1QR2A 1RJEA 2VQDA 1GTVA 2UUBB 1TAQA 3G0IA 5AW1A 1K6IA 3U4MA 1M34A 5ELLA 3UK7A 4DN6A 2G36A 2VPPA 2P11A 1LK5A 4B6FA 1H1LA 2J9YB 4F5EA 3EUFA 3GJZA 4UU7A 4YS6A 3MN1A 4OUDA 1TTQB 3KDPA 4BVKA 2IYRA 1NSTA 4B3TB 3CIFA 1OC4A 4YRIA 3HUTA 1C7RA 1I4WA 4TX1A 5HM8A 2O4UX 3CEHA 4ZO9A 3GD7A 1J2YA 4WWHA 5BR4A 3QKIA 5HBRA 1G4AE 3OHPA 4MCIA 4XVCA 2CVFA 1O97D 1Z22A 1X3SA 1QZ3A 5KSPA 4FS3A 2WJGA 4ER7A 1DC4A 2PSHA 1UDXA 3PXAA 3H8SA 1ZH2A 2HAEA 2FMIA 3V6LA 1T0UA 1AMNA 4OX9B 5KYUA 1HE8B 3PGJA 2I34A 3P8ZA 2XAAA 1M5UA 2B4QA 1C0PA 3ABSB 4F1WA 1ISRA 1SPXA 5AW0A 3GLFB 1Z13A 3ESQA 3IGFA 5LYJB 3LHDA 3EG9B 5KNDD 1BMTA 1RKVA 2E0IA 2PX2A 4FYWA 4BX0A 2I7VA 3GN1A 4ZMBA 2PS3A 3R75A 4ARVA 3JQAD 5DTRA 3H5OA 3ZIUA 2FDCA 2IOHA 3C2QA 4YIHA 1KZ7B 1QH8A 4O5OA 5LVAA 2AT1A 1C7JA 3GBSA 1QPBA 3JQBA 1E7WA 4L5JA 3UWSA 4QTYA 2GAAA 3BSSA 2VSQA 2VK1A 4C7OA 1JEAA 2HGSA 2DQYA 2RHDA 3ZZUA 4I4TA 3UYLA 4B0OA 5DHRA 2VHYA 3FLBA 1C1YA 2GHIA 3CPEA 3GJQA 3GNSA 4TZ0A 3F8WA 1G8HA 1OLUB 3ANTA 3I6IA 3L7CA 3VGJA 3ISJA 1HK7A 2QMEA 2Z5VA 4JWTA 2FKNA 3JQEA 4XQEA 1BKDR 2QVBA 2V6MA 4GUDA 1JQLB 4LNHA 2HSZA 4M87A 1QVZA 1UEJA 4B32A 3CRVA 5EAIA 1M66A 5FOSA 4EPXA 4MV4A 1O08A 2ZQYA 3D7NA 2W6CX 3PU6A 4W5HA 1UC4B 1NR5A 1XTKA 5FR2A 3MJEA 4NJEB 2V5AA 3DCYA 3KPJA 4OM7A 2XWBF 3UXYA 4FDTA 4CF7A 4G0VA 2HL6A 2NU6B 1UBNA 2FJUA 2WZDA 3H4MA 3PUIA 1ICIA 4H7PA 1GQOA 4MWTA 4CU5A 4IF4A 4CFZA 4YK7A 5DSXA 3ETNA 3G7SA 4GZLA 2GVNA 3O8BA 3GFQA 3PUKA 4IKOA 3WWEA 3MSXA 3COWA 5JQWA 5LMUB 3NBQA 1J0CA 3MK31 5LB4A 4C6SA 1PTJC 4CR7A 3M83A 4N8EA 1NF2A 3OMLA 5JYBA 2QMUA 4NMMA 1EHCA 4TMWA 2AOWA 3CJRA 1WXFA 4F3CA 4LF9B 1GNLA 1TT7A 4C21A 5C4GB 1YZHA 2ZXEA 3TDMA 2J3EA 4ZN6A 1POWA 4L0QA 5HRCA 2W6JD 5EP1A 4K9NA 1ZK1A 3C16C 3BJIC 1JG7A 4Q7JB 4PR3A 4ON9A 1XZQA 4PQYA 1MO3A 3SYRA 5JS8A 2CKDA 4DA8A 4XIIA 4KPFC 2FW9A 5CBKA 1PK9A 2VDOB 1M54A 1ONSA 1P1CA 3IVAA 1IXKA 1JQ3A 1ZOSA 3M5DA 4F38A 5HZMA 2V0GA 4FGSA 3ZD9A 4JYZA 1FS6A 1P17A 3AJDA 3MQFA 3CPHA 2VHXA 4LISA 4ZZ0A 1Y33E 1K8ZB 1RQLA 4ARZB 2R6R1 3BIOA 1Y34E 2ISSD 5IJXA 1TMKA 3QUCA 3RWMB 2VTVA 4J0GA 2CL5A 1G8KA 5K4AA 5JFGA 1EUDA 2P1RA 1GGFA 4M0EA 3V97A 1B26A 2ZR0A 5AN9A 4B40A 2EQBA 2AG1A 1DBSA 2O9JA 4OQDA 1SBYA 1J99A 1E77A 4NFSA 4YJGB 1DC5A 3AV0B 4EA6A 4QE3A 2EWMA 4OATA 3T7RA 5E8RA 1C1XB 4F12A 1E43A 2ZRHA 3ASTA 4TM7A 2YXEA 5JCJD 4H6PA 1JJFA 2OBFA 1T4GA 3U9SA 3NUZA 3D0KA 1KHTA 1S02A 1NP3A 4RLSA 5DFAA 5IC6A 1Z2CA 5C34B 1QJ4A 2OOSA 3AG6A 4NPHA 3AERB 2BHLA 1U3UA 4U9HS 4A8PA 3GRPA 3OZRA 3TL3A 1CR6A 4LDJA 1ZISA 1U8CB 3W5IA 4B6EA 3GVLA 4ZI3A 1JQJC 5TY0A 4HG2A 3MLEA 1JI0A 3RIEA 3H11B 3NMUF 2O2DA 3RYHA 4XYLA 4MRMA 4MWBA 3WKCA 1G19A 1QCCA 4LQ4A 3HGTA 1Y5LA 4EW3A 3MBOA 3JD1A 1N6LA 5LWQA 5EWLA 2WVJA 2J6CA 1G8YA 1DRKA 2MSWA 2RGEA 3HCCA 4WCFA 1E2LA 3KL2A 5IUKC 1UOOA 4Y9SA 4P92A 4O2BF 2XGJA 4CV3A 3LGAA 2JKVA 3M4ZA 3W9YA 3H9BA 4PZEA 4A8JC 3CEPB 4IWXA 1FP6A 4PYNA 1M2NA 3ICPA 3ITKA 4XRRA 4LRSB 3TRHA 2PXXA 4DMUB 4LE2A 1ZAKA 3TW8B 3IQWA 4MKXA 5AICA 4YAUA 2WB4A 4MA0A 2O52A 2PGAA 2EARA 2GJ8A 2JGDA 1J1IA 5L7YA 1PZXA 1VHJA 2EWWA 1K6XA 1XCGB 1TZCA 4QGAA 4A6PA 3HL4A 1NJGA 1Z47A 1N5MA 3OX4A 5FOTA 5FBHA 2NT3A 5B64A 2G0AA 5JO0A 2X14A 2XKBA 4GC5A 4HGQA 3MLAA 3U4DA 1T6ZA 5GMOA 3PENA 1E4EB 3UA3A 2ZZMA 2YWRA 1AD2A 3IHLA 5DLDA 5EQTA 3KYDA 2OHGA 2W6NA 1SBQA 3N3BC 3BWCA 4BCDA 5I7UA 1VQPB 3ZEIA 3E53A 1MT0A 4HH0A 5DSZA 2E89A 4W7IA 3QKSA 1YA6A 3P20A 4W1QA 1MC5A 3V7YA 1DZIA 3QVTA 2DBVO 1H2BA 4FYHA 4ENRA 1L4FA 2MMGA 3U60B 2XUIA 1YQEA 2OM2A 4EY5A 4X7MA 2VAWA 4I9NA 5B6JA 1NQTA 4MV0A 1Z2NX 3E05A 3AVUA 1V95A 2DJIA 3OLCX 5BOVA 1ODTC 1A50B 4ZA2A 5KNCD 1TEZA 1LDBA 3KKKA 1NM5A 3LBNA 9LDTA 1V8FA 1KTVA 4YA6A 1E3WA 2CBZA 2ANCA 3EZGA 3O93A 5JAHA 1BE8A 3PNKA 2ZSEA 3NHAA 2BGUA 3EQ6A 1K89A 4L7QA 3VGPA 2HDOA 1PNRA 2LWIA 4CLOA 3D6MA 2G5PA 2XQJA 4RPIA 2J46A 2IV2X 5LOVA 3I5UA 4FE7A 2G06A 1XUOA 1PGNA 3KR0A 2COEA 4NE7A 3Q3IA 5A0VA 3MCUA 4HZIA 3V2IA 3RRNA 1XEXB 3LWDA 1U7DA 3ROPA 3V4FA 1G98A 1S2MA 4RVUA 1N2CE 1YVEI 4WZBB 1KE1A 2I2XB 4UJ3A 1YU9A 4WJZA 5E1MA 1CZKA 1P73A 5EJMA 4B1FA 3NVDA 2O19A 1P33A 2HF8A 2UZ1B 621PA 4GYYA 3B1KA 4LKRA 6AT1A 1U94A 3C6QA 4KC0A 1QFMA 3T56B 4TMYA 2OG2A 3ZWMA 1NLYA 1W6RA 3DC7A 2D2VA 4I1IA 3AEUB 4UUPA 3SSAA 1MC1A 2G4CA 3FMVA 4QOHA 1BHQ1 1FP1D 2IE8A 4M0UA 3VR1A 1SCKA 1IZ7A 2EQAA 2FEXA 2YFQA 4O2AB 5D51S 2GPBA 1YZYA 2AFHA 3NTOA 5TGTA 3RHSA 1R88A 3JX9A 1VHLA 3I42A 1GGVA 2GO7A 1RU3A 4OSPA 3DR5A 4H7HA 4J0JA 1HDXA 1AUQA 1QS0A 1XXLA 3QZUA 3ANMA 1BMDA 3MTIA 4OUKX 5JCOA 2B2XA 3GH3A 3PWKA 4PLCA 1AK1A 1GKLA 1UIRA 1VP3A 2P9CA 4M1SA 3UXEA 3DKRA 2CUKA 2QVYX 2WU3A 3Q3AA 3R0ZA 3KV3O 3TLAA 2B20A 1JMYA 4FZ3A 4U7TB 1G5IA 1XK7A 1SB9A 3G9UA 4KB5A 4TYPA 2OA0A 3VZPA 2UUCB 4BNGA 4DRYA 5CLQA 2NO7A 3NTQA 4FFBA 3FOWA 4J1SA 3LQ6A 5IS2A 5IAGA 4B3SB 1SJ9A 1DKMA 3VOSA 4PGGA 2J3HA 3NTVA 4YV0A 2PAAA 3DD1A 4N1AA 3CO5A 1MKYA 8MHTA 1Z5NA 4FK8A 3E27A 3E9RA 3ZCRA 2OCYC 4AX4A 3NAZA 4KR6A 5J2UB 1BWQA 3O8QB 4JC8A 1UWLA 4GP6A 4ZOCA 1NE7A 2DY1A 3D9QX 3HYNA 4MAMA 2CK3D 4UHJA 3GQBA 3DQZA 3OU7A 3KX2A 4BUCA 4PCLA 2POCA 1KWKA 2ERYA 3U26A 1ZHFA 3L5OA 4LZOA 5FX2A 2ZR8A 3RY8A 3O4IA 3CNHA 3H2YA 3R4VA 4XX0B 2VA9A 1CIVA 2IUYA 3I73A 4MQEA 4MTCA 4FR5A 3DEZA 4KE7A 4CF5A 1P4GA 3EAQA 3SJCA 1SBZA 4AKIA 1UT6A 4C9BA 5JS6A 1OH7A 2O5RA 5BSHA 2AFIB 3H6KA 1BIFA 4RE6A 1REQB 1YQWA 3N28A 3ERCA 1YZKA 3STYA 3GFFA 4QUBA 5EJ9A 5L46A 5IC4A 4NG4A 2HK6A 3O94A 4B4DA 3VHXB 2R1TA 2FSSA 2EW2A 2OLJA 3WJ1A 1CQJA 3LDFA 1SCUA 5EPUA 3GIRA 3H1PA 1JJ2B 2BSAA 2BKXA 2AI3A 4E0BA 4LK3A 4R9RA 2HF7A 3LHIA 2UYCA 2DHEA 5FBWB 3HEAA 2W6MA 5IN5A 3VX3A 2OCKA 3HCBA 1L4BA 3VA7A 1WTAA 5I48A 4EGFA 4MW1A 2FWNA 5TPWA 5JIBA 4II3A 1MPTA 1PR6A 1ZOOA 3HHPA 1LVGA 4JVMA 4L4RA 4ZIRB 3UMYA 2DC1A 3RAEC 4B7CA 2PZMA 2RI6A 3I9KA 3SQXA 1KJQA 4AJOA 1JPVA 1NXWA 4O4LF 4OOSA 1W2HA 1NBOA 1TCCA 4GXTA 1KMIY 1GP2A 1DJQA 1WB6A 3PPIA 3WIEA 5AW8A 4QFMA 1EX6A 2IYTA 3LM8A 2G82A 2P2SA 3D02A 4MMYB 1LXCA 5EE3A 2ZSBA 2ECKA 1V5EA 3HA3A 4YRGA 3TLGA 3JWJA 1JVBA 2YV3A 4XL9A 2Y68A 3EIQA 3RO7A 4YMVA 3L77A 4LA4A 4ZDWA 4L5IA 2H1SA 5JSHA 4KEAA 1E1RD 2RGGA 4WBXC 4N5DA 2F1RA 4LVCA 3VSEA 1P2VA 3E2IA 2AQHA 4B3XA 3ZU5A 2GCIA 2X15A 2FWBA 5LU9A 3MYRA 4A23A 2VXOA 1YDFA 4HHEA 4LQLA 3DVAB 2F4NA 3G9ZA 1XSEA 4DV7B 3UWOA 4TTJA 1CTQA 2F55A 2P2NA 2DLDA 1LDGA 2XMQA 1XG5A 2XUOA 3UHAA 4BQIA 5KQGA 1WLSA 2QGNA 2XMZA 3R0IA 4MR7B 4NYMR 1W1UA 3MTJA 5HQ3B 2FQYA 3AILA 1CVLA 1QC5A 4Q4JA 2WVGA 3MMPA 3QU2A 3FKJA 2W00A 3R7WA 4CFYA 4IS3A 2FW0A 4QUZA 5FLKA 2V0CA 1A9OA 3EN0A 3ZBTA 4Q4HB 1E94E 1OE0A 1C1DB 5KQRA 4EUFA 1XCMA 4I8XA 2ZRMA 5K8TA 1G3RA 3CRMA 3NGMA 2BTQB 1HMPA 1VF7A 1LV8A 3CKLA 3GLHE 5EOVA 3T9DA 1R74A 2R5FA 4UCFA 4DJAA 1F2UB 3MWEB 4GDFA 3IJRA 2C5SA 1S9DA 4G01B 1CUFA 1WOMA 2XBUA 1J0EA 3NT2A 3I5YA 1FUKA 3H0CA 2O8VA 3JZIA 3OZDA 2WIJA 2BISA 1URPA 4C43A 3AEZA 3P4YA 4XKVA 3H42B 3TIFA 1U2DC 3Q8XB 4NF2A 3MJSA 3WB2A 3RBZA 5CB0A 4P0TA 4GNKA 4JOBA 4TSFA 1TU0A 4CTMA 2BGKA 3SM9A 1CJMA 4XPIB 5FKJA 3GDFA 1NGSA 4W9RA 4ZK6A 1J9GA 4EZIA 4TKOB 2QP3A 3GVJA 2XD4A 4R2IA 2XVXA 5AM2A 4D0LB 2ZBPA 4Q16A 3RK1A 3KLMX 2WV7A 2XY4A 3RSOA 4TROA 2JAQA 3PQFA 3IQIX 4KQJA 2YASA 2GBLA 4RIGA 1YNSA 1TZBA 2ZT8A 3PXBA 4EMTA 1VOTA 4DV2B 3OSUA 3L7BA 3UY4A 5TARA 2ORVA 4AJNA 2BVNA 5K0BA 1E5TA 2QIPA 3F7NA 4NQRA 1P2FA 3OP4A 3KXIA 3I0NA 4XM2A 4GRIA 3UT5B 4C2UA 3DMHA 2ECPA 1PL0A 1TJ4A 4B83A 5EMNA 1UOEA 3QWBA 4Q3BA 3ISXA 1JHPA 1F2DA 3IAS1 3DHWC 1IWBB 1IN4A 3MJDA 5DYTA 5JCPA 3MGAA 4B80A 3O73A 2IV7A 3SDSA 4BLUA 5BSYA 1JEYA 1VL8A 2CLIB 5A71A 4AVYA 1LJLA 4BN5A 2H6EA 2GZRA 3IVGA 3KWFA 1VIAA 1SO8A 2ICAA 4IXNA 3WZMA 1FPQA 2FTKE 4QREA 1KYXA 4JYPA 5TJ9A 5FDFA 5AKEA 1G0NA 5EY5B 1UQRA 3TS1A 1QE3A 5B3LA 1G4HA 3ZHTA 2QTCA 3MS2A 3ORQA 1GAJA 1M33A 4XN0A 4QFCA 2PT7A 2C9CA 3PDWA 4H3KB 1UOQA 1Q19A 3RRXA 1ZC3A 4G0ZA 4CG1A 5MFPA 4OREX 1IHDA 2B4KA 1LPBB 1PEDA 3DAOA 4GMXA 3I45A 1JE1A 3V8QA 3A6JA 3OOHA 2BEVA 5I7SA 2R47A 5ALYA 5EJ4A 1F4LA 4Y6GB 3C7CB 3D4BA 2PRJA 2C9BA 3AUUA 2LXNA 2AXPA 4OBWA 2JJ1D 3IKMB 3GP5A 1PT6A 3QU4A 3NHSA 5AJVB 5K3AA 2GXAA 1IZ8A 1Q0QA 2IYLD 2FE4A 2C4HA 3K53A 2CHEA 3I12A 4F97A 1IG3A 3LT5A 1JKIA 3NPAA 3F0TA 4N3AA 2QM3A 4HD8A 4OYLA 2DKFA 3TNFA 4J6EA 4E21A 2HPVA 5CRIA 2OSVA 4C3VA 3WL5A 3EEBA 3RYCB 2IHJA 3W7VA 3WWZA 2CDRA 2GETA 2GI4A 3HKBA 1O6ZA 4N0MA 3V4RA 1QYIA 5K3DA 4IDCA 2OXRA 1ISFA 4O2BA 5E6TA 2WILA 4A6EA 1SN7A 4A6DA 1F4PA 2ONJA 2IKSA 4HAYA 4MOWA 5DCYA 1I33A 3L7KA 2A8YA 3L43A 1VM6A 5KYVA 1M34B 3P9CA 1E79A 4EJ6A 2W2TA 4R9UC 4KWCA 4UU0A 3TLMA 2VBFA 3L40A 4PNEA 1MIOA 1K2VN 2NZ2A 1WB4A 2QX9A 4YALA 3MTEA 3Q7IA 4IV5A 3HN2A 4K8OA 4OEHA 2BE7A 3W2IA 1LI4A 2V6JA 1CQZA 4P4NA 1QMPA 1MX3A 2GILA 3FOAA 2JRLA 4HYTA 3T9AA 1VQ6B 5TS3A 2EZ9A 3KKNA 4MPRA 2XUHA 3F96A 1VKJA 5FTWA 1VCHA 1O8CA 2TMKA 2D59A 4JLMA 4LXGA 4DG8A 1CB0A 2FSIA 2HN9A 1MJNA 2I80A 1FW8A 4L9AA 2YOHA 1MVOA 3RVOA 4Q3KA 4M8NE 4ENPA 1UEXC 2PK3A 5EZSA 3UK1A 5EEGA 4A15A 3I2GA 3LGXA 2BLLA 3M1LA 2AJTA 5KYUB 1MO5A 2J0EA 2KS6A 1LLFA 2P9JA 1XD9A 2GNOA 1CULC 2DPGA 2V74B 3MB5A 3QG5A 1R0KA 1EK0A 3AOEC 2FMXA 5A5DA 4QASA 1M1ZA 3HDTA 3KFVA 2NTVA 4BLPA 4K9OA 4B09A 3HO8A 4CMBA 3IEVA 1RM4A 1Y5MA 2GN2A 1UBEA 4L51A 3IHTA 2J3QA 1TW2A 3WL7A 2WPDD 3NH6A 3QV1A 4YECA 4DNOA 4IDQA 2MIIA 3WR5A 3DPUA 1QH8B 3FCXA 3CZQA 3K92A 4KODA 3OWHA 3PFBA 1DQNA 1U28A 2IXDA 3EVNA 2V97A 3Q3JB 4DA6A 1GTL1 5JXWA 5E3HA 3TOVA 4MKFA 5IT4A 4B82A 1TZ2A 2XB4A 3WSWA 2J5KA 4AZSA 2NACA 1PV4A 4C7OB 3QPVA 4I4TB 1IC6A 4XIFA 1Q6YA 4C0XA 3G0OA 1JR3E 1L4EA 4ROTA 2CCKA 4RVSA 3HXQA 5FLYA 1OSNA 4CCYA 3ADBA 3BZBA 3HMQA 3ZXSA 4C0AC 2XHZA 3C85A 1V26A 2ZBEA 1L5HA 3EPHA 3EGWA 3DO6A 5I7HA 1Q21A 2EF0A 4F96A 3UKJA 3HRIA 2ECQA 1LY1A 3MHPA 3FRJA 1PHRA 2EYUA 3CC4B 1R4ZA 3PHHA 4H3VA 2HEGA 3P9IA 2ILVA 2V6BA 2V59A 4HLUC 4HMOA 2NQTA 4X7PA 2V3WA 2CMFA 3QGMA 5AJYA 5T5QA 5C1OA 3IV6A 1H4QA 2J09A 2Q28A 3PGMA 1V8BA 1SXJE 5JSYA 4ZYLA 1TJYA 2X0DA 4M0LA 4UPEA 1QGDA 4Z1MA 1HG1A 2BGNA 4GW3A 3I62A 1LBHA 3OC6A 1D8AA 3L0ZA 4UMEA 2VF8A 3CVVA 3FROA 1NHWA 5GVSA 1PFQA 4INOA 2CL0X 3AHFA 4RZXA 1YCGA 1K97A 3HDJA 4D92A 4I6JA 5C8ZA 3A3GA 1NC3A 1AA6A 4FM9A 3FUCA 2AHOA 1HOTA 3GFRA 1E2EA 5F9FA 3I2FA 5C35A 2YZMA 4AMVA 1Y6JA 5JROA 1E2NA 1V35A 1AB6A 2CJFA 2QPAA 3IT0A 4OK5A 1XZJA 3DZIA 1T9HA 3KJNA 5FOUA 1QF6A 2UYGA 3EXG1 4II2A 3U13A 3BA6A 2V6GA 3AFIA 1K8XB 5ALLA 2FGKA 3WE7A 1EUCA 1Q0TA 3QOYA 1IEVA 1Q83A 2A1UA 1ODFA 1L7OA 2IZ0A 2MSKA 3N8IA 3W7AA 3BD8A 2I7DA 2AF4C 1TU3A 1OKKD 1GZUA 4MV5A 1TA9A 2ZR9A 5FR1A 5CITA 1AO0A 1ORIA 5KQMA 1WSDA 4LJ6A 2Y1KA 2J0SA 3ELYA 4NSNA 2K5UA 1RP7A 3LHFA 4Y1FA 2PUHA 3NEPX 2OZKA 1Y1QA 4MUYA 2AS0A 2QRNA 3DAPA 4MYCA 4OOVA 2IXAA 3U19A 1NXTA 1EUDB 1ZI9A 3L7AA 2O7VA 4F2PA 2X3FA 4P2NA 4CR8A 2I55A 1UZLA 4GVPA 3SX2A 3O3MB 1NX9A 3IXMA 3GWGA 1CJVC 3H9JA 2ZAMA 2B2CA 4KXNA 2YWDA 3B6EA 4PSAA 5DKFA 5C0OE 2F3PA 4RPKA 2P2GA 1JFLA 2GTPA 2PX8A 1M1KD 1P29A 3DDCA 4QDZA 2NVUA 5KYWA 3LC2O 3KAQA 3QIVA 1BXRA 4HY3A 3RUIA 4YT2A 1L5ZA 3I72A 1BJKA 1NMSA 1YIOA 2FUNB 4YJHB 3V9PA 4CDRA 3IDSA 1XJCA 3AEKA 3H8WA 3Q8MA