2V7XA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYAREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7xA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7xA01
5B6IA 2ZBVA 2WR8A 2V7VA 1RQPA 2Q6LA 1WU8A 2ZBUA 2Q6OA 2Q6KA 2C4UA 5LMZA 2V7XA 1RQRA 2C5BA 2V7UA 2CC2A 2V7TA 4CQJA 2Q6IA 2C4TA 5FIUA 2CBXA 2CW5A 2C5HA 2V7WA 2F4NA 2C2WA
chains in the Genus database with same CATH superfamily
2B8JA 5C7IO 3QEMA 1QLWA 2HLPA 1D4FA 4CEJA 1R3DA 2E4YA 3A3KA 4B3BA 4RTPA 1GJRA 2GZMA 4MRNA 1UBLS 3H4VA 1A96A 2RKWA 2P4UA 2OORC 1WW8A 2YVLA 2BONA 3R3UA 4KJZA 3DDYA 2C96A 4MKIA 5G0VA 4Z4HA 2POCA 4KO3S 4EJMA 2VWGA 1RNLA 4S1VA 3CVXA 3H9BA 5LDGA 3UFXA 1Q91A 1G5TA 4C4PA 2XODA 4EO7A 3DT8A 1ZL2A 3GFGA 1SXIA 2Z08A 3CPEA 1TPZA 2QG6A 2TYSB 4IJMA 1TUBB 5J4YA 3DF9A 5F33A 3SQMA 3DNPA 4ZVNA 2Z1MA 3G6WA 4UD2A 1TGVA 4EI8A 1AHNA 1H2YA 4MWEA 1XA0A 3DL7A 1PGQA 4Q00A 5IT0A 1XDDA 3D7MA 4X7RA 4EHBA 4PYNA 1ZLXA 4CIBA 2FPOA 3AINA 4CMBA 4MYRA 4LQLA 4UTXA 4Q48A 3ZCXA 4IO0A 4MYHA 2G6BA 3H1EA 3GLHA 3RCBA 3ROGA 2IHYA 4UCXA 4ODIA 3ULKA 3LTNC 1NRWA 1NT2A 4BYGA 5HM6A 1SH7A 4OGGA 1ANKA 4ZQBA 3AI3A 3U39A 3GL9A 2WJAA 3G49A 3N6VA 3JQAB 5K0LA 1Y6RA 2WTMA 4FE3A 3H8WA 4Q7LA 3HDQA 4I4NA 5FOVA 1R0SA 4DJ5X 3ASQA 2JLYA 3VO8A 3ONEA 1XDBA 3P9QA 3W8NA 4E4RA 3ENNA 1YXMA 3UUEA 4RAOA 4B4OA 1I8DA 3AEQB 1Z3CA 3IKTA 5E6TA 4I6EA 1U02A 1WSVA 4II3A 1TFUA 1U5BB 2CNBA 2GJPA 3EYWA 4O2BF 1T6XA 1VGVA 3HPRA 1SQ6A 3WG9A 4HYEA 3NO4A 4JBYA 1UEJA 1NBWB 2AG5A 2JHGA 4QEKA 5TJ9A 1KQFA 2ZJ2A 1E79A 3N1UA 1PJCA 2CLCX 3QOYA 5E9QA 3Q7QA 1WMFA 3R3HA 1YJAA 3L0IB 4XPIB 1FMJA 3IA2A 1QHYA 1V7CA 3ROFA 4BMYA 4GKKB 5HHTA 4M53A 4JIMA 4L8LA 4UMEA 3HB1A 4NBUA 2X0EA 5JXHA 1BVHA 1G7RA 3NBKA 3QKWA 3RVBA 3KEQA 2UYHA 2PGIA 4D4IA 4IHAA 4GKJB 4N48A 4G1BA 4RK1A 4HS4A 2M5SA 3CY6A 1TECE 4CM4A 3UWSA 2ZS9A 2JPDA 3TE7A 4GKAA 2IUTA 2CF4A 3RH0A 3Q8XB 4DR6B 4B40A 5TSDA 1QHSA 3EUEA 4EYSA 1MVOA 4RD1A 2GAJA 4N8DA 3NOOA 1TT7A 2LIPA 5J2TF 2Z0MA 3EFBA 3Q7TA 2BDTA 3FGPA 4Q3CA 2B1QA 4I6JA 1TZKA 1ISHA 2PRSA 1O03A 2D1FA 3JQ9C 1YZQA 1EE1A 4I99A 2FJUA 4TXHA 2O06A 2C9ZA 3E61A 1JEEA 3A7EA 2IPMA 3GRAA 4NIMA 5CTAA 3M3PA 4NEQA 4RL4A 7MDHA 3WBFA 1Y7LA 1U7WA 4RPHA 1NPYA 2XUPA 3PDIA 4EYGA 5DDIP 5EWMA 2X85A 1JILA 1GLGA 5KNLA 1E79D 1JAXA 1BEZA 5MGNA 1D07A 3E7XA 1UAAA 2JRCA 4FGJA 2NUAA 2FQ1A 2H5EA 3CVVA 1AQLA 1OX6A 2YY5A 3LX4A 1XJ0A 1V9CA 4RTLA 4URWR 4QLBA 2IEIA 1I6MA 4PM4A 5D5HA 4RPLA 2CGEA 4B35A 1HT3A 2UZ0A 2AS0A 3KWFA 3MWYW 4UM9B 3AZOA 3CF4A 4YN3A 2Q3MA 2NW6A 1QGOA 3ZC3A 1CF2O 2FDXA 2J3LA 1LPMA 3DL2A 4JGBA 4MKFA 3S2IA 4DSUA 4CEIB 2JGDA 1AO0A 1RSZA 2ATEA 2Q1TA 3KPUA 5GMOA 4FMBB 4AF6A 3N28A 1QVWA 2HKIA 4GE3A 2FXVA 4Z6KA 3LDHA 3L0SA 5DI3B 1JHZA 3I28A 4CV0A 2MMCA 2JAPA 2JCXA 5K7SA 1N78A 1GNSA 1P5FA 4B6PA 4FMPA 2ZZNA 2G8NA 3JYPA 1R2QA 2ZUFA 2BH2A 5LZ2A 2H85A 3FYCA 3R23A 4JYCA 4B3HA 5LZ7A 1O5IA 4M1MA 1GZ5A 4TN1A 4YJ3B 5T8KC 5KWEA 1CJSA 2HMUA 3CEPB 2VJAA 4H15A 4IIYA 4PCAA 1VQ9B 1WUJS 3I53A 1V8OA 3IQDB 3BXXA 2GD6A 4FT2A 1USUA 2Q27A 4HFNA 4IJUA 3W1VA 4D3DA 4KLAA 4F93B 3OTOB 1P1CA 4IIHA 1PT8A 1M8FA 1AXRA 1PJ8A 2H7CA 2OWEA 4QYTA 4U2KA 1EP9A 2YR0A 4G65A 5CVDA 2QUZA 3GLIB 1XSEA 4Q9LA 1PX2A 4TTIA 4F3YA 3Q98A 1YJBA 2KPOA 1PJAA 3CEMA 3FBTA 1W4RA 3L8DA 4MJLA 2GN9A 2YV1A 2AEEA 4OKIA 3Q6QA 4KVAA 4GUDA 1XNHA 2AJLI 1FXUA 2PANA 3L6CA 3OE7D 3OVMA 5LUAA 1IPEA 3RR2A 1MT3A 4RNDB 4Y2GA 5FPQA 1IHPA 5B57C 1T8UA 1UK6A 5CT9A 4DSNA 1V4NA 3EIUA 4RQBA 2O52A 4IZ6A 4U9HS 5AKHA 3HM2A 5IKOA 3GRZA 3FZEA 3HEAA 2X6TA 2ZXIA 3RVSA 3IAS1 2J4CA 1XTKA 1SOMA 4NOMA 3OLVA 3R2JA 1C50A 4D8VA 3AKDA 2FPGA 3FWYA 4MWBA 1MO3A 3DWFA 4H7DA 1UZNA 1WVIA 2A9VA 2YXBA 3N75A 1G20B 5DM2A 4C89A 2EF0A 5L3SA 4INZA 4V0NA 4LXGA 4QXRA 2QD4A 4ZVSA 3AP2A 4TMXA 2WT9A 2XYRA 3FUWA 4OQXA 2XNJA 5AXAA 2AEMA 1K3FA 1T9GR 4XEHA 3UKJA 3AUTA 1HYBA 1X74A 2BJHA 3QXHA 4JBLA 1UMCB 3CM0A 4HYTA 2OE2A 4KN6A 2C2KA 3SY8A 1C3XA 3T7EA 1KEUA 1N2EA 4QWWA 3UGJA 4AWAA 3MMZA 2RGGA 1KZLA 1LH0A 1U7ZA 1O4VA 1YQDA 4JKIA 4L9AA 4D3FA 5K0SA 4RPGA 2DIEA 3PQCA 4QXAA 2FPPB 5HRUA 3O1JC 3ZTYA 221PA 2YWXA 1ZCJA 2WAAA 3PRYA 3X1KA 3A8KA 3UJ6A 1WUHS 1J8MF 4JLVA 4EHJA 5A7FA 1J70A 1KU0A 1A04A 4JX9A 4QBIA 2PKCA 3BORA 5JPIA 4EVIA 3QLUA 3LLCA 5KTYA 1LUAA 2QU7A 3FLMA 4II2A 1YZFA 3FPKA 1ST3A 4JJFA 1RCUA 3M4NA 3UNXA 5JI2E 2YX1A 2BFEA 4ZO6A 2NVOA 1I3CA 1RJ9B 3C6KA 4RYDA 2GUGA 5K8TA 5CAEA 1DCFA 2XMGA 3Q6RA 1IQ0A 2J67A 3K1JA 4RJTA 8ABPA 1WXGA 1NKVA 5BVHB 1MEOA 3HB5X 1V1MA 1N2IA 2PD4A 1O54A 4TS3A 4UBOA 3F98A 3T1QA 3TTUA 1TC2A 4B45A 3ZWPA 2ZR7A 3JQ6A 4EB3A 4KC0A 4NZNA 3RFCA 1N9GA 3RVPA 2G67A 2JJ2D 5REQA 2XZOA 1KE1A 3P0IA 1M2FA 4GR5A 1U3VA 1BTOA 4N8SA 4K6HA 1YB2A 3O73A 4EG0A 4ENWA 3TL3A 3EMDA 4KCGA 1XHLA 3QX8A 4WK4B 3WZMA 3FVTA 1UDWA 2ZUWA 2CHVA 4N47A 4F2DA 4X7DA 3OZUA 3VPCA 3PGJA 2FMXA 5K20A 3KZCA 4WCFB 4F9GA 1E1YA 1RDFA 1OGJA 1LS6A 2Q9UA 4TV8B 2HEIA 4KI7A 2C7VA 2O8EA 2D0PB 3NHZA 2CFCA 4G2TA 5H3CA 2M6LA 1WB4A 3WRYA 1N2CE 4M8SA 4MLZA 3RM3A 1Q3HA 5CVEA 5D01A 2LTAA 2ORIA 1JIIA 3OX2A 4V2UA 1HDEA 3OZTA 4MPDA 2JK0A 2O6LA 3NWPA 5TE9A 3F9IA 3M33A 3CX4A 4TMYA 3T6KA 1B2RA 2OFWA 3ZHTA 1V3TA 3PQ7A 2F1MA 5I8PA 3HLTA 3TTVA 4E51A 5C1PA 3SBDA 4TS4A 5KAPA 4P92A 3RYTC 1S01A 1J25A 3NHUA 5G3ZA 1TJ4A 2VXYA 5JBIA 1KTIA 3QVUA 4AL4A 1LJLA 2IUYA 5B1SA 1P9LA 2BC9A 2NV6A 2D4HA 4S24A 1WOMA 5JNLA 2GKOA 4Y9TA 2AFIE 3IUQA 4QJ4A 2IDKA 5CG2A 2DKFA 5F9MA 4AO8A 2NU8A 4W9RA 3EJ6A 3RADC 2Q49A 1OGYA 2PUBA 1SHJA 2GXQA 4XVCA 2DEUA 2CF5A 3OZDA 4UEQA 1KERA 2O2SA 1ZN9A 2O5VA 2Y8EA 4QELA 3UGKA 1XPRA 3R6DA 4IFIA 1WU8A 1U9IC 3TLYA 3ZCRA 4MVJI 4F6CA 2RC6A 3PLAE 1RVDA 2VPXA 2WA1A 4Z2AA 1VJGA 2DFNA 1DZIA 2D54A 2PGDA 4OQEA 2XZTA 3DWEX 1GV0A 3FTCA 5BSRA 4XLHA 1ZQ1A 4E88A 1YKSA 2A58A 4LWQA 4KLNA 1KHTA 5MN5A 1G9XA 3MRTA 2F8LA 3DDOA 5TXGA 1KETA 2VHUA 4MQLA 1D1TA 1RJEA 1OY1A 4LSGA 1ZK4A 5EIHA 1RFGE 3R3WA 4KPUB 5HSGA 5AI4A 1XNQB 5DLQC 4JI1B 1VIMA 4FJ0A 5L7WA 2FP4B 3M9XA 1U9JA 2O07A 3FX2A 3SQNA 4D92A 3PF9A 2DR0A 2R1TB 3PNOA 1OOEA 3JAKB 4LXHA 5D7BA 4CLRA 4HP8A 1IWBB 1E3EA 3OEED 1K8XB 2O5RA 2WM3A 3GGCA 3HN6A 1UPCA 5E1MA 4G0VA 3AWDA 1H2EA 1GAQA 1XTUA 4KQ6A 3VR1A 1CXZA 2I67A 2DKNA 3AVWA 4M89A 1JZTA 2J0SA 5IVPA 1RWPA 3WR5A 1KFKB 1XGKA 4TZ6A 3GUYA 3JQ7B 4CM6A 3U0BA 4XR9A 5HCIA 4H3VA 1CUXA 2TMYA 3DT6A 3UAVA 4AN1A 2G5PA 1YTUA 3LWNA 1GPWB 1ULUA 1R0WA 3WYAA 4EAQA 1YUBA 4DYVA 4XWWA 3DQZA 1TW3A 4IXMA 4LG1A 4UBMA 5F9HA 5ELMA 4MKXA 4C0JA 3F9RA 2W8ZA 2WVJA 4L8WB 3QM1A 5LC1A 3FMPB 4L4ZA 4FMDB 4GECA 3HWSA 4HL6A 2RHWA 3K1YA 4BB9A 2QM3A 2B98A 3ELUA 4MW2A 1E96A 1KSGA 5TEWA 3DUFA 4GZMA 3NDIA 4GI5A 1XFOA 3BE4A 5JJLA 4LNAA 3EZFA 4HG2A 3AERA 3TRFA 3GLHE 3CLRC 5HKOA 3WL8A 3L7LA 5K03A 1J2RA 1EJ2A 1S2LA 1U31A 2YOFA 4G5XA 5SZJA 1RZRA 4M0FA 4WK0B 1M76A 2W83A 2YZMA 2YVUA 3KG2A 3K09C 4G1CA 2I8CA 3TBHA 3TNYA 2F90A 4G3XA 1KJWA 1X7XA 2ISQA 1M2KA 2D8AA 1T1RA 3T7TA 3LNCA 1EH5A 2X8JA 4KAFA 8LDHA 3ZDRA 2C98A 4MWTA 3Q1LA 1X1RA 2WWIA 2XF2A 1K6JA 1FA9A 2P2DA 2ZB2A 2QJFA 3GCWA 4MQ4A 4N3CA 1EFLA 1PGOA 3CLTC 3ODPA 3TLJA 1IM5A 2OQRA 2PYZA 2QR3A 4I66A 4TM8A 3NS7A 5LDHA 4YJ3F 5FJJA 1RHJA 1VLOA 3C6ZA 1ORRA 3DKRA 4Q3DA 4D45A 5MN6A 3L4EA 3B53X 1JHDA 1E9EA 1NNUA 3HKEA 1UBGA 2Q45A 4Q9NA 4HAIA 5B1HA 4QATA 1SPXA 2XTNA 3IIKA 2A33A 4K1LA 1JLMA 3QU5A 5CB8A 1BA2A 1BKYA 1T3HA 1X1EA 2JJQA 3DONA 5HTOA 3R5HA 4GYYA 3TI9A 1T9KA 1PVOA 2G07A 4J07A 4L8VA 2VHCA 1QBKC 4HZIA 3WIUA 1SUIA 5JCXA 2CDRA 3GFOA 5FR2A 1GKYA 4MDYA 1TMKA 5AW5A 3B85A 3RTAA 3GP5A 2EYUA 3QBEA 2GBIA 4ARZA 3UMGA 4IO1A 4DCUA 3AHEA 4RL6A 1FIUA 1NDUA 1YHZA 3T35A 2W37A 4UBKA 1N6OA 3SX0A 3SXPA 4OQDA 3TPCA 4IUBS 1E89A 5KYUA 1FMLA 1VCIA 1Y1SA 4MUIA 2OHHA 4HNSA 3V3KA 3ZE0B 5FWXB 1NI4B 4QTUB 4EH1A 4CV3A 4L16A 3UKOA 1RYHA 2O2HA 1LV7A 2F62A 4S3MA 4YRKA 5BN3B 5AR1A 1U1IA 3IDZA 1DKOA 3PEYA 3BJEA 1VMAA 2CB9A 4C43A 5ERXA 1YNSA 2PRJA 2XNHA 4M8LA 1X19A 4CI0B 4TKOB 1SCUA 3F6PA 2ZRHA 1KARA 1PSZA 2CSUA 2C9MA 3NGXA 3OESA 4KQCA 1CE8A 3K9HA 1H0HA 2NYUA 3EAQA 3K2QA 3LSTA 4GR4A 4NECA 4P53A 2YZNA 4XFJA 4AYXA 3L84A 4RABA 1HFJA 4OYRA 4Z9XA 5B7GA 3HVRA 2B1IA 2WLSA 2INGX 4IDHA 1YFLA 3P2JA 1NM5A 3MG9A 2ZLBA 3CUVA 5EP4A 5FYDA 1EFVA 2WM8A 4LF4B 3Q88A 4UHHA 1BE0A 4HDKB 1RS0A 5JR3A 5EI5A 4OP1A 4LYHA 3A1UA 4M0KA 1P4SA 2A7XA 3M6WA 3P9PA 2GH1A 2GJAA 3GEHA 2ZJBA 2A86A 4YJHA 2E0IA 2NXEA 1XXLA 4A8HA 2W6IA 3AEZA 2JN9A 4KITB 4BKQA 3V7UA 2E1BA 1NR1A 1G8KA 1H5UA 1TJYA 1PJQA 4M7WA 4O3FA 4XGIA 1KJYA 1KNXA 2B2CA 4PBRA 2VHEA 1XU7A 1P29A 3VR3D 2Q50A 4KDRA 2GD2A 3EZNA 4AICA 5LQAA 3ZJ4A 3IH5A 4Y1EA 5EMJA 3UCEA 1W87A 3DDUA 3CPXA 2KLBA 3EGEA 3KTFA 1PZFA 1QFYA 1RPJA 2GK7A 1U8CB 3DMRA 3QP9A 4ZO4A 4BP1A 3ZS9A 4BQSA 1GQRA 1RRMA 3A28A 5JD4A 3DBLB 4O1IA 1PJ5A 3BIXA 1N36B 2R3SA 2PGOA 4G09A 3BCFA 4F84A 3V4OA 1XMQB 2FUG1 2G72A 1DO2A 2RH9B 3BWCA 5T64A 3OG9A 1UWCA 1Z0FA 1U3CA 1R5JA 2QV0A 1U9ZA 1GDDA 3BQ9A 1ULSA 4TV8F 1Z7YA 4QTXA 3N2LA 5A4DA 1ECCA 1RQLA 2D9RA 1DSSG 4EDFA 4NAHA 1SUAA 4DVJA 3JYNA 2LNDA 3GLSA 2QPOA 5IAGA 1I3OA 3ZDCA 3GD7A 1Y33E 3IDOA 4ND4A 2AQ8A 2XR1A 3T56B 2K4MA 4L9SA 4UBLA 3SOPA 4IUDS 1SAYA 1OYWA 1T5DX 3AY3A 2GZ1A 1FX0A 1CS4C 3DHVA 3L49A 1VG9B 4IFEA 1Z8HA 4TUYB 5FD8A 5TJHA 4TQ9A 3STYA 2IHTA 4DIMA 2CWDA 5F23A 1ZGJA 4EGCB 4JU9A 5JNUA 1ISPA 2EJBA 4HUQB 3N58A 3VTZA 4LJ5A 5THKA 3KB1A 3NT4A 1M1KD 4QJ5A 1KZ7B 4ZQGA 5L3RA 4N76A 2CJFA 2O3RA 4CZ2A 4X64B 3KKOA 3CLSC 1TDJA 2NZWA 1LXCA 2DR2A 4HAUA 3H5TA 2XHZA 3MWFA 3NC4A 3KOUA 4KX3A 1GWNA 1IN1A 4PR0A 4IP0A 3WFIA 1OAKA 1TUGA 1N8RD 1VG1A 1YGPA 2J0EA 3CMEB 1T2CA 1L5HA 4ES6A 1JNYA 4DLNA 4WT7A 2IOQA 1ZC3A 4Q3EA 3IRUA 1VYVA 1T5IA 3REQB 4GVXA 1S4QA 4REMA 2Q29A 1G4AE 1LA2A 4HDNA 4GM0A 4RY0A 3FOCA 1X7YA 2YXEA 4EVQA 3EAGA 2G08A 2JGMA 1LWOA 5ECYA 1BW9B 1ODKA 5H7XA 4RWZA 3A70A 1EXNA 3D6UA 4QPZA 5TPZD 3PITA 4K6FA 4A6PA 2EFDB 3AIMA 5LQDA 1GCAA 1FJ2A 1SCJA 2WHYA 4C0KA 1RAHA 4QUEA 4DA9A 2Q3DA 3N2YA 3SIWA 4HB4A 4N54A 1Z7GA 3R8CA 4RIGA 4Z4SA 2EP5A 5DYWA 1W35A 2HOQA 3K6JA 2ECKA 3NEAA 4Z9BA 2YWGA 1KJJA 1K06A 1RWXA 1YD7A 1Y5LA 2I3DA 2XVZA 2ZKIA 3N0VA 4B5KA 3T4EA 5IANA 2SKEA 3T9BA 2HTEA 4UTZA 1PTJA 3VBEA 1DZ3A 3O84A 5EQTA 4H7HA 2JH9A 1D2CA 1QGDA 2CXOA 1XZKA 2I2XB 2NU6A 2QMHA 1H8EA 1LLQA 4U2GA 2G77B 1VCMA 2P9EA 1XZCA 3ILHA 2QN2A 5GP1A 5IYZB 1KI8A 1OLSB 2IS6A 1CR2A 3Q3CA 2AFHA 2G63A 4DG8A 2CJPA 3AR2A 1NI5A 1Q1AA 4TV9A 5DEOA 4NULA 3VUEA 5LDDC 2YNMA 1M6EX 3LQQA 2L18A 1DEHA 2DVMA 2OBNA 3HA3A 3BAZA 4CCWA 4RTRA 1WM1A 5IJXA 3UQYS 3LW8A 2W8BA 1BMFA 4TYPA 3NXKA 4XLEA 2IZ5A 4FMDF 3TVYA 3D3WB 3QPBA 4D6PA 1SCBA 4URFA 5HILA 1EDOA 2HUNA 1BWPA 1ISFA 1RQGA 3FROA 1NAIA 4TN5A 1WP6A 2C31A 2PRKA 1EESA 5JBQA 1NZFA 1U8YA 3UJ3X 1SHKA 1ONNA 2JIDA 2FLVA 3ZHYA 1MMFB 2D2FA 4IVRA 4JC4A 1U90A 1P72A 4KKXB 4UUAA 1RHKA 2AOUB 2B1RA 4Q7QA 1FYXA 3MRVA 4OIMA 4CKCB 1ATZA 4RTMA 1R0LA 3VPHA 5CNIA 4R0VA 3E03A 5KHAA 1NW3A 3WMEA 3V1MA 4EVSA 4D4LA 3AIKA 4G0OA 1DAFA 5A1TA 3OJXA 1TMGE 4OMFG 3UMRA 1M0EA 1Q11A 3MTBA 1CUHA 3EH1A 1C1XB 3C85A 5L7TA 4PRYA 3WBBA 1HNXB 1OXSC 4QTZA 1C3JA 1SZPA 4LSWA 1DLJA 1F4VA 4EJ2A 2ZZQA 5FT9A 3WOVA 4BMSA 1J23A 4H59A 4MJ3A 4BQNA 2C2BA 2ZUVA 4E08A 5IJWA 1IN4A 2J87A 3ZVKA 4LBVA 1E1CB 1OSNA 1XTIA 2VBTA 4ZGBA 2MYUA 3CNBA 3MGBA 5CCDA 4TROA 4C9BA 3BXGA 4LOHA 2I7XA 5A5FA 2RK3A 2YQ4A 2R84A 4P4UA 2YNMD 5MGBA 1DJOA 2GEUA 4AJHA 2PIAA 3R7FA 2HT1A 2G5GX 4IKPA 4JQYA 4YR9A 4YT8A 3GJ3A 2CHQA 2WJHA 2VTBB 1S3FA 2H63A 4P7FA 4B83A 4HNVA 2X2OA 2I4OA 4B43A 1FNSA 2HWYA 2P3LA 1PNQA 4BWYA 1ZIOA 1CLEA 1CUFA 2XAAA 5CRIA 3BA1A 1P5HA 3S5UA 4D9EA 3L7YA 2ANCA 2YFKA 1U1CA 2UVQA 1GTSA 4RVCA 5C80A 4R8KA 5U4XA 4JP8A 2P3SA 5DNCA 1DJMA 4GH5A 3INRA 1ID8A 4OH7A 3VHQA 4CHTA 1M6YA 4CKEA 3B5EA 3I04M 4UHDA 5EXXA 2GZSA 3IAXA 1DAKA 3JATA 4I1UA 5AOAA 3AETA 4RVUA 2E4AA 1ZW1A 2QL7A 1JXQA 3Q6NA 3R9XB 1OFHA 3WB0A 2J5BA 4BQRA 4RSRA 1UJMA 1TCBA 3ASTA 2XB9A 3FSEA 2X53S 1ZPDA 2ZVPX 3ZIAA 3LCUA 3O4GA 1VQ4B 1TTHA 3P2YA 4JXKA 3QXCA 3PPYA 2YRFA 1ETHA 1SBYA 4EHLA 5CLQA 5DP2A 3PIIA 5FOSA 3VR2A 4KODA 4EUKA 2Z5FA 1VL0A 1UK8A 2J3KA 2ZT5A 3V1TC 1E98A 4R2JA 1TVMA 5DYGA 4WN9B 1DKMA 1XZFA 5ALIA 4HPJB 4CKWA 3HLYA 1GCUA 2O8DA 1QP4A 1Z73A 1H23A 4E15A 1VI6A 2UKDA 2RH4A 4G37A 1N4AA 3N0WA 5JAHA 2A1UB 1N0WA 1G60A 3CRNA 1Q92A 1OXUA 4Z86A 3NKVA 3DW1X 3OURA 3Q11A 3KXPA 5EEGA 4QTYA 2DHDA 1J1IA 3EZ2A 2OP1A 3M6UA 4FGSA 2N0SA 4K2AA 2IYRA 2O1EA 3MIIA 4W8HA 1BDIA 4KHPB 1MV8A 5LSAA 2GUWA 2XEDA 1MAWA 2Q5LA 4NJMB 3ZBPA 5F77A 5T67A 4XSHA 4YAGA 1CEEA 1ZBDA 4NCXA 4BNJA 3I6ZA 1FDIA 1HBJA 1SG9A 3A9UA 3WADA 4LC1A 5FWXA 4DNPA 2XE4A 4PSKA 1GPYA 4Q1FA 4R1QA 3EPHA 2VR1A 3BGOS 3R5XA 4WVFA 4M1OA 3G71B 4MIKA 4QUBA 4PRLA 4U3JA 4BGIA 3MELA 4ZEOA 2HBQA 3UHFA 1RPNA 5F3RA 4MKHA 2PJUA 1FTQA 3VR2D 3I62A 2ZDHA 4FFBB 4YRRA 4EUSA 3AOGA 1T4DA 5E4FA 1QYRA 3R09A 5DHAA 4H16A 7YASA 1TLFA 1PLLA 3DZBA 4UBJA 3UV6A 3VISA 1F3OA 2LVBA 3AG5A 4HH0A 3ADOA 1I4EB 1DAPA 4Z1MA 2RGWA 4DNOA 4ZCRA 3CUKA 1HMYA 4ILEA 4LE0A 1B43A 1IN7A 3KV3O 4R4JA 2EWMA 3WTCA 4DZRA 3GLGE 3AKYA 3ISJA 5DM0A 4TUYF 3VR4A 1HE8B 2XB6A 3UMSA 3W5IA 2ZI5A 3FYUB 1IFXA 3I23A 4WFQA 4BX3A 5JZVA 2V74B 4V0QA 1YQXA 2QE6A 3O4VA 3R7SA 4LX8A 2WYRA 2IYAA 5P8WA 2FEOA 2PV0A 1DC5A 3LM8A 4WCFC 1DC4A 4UHBA 5C3MA 3ZDQA 2ZANA 2CVQA 1C1HA 2C88A 2JD1A 3IIIA 1UKBA 3P0HA 3QG5A 1FP2A 1QVVA 2GM9A 3RIEA 4D6YA 5B58C 3GELA 1VP3A 2YJGA 3GYBA 4WZBB 1QU2A 4FHZA 1UBNA 1BSVA 1N25A 3NG1A 5IAKA 4ND1A 4TWBA 1B0PA 4Y6LA 4Q1BA 2DQKA 4K3VA 3CP8A 1RQ7A 3IP1A 4CJXA 2P69A 3ZVMA 5LQCA 3C6QA 1BJKA 4GSYA 1QAMA 1RAGA 1XRQA 5A04A 3C8ZA 3QLVC 3FIUA 4MGZR 3FCXA 1TZJA 4JJ4A 3FFBA 4PVCA 3IUJA 2C20A 4FFVA 3U49A 1WLSA 1L8QA 4K0KB 3TG2A 3ASVA 5TVKA 3V1NA 2BFDA 2PYIA 2JFYA 2YJNA 2QYHA 5AH0A 1VMIA 2ZWAA 5EPUA 4PHGA 4CIVA 5G1PA 1IXYA 1IDN1 5K3OA 2PN1A 3ZGLA 1XTQA 4OB8A 1EDZA 4LBWA 1QVGB 4PANA 1JFFB 1FYWA 4F0JA 2J48A 1GQFA 1PGPA 2ZP1A 3I6QA 1F8UA 3OOJA 4GP7A 3KSRA 2G5TA 4L3VA 3V2GA 3AF6A 3H3FA 3A3YA 5G1OA 3FTNA 4F6RB 4E7PA 421PA 3WHKA 4DWJA 1HE3A 1MABA 2R7NA 3RK1A 4YAIA 1A2QA 1Y6FA 4GL2A 1GILA 4K9KA 4X94A 5IC6A 5LXTB 4GPIB 3KKPA 2FI1A 3H1GA 4OJNA 3WGVA 4EYEA 4AY6A 1HORA 2B94A 3EXG1 1OV6A 3TSOA 1V25A 4TSKA 1JJAA 3LVRE 3UENA 2ZUTA 1GYRA 3A2NA 4EABA 2GCOB 1NNI1 2WF7A 5IYZF 2GFHA 2YC4C 1Q1NA 2OYSA 3WAKA 2QD2A 1E6CA 1UEXC 1CR4A 3MZ0A 1SURA 3P9IA 3ZHRA 1OASA 1QYDA 3PWZA 1CF9A 4JP5A 5EFOA 3F4LA 2VSNA 3ZX4A 1K6MA 3RC3A 4R2IA 2P27A 2WZBA 3P94A 3SC4A 3H2ZA 1YB4A 4QPNA 2CVFA 1JRLA 3UMCA 2NT3A 4OUDB 3AXSA 2A5GA 1Y7HA 4N7JA 5JFGA 4RJIA 1R16A 3K16A 3N87A 3UXEA 1DBWA 3QUAA 4NCBA 4RORA 3PU6A 3GWZA 4G25A 1U2EA 2R8RA 4YBRA 1EQ2A 2BEWB 2JI6A 3AETB 4WESA 4H7PA 2O1WA 3GXBA 3HJTA 1TTPB 2B0JA 4EM6A 5HJEA 1DVRA 2O2DA 3LHSA 3WMWA 5K4AA 5JXIA 3DEAA 3A6GA 3H8SA 1OTXA 5BUCA 4YJ2B 3QVMA 1X7ZA 4PLTA 2NSHA 4B1FA 2F8MA 3M2TA 5KTMA 3CG4A 5GVSA 2B99A 3FJYA 3USCS 4WBNA 1KHHA 3IB6A 1E9CA 5IJ0A 4NTZA 1Y37A 2G83A 4QDZA 4F97A 3DC7A 4PGMA 2HPVA 1COWA 1NUUA 2I78A 4FDMA 1QH1A 4A0HA 3U7EB 4UJ3A 3DBIA 3RIGA 4KXMA 4UPVA 5K3FA 2NX2A 3UCFA 3M1LA 1GZ7A 2VDVE 4Q19A 4DJFC 3U7HB 5CFLA 1SQSA 3CCRB 3OF2A 5GY7A 1NOJA 2V6GA 4YASA 1CZKA 3W6OA 4M4SA 1H6CA 1E5QA 2V0GA 4M1KA 2NXCA 2W6OA 4J2TA 2IOFA 2A6PA 5B55A 4RTQA 1EE2A 3V1KA 4KJXA 3ZEIA 3KT8A 2FFRA 2FRXA 2IZ6A 1BYUA 1Z75A 1N57A 3RUFA 4XWKA 3QKTA 3H5IA 5D87A 1NVAA 1SIUA 2HREA 2CNWA 3HO6A 1QV7A 4U7WA 2OCAA 3KKMA 2VK2A 4IXTA 1U8EA 3O26A 3WA7A 5FNZA 3G9UA 1DGQA 1YR6A 4MR8A 1ODJA 2EIHA 2D5CA 3KAKA 3O3NB 1MO5A 4NMMA 2PZBA 1XCJA 5JCOA 4EO9A 1NZDA 2QAGB 4ZCIA 3E1YE 1PNVA 1QFXA 1Z5VA 1TZMA 1JHMA 1Z74A 3A9TA 3AM3A 4N9WA 5E3JA 3HN7A 3ASZA 5EAIA 1X14A 3L6BA 1II8A 1Q14A 2GSWA 1RXEA 2OKCA 4FOLA 3W7VA 4YCMA 3TZCA 4FC7A 1PT6A 1E4EB 2YV3A 3HU2A 1WDKA 1DV1A 2UZ1B 5FJIA 2B8TA 1S72B 1COWD 1ZRSA 2XQVA 3SLDA 1JKFA 4QDJA 5HM8A 4DV2B 3K5WA 2ZROA 3PA6A 2HMVA 2FUEA 3A6PC 1JPUA 2QZSA 2AFHE 3PQDA 3V48A 3Q1KA 4DT1A 2FZVA 5F9FA 1Q2XA 3E2PA 4P5EA 3T8YA 4JT9A 2NP7A 4YPVA 5B4TA 1RP1A 4ASUA 2GPAA 4TWRA 3RAFC 4ZXFA 3AB7A 3RVNA 1XZPA 2OCBA 4CKZA 3IUBA 4YCAA 2ODQA 4QYWA 1SD1A 5FUWA 5B30A 1MU0A 3BILA 2XUJA 2BGUA 3O9ZA 1TKCA 4HNUA 4YROA 4Z3OA 1EEXB 1N5KA 4BFCA 2PS9A 3LTEA 2ZR0A 3R5KA 5EP2A 2DTDA 4D74A 4IZIA 2OOSA 3CZQA 2VTDA 5CVVA 5BSHA 3LQRA 4IRMA 2O6HA 1BFKA 1KI7A 1WNTA 5IZCC 1QGED 5F76A 1DTSA 2ZR9A 1QE0A 2JKYA 1OVMA 3FPSA 4H77A 2DBRA 2R00C 1EGQA 1GGFA 5G0TA 4KOEC 4WWHA 3BIFA 1Y8QB 4CFYA 1BWSA 2EHJA 3W5DA 4XLTA 4KDCA 5CBKA 1XELA 4RIEA 4E3WA 3AK4A 1T2UA 2QLJA 4MPTA 5EKDA 3EBOA 2ZSAA 5BO5A 1NE7A 3WWPA 6ADHA 1W581 3U40A 2NUTB 3ZPNA 4KL8S 1XIVA 4HNAA 1P91A 2NGRA 4CM9A 2XMCA 3DTTA 3KJFA 3LY7A 3HBNA 5CLIA 4BLSA 2HK6A 5AW3A 1ZG3A 4DPLA 3H0EA 4HEA6 1M6VA 4IF4A 4IXWA 5IZ4A 3H6GA 4KFSA 1XU4A 4KOAA 1EM8B 3DFZA 3IGFA 3NASA 1SQFA 1RRVA 1J39A 1D2EA 1DINA 5LBTA 1E3DA 2CLMB 2P2LA 3SVLA 3H3XA 5JS6A 1QANA 4G0QA 4LGMA 1YNOA 4R9UC 3PUXA 3E9NA 4DMGA 1RABA 1B1AA 2DBQA 2ZJYA 4WXRA 4RDXA 1XROA 5FAXA 3LCMA 2A5DA 3MNFA 1RXVA 1ZEMA 2ZREA 4GWKA 3AFOA 4C07A 4MROA 1KDTA 1INLA 1E4VA 4P81A 3EZXA 4RYLA 4X65B 4EJSB 5A4AA 3P96A 1FZTA 3MBOA 4GE0A 4W63A 1GXSA 3KL4A 1NX9A 2PXXA 4LI3X 4OLAA 2WB2A 2IDJA 2Z2XA 2X1HA 4G4SP 1QAOA 2G9RA 2XE8A 1T0BA 2Q4BA 1OYYA 4Q9DA 2AD1A 4Q6BA 4YCBA 5AUNB 3PKJA 1LC3A 1PR1A 5CW1A 1RC0A 3QVTA 3ORRA 4DPKA 5FX2A 2WICA 5CFQA 9MHTA 2JHFA 2FZGA 4HAZA 2BCGY 3HVKA 4RV9A 4Y0AA 5AJWA 3ROZA 4JUIA 4OAPA 2AR7A 3IJEB 4RTOA 5JT1A 3AHGA 3G89A 1E0DA 2OBBA 3HBLA 4CM3A 4OXQA 4PC7A 4GXTA 3MERA 4INPA 4YV0A 1YMUA 3RUIA 1RAFA 1L2TA 1V5FA 3WYDA 1Y8RA 4PC2A 1Z88A 2XTJA 3B36A 4IJKA 4NI5A 2ZT7A 4CR8A 5JD5A 4E2YA 3FWNA 3M6MD 3DSRA 1O96B 4IR7A 3R6JA 3TIGA 4I4TB 5DEIA 1WUIS 4HAYA 1CUIA 4U39A 4FK8A 2IYSA 5F1OA 1P1HA 1S89A 1GFSA 5EOVA 5CDHA 1BDMA 1AQIA 1GU1A 1MKYA 2WU8A 3VPGA 1V8DA 3ZCUA 5C7OO 3PNYA 5FOXA 4YWJA 3FUCA 2ADFA 1QYXA 3K1AA 5ESDA 5F7ZA 2ZTHA 3RGWS 3UHOA 1I9GA 4C4SA 1NJID 2L42A 4UASA 2K6GA 3RC7A 3B9PA 3JAWA 3WIBA 2W70A 1XTJA 5K2MA 1GT6A 1Z0SA 5LXTF 3BTUA 1XLWA 1ZGZA 4IIFA 4QE3A 3UXYA 1ML3A 4G1UC 3O3MB 2ODBA 2BL4A 2Y71A 1FFXA 2NG1A 3HYSA 3LE8A 4I50A 3TN7A 4ICIA 3OD1A 4F38A 1Q6ZA 5HZHA 4JC0A 2WIJA 1XA4A 1V8PA 3I9OA 4HBGA 1O5OA 1VYTA 1X8XA 2ILVA 3ROXA 1IHOA 1PJ6A 1MJNA 1C29B 4P33A 3MJFA 4QAQA 1WXXA 3CF6R 4Y2PA 3CC2B 2MYNA 3L5OA 4XWAA 5FNVB 3THYA 2IOYA 2V4UA 4J7CA 1MCZA 4M7RA 4ZU1X 5EIBD 3BSFA 3U7QA 3OTQA 3EWAA 3NTVA 4RMHA 2IYYA 3Q6MA 1EK6A 5CK5A 1A7UA 5DNDA 3KLBA 1FPQA 3M5PA 4ZHQB 2ZPAA 4P58A 2PBRA 4QHYA 3PPWA 3PNVA 1Y8ZA 3P2IA 2UV8A 1C3EA 1IAQA 1WSWA 3AC0A 3GCDA 1E5VA 3BERA 2Z8ZA 3ZXIA 3IODA 4DRYA 4PZPA 2FSIA 4DV1B 2DF8A 3FVWA 3QYJA 4KGDA 5A02A 1V2GA 2W2KA 3G2IA 3PX2A 5E6UA 5LZ9A 2WJVA 3GIWA 3JCZA 3ANYB 3K2IA 4YJ2F 1CEYA 1YJCA 1NPTO 4LGYA 2JASA 3IQWA 3DJYA 2J3HA 1SUSA 2CCJA 4RMNA 5KEIA 1TKAA 5KJEA 4C7BA 3FR7A 2HIAA 5HG0A 2GM4A 3PJDA 4UVDA 1Z6QA 4X1OA 4KXWA 3K8QA 4HEQA 2C29D 3EMVA 4U9UA 2XV1A 2KS6A 5CXUA 4DCPA 2AZXA 4EY7A 1F0KA 3U17A 2Z95A 4D42A 4ZAVA 1TA9A 1RC1A 4RTKA 1E63A 2JIQA 3CSSA 1C0LA 3LUHA 3QLTA 5F4ZA 1Z2EA 2H7XA 1QGZA 3DR5A 2PUEA 2BFOA 2VQDA 3DAOA 2Y77A 4CLOB 5K6AA 2IBTA 4HYQA 2QBYB 4ZDWA 3T5TA 3A1PA 1N3IA 3QUQA 3VFDA 3H3JA 1SCIA 2F43B 3T1YB 4DSOA 4EL0A 2FPWA 4OHZA 2JHPA 4JZYA 1I5EA 1SBCA 4GNKA 3DCJA 2ZI3A 4OQFA 4R9NA 2V59A 4F21A 3WGHA 4DNRB 1CUJA 4ZQFA 5LM3A 2OBMA 1Z6TA 3ILYA 1ZM7A 2ZSFA 1WTAA 1D7OA 3RK4A 4BMNA 4DN6A 1NVVQ 3RD5A 1ZJWA 1PQUA 1F2TA 1BRTA 1QO7A 4LDQA 1CQPA 4C1BA 5I7OA 4B3SB 2BGJA 1VQKB 5EP3A 1UKAA 1YL7A 2ZWMA 3BXFA 2JAOA 3FKSD 2ISCA 3LQ2A 4HXGA 3VNSA 5JZ9A 5DBGA 1TTTA 3Q5DA 4ND8B 2WYUA 1HT2E 5E2IA 1RTTA 4KFUA 3FTEA 2QUKA 5AHXA 3KUCA 3UUWA 4BQEA 5M04A 2UUPA 2ENWA 4KRYA 4RU1A 2EFGA 1QWOA 3R3VA 4MVJG 4BKPA 4YR7A 3OZAA 2IIPA 4GYJA 1A7KA 1PWYE 1XWWA 3JY6A 2OC4A 3NBZC 1KTVA 3D3EA 3K72B 2D0DA 4DC9A 3B1YA 1ZGGA 3B8EA 4KQHA 1JP7A 3FJOA 3CUUA 4NICA 4X91A 3FCOA 5C46F 5ALVA 3ESDA 4YT4A 2VLBA 2YIDA 1MB2A 5H4GA 4P9NA 1SO8A 5I3CA 4CEHA 3OPYA 4GLBA 3C7DB 1VPWA 3WFZA 1L7QA 5K0JA 2DPLA 4EKYA 5C7LO 4Z4UA 1CS0B 3JS5A 5TQ2B 4X8OA 1L1QA 1XD9A 3AI1A 1H3FA 1QVZA 3S2ZA 4ZYWA 3VAYA 1NXOA 2NTYC 1X15A 3JZAA 1K8ZB 2XCQA 4OQQA 5CYOA 3X0DA 1ST2A 4JUBA 2D5IA 3N3BC 5F1KA 2XT0A 1JIJA 4Y2UA 3DM9B 1RRKA 2C0PA 2R6DA 1I3NA 1WHSB 2XJ4A 2ZDGA 3L4KA 1KAEA 5KZMB 2SKCA 1ONPA 4HDMB 4MVJF 2FR0A 3IILA 2ZUBA 5KVSA 5GV7A 1ESEA 2RHTA 1PNTA 1BE8A 1IM8A 4KBYA 5DI9A 3LT2A 5JZOA 1M1YA 1ZN2A 2XCUA 3BDVA 3ANXA 5AKGA 3T5GA 4H08A 2O20A 2IYOA 4LQ4A 2VAVA 3ADDA 3ZNQA 4PSDA 3L7KA 3WL6A 3GARA 5KNDA 4J75A 1F2VA 1BXGB 5IXJA 2Y0EA 5K6RA 1TU4A 3HUUA 4BQPA 1KPIA 1UBSB 3ZWVA 1NVFA 1ZNWA 1EM6A 4C4AA 1A9ZA 4J91A 4RHUA 2GLXA 5IN4A 1R9GA 1AGXA 2NUPB 2XGMA 3LBIA 3MJEA 4Y9RA 3D4BA 3QVJA 1MR3F 4RFLA 3LL7A 4KVZA 2VSYA 4A73A 3BGWA 4F72A 4YMHA 3A4VA 2HHHB 5L4NA 1M5TA 4NBLA 3KELA 1YC2A 2RAVA 1I7DA 1YS9A 1MTOA 1U6IA 2WWHA 3DHNA 3IALA 4Y2XA 4A03A 3LK6A 1UWLA 2ZBVA 2BI4A 3S3TA 1NUQA 1YWGO 2IUEA 4COOA 5KWVA 1K86A 3ZBTA 4P08A 2YXPX 3P1JA 4HO1X 1XRNA 3WRWA 1HQCA 1SUFA 1ZSVA 4EX7A 1CQJB 3OZWA 2BEKA 3LW7A 1PKVA 1D7AA 1EYZA 2Y2UA 2QIPA 5KYTA 3BZWA 5AVVA 4NBNA 4U2CA 4ZVMA 4C76A 5DP1A 4DXDA 3CW2A 4U5XA 5KCZA 4PLZA 4XH9B 4J4HA 2EJVA 3KTOA 3HY3A 4OO3A 2ZZGA 3ZGZA 2GEFA 1HDRA 5ICCA 3ORHA 1WV1A 3V4PB 2OORA 4DQDA 3ER9A 4C7OA 2W42A 2VDWB 4YAKA 4RK7A 1CDOA 2HSWA 3HXMA 2Y4NA 4EEKA 1KH3A 4HDSB 2HJGA 3CKMA 3MHPA 1EUDA 2GD1O 2ETXA 2ONYA 2Z30A 3LUCA 4F1JA 4PN3A 3ESYA 4IIJA 1ZVJA 3NIFB 5BYAA 2NTVA 4YRZA 2WKWA 3O2JA 1CX9B 2I03A 1N3YA 4AG3A 4MVYA 4QYMA 4OQNA 3A26A 5JALA 2BM0A 3N9IA 5BRJA 2JG3A 5BV1A 5JRDS 2P41A 4FLEA 1AD2A 3NTLA 4UTOA 5HK8A 1EX1A 1RI3A 2FJPA 5C31A 2IS1A 4YUAA 3GYGA 3FE2A 1A50B 4GBGA 3QHQA 2PMBA 1LLUA 3LYAA 4WQMA 2B34A 2OECA 3QE4A 1DT5A 3I2JA 3R0XA 1R0XA 3LDAA 1FVHA 1AC5A 2HHCA 2OTCA 4QL3A 1IM2A 1GHTA 5EXSA 4LF8B 1LLCA 3MS7A 4NC9A 2XWPA 3N8DA 2F3UA 4XJTA 2XE7A 4WJLA 1B15A 2R8OA 4YV7A 1P1JA 3MJDA 1E99A 1NFFA 1OTHA 2H4XA 4Q4AB 2PVSA 5AMXA 4HNQA 1JV2B 2XSZA 1HG0A 2RGCA 2YZKA 3HCDA 3NM4A 1L5GB 3SFZA 4DR4B 1KEZA 4GS5A 1CB0A 4RVNA 3JV7A 1FUYB 1TIPA 1XDSA 1W85A 4GXNA 5LL6P 3RWBA 5CX1A 4MA0A 3V8NA 4ID3A 3IDSA 4J1SA 3QGMA 1EJ6A 4AUEA 2FZWA 3CR7A 3OX4A 4FX2A 3K9CA 5AOBA 3B6EA 4IVQA 4KNVA 1KR5A 3RRFA 2AG0A 5DS0A 3AL3A 2KBEA 5J1TB 1YKGA 2IQ5A 3CTAA 3Q3JB 3URMA 1J99A 4YRSA 3S1AB 4HWPA 5F73A 1T3TA 2C77A 5JAQA 2O8BA 5LIPA 1MFPA 2R85A 3G1UA 3QVVA 1DB3A 2AJDA 4XQFA 4CQMB 2XKKA 1OR8A 2AF3C 1KDZA 2RJOA 4UKDA 3V4VB 4AKGA 3EIHA 2PMFA 3P97A 1WCIB 4ALJA 4EELA 2QRVB 1QE3A 5TQ2A 2PX6A 2IUFA 3FHOA 1M2JA 1ZXXA 3EGIA 3QXGA 4ZJPA 3CSDA 1HLGA 2IEGA 3HGTA 5E8JA 1E1RA 1KZYC 5LU8A 4NMLA 3TMKA 3R6KA 3ZY6A 3HHEA 2OBTA 1Z5NA 1S96A 2QZPA 1AE1A 1QSGA 2I4TA 3BIWA 4RA9A 4D9FA 3Q6IA 4QA9A 2HA4A 4U2DA 3E7WA 2VOEA 3JQ9A 3PRJA 4X71A 1MC1A 1TYDE 4YRFA 3VH1A 3QTBA 1QQ6A 3O93A 4WJKB 3RNOA 3UMMA 1RC8A 3NHKA 3N0TA 3KZNA 5IKEA 1DEAA 1NA5A 2PT6A 3VXKA 4HCJA 4UUMA 2ODEA 3KHSA 3R7AA 1G8AA 1YR1A 3BGVA 2WF5A 3BMXA 1SB9A 4BMPB 1UXJA 2BFPA 3GH1A 1JF8A 4MVXA 1V6SA 1JEYB 2FX2A 4G89A 1ML4A 3EXFA 4RGVA 1EFRA 4NV3A 4FSDA 4TT8A 4EPWA 2D74A 5CCXA 4MVCA 2B4AA 3LV8A 3MCWA 3MGAA 3JWJA 3CRVA 2H11A 2FSSA 4D46A 2CNKA 4Y6PA 4QDOA 1HGXA 1N33B 1JDSA 2NZ8A 2GPNA 1Y48E 1G3MA 4Q0MA 2G9NA 5JAZA 7MHTA 1XZMA 4FHFA 2WFLB 4MCJA 1PG5A 3BYZA 4UOQA 4XD2A 3N2KB 3QTTA 3OLYA 2HDNB 1C4XA 1A8QA 1Q1GA 2BMWA 2J33A 5K0EA 3RASA 1ID1A 4Q7KA 1P2BA 4MITA 5TC4A 3UJ7A 5WRFA 1XK6A 1V0EA 1E1RD 2XECA 1CERA 1V7PC 3DL0A 4I5EA 4R1NA 2ZM5A 5LNK1 5CBPA 4YAJA 5I9LA 1CRQA 4JP3A 3FOWA 1M2HA 2RIRA 3KETA 5A0TA 4YMTA 2J3EA 3EOAI 3GK3A 4L73A 1G8FA 1CJMA 1M0TA 1Z0UA 3BY1A 1R6VA 2CHGA 1T91A 2QAGC 3FCYA 4YCJA 4F2HA 3N53A 2PH1A 2VPIA 3NX4A 3RTGA 1PFKA 2WMDA 5T8KA 1YSCA 4GL4A 2Q7DA 3USES 5CT8A 4MINA 2Q3JA 2WMYA 3KT0A 2HW8A 1U8TA 3DQPA 1R9MA 3LBHA 3WJ2A 2FR1A 2AVDA 1GPJA 1I2BA 1P2DA 1DQRA 1WE2A 2QENA 2WP0A 3PVCA 4IKEA 4REOA 1IN6A 5AWFC 3AUUA 3WLEA 1U1DA 1IZYA 1EFRD 1PJ4A 2W48A 1U6KA 1K68A 2V8BA 2VZ0A 5SV2A 3NHWA 1BHQ1 3AHJA 4LJAA 1V1RB 3U5ZB 5DV9A 5HK9A 3N2ZB 3I37X 4B44A 1F6BA 3L07A 4BV8A 5CURA 2OZLB 3BQMB 3FLBA 4MP6A 4TM7A 2ZUEA 4ZGWA 4JR2A 4QQ8A 2JJMA 3DCIA 3CC8A 3OLZA 2JLVA 4QFMA 2PRZA 4NYIQ 3OM9A 1L4YA 3SKBA 4EGAA 5TPWA 3NTXA 2M9MA 1T1SA 4ZP1A 4Q4LA 3I72A 4D57A 4C2UA 3QF4A 3BL5A 3F6YA 1IZ7A 4BHTA 3K0CC 2JI7A 3CLUD 1UC4B 3MUOA 2HNAA 4S1PA 1UC5B 5FWDA 3SSOA 2QL9A 1WCWA 5GJVC 5LQJA 2ARKA 3ABZA 5I5EA 4CG0A 2CFOA 2W6QA 3NOQA 5AVSA 2WAOA 2H1LA 4D2IA 3TNDA 4DJTA 3PI6A 5MFZA 1FU4A 2X9LA 1RI1A 1LI4A 3OIGA 4BFZA 4K81B 1NKSA 3E2MA 3GDOA 1BVUA 2QW8A 2ZRDA 1ZA1A 2FSVC 3C16C 2UVPA 4KO8A 5KYVA 3TK1A 3CT6A 3VKGA 1C3OA 2B4KA 2VQSA 3HO8A 4MMZB 5DZSA 2JVKA 2X2FA 3NHBA 1S3SA 1C4OA 4JR1A 2OXTA 2A92A 2ISSD 2C54A 1TM5E 4IDCA 3WTBA 1B16A 4PYIA 1FXWF 3OKFA 3OQ1A 4DEVA 3UQZA 1RXSA 3SFVA 3E9CA 2EZTA 1JDZA 1XRRA 2P9GA 5IJAA 2YMMA 3JVDA 2X14A 1WMEA 4DNTB 3M6XA 3U48A 3GFRA 1VA5A 1WPCA 5LBIA 1BMDA 4OUKX 1AGRA 4MW1A 2BFMA 2VJCA 2Q46A 4WJZA 3QUTA 4DWOA 3IQHX 1UPUA 4L28A 4B3JA 3EQ7A 1VLJA 1HTBA 3VZSA 3C3KA 3L8ZA 1PR4A 2V7WA 1GTMA 3AQ4A 2LD4A 3WC4A 2O1SA 4RY2A 2NVBA 1V5GA 2P91A 1NMQA 1KOJA 2R86A 4L0MA 4P3XA 5ALLA 4ZVVA 2OG2A 3GMDA 5B2ZA 1E69A 2X3FA 3RJZA 4EMSA 1I7QB 3G8DA 4CL3A 4EJSC 5BP7A 1DUVG 2BM9A 2GAFA 1UR5A 2CDNA 3DHEA 4N12A 3C3CA 1CP2A 3IJ5A 3DEKA 3WGJA 5JDCC 4ETWA 2CN1A 2IYWA 3EXEA 4LFCB 2Z5LA 3K20A 2EG5A 1MJFA 4FC6A 5JWHA 1Z7EA 4LRTB 2D1TA 1XLUA 2JLUA 1WBJB 3PQFA 3NATA 2IYPA 5IBQA 2H18A 4M0MA 4WLNA 4CGYA 3GT4A 3DBRA 5FUXA 2PWBA 3ROKA 4AYWA 1XL1A 4O02B 3HKDB 3KQVA 3S68A 4RJLA 5JAUA 5EMNA 1ZZGA 3LWDA 3EBPA 2Q3HA 3TLXA 4DJJA 1Z4OA 2PLNA 3JD3A 4C0XA 2PL1A 3U60B 1N08A 4P80A 1CF4A 2IEZA 2V5VA 2JHCA 4HIZA 2QD3A 1FLVA 2DECA 2RGEA 1UH5A 4M88A 4R5HA 3OETA 4A2WA 5C7YA 4OY3A 4Q47A 3KEWA 1DE0A 4AZ0B 5EJ9A 4XMYA 4U0JA 5ALDA 3D3QA 4J7AA 3OF3A 1Q19A 4GBMA 1NVGA 1M1YE 3H7IA 3DXYA 8OHMA 3U3JA 1PQ4A 5CDSA 4BZWA 2QE7A 2ZRAA 4X1KA 5KW9A 2XYPA 1A9XB 2RBKA 4GZ5A 5CEEA 5JH7B 3JRWA 1CNEA 1JJVA 1RP7A 3KJEA 1H42A 2Q2VA 3A7DA 4JHLA 4JHXA 5T3YA 4YVFA 2ODWA 5D3MB 4JLWA 3GZ4A 5J4KA 1W5FA 4Q1CA 4TKLA 4EB0A 3N8NA 4JR0A 4V03A 3SGLA 1RZVA 3RUHA 1T2EA 4ZGGA 2QVGA 3KYBA 3GGOA 3BC1A 1HSZA 3VC2A 1Z45A 1CBUA 2P78A 1HETA 1U9IA 3NHMA 4A0GA 3CUEF 2CFTA 4N0EA 1UIMA 2QMQA 4JLDA 5KIAA 3DW3X 1T9GS 2Q6TA 5DTMA 3AVYA 3BMCA 3COYA 2QUBA 3ZV5A 2O14A 5F4MA 1YACA 3RF6A 5H1YA 3A31A 3DZIA 2G28A 4FYWA 1DEKA 2FFJA 3LNNA 5IPFA 3RLIA 2B21A 1K5GA 4C2TA 5JNSA 3PP8A 2JGLA 1QQ7A 2DP4E 3O1IC 1FNMA 4IQFA 1AXEA 1E6WA 4BNHA 2J6CA 3QLJA 4O2BA 3O0TA 3ORFA 3VYVA 3G0CA 1KK3A 1N75A 4DQXA 4L5JA 4MEAA 3ZXUB 3OWHA 1MQAA 5ADUS 1VYHA 4NYJQ 1L4GA 2WJIA 4KO2S 3NTQA 2VSXA 3R40A 1VJ0A 4U02A 4PRKA 4LZLA 4YP7A 2WD7B 5HE9A 5BQFA 4J1TC 2CXHA 5JROA 4DUGA 1ZJYA 1CQIA 4NENB 1R4MA 4GP9A 1Q82D 1F20A 1QZUA 3K4QA 4GG1A 3MS4A 4P0PB 1TE2A 4UULA 1T8RA 2D8MA 4G4IA 4JBXA 4ROXA 5ES3A 2VATA 1JHQA 3GUCA 1GNVA 1H22A 2FVYA 3EGWA 1H85A 1EB8A 4QJIA 1RYDA 2FN4A 2PWZA 1KDOA 2Z4SA 4HWTA 2QI9F 5EL0A 1TK3A 4BO7A 2ES4A 2AE2A 2Q5FA 2VVTA 1B0AA 4L85A 4CMIA 5J2TA 1ZI6A 1OD6A 1L5OA 1RYYA 1UMDA 4IDBA 1HE5A 3U7JA 4JASB 4WEOA 4ZANA 2B6NA 4ER0A 2BYTA 1MHPA 3JZMA 1DOAA 5TIIA 4IUYA 1U8UA 3TSYA 1P31A 3SICE 3GDHA 3IQFA 3GDWA 4GSKA 4UW9A 3W5JA 1DS6A 4QYXA 2BM8A 1E8DA 2YS6A 4CN8A 4EQZA 3IXMA 3AX6A 4LDRA 1AGNA 3H4TA 4MKZA 4PSUA 3T1NA 4EW3A 3B9RA 1TJPB 2C5SA 2J9GA 3F74A 2QKYA 4C7JA 2YIVX 4KQWA 3VMMA 3A6KA 2RE8A 2CV0A 3K09A 4OP3A 4LJRA 4OHYA 1WV0A 1PDWA 1R74A 3K0AB 2VUIB 2QDKA 2CDCA 2ZRNA 2I29A 1AGYA 2DFKB 1NHWA 3TSAA 2QM8A 5A5EA 3R6TA 2DY1A 4GOLD 1KR2A 2IEAA 1RKXA 4F4JA 4YP1A 4F60A 1KGSA 3I4FA 1A8SA 3HS3A 5DLEA 5AVJA 1UBFA 1CEXA 2M32A 4REQB 4XJSA 3WE7A 5IBRA 3MC1A 2X6YA 1OFIA 4RX1A 4RD3A 3EF3A 3UUFA 4RCZA 4YJDA 3ZZ0A 2FF5A 4HTAA 1E9SA 1GSIA 5K3BA 3GPIA 4JEMA 1L4UA 5AJUA 4C0AC 5KKCA 1DWUA 2WHXA 2EZ8A 1E9VA 5IDYA 5JY1A 3H86A 3I09A 3RSSA 2DB3A 1E9FA 2BVNA 2B30A 2DHCA 1NQXA 3IHLA 4KWEA 5CLFA 5C8XA 2WZPP 1DBQA 2ABWA 3IPCA 3NRBA 3QZUA 5BSMA 3ZWXA 4DJEC 4K9QA 5BWLA 1RRCA 1E3XA 3LUDA 4MLPA 4X60A 4QV2A 1HZJA 4FVTA 2QTAA 1ZZEA 4ZXPA 1JFSA 2XOXA 3RKSA 3C8UA 2VRCA 3T12A 1VRVA 4MRSA 2VQFB 2AZ4A 4G86A 2OB2A 1EWTA 2OAP1 3ZVRA 1PGNA 2VH2A 4KIJA 4Z2YA 2WFAA 3GCXA 4WLUA 4F8YA 2XQIA 4JMPA 1SULA 2GZ2A 5F7JA 1J90A 3L0OA 4O0MA 1G3RA 3H9NA 1RPAA 1PJ7A 2ONJA 2PSDA 5JECA 1XZHA 3GEGA 1GFZA 2SKDA 1FDOA 4ACAA 2FW0A 3P2KA 4B6JA 1D1SA 3CLTD 4QEDA 1XI2A 4ZZ2A 4A5OA 4W99A 2HK7A 3QKRB 3VU0A 1Q0RA 3VOAA 3AU9A 2XWJI 2JBAA 3B89A 3B3JA 3NBAA 1NVTA 1PZMA 4P4SA 3T54A 2PGAA 3RLFA 3ZPXA 3OE5A 2YRXA 1FFCA 4JDUA 4E5VA 5AKXA 3CPHA 3RIYA 3B6ZA 4P7BA 3ZU6A 2CJWB 3LU1A 3HPQA 4BZPA 3ELBA 1CU1A 4G5FA 5CDFA 2VH5R 4RQUA 3FRJA 3X2EA 4WADA 3X3HA 3G5LA 5G3YA 3DE0X 3KZOA 4AB1A 1UK9A 4FIZA 1VRWA 1I7SB 5JASA 5J2UB 3ANTA 3VSBA 3TSWA 1VI5A 4NOJA 2VRCD 4EAAA 2UXCB 1JWAB 2O3UA 2BHSA 1QC5A 5DLYA 2WOOA 4ZDJA 5KNCH 4YRQA 1NVWQ 4MS1B 4PZDA 4K46A 1CNFA 4HRVA 2X1LA 3GNSA 3K4HA 2Z09A 4OB6A 4LECA 4TVBA 1OGIA 5G4LA 4S12A 2BHRA 1FLDA 2C04A 2QZ9A 1JMVA 2I1VB 4HVCA 4M9CA 1G21B 4ZJYA 1EK0A 2A67A 4KIGA 4UUOA 2VCHA 4P31A 1UJNA 3INTA 4N49A 4OOFA 3T52A 4HT3B 4CL2A 3WQRA 3W78A 4ZYTA 5I9SA 4FEEA 4JBNA 1P7WA 1SBZA 2NVUA 2VA8A 1DBVO 5EYPB 4S04A 3I01M 4JJEA 1DARA 4OAOA 4PO8A 3B2EA 1YS6A 2RK6A 3JTMA 1FW6A 2GESA 5FPTA 1JECA 4JCCA 4RMJA 1XZGA 2I76A 5FTKA 1N3BA 1K3UB 4U7GA 4WCDA 5B7PA 1PLJA 3OHSX 3TL6A 3UV3A 5CYPA 4FDUA 4PU0A 1Z08A 4RIHA 2FN9A 3GOHA 3R6LA 4XOTA 2GCEA 2IHBA 2ZRKA 1KO8A 1Z4KA 2JCSA 4HGPA 2P30A 3UA4A 2I7DA 4C7KA 4K40A 2XMZA 3PUZA 4P4GA 4BNXA 4MRPA 3HV2A 4WGGA 4MKGA 4DLSA 4JNCA 1B93A 4GP6A 2FSUA 3KEGA 1YTLA 2I3BA 1QZ3A 4CMJA 1VL8A 2GKSA 4DEXA 4KACA 3OWXA 3COWA 4N65A 4R71A 1B3RA 3SR0A 3ZOKA 2JGNA 5HPYB 3ZGVA 4LE2A 3UYLA 2QB5A 3ISTA 3WO0A 4RFVA 1Q7BA 2LE0A 2ON6A 4FZRA 3I56B 3M6LA 3GDFA 1H1LB 1LSOA 4K1XA 2AJBA 2WP8J 5EKTA 5FOQA 3QMVA 3IPLA 1TUBA 3DOCA 1NBME 1Z35A 3ELWA 3MTGA 1KYTA 1U0JA 4QUJA 4ARVA 4EFKA 1GGNA 1U0FA 1DBSA 3O8QB 1WXIA 4BQOA 1MNAA 4LX0A 4RENA 2H08A 3QSGA 1HO3A 4Z1OA 3GEBA 1CETA 4MP3A 2CL6X 4CIDA 3KEFA 3KLOA 1U6JA 4MNTA 2Y1OA 2QRJA 4WA7A 2A4MA 2EKZA 1SBNE 2ANBA 3KPYA 4OEHA 3COSA 1IUPA 3A9WA 4R84A 4CIWA 2PGJA 2CKMA 4G1MB 3P4XA 4L6IA 3JQAA 3RODA 2GGSA 4K0RA 2MYTA 4AJ1A 3HMQA 2NXWA 5HMMA 3S28A 1R5BA 1WTCA 2FZLA 2HXGA 5E4YA 4V39A 4H7IA 3SEQA 4FFNA 4BNTA 3KQNA 4HX2A 5EEHA 5IK2A 2R44A 3EQ2A 4PHHA 4F9FA 4MV0A 2DUWA 3COZA 3LPNA 1W30A 3RTEA 4KREA 3AEQA 1OB0A 3WFJA 1PG0A 1JDVA 1KYQA 1UPXA 2CY0A 3FIJA 4Q7EA 4BFVA 4ZKDA 1U5BA 3FCSB 3LBNA 3M1IA 3MIZA 2PXCA 4ZQHA 4BKOA 4A4DA 1CJTC 1B74A 1JJIA 2J5XA 3T06B 5KSPA 4FFOA 1L4BA 1QV9A 5FULA 2HC9A 5AXBA 3DTVD 5FFNA 5KJ1A 2JIMA 3IAM6 2BUCA 1XHFA 3OTIA 2PLFA 1LU9A 3U3MA 3FWKA 2HWXA 4EPRA 4F11A 4FR0A 5CFMA 4IDFA 5ECDA 4QSHA 3MT7A 4PZ9A 3TKAA 2R5FA 3B9BA 1N0IA 1L5LA 2OWDA 3LQ6A 4OAQA 1IOLA 3BPSA 2R87A 4AFNA 5HJ7A 1NW7A 2B8WA 2QMUA 3TKLA 2XMSA 3GGGA 3OIFA 3I8OA 3IYLW 2DJ5A 4UXJA 3ANMA 1XKXA 3ZIDA 1JG6A 3WWOA 2FDRA 2PM8A 4K6GA 2GXUA 3AM1A 1I2CA 2C1ZA 2JHAA 1Q0UA 2YIMA 1XVIA 3UXMA 2X13A 3WL3A 1ZP6A 4BFLA 3GJTA 3CCBA 4I5IA 4LHYA 2AYYA 5C1BA 2AZDA 1DX9A 1UFRA 3ZVLA 4BC0A 1QQAA 4OREX 3IR6A 2QEXB 4XJXA 3N7TA 4P1VA 1C81A 4U00A 5DXJA 3K0BA 2J5RA 3PTAA 2D1YA 5DGHA 3GLKA 4XUGB 5LQNA 1L3BA 1KK2A 2DHQA 5A8AA 2JIBA 3HP1A 1YR3A 3QA3E 3KWMA 3AB8A 4J0KA 4K9SA 3S0JA 4OLJA 5C81A 4EHKA 3THXB 3OPQA 1NBAA 2IE0A 2UXBB 4Q3KA 1MX1A 1H9AA 4G5SA 1YIAA 3UWPA 3LBYA 3OO1A 2NACA 3D6FA 4LMAA 2GKGA 2WR8A 2IHKA 4DDMA 1FJXA 1PL6A 5GADl 4UHEA 4A36A 3OO0A 4G26A 1E7YA 2MJLA 4NHOA 4KIWA 4UNQA 3BHIA 3BSSA 2IX9A 3BD6A 2EW1A 4LHWA 1ILWA 3AF0A 3A1SA 5CFPA 4UDYX 1ZVQA 5CMLA 4CEIA 3O74A 3LYLA 3NRCA 3WLHA 2BKLA 1J0DA 2J41A 2ORYA 1M9NA 1LVUA 3A1WA 3E8SA 1C8VB 4MW6A 4QSMA 4N9QA 3VU1A 4CNQA 2BLLA 2PUAA 5DI3A 2YBDA 1UKEA 4DDHA 2C4VA 4LQCA 4M8IA 1Y4DE 1IEWA 3RKUA 4DMKA 3BMNB 4A8TA 4HQNA 1V3QE 3CNNA 5IASA 2OBRA 3R7NA 2DLNA 2PHZA 3BWDD 3R5FA 4ZVTA 2REBA 4YJ3A 4WOKA 5LPNA 3A06A 3FMGA 3TOXA 3WOHA 2V7VA 3CPWB 1PS9A 1I2MA 1UDRA 1YJXA 1VBKA 2FN3A 3JQDA 3K71B 1P4JA 4CTMA 4AI6A 4B6OA 3OZVA 1P7ZA 1I6WA 1OI7A 3GLIA 1WQ1R 3X1ZA 3K96A 2GOYA 4HAWA 2PK3A 4I36A 4CE6A 2GJ9A 2H2WA 3DZCA 4CLEA 4JU8A 3QKUA 3V8QA 2A1IA 3M0EA 2GAAA 4WLVA 2OXCA 2GX6A 1M0SA 2V31A 3CX7A 4R6XA 3PR3A 3LRTA 1F2UB 3M1YA 1DUIA 1KJNA 4HFMA 4Y6OA 1QRAA 1YS1X 4QOGA 5H70A 4EI7A 1IXRC 3P27A 3LSYA 1RWNA 3IQXA 1QF7A 2JLRA 3AU8A 3P52A 3LRPA 3PQ4A 3I9V6 3COJA 4KUEA 1YVUA 4KAAA 4I1YA 1E64A 1G6KA 1OFTA 4UQLA 1Q44A 3KJQA 1A2KC 1C7ZA 1PLKA 4MPRA 5AI8A 3V34A 4DSAA 5FL7A 1UXGA 4FI3F 1IMOA 3F9CA 4RSHA 1THZA 4YMIA 5IEBA 1M73E 1NJFA 1PX0A 2H1IA 2XQJA 3A4NA 4Y0VA 5AHRA 4LY0A 1G20A 2ERXA 1JUDA 3U3DA 5FLKA 2RHGB 5AW7A 5J2UF 3ENQA 4PZCA 4YRLA 4E22A 1SVNA 4DJAA 3CCMB 3OECA 3ZG6A 2BI7A 3GJ7A 3HA7A 1L5SA 1V96A 2CK3A 1BGXT 4AY4A 4BU0A 2QX8A 3CRQA 3E3LA 1UMCA 5GVRA 1Q0ZA 2NM0A 3C5VA 3ICVA 1AKEA 1SVKA 4IYRA 5EXTA 5I47A 1EQUA 1USIA 4JAVC 2A0FA 1AIPA 2Y0BA 3T7CA 2FPPA 2W2MA 1TB4A 2XUDA 4FWIB 3NE5B 2CB0A 1HQDA 4Q3OA 1J8FA 1YRLA 2FY8A 2X23A 4MRAA 1G5HA 2XYHA 3U56A 2WUEA 3PUNA 1YQ9A 2C3YA 2Q9CA 2GZ3A 2QZ4A 2WF8A 3SIXA 2H31A 1W1WA 3W8EA 1VSBA 4C6RA 3HWWA 4FYYA 4MUFA 5DM4A 2BBOA 3LWZA 3CMAB 3CLKA 2WU4A 3MFYA 5DCWA 3W4IA 2QSUA 4MHOA 4U2BA 3HCCA 4AUKA 3BTOA 3LO5A 1RJ9A 3E6AA 2AF4C 3UJDA 4OB7A 4I9UA 4DQ0A 1XD2B 3JYHA 5BVHA 4V0LA 1KI6B 4QARA 5B1EA 3T7IA 3S8MA 3GJQA 4X7BA 2ZL5A 3HWRA 4BFSA 4GMHA 2C97A 3ZZNA 3CCEB 3ITDA 4P34A 1A9PA 1CPYA 2YC2C 3OZEA 3RSLA 3U0VA 5C1OA 1KNQA 2JATA 5AM4A 4M0LA 1ZA2A 3ESRA 4BNNA 5IYNA 2KYRA 2J4DA 3WHPA 2WFMA 1ZINA 4BTLA 2ECOA 4WCFA 4X41A 2WUFA 5JZSA 2XA1A 4MV8A 2VNJA 5IT9A 3TDNA 2QRZA 4MTLA 1Z4PX 2LCFA 1VKHA 3PE3A 4TV8A 2PH3A 1CVLA 3FPEA 4K88A 1KRXA 1GZUA 5KYYB 3DMFA 1D4AA 2R48A 1J0EA 4WKCA 1T5OA 1IJEA 3P9RA 1FVFA 3CR8A 3NYRA 1AKYA 1VG8A 1CDEA 1FNBA 1MB9A 2XMBA 4AX4A 4NCKA 2PS1A 4BDTA 3MS2A 1OLOA 4LPKA 2FOLA 5BMOA 3QLVA 4KO4S 4MUKA 3VPDA 2RG7A 3M5DA 5SYNA 5AM5A 3WK5A 2X0JA 2EOAA 4CDMA 2R9VA 3ETJA 1XA3A 1SUEA 1R12A 3MWDB 1REQB 4UEOA 4RK4A 4YO7A 5JAIA 3N7AA 4KXXA 1ZM2A 3LKBA 4X5OA 1BYIA 1QQ5A 3ZYZA 5HQ3B 4X06A 4URZR 3THOA 3OH8A 1G8YA 4CODB 5CLJA 1L3CA 4P7GA 5CDFE 5K0TA 4HB2A 3QMMA 4BB5A 4OHVA 2IEDA 2QT9A 3MUEA 1MX5A 5ESXA 5B58T 1LDEA 2VP5A 3BSWA 1TNDA 1WP9A 5BT9A 2ZQ5A 4DG5A 2GBPA 4NLLA 4OXXA 4FBMA 1W2BB 1PFVA 2WZDA 3GRYA 2BAGA 4RGBA 4OPVA 5CDYA 2WM9B 2R60A 2ECFA 3ITEA 1VBNA 3H83A 3ZU4A 2ZE7A 1X7WB 5AK4A 4A92A 4AIIA 1T6NA 3DPSA 4IH4A 4L95C 5HOEA 3D6TB 4QVGA 2NUBA 1AVTA 1RW4A 4PZ0A 2CLSA 4G2NA 4TTTS 4CF5A 5ITSA 4PQYA 5J9FA 1SVMA 5L51A 5FL3A 3PGKA 3TRIA 1WJGA 4L8YA 3WNZA 3EVZA 5A3SA 3OOHA 1L7OA 4LF6B 4KPUA 1G17A 5DM60 4EFDA 3KSBC 1D6JA 2ZW9A 3IB3A 2XZPA 3N3AC 3SEZA 3TDKA 4XSVA 4D41A 3LDGA 3CNHA 1EHIA 2DQSA 2R1TA 5ILOA 3JAKA 1YAJA 3ZE9A 1V6AA 4X97A 1NVDA 2H2GA 2QTNA 1NW6A 1VMKA 4CCYA 1KFJB 5KTPA 3WXMA 4X3OA 3ZJYA 3ABSB 5ALOA 4HWRA 2JEYA 3DMPA 1XMOB 2FLWA 1KZ4A 1QH8B 3NIDB 3PHGA 3T7AA 2H8KA 3TH5A 2NXNA 1Q0HA 1HKHA 3GBPA 2ZXEA 3JQ7A 4INOA 4WZAB 3WK4A 4XYGA 1PAUA 1KGDA 1BE6A 1JT2A 4YAFA 1FK8A 1QHIA 1U2DC 1YB1A 1YJ9B 4FGWA 1YI0A 4IEIA 1JALA 2JVJA 2M98A 4J1QA 4OGWA 4ERNA 2VJLA 3Q3GE 2BTQB 4B74A 2OTLB 3P8ZA 1X6VA 1NZJA 4UU1A 4YDQA 4L7VA 1XL0A 2VEDA 2DETA 2DM6A 3D2BA 3H2JA 8MHTA 1YULA 1OYOA 2Y76A 1MOPA 1MT0A 1QF9A 3EASA 1VL1A 3T1VA 3QIVA 1LK5A 2VTEA 3CB4A 3O8NA 5FBQB 3A32A 4RZHA 1G4UR 4HMPA 1QU3A 2BN4A 3U1TA 3CIOA 4JVSB 3V7WA 3DD1A 4EWLA 2W00A 5ABPA 2N75A 2EZ4A 2JAHA 1ZM9A 5A6SB 1K7CA 2DUUA 1W34A 4D3ZA 1WOSA 4D9JA 3EXAA 3ZWAA 1GR0A 1IY1A 1MB3A 3JXEA 3ZVNA 2AXQA 3OCZA 4BP3A 3AV0B 1PBTA 3HADA 4ENQA 4DR2B 4YX9A 2GEKA 1G64A 5JTTA 4PXAA 3PX3A 3SMVA 3ANSA 1E1NA 3EOBI 5SZIA 1J42A 2LDBA 2O50A 3H1BA 3PA8A 3KFXA 1GUYA 4QNMA 3SIRA 2F64A 2C4WA 3QYAA 3E7DA 3GV0A 1IHMA 3EDYA 4FZ5A 4DABA 4C21A 1OZHA 3FYDA 4KH0A 4KK3A 1GAEO 4UM8B 3U9LA 2ZE8A 1XYVA 1DFGA 5GONB 3W6PA 3SEFA 3OQJA 1RYMA 4F4IA 3OP1A 4AU1A 3GA0A 2XT6A 2ZRIA 4WOBA 3BXPA 4AJ4A 2H2FA 1E5TA 4F1KA 1ZLYA 3FUVA 3SS9X 1MORA 1XNGA 2PKWA 5FLXA 3OPMA 1KE2A 2GSDA 1IUKA 1G3QA 4KQEA 2OMEA 4V0OA 3TR0A 2JDID 1TF2A 3B52X 1O95D 1SR8A 1YL5A 5J3OA 3JR3A 2V4DA 1FY2A 4OSPA 4D8YA 4PQFA 5LD2B 2CLLB 4ENSA 1MC5A 4TZ0A 2DCUA 4Z4TA 4KH1A 4X8HA 4KN5A 5GQSA 4DYDA 3KDSE 1D6SA 5EJAA 4YMLA 3LXMA 3G2JA 1I80A 1N1MA 2KVOA 2BH9A 3M4JA 3FW1A 3U80A 2VP0A 3DOIA 1JTFA 4P84A 1CJVC 1L5ZA 1PV2A 3PC8C 1U11A 3ZW7A 4L1KA 4AC9A 3IQGX 3NM5A 3C3PA 1O97C 4QJ3A 1E2NA 4L4UA 5KOJB 4Q4HB 1NI4A 3IBFA 4BFYA 3TUZC 1JEJA 1R8JA 1P74A 2YZGA 3AF4A 5B3KA 1PEYA 1X9IA 2JGKA 2V6JA 3D6MA 4JEUA 5ALHA 4PO3X 5ENZA 1ZOPA 2YHIB 3H19A 4MQUA 4Z4QA 4ZQCB 4EG7A 5JW6A 3OQOA 1NQTA 5IZCA 4QRHA 4ZVPA 1KQOA 1RXIA 2QUIA 3F71A 2C7BA 4HQKA 1CUCA 1LSSA 5JSUA 3B12A 3ADBA 2R00A 2PU5A 1ONOA 5KSWB 4MQMA 4Q24A 1Z34A 1WBDA 2DYIA 3IESA 3VHRA 2A5FA 4OCZA 2XXAA 3G4SB 2HCBA 3I92A 1I9CA 3CFYA 2HMWA 3SDZA 4IGKA 5L3QB 2VHTA 2XOEA 1XD8A 3FMVA 4AZTA 2WZNA 3GI1A 3U6KA 1FFAA 3IP9A 4F86A 1Z39A 4FI3C 4Q9KA 2ZKLA 3F6SA 4FE7A 1C2YA 4IFTA 1M0WA 2H29A 1SVUA 1CC1S 1QTRA 3CPSA 4XQEA 1NR5A 3FSGD 1EA7A 4RFSB 4KI0A 4PNPA 3MRSA 2XGGA 3HG7A 2E9SA 5A2QA 4RVSA 5DT9A 3TAUA 1ACMA 4BYMA 4GDMA 4Z9YA 1T3GA 1NY6A 1TCAA 1WO8A 1MA3A 2XKJE 3ESQA 3H8JA 3HB9A 2VNAA 3QKIA 5B6IA 3W4KA 1JLHA 1GSHA 3KUUA 2QSZA 1SBIA 1DP4A 2LKCA 1GFWA 1ZMOA 2C5EA 4B3CA 4DKXA 4EKNB 5LYJB 4R2LA 4ESVA 2YJ4A 3C3MA 3LOPA 4NEGA 4LJKA 3EGXB 4OHMA 1ZITA 2BUBA 5CT4A 3EZ9A 1ZD4A 3G7NA 3L5KA 4DNFA 1EP2B 1QFJA 3HZOA 3DDWA 3ZS8A 1KYIA 3DBLA 1N32B 4H0CA 3ZNOA 4KKTA 3ZUPA 5K9ZA 4W5NA 3Q7RA 4D9IA 4OPOA 4FYJA 2ZJ8A 5ALQA 1G5IA 5AJXA 1GL9B 2W2PA 1SFRA 2X5NA 1KWGA 1P0QA 3T7JA 3L8CA 2B5VA 2QLFA 3MT0A 5HYVA 1TUIA 3L4BC 1K9MD 4L2IB 5D6OA 3AF2A 1J6UA 2IV3A 1FEZA 1XQVA 4JQCA 1H4SA 1BCRB 2P2NA 3OZFA 3O4IA 4MAFA 1O9HA 3E1KA 4FLFA 1OB5A 2UYQA 1P5RA 1T8TA 3TD9A 2ACVA 2RJ3A 3MW8A 5JATA 2J8ZA 1KS9A 3NEYA 4EPTA 4TUYA 2Y6VA 2CFRA 4CM5A 8ADHA 3B8HA 4OL0A 2ZRQA 3C45A 3CR3C 5HCNA 4E7OA 1NNLA 2ZYHA 4ZRDA 1Z3IX 2FHSA 3CRMA 3A3OA 3HA2A 3I83A 3QG1A 3NDBB 2HD4A 1CUEA 4ATNA 4C4ZA 4HLUA 3MUFA 4HUTA 2H48A 2Q3BA 3ZTTA 1N0VC 1G20E 1UWVA 3BGSA 5FEUA 1CRZA 3VV2A 5JHGB 4P3PA 2J9RA 1GARA 2Z8YM 3PICA 1BU5A 4GNRA 5C8YB 1CY7A 1R50A 4RF2A 3Q3EA 5HFAA 2HB6A 4NZOA 4BKRA 1NPDA 4DMMA 1KIFA 2GARA 3REQA 5F7XA 2ASEA 3PWTA 3NBMA 3MPOA 5KTSA 1T5SA 1EBFA 4GLLA 5BW6B 3G2QA 4XQGA 4FNMA 5DRYA 2W98A 1BW9A 2R8ZA 2OCLA 3FUXA 4FZVA 4QFBA 5CFOA 5FUVA 2VDUE 1TKRA 3UVEA 3BK1A 1IAVA 4R2XA 4TRJA 3HBFA 4BMVA 4PLFA 1HXHA 2W93A 2B69A 4HXEB 1E58A 5HTKA 1JA0A 3NOVA 4R8SA 3PNPA 2JAUA 2WIKA 2J07A 2YV2A 3T9EA 4RV5A 4JIGA 5AD1A 1XMVA 5J3JA 1NVVR 1Y81A 1V3VA 1KFEB 4F6LA 4HKTA 3TJRA 1GG8A 3PI7A 2R68A 1NXTA 1M7BA 3DZ8A 3KUXA 1Z4LA 4X8LA 3PQ2A 2OCIA 3RRYA 2AL7A 4UQPA 2ZDQA 1WORA 3FD8A 3W9SA 4BX8A 3LDFA 4JVMA 1U3FA 1VHQA 4W1SA 3A3BA 2YZ2A 4ZO8A 3FYHA 3GGJA 2QA5A 5CK4A 1XMXA 5F2NA 1GA4A 1RQNA 4GI2A 2P8SA 1U8FO 2JLBA 2VC2B 4HAVA 1JGTA 1GYQA 4R16A 2J6HA 1ZK0A 5IYZA 4HH4A 2HXYA 4R0MA 2IL1A 5E38A 3UC9A 3RSHA 3R7BA 5G4KB 1VMDA 3TSZA 3W8DA 3HJHA 2YQZA 5DJ5A 1DKRA 1RWVA 1QS0B 2VQ6A 4CQNA 5FTMA 1P0IA 2P6PA 1FP4B 5AIAA 1P9WA 3ZQKA 3L7DA 2FPSA 3PHBE 1S8OA 3N6RA 4NH4A 4F91B 1DQZA 2QJRA 3D3WA 3TW8B 4JQSA 1JFRA 3DPUA 3OQPA 4RIIA 1WEKA 4C5BA 4C7VA 1WTHD 4HXYA 1HY3A 4BFWA 5B2FA 2WIAA 3UO8B 4EG3A 2ETVA 4G5HA 4UVGA 1JG7A 1XKLA 1ECFA 2ZYVX 1GGJA 2AOUA 3ZLVA 1T1JA 1F38A 3S1SA 1JKMA 3WZLA 2CKDA 4L0CA 4CKCA 1ISJA 3JQPA 1S2NA 1VBFA 2O48X 2ZCUA 5DE3A 3SC6A 1G6HA 1XRLA 4RO0A 1O1YA 3ED1A 3DVRX 4X54A 1Z5ZA 5HQJA 2B7BA 5LYYA 4IQ0A 3TR6A 4ENVA 1X2BA 3B3AA 4PTZA 3AG6A 3W1EA 5HVNA 1L1FA 2E4ZA 1M5RA 1DEOA 2X1VA 4JWTA 1JHXA 3IPXA 1M10A 1IDOA 4NDAA 3R0VA 1LBTA 2WHEA 4NATA 3GG2A 2YYSA 3IEVA 2HGZA 3Q40A 4FZ3A 4GZLA 3H17A 4DMLA 4HMOA 2XB2A 1TMOA 1C7IA 1EZZA 2JFPA 3MD0A 4Z7QB 2OKGA 3ABRB 4W8GA 4X6UA 2WAYA 3TQIA 2CLHB 1E1CA 1RXUA 1KFBB 4G0YA 4PYLA 1E2UA 4X84A 2ZULA 4XW2A 2CNNA 5GONF 1L7XA 3ZI7A 3GLFB 2OXIA 2BI8A 3CKKA 3H9GA 4MARA 1SZCA 4MPPA 4Z8YA 5E6SB 3RS3A 4ZMSA 3UM9A 4P36A 1U0SY 5KNBH 1E7RA 3I64A 1MLDA 1GG2A 3MSCA 2VTBA 3CT4A 3HKBB 3NDRA 4PGFA 3GC6A 1AKRA 4G56A 4KR9A 2C2MA 1JDJA 2UVDA 5I9IA 4NOLA 2FSFA 4O4LB 4A1OA 1EVYA 1YCFA 1EWVA 1UXOA 2H06A 4LOKA 1DHTA 4P35A 4QDXA 3OKPA 4LXYA 1QHXA 1I2AA 4PBSA 2PZFA 4QUHA 3F2IA 3UMYA 1ICEA 2GK4A 4UFNA 3D1JA 3DLAA 4LCBA 1PKXA 2EP7A 1PDOA 3O9VA 1J33A 3PDCA 2VYVA 3MQ4A 3R9XA 1DQSA 1F3LA 1R0ZA 2H2HA 1SMKA 2COEA 3BK2A 1ESNA 4M1QA 4HY3A 1FB5A 1NTOA 2ALJA 3PPIA 4E46A 3C0KA 2FUKA 3IEMA 4BO4A 2FMUA 4GXQA 3PWKA 1H0KA 1UDCA 4OFZA 5K1ZA 1CZHA 1EUQA 4DS3A 4AMGA 4N0DA 2YYAA 3ZXXA 1Y8CA 3B3QA 4UXIA 3A36A 4QG7A 4JVOA 5F4OA 1T9ZA 4BASA 1QOPB 1E18A 2I33A 3EPLA 2BEUB 4WN9A 1C3VA 1JIVA 1T25A 3OUTA 3Q87B 5E7IA 3BX1A 1WPQA 1NRJB 3JQRA 4KR7A 1HT0A 4AG5A 3LA8A 4DW8A 3KD3A 2GEDA 3L8EA 2IHVA 5KDLA 3F47A 2PUJA 4ZCSA 3VBCA 4DM3A 4XYLA