2V83A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v83A01
2V87A 2V88A 2V89A 2V83A 2JWOA 2V85A 2V86A
chains in the Genus database with same CATH superfamily
1DI2A 2YU8A 1HNWE 4F9BB 3IWBA 3J81C 5AE1A 1AH5A 2DMYA 2EPMX 4F6MA 3ADLA 4WXCA 2EPAA 3HPSA 2YTEA 3ADIA 4JV5E 1BBGA 5AE3A 2EJ4A 2KOUA 4LU9A 1A1HA 3KWRA 4BMJA 2JR1A 4M0VA 2GPIA 3HTXA 2EPUA 2YSOA 1EH6A 2LTSA 1HNXE 2EZ6A 2D9HA 2EOHA 4IS1C 2N3GA 2EMHA 4JI0E 2JXPA 2EN8A 2V86A 1X3CA 4GZNC 2EL5A 3MHSC 3HXLA 3IWCA 2V89A 1A1JA 3VYXA 2ENAA 2NA2A 4YHHE 3LLHA 2HHHE 2L6MA 4R8OA 3C4BA 3DF6A 1X5WA 4MLVA 4DR5E 2JPAA 2LUPB 2UUCE 1ZU1A 2A25A 1IBKE 1SR9A 4F2JC 3FIGA 1X49A 2BB8A 3HQ1A 2EPPA 2EMAA 2EOQA 2EL4A 4DMIA 1GZ6A 2EM7A 4R2CA 2EMWA 2EMLA 1KJKA 4P78A 2EE8A 3ZOQB 3EPKA 1PDAA 1T4NA 2GHFA 3VYYA 2H36X 2EMGA 4J8ZA 2YTPA 3ECRA 2EMCA 2KHXA 4WX9A 1YSAC 2BBGA 2EPKX 4DV1E 1T39A 2UXDE 1NCSA 2NUEA 1TF6A 4F9AB 3EPHA 2YTDA 1I94E 3OTOE 2RS7A 5KL6A 2YRKA 3J7Yp 4WPYA 2JOXA 4JI8E 4O5GA 2EM3A 4NHRA 4LFAE 4DV4E 5A6JA 1ZBQA 2ENCA 3HPZA 3THNA 1J26A 2MDGA 2EOEA 1UBDC 4WSPA 1AAYA 4NXNE 2EPCA 1XMOE 3ADJA 2LMZA 2N8XA 3MSWA 2EOJA 4B3ME 2ZM6E 2DRPA 1EH8A 2JWOA 1MGTA 4X8WA 5LL6R 1YZ9A 2RQLA 2VRDA 2EOZA 4GKKE 4BCAA 2YTFA 4WYQB 1HNZE 5T6JA 2WBUA 4BS9A 2PRTA 2JY9A 2EM9A 2R1FA 4NZVA 4JI1E 2N3HA 2LCEA 4KWYA 5LMUE 1O0WA 5AASA 4F9CB 4DR3E 2EOOA 2LTRA 3THOB 3F6GA 5IXMB 5A2QC 2GLIA 5BR8E 2YTNA 4KHPE 2ODRD 4BBYA 2EM4A 1EH7A 2JOBA 3C4TA 5KL3A 2EQ1A 1GTKA 2K7IA 1N32E 2ODRC 2B3TB 2G7HA 2ENHA 4R2SA 2IHR1 2J7JA 3EPJA 1N36E 4DR7E 1N3GA 5ADZA 5DNYA 2B7TA 2ELYA 4F6NA 3J80C 2F4VE 4X9JA 3OMLA 4DUZE 3K6QA 2M7QA 4BC7A 4WFTA 4DR6E 4FK5C 1WRJA 3AUZA 1SFEA 3T1HE 2WZOA 2E72A 2L8TA 2HC5A 4F54A 1UHZA 1XNQE 2EN1A 3C6MA 1X6HA 1ZBTA 2ELZA 5FLXC 1X6EA 4L5NC 5IV8B 1DGCA 1IQOA 2VF1A 1LLMC 2YTIA 3DJWA 3M99B 2YTJA 4LF6E 2YRHA 2CT1A 1L4SA 3EQ1A 2EMKA 4O24A 4ZYHA 1G2DC 1STUA 2YZTA 4O4KA 4JYAE 1F2IG 3JU0A 4IJDA 4TUIA 2EORA 3C6KA 5TSEA 4WSGA 4JI2E 2YTOA 2EN7A 1RMDA 2RPCA 2VQFE 3H09A 1YFHA 2MKNA 2EOIA 2F8BA 1FKAE 2V87A 4M2ZA 4LTYA 4Q35B 2CTDA 2DIXA 1QNTA 4B3SE 2EOSA 4R2AA 4BC9A 5A6BA 1T4LB 2E5LE 3QG5C 1JK2A 4LFCE 2YPNA 1G2FC 5AE2A 2YSPA 4GKJE 4M9VC 2LRSA 2RTXA 4B3RE 2MDRA 4R2EA 2JP9A 2FGGA 1N34E 5KL2A 1B69A 2FV4B 2YU5A 4JI3E 4JI4E 3KZYA 3UK3C 2YTQA 2RS6A 2WCC3 2VE7C 4OX9E 4RH8A 1PJSA 5KL7A 2L3CA 3J7AG 2EM5A 4X64E 1NEIA 4BHBA 4R2QA 2YWQA 2EM0A 5CFFE 4JI6E 3P1XA 2EM6A 2EMBA 4DV0E 5KL4A 3BBGA 2EOYA 3L00A 2MC5A 4LF9E 2UXCE 1UILA 2LT7A 2WBSA 1A1KA 2WBTA 2DMIA 4R2RA 2EM8A 3T1YE 4DV6E 1MEYC 1XNRE 2L92A 3IWDA 2EMFA 2EPNA 1X6FA 2EPRA 2HGHA 4HTGA 1P47A 2EPXA 3F6HA 1YPNA 4M30A 3MHHC 2DLQA 2EN6A 3JTZA 2CSHA 5A69A 4X65E 2L3JA 4I8OA 4MLQA 4HEIA 4P7DA 5A6BD 1YYWA 4DV3E 2UUBE 2I9IA 1RC7A 2JYAA 5KL5A 3EPLA 4X62E 1WXRA 2L2KB 4RHBB 4TUGA 3BGHA 2M4IA 4R2DA 1FJGE 2LJUA 5IWAE 2Q8UA 1YYOA 4DR1E 2I13A 2LVHA 1PJQA 2EN2A 4AQYE 2ADRA 1YUJA 4ZYDA 2R76A 2V83A 1JK1A 3LMLA 2EOXA 2V88A 2LBSB 1QU6A 4NXME 2LJHA 4LFBE 2RSIA 1EKZA 4Q28A 4X66E 1WHQA 1A1FA 4K0KE 1YUIA 4WXDA 1J5EE 4O43A 2EMIA 2EPZA 5AC4A 1GQEA 2EP3A 4YY3E 2EMYA 2M9AA 1IQSA 4DUYE 2L2NA 5IT9C 1UN6B 5LMNE 1PKPA 3KZZA 2NUFA 2DLKA 2EM2A 4ZYGA 3AV0A 1IBME 4R03A 4L8NA 2EOFA 1IMUA 2UU9E 2EWLA 2V85A 4DV7E 2EN3A 3VHTB 1XMQE 3VK6A 2B9DA 5F3WA 4DR2E 1A1GA 4DV5E 4B3TE 2EPOA 1KYQA 2EQ0A 2CPNA 4KZSA 2FTXB 4JI7E 2LE2A 3RMPA 3BF2A 2EMXA 1HR0E 2MC6A 5A6KA 4ZYEA 2DGCA 2L2MA 2UXBE 2B7VA 2VQEE 3JAMC 1WHNA 2K4VA 4OOGC 2L33A 4N4RB 1T4OA 1TN9A 1WJPA 1T38A 1X47A 1PJTA 2YT4A 1RQ0A 1YYKA 5LLQA 2DSYA 2NUGA 4R2PA 2M1SA 3TQMA 4DV2E 1ZAAC 2DB2A 4DR4E 1N33E 2NABA 1ZR9A 1A1LA 1TF3A 2E1MA 2RSMA 2JVAA 2LO3A 4BHCA 2EL6A 2V8QB 3BIDA 5AC5A 2YRMA 2LUQA 2EPLX 1BBOA 2EQ3A 2EN4A 4DKKA 1A1IA 2EMZA 4LF5E 2HJJA 2YTGA 4LF7E 4LF8E 2KONA 3ADGA 1IBLE 4LF4E 1DQ3A 2MKDA 1Z1BA 2UUAE 5A6AA 2LV2A 1BB8A 2EOMA 1X48A 4GEQB 4JI5E
chains in the Genus database with same CATH topology
1FKAE 2ZM6E 2V87A 4AQYE 4B3ME 4M2ZA 1DI2A 4LTYA 1HNWE 2V83A 2JWOA 4X8WA 5LL6R 4F9BB 1YZ9A 4GKKE 3IWBA 3J81C 4BCAA 5AE1A 2DIXA 2DMYA 3LMLA 2V88A 2LBSB 4WYQB 1QU6A 1HNZE 5T6JA 4B3SE 3ADLA 4BS9A 2JY9A 4NXME 3HPSA 4BC9A 1T4LB 3ADIA 2LJHA 2E5LE 4JI1E 2N3HA 4JV5E 4LFBE 5AE3A 5LMUE 1O0WA 2KOUA 5AASA 4LU9A 4Q28A 4F9CB 4DR3E 1EKZA 3KWRA 4BMJA 4X66E 1WHQA 2LTRA 3F6GA 5AE2A 4LFCE 4K0KE 2JR1A 5A2QC 4M0VA 5BR8E 1J5EE 3HTXA 4GKJE 2LRSA 2LTSA 4KHPE 1GQEA 2RTXA 4B3RE 2MDRA 2ODRD 1HNXE 2EZ6A 4BBYA 2FGGA 2JOBA 3C4TA 4YY3E 2N3GA 1N34E 4DUYE 2L2NA 4JI0E 5IT9C 2FV4B 4JI3E 5LMNE 4JI4E 1N32E 2V86A 2ODRC 1PKPA 2NUFA 2RS6A 4OX9E 2VE7C 3HXLA 3IWCA 2B3TB 2G7HA 2V89A 3AV0A 3VYXA 1IBME 2IHR1 1N36E 2NA2A 4YHHE 4DR7E 3LLHA 4R03A 5ADZA 4L8NA 5DNYA 2B7TA 2L3CA 2L6MA 2HHHE 2UU9E 3J7AG 4R8OA 4X64E 2EWLA 3C4BA 3DF6A 2V85A 3J80C 4DR5E 2LUPB 4DV7E 2UUCE 5CFFE 2F4VE 3OMLA 4JI6E 4DUZE 1XMQE 3VK6A 2B9DA 3K6QA 2M7QA 4BC7A 3P1XA 5F3WA 4WFTA 4DR2E 1IBKE 1SR9A 4DR6E 4DV5E 4DV0E 3FIGA 4B3TE 1X49A 3AUZA 3HQ1A 4KZSA 2MC5A 2CPNA 4LF9E 2UXCE 1UILA 2FTXB 4JI7E 2LE2A 3RMPA 4DMIA 3T1HE 2WZOA 1GZ6A 1HR0E 2L8TA 2MC6A 4F54A 1UHZA 1XNQE 3T1YE 1ZBTA 2L2MA 5FLXC 4DV6E 4L5NC 4P78A 2UXBE 2B7VA 3ZOQB 2VQEE 2L92A 1XNRE 3IWDA 1T4NA 3JAMC 1WHNA 2VF1A 2K4VA 4OOGC 2L33A 3DJWA 3VYYA 2H36X 4J8ZA 1T4OA 2KHXA 4LF6E 3F6HA 4M30A 4DV1E 2UXDE 3JTZA 1X47A 2YT4A 4X65E 1RQ0A 2L3JA 1YYKA 4I8OA 2NUEA 2DSYA 2NUGA 4F9AB 1STUA 2YZTA 2M1SA 4P7DA 1I94E 4DV2E 1YYWA 3OTOE 2DB2A 4DV3E 2UUBE 4JYAE 4DR4E 2RS7A 1RC7A 1N33E 3J7Yp 4WPYA 2JOXA 3JU0A 4JI8E 2E1MA 2RSMA 2JVAA 4LFAE 4TUIA 4X62E 2V8QB 1WXRA 4DV4E 2L2KB 2LUQA 1ZBQA 3HPZA 4TUGA 1J26A 2M4IA 1FJGE 4DKKA 4JI2E 4WSPA 5IWAE 4LF5E 4LF7E 4NXNE 1YYOA 4LF8E 2KONA 2VQFE 3H09A 4DR1E 3ADGA 1IBLE 1XMOE 4LF4E 1DQ3A 3ADJA 2UUAE 2LMZA 2F8BA 1X48A 4GEQB 3MSWA 4JI5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V87 A;  2V88 A;  2V89 A;  2V83 A;  2JWO A;  2V85 A;  2V86 A; 
#chains in the Genus database with same CATH topology
 1DI2 A;  2YU8 A;  1HNW E;  4F9B B;  3IWB A;  3J81 C;  5AE1 A;  1AH5 A;  2DMY A;  2EPM X;  4F6M A;  3ADL A;  4WXC A;  2EPA A;  3HPS A;  2YTE A;  3ADI A;  4JV5 E;  1BBG A;  5AE3 A;  2EJ4 A;  2KOU A;  4LU9 A;  1A1H A;  3KWR A;  4BMJ A;  2JR1 A;  4M0V A;  2GPI A;  3HTX A;  2EPU A;  2YSO A;  1EH6 A;  2LTS A;  1HNX E;  2EZ6 A;  2D9H A;  2EOH A;  4IS1 C;  2N3G A;  2EMH A;  4JI0 E;  2JXP A;  2EN8 A;  2V86 A;  1X3C A;  4GZN C;  2EL5 A;  3MHS C;  3HXL A;  3IWC A;  2V89 A;  1A1J A;  3VYX A;  2ENA A;  2NA2 A;  4YHH E;  3LLH A;  2HHH E;  2L6M A;  4R8O A;  3C4B A;  3DF6 A;  1X5W A;  4MLV A;  4DR5 E;  2JPA A;  2LUP B;  2UUC E;  1ZU1 A;  2A25 A;  1IBK E;  1SR9 A;  4F2J C;  3FIG A;  1X49 A;  2BB8 A;  3HQ1 A;  2EPP A;  2EMA A;  2EOQ A;  2EL4 A;  4DMI A;  1GZ6 A;  2EM7 A;  4R2C A;  2EMW A;  2EML A;  1KJK A;  4P78 A;  2EE8 A;  3ZOQ B;  3EPK A;  1PDA A;  1T4N A;  2GHF A;  3VYY A;  2H36 X;  2EMG A;  4J8Z A;  2YTP A;  3ECR A;  2EMC A;  2KHX A;  4WX9 A;  1YSA C;  2BBG A;  2EPK X;  4DV1 E;  1T39 A;  2UXD E;  1NCS A;  2NUE A;  1TF6 A;  4F9A B;  3EPH A;  2YTD A;  1I94 E;  3OTO E;  2RS7 A;  5KL6 A;  2YRK A;  3J7Y p;  4WPY A;  2JOX A;  4JI8 E;  4O5G A;  2EM3 A;  4NHR A;  4LFA E;  4DV4 E;  5A6J A;  1ZBQ A;  2ENC A;  3HPZ A;  3THN A;  1J26 A;  2MDG A;  2EOE A;  1UBD C;  4WSP A;  1AAY A;  4NXN E;  2EPC A;  1XMO E;  3ADJ A;  2LMZ A;  2N8X A;  3MSW A;  2EOJ A;  4B3M E;  2ZM6 E;  2DRP A;  1EH8 A;  2JWO A;  1MGT A;  4X8W A;  5LL6 R;  1YZ9 A;  2RQL A;  2VRD A;  2EOZ A;  4GKK E;  4BCA A;  2YTF A;  4WYQ B;  1HNZ E;  5T6J A;  2WBU A;  4BS9 A;  2PRT A;  2JY9 A;  2EM9 A;  2R1F A;  4NZV A;  4JI1 E;  2N3H A;  2LCE A;  4KWY A;  5LMU E;  1O0W A;  5AAS A;  4F9C B;  4DR3 E;  2EOO A;  2LTR A;  3THO B;  3F6G A;  5IXM B;  5A2Q C;  2GLI A;  5BR8 E;  2YTN A;  4KHP E;  2ODR D;  4BBY A;  2EM4 A;  1EH7 A;  2JOB A;  3C4T A;  5KL3 A;  2EQ1 A;  1GTK A;  2K7I A;  1N32 E;  2ODR C;  2B3T B;  2G7H A;  2ENH A;  4R2S A;  2IHR 1;  2J7J A;  3EPJ A;  1N36 E;  4DR7 E;  1N3G A;  5ADZ A;  5DNY A;  2B7T A;  2ELY A;  4F6N A;  3J80 C;  2F4V E;  4X9J A;  3OML A;  4DUZ E;  3K6Q A;  2M7Q A;  4BC7 A;  4WFT A;  4DR6 E;  4FK5 C;  1WRJ A;  3AUZ A;  1SFE A;  3T1H E;  2WZO A;  2E72 A;  2L8T A;  2HC5 A;  4F54 A;  1UHZ A;  1XNQ E;  2EN1 A;  3C6M A;  1X6H A;  1ZBT A;  2ELZ A;  5FLX C;  1X6E A;  4L5N C;  5IV8 B;  1DGC A;  1IQO A;  2VF1 A;  1LLM C;  2YTI A;  3DJW A;  3M99 B;  2YTJ A;  4LF6 E;  2YRH A;  2CT1 A;  1L4S A;  3EQ1 A;  2EMK A;  4O24 A;  4ZYH A;  1G2D C;  1STU A;  2YZT A;  4O4K A;  4JYA E;  1F2I G;  3JU0 A;  4IJD A;  4TUI A;  2EOR A;  3C6K A;  5TSE A;  4WSG A;  4JI2 E;  2YTO A;  2EN7 A;  1RMD A;  2RPC A;  2VQF E;  3H09 A;  1YFH A;  2MKN A;  2EOI A;  2F8B A;  1FKA E;  2V87 A;  4M2Z A;  4LTY A;  4Q35 B;  2CTD A;  2DIX A;  1QNT A;  4B3S E;  2EOS A;  4R2A A;  4BC9 A;  5A6B A;  1T4L B;  2E5L E;  3QG5 C;  1JK2 A;  4LFC E;  2YPN A;  1G2F C;  5AE2 A;  2YSP A;  4GKJ E;  4M9V C;  2LRS A;  2RTX A;  4B3R E;  2MDR A;  4R2E A;  2JP9 A;  2FGG A;  1N34 E;  5KL2 A;  1B69 A;  2FV4 B;  2YU5 A;  4JI3 E;  4JI4 E;  3KZY A;  3UK3 C;  2YTQ A;  2RS6 A;  2WCC 3;  2VE7 C;  4OX9 E;  4RH8 A;  1PJS A;  5KL7 A;  2L3C A;  3J7A G;  2EM5 A;  4X64 E;  1NEI A;  4BHB A;  4R2Q A;  2YWQ A;  2EM0 A;  5CFF E;  4JI6 E;  3P1X A;  2EM6 A;  2EMB A;  4DV0 E;  5KL4 A;  3BBG A;  2EOY A;  3L00 A;  2MC5 A;  4LF9 E;  2UXC E;  1UIL A;  2LT7 A;  2WBS A;  1A1K A;  2WBT A;  2DMI A;  4R2R A;  2EM8 A;  3T1Y E;  4DV6 E;  1MEY C;  1XNR E;  2L92 A;  3IWD A;  2EMF A;  2EPN A;  1X6F A;  2EPR A;  2HGH A;  4HTG A;  1P47 A;  2EPX A;  3F6H A;  1YPN A;  4M30 A;  3MHH C;  2DLQ A;  2EN6 A;  3JTZ A;  2CSH A;  5A69 A;  4X65 E;  2L3J A;  4I8O A;  4MLQ A;  4HEI A;  4P7D A;  5A6B D;  1YYW A;  4DV3 E;  2UUB E;  2I9I A;  1RC7 A;  2JYA A;  5KL5 A;  3EPL A;  4X62 E;  1WXR A;  2L2K B;  4RHB B;  4TUG A;  3BGH A;  2M4I A;  4R2D A;  1FJG E;  2LJU A;  5IWA E;  2Q8U A;  1YYO A;  4DR1 E;  2I13 A;  2LVH A;  1PJQ A;  2EN2 A;  4AQY E;  2ADR A;  1YUJ A;  4ZYD A;  2R76 A;  2V83 A;  1JK1 A;  3LML A;  2EOX A;  2V88 A;  2LBS B;  1QU6 A;  4NXM E;  2LJH A;  4LFB E;  2RSI A;  1EKZ A;  4Q28 A;  4X66 E;  1WHQ A;  1A1F A;  4K0K E;  1YUI A;  4WXD A;  1J5E E;  4O43 A;  2EMI A;  2EPZ A;  5AC4 A;  1GQE A;  2EP3 A;  4YY3 E;  2EMY A;  2M9A A;  1IQS A;  4DUY E;  2L2N A;  5IT9 C;  1UN6 B;  5LMN E;  1PKP A;  3KZZ A;  2NUF A;  2DLK A;  2EM2 A;  4ZYG A;  3AV0 A;  1IBM E;  4R03 A;  4L8N A;  2EOF A;  1IMU A;  2UU9 E;  2EWL A;  2V85 A;  4DV7 E;  2EN3 A;  3VHT B;  1XMQ E;  3VK6 A;  2B9D A;  5F3W A;  4DR2 E;  1A1G A;  4DV5 E;  4B3T E;  2EPO A;  1KYQ A;  2EQ0 A;  2CPN A;  4KZS A;  2FTX B;  4JI7 E;  2LE2 A;  3RMP A;  3BF2 A;  2EMX A;  1HR0 E;  2MC6 A;  5A6K A;  4ZYE A;  2DGC A;  2L2M A;  2UXB E;  2B7V A;  2VQE E;  3JAM C;  1WHN A;  2K4V A;  4OOG C;  2L33 A;  4N4R B;  1T4O A;  1TN9 A;  1WJP A;  1T38 A;  1X47 A;  1PJT A;  2YT4 A;  1RQ0 A;  1YYK A;  5LLQ A;  2DSY A;  2NUG A;  4R2P A;  2M1S A;  3TQM A;  4DV2 E;  1ZAA C;  2DB2 A;  4DR4 E;  1N33 E;  2NAB A;  1ZR9 A;  1A1L A;  1TF3 A;  2E1M A;  2RSM A;  2JVA A;  2LO3 A;  4BHC A;  2EL6 A;  2V8Q B;  3BID A;  5AC5 A;  2YRM A;  2LUQ A;  2EPL X;  1BBO A;  2EQ3 A;  2EN4 A;  4DKK A;  1A1I A;  2EMZ A;  4LF5 E;  2HJJ A;  2YTG A;  4LF7 E;  4LF8 E;  2KON A;  3ADG A;  1IBL E;  4LF4 E;  1DQ3 A;  2MKD A;  1Z1B A;  2UUA E;  5A6A A;  2LV2 A;  1BB8 A;  2EOM A;  1X48 A;  4GEQ B;  4JI5 E; 
#chains in the Genus database with same CATH homology
 1FKA E;  2ZM6 E;  2V87 A;  4AQY E;  4B3M E;  4M2Z A;  1DI2 A;  4LTY A;  1HNW E;  2V83 A;  2JWO A;  4X8W A;  5LL6 R;  4F9B B;  1YZ9 A;  4GKK E;  3IWB A;  3J81 C;  4BCA A;  5AE1 A;  2DIX A;  2DMY A;  3LML A;  2V88 A;  2LBS B;  4WYQ B;  1QU6 A;  1HNZ E;  5T6J A;  4B3S E;  3ADL A;  4BS9 A;  2JY9 A;  4NXM E;  3HPS A;  4BC9 A;  1T4L B;  3ADI A;  2LJH A;  2E5L E;  4JI1 E;  2N3H A;  4JV5 E;  4LFB E;  5AE3 A;  5LMU E;  1O0W A;  2KOU A;  5AAS A;  4LU9 A;  4Q28 A;  4F9C B;  4DR3 E;  1EKZ A;  3KWR A;  4BMJ A;  4X66 E;  1WHQ A;  2LTR A;  3F6G A;  5AE2 A;  4LFC E;  4K0K E;  2JR1 A;  5A2Q C;  4M0V A;  5BR8 E;  1J5E E;  3HTX A;  4GKJ E;  2LRS A;  2LTS A;  4KHP E;  1GQE A;  2RTX A;  4B3R E;  2MDR A;  2ODR D;  1HNX E;  2EZ6 A;  4BBY A;  2FGG A;  2JOB A;  3C4T A;  4YY3 E;  2N3G A;  1N34 E;  4DUY E;  2L2N A;  4JI0 E;  5IT9 C;  2FV4 B;  4JI3 E;  5LMN E;  4JI4 E;  1N32 E;  2V86 A;  2ODR C;  1PKP A;  2NUF A;  2RS6 A;  4OX9 E;  2VE7 C;  3HXL A;  3IWC A;  2B3T B;  2G7H A;  2V89 A;  3AV0 A;  3VYX A;  1IBM E;  2IHR 1;  1N36 E;  2NA2 A;  4YHH E;  4DR7 E;  3LLH A;  4R03 A;  5ADZ A;  4L8N A;  5DNY A;  2B7T A;  2L3C A;  2L6M A;  2HHH E;  2UU9 E;  3J7A G;  4R8O A;  4X64 E;  2EWL A;  3C4B A;  3DF6 A;  2V85 A;  3J80 C;  4DR5 E;  2LUP B;  4DV7 E;  2UUC E;  5CFF E;  2F4V E;  3OML A;  4JI6 E;  4DUZ E;  1XMQ E;  3VK6 A;  2B9D A;  3K6Q A;  2M7Q A;  4BC7 A;  3P1X A;  5F3W A;  4WFT A;  4DR2 E;  1IBK E;  1SR9 A;  4DR6 E;  4DV5 E;  4DV0 E;  3FIG A;  4B3T E;  1X49 A;  3AUZ A;  3HQ1 A;  4KZS A;  2MC5 A;  2CPN A;  4LF9 E;  2UXC E;  1UIL A;  2FTX B;  4JI7 E;  2LE2 A;  3RMP A;  4DMI A;  3T1H E;  2WZO A;  1GZ6 A;  1HR0 E;  2L8T A;  2MC6 A;  4F54 A;  1UHZ A;  1XNQ E;  3T1Y E;  1ZBT A;  2L2M A;  5FLX C;  4DV6 E;  4L5N C;  4P78 A;  2UXB E;  2B7V A;  3ZOQ B;  2VQE E;  2L92 A;  1XNR E;  3IWD A;  1T4N A;  3JAM C;  1WHN A;  2VF1 A;  2K4V A;  4OOG C;  2L33 A;  3DJW A;  3VYY A;  2H36 X;  4J8Z A;  1T4O A;  2KHX A;  4LF6 E;  3F6H A;  4M30 A;  4DV1 E;  2UXD E;  3JTZ A;  1X47 A;  2YT4 A;  4X65 E;  1RQ0 A;  2L3J A;  1YYK A;  4I8O A;  2NUE A;  2DSY A;  2NUG A;  4F9A B;  1STU A;  2YZT A;  2M1S A;  4P7D A;  1I94 E;  4DV2 E;  1YYW A;  3OTO E;  2DB2 A;  4DV3 E;  2UUB E;  4JYA E;  4DR4 E;  2RS7 A;  1RC7 A;  1N33 E;  3J7Y p;  4WPY A;  2JOX A;  3JU0 A;  4JI8 E;  2E1M A;  2RSM A;  2JVA A;  4LFA E;  4TUI A;  4X62 E;  2V8Q B;  1WXR A;  4DV4 E;  2L2K B;  2LUQ A;  1ZBQ A;  3HPZ A;  4TUG A;  1J26 A;  2M4I A;  1FJG E;  4DKK A;  4JI2 E;  4WSP A;  5IWA E;  4LF5 E;  4LF7 E;  4NXN E;  1YYO A;  4LF8 E;  2KON A;  2VQF E;  3H09 A;  4DR1 E;  3ADG A;  1IBL E;  1XMO E;  4LF4 E;  1DQ3 A;  3ADJ A;  2UUA E;  2LMZ A;  2F8B A;  1X48 A;  4GEQ B;  3MSW A;  4JI5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...