2V83A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v83A01
2V86A 2JWOA 2V87A 2V89A 2V85A 2V88A 2V83A
chains in the Genus database with same CATH superfamily
2EORA 3ADJA 1N34E 2H36X 1O0WA 3F6GA 2N8XA 1AH5A 2UUBE 1ZAAC 1BB8A 1ZU1A 2EMKA 2YTJA 2YRMA 2EM8A 2L33A 4BHCA 4Q28A 5A6BD 5KL3A 4R2PA 1DI2A 4JI7E 3T1HE 5IV8B 1T4OA 2NA2A 4DR5E 2EMCA 5A69A 2V89A 2LTRA 2LUPB 2LTSA 2ODRC 2EOHA 4MLVA 2EPZA 3VYXA 1RQ0A 4WYQB 2EOJA 3JU0A 1X6EA 2K7IA 3IWDA 1MGTA 4DV5E 2DGCA 2EPPA 3KZYA 2L92A 3MSWA 2V85A 4GZNC 2EOEA 1DQ3A 2EPKX 2E1MA 2YTNA 2JPAA 2EMIA 5LLQA 3J7AG 5LL6R 3KWRA 2FV4B 2DB2A 2YU8A 4O43A 4DV7E 4ZYGA 2EMYA 1STUA 4NZVA 4LFCE 2EPXA 4DUZE 4GKKE 1I94E 2B3TB 1LLMC 2B9DA 2M9AA 3VHTB 2YU5A 2EPOA 4RHBB 4JV5E 4M30A 4F6MA 2I13A 3OTOE 1ZBQA 2RSMA 5A6AA 2G7HA 5AE3A 3ADGA 4M9VC 4HEIA 3HXLA 5A2QC 2LT7A 2EMHA 5F3WA 4ZYEA 1X48A 2E72A 3J81C 4BCAA 4R2EA 1G2FC 2LE2A 3DF6A 1X6HA 1UHZA 2DLKA 3TQMA 2UXCE 2EMZA 2EM4A 5AE1A 3HTXA 1GZ6A 2UXDE 1YSAC 1KYQA 1Z1BA 2YTDA 4TUGA 1WJPA 2EM6A 2IHR1 4KHPE 2J7JA 2EN1A 2LRSA 2EOQA 2N3HA 1B69A 4KWYA 4DR4E 1RMDA 2EN3A 2EPUA 1YFHA 1TF6A 2V8QB 2JXPA 2LCEA 2EPRA 4TUIA 2YT4A 2NUFA 2ELYA 2YTFA 2RS6A 4J8ZA 4F54A 3EQ1A 4P7DA 2UXBE 2ENAA 2LJUA 1T4NA 1RC7A 1FJGE 2CT1A 2EM0A 2YTIA 2LMZA 3IWCA 1YYOA 1YUJA 2EMFA 1GQEA 2MDGA 1FKAE 2EPMX 4YY3E 2V88A 2YRHA 4X65E 4F9BB 4LU9A 2JY9A 1PKPA 3LMLA 2ENCA 1MEYC 3ADIA 5IXMB 2GLIA 2PRTA 1X3CA 4FK5C 2RQLA 3HPZA 3BBGA 3BIDA 2A25A 4ZYHA 2VQFE 2EPNA 1YYWA 2DSYA 2LVHA 1A1HA 2EOZA 1YYKA 2EJ4A 3VK6A 4X8WA 2EMBA 1T38A 4DR1E 5A6KA 4LF6E 2L3JA 2CSHA 5KL4A 4X64E 4NHRA 4GEQB 1A1LA 4WSGA 2KOUA 4R2AA 2EQ1A 4DMIA 2K4VA 5DNYA 1PJTA 2EOYA 3KZZA 2HHHE 4MLQA 1N33E 2DMYA 1N32E 4RH8A 4NXME 2ODRD 4ZYDA 2BBGA 2EQ3A 3C4BA 2Q8UA 2EMAA 3C6KA 3VYYA 4GKJE 1L4SA 4BS9A 2F8BA 4BHBA 4LF8E 2D9HA 2MKDA 4X9JA 4IJDA 3MHHC 4DV6E 2WCC3 2B7VA 1EH8A 3QG5C 4O5GA 4BBYA 1KJKA 3HQ1A 1NCSA 1PDAA 5CFFE 2UUAE 1HNXE 4LF9E 2RSIA 1TN9A 1ZR9A 2B7TA 1GTKA 2F4VE 2L2MA 3EPHA 3THOB 4WPYA 3J80C 2EM7A 2MDRA 2YSPA 1G2DC 2LUQA 2L3CA 2DRPA 3THNA 5TSEA 5BR8E 3C6MA 1UBDC 2EM9A 5IWAE 4N4RB 2UU9E 4JI6E 2N3GA 1WRJA 5A6BA 4R03A 1UILA 2ADRA 4JI1E 4LFBE 2EMWA 5KL6A 1WHQA 2VE7C 3L00A 4M0VA 2JVAA 1WXRA 3ECRA 2MC6A 2L6MA 2EM2A 3P1XA 1XMOE 3BGHA 2EL4A 1X6FA 2LV2A 2NUGA 5AASA 2EZ6A 2EN4A 4DR7E 4LFAE 4OX9E 1X47A 4Q35B 4B3SE 4LF5E 2JYAA 3K6QA 4O24A 4R8OA 2NABA 4F2JC 2EM5A 2DLQA 2HJJA 2NUEA 2EN2A 2DIXA 2EMXA 2YTPA 4R2RA 2WBTA 4JI4E 2YTOA 2EMGA 4JYAE 2EN7A 4DKKA 1X5WA 5LMNE 4DV4E 1XMQE 2LJHA 2YTQA 4YHHE 2JP9A 2YSOA 1J5EE 1N3GA 5KL2A 1BBGA 1EH7A 5AE2A 1YUIA 2EL5A 1A1FA 2RTXA 3T1YE 1P47A 1J26A 2HGHA 1X49A 2EMLA 1A1GA 2HC5A 2EWLA 2R1FA 1DGCA 4WXCA 4OOGC 3JAMC 1XNRE 3JTZA 4F6NA 4DV2E 2R76A 2MC5A 2YTEA 5AC4A 3OMLA 5T6JA 4DV1E 1T4LB 2EOXA 1TF3A 3DJWA 3J7Yp 1SFEA 3HPSA 3ZOQB 2JOBA 1A1KA 2LO3A 1PJSA 4AQYE 2JWOA 2V87A 5LMUE 1ZBTA 1NEIA 2VRDA 2M4IA 3H09A 5A6JA 2I9IA 4BMJA 1SR9A 2CPNA 1HR0E 2EL6A 2LBSB 1EH6A 4WSPA 2MKNA 2EOFA 2FGGA 2L2NA 2V83A 2EP3A 3AV0A 1T39A 4M2ZA 3RMPA 2RS7A 4R2QA 2EOMA 2WBUA 2EOOA 1YZ9A 5AC5A 4I8OA 2WBSA 3EPLA 4JI5E 2FTXB 2L2KB 4JI2E 1IBME 1BBOA 2YWQA 2GHFA 2YTGA 4O4KA 4DR6E 3IWBA 3LLHA 1IBLE 2YPNA 4LF7E 2DMIA 2ENHA 1HNZE 4NXNE 4B3ME 2RPCA 3EPJA 5KL7A 2L8TA 4WFTA 2JR1A 3C4TA 1PJQA 1F2IG 4BC9A 2YRKA 4F9CB 2M1SA 4L5NC 4JI3E 2EOSA 2KONA 2YZTA 4L8NA 3FIGA 2EPCA 1IQOA 4DV0E 1A1IA 2EE8A 4X66E 4DV3E 1N36E 4F9AB 1IMUA 4LTYA 1YPNA 3AUZA 2UUCE 4BC7A 3UK3C 4P78A 4IS1C 3ADLA 1UN6B 2EM3A 2EQ0A 5FLXC 1QU6A 2KHXA 4WX9A 2EN8A 5IT9C 2GPIA 3EPKA 2E5LE 4KZSA 3M99B 1HNWE 2BB8A 1WHNA 2ELZA 1JK1A 1AAYA 4X62E 2M7QA 1QNTA 4JI8E 3MHSC 1JK2A 4R2SA 2EOIA 2EPAA 2EN6A 2ZM6E 5KL5A 4HTGA 2EPLX 4WXDA 4R2CA 4DR2E 4K0KE 5ADZA 4JI0E 2CTDA 3BF2A 1IQSA 4R2DA 4B3TE 4DUYE 3F6HA 1A1JA 4LF4E 2V86A 1XNQE 2VF1A 1IBKE 4DR3E 2JOXA 2VQEE 2WZOA 4B3RE 1EKZA
chains in the Genus database with same CATH topology
5BR8E 3ADJA 4TUIA 2YT4A 1N34E 2NUFA 2H36X 1O0WA 3F6GA 4I8OA 2RS6A 2UUBE 4J8ZA 4F54A 4JI5E 4P7DA 5IWAE 2UXBE 1T4NA 1RC7A 2FTXB 2L2KB 4JI2E 1IBME 2L33A 2UU9E 4JI6E 2N3GA 1FJGE 4Q28A 4LFBE 4R03A 1UILA 1DI2A 4JI1E 2LMZA 3IWCA 4JI7E 1YYOA 1WHQA 2VE7C 4DR6E 1GQEA 3IWBA 3LLHA 1IBLE 1FKAE 4X65E 4YY3E 2V88A 4M0VA 4LF7E 3T1HE 2JVAA 4F9BB 1T4OA 4LU9A 2NA2A 2JY9A 1WXRA 1PKPA 3LMLA 4DR5E 1HNZE 4B3ME 4NXNE 2MC6A 3ADIA 2L6MA 2V89A 3P1XA 2L8TA 1XMOE 2LTRA 2LUPB 2LTSA 4WFTA 2ODRC 2JR1A 3C4TA 3VYXA 3HPZA 2NUGA 4BC9A 1RQ0A 4WYQB 4F9CB 5AASA 2EZ6A 3JU0A 2VQFE 4DR7E 3IWDA 2M1SA 4L5NC 4JI3E 4LFAE 4OX9E 1X47A 2KONA 4B3SE 2DSYA 1YYWA 4LF5E 4DV5E 2YZTA 3K6QA 1YYKA 4L8NA 3FIGA 4R8OA 3VK6A 2L92A 4K0KE 4DV0E 4X8WA 4X66E 4DV3E 1N36E 3MSWA 2V85A 4F9AB 4DR1E 4LF6E 2NUEA 4LTYA 1DQ3A 2L3JA 3AUZA 2UUCE 2DIXA 2E1MA 4BC7A 4X64E 4JI4E 4P78A 3ADLA 4JYAE 4DKKA 3J7AG 5LL6R 4GEQB 5LMNE 3KWRA 4DV4E 2FV4B 5FLXC 1XMQE 2LJHA 2DB2A 1QU6A 4YHHE 4DV7E 2KHXA 2KOUA 1YZ9A 4DMIA 1J5EE 2K4VA 5DNYA 5IT9C 1STUA 2HHHE 2E5LE 4LFCE 5AE2A 4DUZE 1N33E 2DMYA 4KZSA 4GKKE 1I94E 1N32E 2B3TB 1HNWE 2B9DA 1WHNA 4NXME 2ODRD 2RTXA 3T1YE 4JV5E 3C4BA 4M30A 4X62E 3OTOE 1ZBQA 2RSMA 1J26A 2G7HA 2M7QA 1X49A 5AE3A 3ADGA 3VYYA 4GKJE 3HXLA 4BS9A 2EWLA 2F8BA 5A2QC 5F3WA 4OOGC 4JI8E 3JAMC 1X48A 4LF8E 3JTZA 3J81C 1XNRE 4BCAA 4DV2E 4DV6E 2MC5A 2LE2A 3DF6A 2ZM6E 2B7VA 4BBYA 3OMLA 5T6JA 1UHZA 3HQ1A 4DV1E 2UXCE 1T4LB 3DJWA 5AE1A 4DR2E 3J7Yp 5CFFE 3HTXA 3HPSA 1GZ6A 3ZOQB 2JOBA 5ADZA 4JI0E 2UXDE 4TUGA 4AQYE 2UUAE 2JWOA 2V87A 5LMUE 1HNXE 4LF9E 1ZBTA 4B3TE 2M4IA 4DUYE 3F6HA 2IHR1 3H09A 4LF4E 2B7TA 4KHPE 4BMJA 2V86A 2L2MA 2F4VE 2LRSA 1SR9A 2CPNA 2N3HA 4DR4E 4WPYA 1HR0E 1XNQE 3J80C 2VF1A 2LBSB 2MDRA 4WSPA 2V83A 2FGGA 2L2NA 3AV0A 1IBKE 2LUQA 4DR3E 2JOXA 2L3CA 2VQEE 3RMPA 2RS7A 4M2ZA 2V8QB 2WZOA 4B3RE 1EKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V86 A;  2JWO A;  2V87 A;  2V89 A;  2V85 A;  2V88 A;  2V83 A; 
#chains in the Genus database with same CATH topology
 2EOR A;  3ADJ A;  1N34 E;  2H36 X;  1O0W A;  3F6G A;  2N8X A;  1AH5 A;  2UUB E;  1ZAA C;  1BB8 A;  1ZU1 A;  2EMK A;  2YTJ A;  2YRM A;  2EM8 A;  2L33 A;  4BHC A;  4Q28 A;  5A6B D;  5KL3 A;  4R2P A;  1DI2 A;  4JI7 E;  3T1H E;  5IV8 B;  1T4O A;  2NA2 A;  4DR5 E;  2EMC A;  5A69 A;  2V89 A;  2LTR A;  2LUP B;  2LTS A;  2ODR C;  2EOH A;  4MLV A;  2EPZ A;  3VYX A;  1RQ0 A;  4WYQ B;  2EOJ A;  3JU0 A;  1X6E A;  2K7I A;  3IWD A;  1MGT A;  4DV5 E;  2DGC A;  2EPP A;  3KZY A;  2L92 A;  3MSW A;  2V85 A;  4GZN C;  2EOE A;  1DQ3 A;  2EPK X;  2E1M A;  2YTN A;  2JPA A;  2EMI A;  5LLQ A;  3J7A G;  5LL6 R;  3KWR A;  2FV4 B;  2DB2 A;  2YU8 A;  4O43 A;  4DV7 E;  4ZYG A;  2EMY A;  1STU A;  4NZV A;  4LFC E;  2EPX A;  4DUZ E;  4GKK E;  1I94 E;  2B3T B;  1LLM C;  2B9D A;  2M9A A;  3VHT B;  2YU5 A;  2EPO A;  4RHB B;  4JV5 E;  4M30 A;  4F6M A;  2I13 A;  3OTO E;  1ZBQ A;  2RSM A;  5A6A A;  2G7H A;  5AE3 A;  3ADG A;  4M9V C;  4HEI A;  3HXL A;  5A2Q C;  2LT7 A;  2EMH A;  5F3W A;  4ZYE A;  1X48 A;  2E72 A;  3J81 C;  4BCA A;  4R2E A;  1G2F C;  2LE2 A;  3DF6 A;  1X6H A;  1UHZ A;  2DLK A;  3TQM A;  2UXC E;  2EMZ A;  2EM4 A;  5AE1 A;  3HTX A;  1GZ6 A;  2UXD E;  1YSA C;  1KYQ A;  1Z1B A;  2YTD A;  4TUG A;  1WJP A;  2EM6 A;  2IHR 1;  4KHP E;  2J7J A;  2EN1 A;  2LRS A;  2EOQ A;  2N3H A;  1B69 A;  4KWY A;  4DR4 E;  1RMD A;  2EN3 A;  2EPU A;  1YFH A;  1TF6 A;  2V8Q B;  2JXP A;  2LCE A;  2EPR A;  4TUI A;  2YT4 A;  2NUF A;  2ELY A;  2YTF A;  2RS6 A;  4J8Z A;  4F54 A;  3EQ1 A;  4P7D A;  2UXB E;  2ENA A;  2LJU A;  1T4N A;  1RC7 A;  1FJG E;  2CT1 A;  2EM0 A;  2YTI A;  2LMZ A;  3IWC A;  1YYO A;  1YUJ A;  2EMF A;  1GQE A;  2MDG A;  1FKA E;  2EPM X;  4YY3 E;  2V88 A;  2YRH A;  4X65 E;  4F9B B;  4LU9 A;  2JY9 A;  1PKP A;  3LML A;  2ENC A;  1MEY C;  3ADI A;  5IXM B;  2GLI A;  2PRT A;  1X3C A;  4FK5 C;  2RQL A;  3HPZ A;  3BBG A;  3BID A;  2A25 A;  4ZYH A;  2VQF E;  2EPN A;  1YYW A;  2DSY A;  2LVH A;  1A1H A;  2EOZ A;  1YYK A;  2EJ4 A;  3VK6 A;  4X8W A;  2EMB A;  1T38 A;  4DR1 E;  5A6K A;  4LF6 E;  2L3J A;  2CSH A;  5KL4 A;  4X64 E;  4NHR A;  4GEQ B;  1A1L A;  4WSG A;  2KOU A;  4R2A A;  2EQ1 A;  4DMI A;  2K4V A;  5DNY A;  1PJT A;  2EOY A;  3KZZ A;  2HHH E;  4MLQ A;  1N33 E;  2DMY A;  1N32 E;  4RH8 A;  4NXM E;  2ODR D;  4ZYD A;  2BBG A;  2EQ3 A;  3C4B A;  2Q8U A;  2EMA A;  3C6K A;  3VYY A;  4GKJ E;  1L4S A;  4BS9 A;  2F8B A;  4BHB A;  4LF8 E;  2D9H A;  2MKD A;  4X9J A;  4IJD A;  3MHH C;  4DV6 E;  2WCC 3;  2B7V A;  1EH8 A;  3QG5 C;  4O5G A;  4BBY A;  1KJK A;  3HQ1 A;  1NCS A;  1PDA A;  5CFF E;  2UUA E;  1HNX E;  4LF9 E;  2RSI A;  1TN9 A;  1ZR9 A;  2B7T A;  1GTK A;  2F4V E;  2L2M A;  3EPH A;  3THO B;  4WPY A;  3J80 C;  2EM7 A;  2MDR A;  2YSP A;  1G2D C;  2LUQ A;  2L3C A;  2DRP A;  3THN A;  5TSE A;  5BR8 E;  3C6M A;  1UBD C;  2EM9 A;  5IWA E;  4N4R B;  2UU9 E;  4JI6 E;  2N3G A;  1WRJ A;  5A6B A;  4R03 A;  1UIL A;  2ADR A;  4JI1 E;  4LFB E;  2EMW A;  5KL6 A;  1WHQ A;  2VE7 C;  3L00 A;  4M0V A;  2JVA A;  1WXR A;  3ECR A;  2MC6 A;  2L6M A;  2EM2 A;  3P1X A;  1XMO E;  3BGH A;  2EL4 A;  1X6F A;  2LV2 A;  2NUG A;  5AAS A;  2EZ6 A;  2EN4 A;  4DR7 E;  4LFA E;  4OX9 E;  1X47 A;  4Q35 B;  4B3S E;  4LF5 E;  2JYA A;  3K6Q A;  4O24 A;  4R8O A;  2NAB A;  4F2J C;  2EM5 A;  2DLQ A;  2HJJ A;  2NUE A;  2EN2 A;  2DIX A;  2EMX A;  2YTP A;  4R2R A;  2WBT A;  4JI4 E;  2YTO A;  2EMG A;  4JYA E;  2EN7 A;  4DKK A;  1X5W A;  5LMN E;  4DV4 E;  1XMQ E;  2LJH A;  2YTQ A;  4YHH E;  2JP9 A;  2YSO A;  1J5E E;  1N3G A;  5KL2 A;  1BBG A;  1EH7 A;  5AE2 A;  1YUI A;  2EL5 A;  1A1F A;  2RTX A;  3T1Y E;  1P47 A;  1J26 A;  2HGH A;  1X49 A;  2EML A;  1A1G A;  2HC5 A;  2EWL A;  2R1F A;  1DGC A;  4WXC A;  4OOG C;  3JAM C;  1XNR E;  3JTZ A;  4F6N A;  4DV2 E;  2R76 A;  2MC5 A;  2YTE A;  5AC4 A;  3OML A;  5T6J A;  4DV1 E;  1T4L B;  2EOX A;  1TF3 A;  3DJW A;  3J7Y p;  1SFE A;  3HPS A;  3ZOQ B;  2JOB A;  1A1K A;  2LO3 A;  1PJS A;  4AQY E;  2JWO A;  2V87 A;  5LMU E;  1ZBT A;  1NEI A;  2VRD A;  2M4I A;  3H09 A;  5A6J A;  2I9I A;  4BMJ A;  1SR9 A;  2CPN A;  1HR0 E;  2EL6 A;  2LBS B;  1EH6 A;  4WSP A;  2MKN A;  2EOF A;  2FGG A;  2L2N A;  2V83 A;  2EP3 A;  3AV0 A;  1T39 A;  4M2Z A;  3RMP A;  2RS7 A;  4R2Q A;  2EOM A;  2WBU A;  2EOO A;  1YZ9 A;  5AC5 A;  4I8O A;  2WBS A;  3EPL A;  4JI5 E;  2FTX B;  2L2K B;  4JI2 E;  1IBM E;  1BBO A;  2YWQ A;  2GHF A;  2YTG A;  4O4K A;  4DR6 E;  3IWB A;  3LLH A;  1IBL E;  2YPN A;  4LF7 E;  2DMI A;  2ENH A;  1HNZ E;  4NXN E;  4B3M E;  2RPC A;  3EPJ A;  5KL7 A;  2L8T A;  4WFT A;  2JR1 A;  3C4T A;  1PJQ A;  1F2I G;  4BC9 A;  2YRK A;  4F9C B;  2M1S A;  4L5N C;  4JI3 E;  2EOS A;  2KON A;  2YZT A;  4L8N A;  3FIG A;  2EPC A;  1IQO A;  4DV0 E;  1A1I A;  2EE8 A;  4X66 E;  4DV3 E;  1N36 E;  4F9A B;  1IMU A;  4LTY A;  1YPN A;  3AUZ A;  2UUC E;  4BC7 A;  3UK3 C;  4P78 A;  4IS1 C;  3ADL A;  1UN6 B;  2EM3 A;  2EQ0 A;  5FLX C;  1QU6 A;  2KHX A;  4WX9 A;  2EN8 A;  5IT9 C;  2GPI A;  3EPK A;  2E5L E;  4KZS A;  3M99 B;  1HNW E;  2BB8 A;  1WHN A;  2ELZ A;  1JK1 A;  1AAY A;  4X62 E;  2M7Q A;  1QNT A;  4JI8 E;  3MHS C;  1JK2 A;  4R2S A;  2EOI A;  2EPA A;  2EN6 A;  2ZM6 E;  5KL5 A;  4HTG A;  2EPL X;  4WXD A;  4R2C A;  4DR2 E;  4K0K E;  5ADZ A;  4JI0 E;  2CTD A;  3BF2 A;  1IQS A;  4R2D A;  4B3T E;  4DUY E;  3F6H A;  1A1J A;  4LF4 E;  2V86 A;  1XNQ E;  2VF1 A;  1IBK E;  4DR3 E;  2JOX A;  2VQE E;  2WZO A;  4B3R E;  1EKZ A; 
#chains in the Genus database with same CATH homology
 5BR8 E;  3ADJ A;  4TUI A;  2YT4 A;  1N34 E;  2NUF A;  2H36 X;  1O0W A;  3F6G A;  4I8O A;  2RS6 A;  2UUB E;  4J8Z A;  4F54 A;  4JI5 E;  4P7D A;  5IWA E;  2UXB E;  1T4N A;  1RC7 A;  2FTX B;  2L2K B;  4JI2 E;  1IBM E;  2L33 A;  2UU9 E;  4JI6 E;  2N3G A;  1FJG E;  4Q28 A;  4LFB E;  4R03 A;  1UIL A;  1DI2 A;  4JI1 E;  2LMZ A;  3IWC A;  4JI7 E;  1YYO A;  1WHQ A;  2VE7 C;  4DR6 E;  1GQE A;  3IWB A;  3LLH A;  1IBL E;  1FKA E;  4X65 E;  4YY3 E;  2V88 A;  4M0V A;  4LF7 E;  3T1H E;  2JVA A;  4F9B B;  1T4O A;  4LU9 A;  2NA2 A;  2JY9 A;  1WXR A;  1PKP A;  3LML A;  4DR5 E;  1HNZ E;  4B3M E;  4NXN E;  2MC6 A;  3ADI A;  2L6M A;  2V89 A;  3P1X A;  2L8T A;  1XMO E;  2LTR A;  2LUP B;  2LTS A;  4WFT A;  2ODR C;  2JR1 A;  3C4T A;  3VYX A;  3HPZ A;  2NUG A;  4BC9 A;  1RQ0 A;  4WYQ B;  4F9C B;  5AAS A;  2EZ6 A;  3JU0 A;  2VQF E;  4DR7 E;  3IWD A;  2M1S A;  4L5N C;  4JI3 E;  4LFA E;  4OX9 E;  1X47 A;  2KON A;  4B3S E;  2DSY A;  1YYW A;  4LF5 E;  4DV5 E;  2YZT A;  3K6Q A;  1YYK A;  4L8N A;  3FIG A;  4R8O A;  3VK6 A;  2L92 A;  4K0K E;  4DV0 E;  4X8W A;  4X66 E;  4DV3 E;  1N36 E;  3MSW A;  2V85 A;  4F9A B;  4DR1 E;  4LF6 E;  2NUE A;  4LTY A;  1DQ3 A;  2L3J A;  3AUZ A;  2UUC E;  2DIX A;  2E1M A;  4BC7 A;  4X64 E;  4JI4 E;  4P78 A;  3ADL A;  4JYA E;  4DKK A;  3J7A G;  5LL6 R;  4GEQ B;  5LMN E;  3KWR A;  4DV4 E;  2FV4 B;  5FLX C;  1XMQ E;  2LJH A;  2DB2 A;  1QU6 A;  4YHH E;  4DV7 E;  2KHX A;  2KOU A;  1YZ9 A;  4DMI A;  1J5E E;  2K4V A;  5DNY A;  5IT9 C;  1STU A;  2HHH E;  2E5L E;  4LFC E;  5AE2 A;  4DUZ E;  1N33 E;  2DMY A;  4KZS A;  4GKK E;  1I94 E;  1N32 E;  2B3T B;  1HNW E;  2B9D A;  1WHN A;  4NXM E;  2ODR D;  2RTX A;  3T1Y E;  4JV5 E;  3C4B A;  4M30 A;  4X62 E;  3OTO E;  1ZBQ A;  2RSM A;  1J26 A;  2G7H A;  2M7Q A;  1X49 A;  5AE3 A;  3ADG A;  3VYY A;  4GKJ E;  3HXL A;  4BS9 A;  2EWL A;  2F8B A;  5A2Q C;  5F3W A;  4OOG C;  4JI8 E;  3JAM C;  1X48 A;  4LF8 E;  3JTZ A;  3J81 C;  1XNR E;  4BCA A;  4DV2 E;  4DV6 E;  2MC5 A;  2LE2 A;  3DF6 A;  2ZM6 E;  2B7V A;  4BBY A;  3OML A;  5T6J A;  1UHZ A;  3HQ1 A;  4DV1 E;  2UXC E;  1T4L B;  3DJW A;  5AE1 A;  4DR2 E;  3J7Y p;  5CFF E;  3HTX A;  3HPS A;  1GZ6 A;  3ZOQ B;  2JOB A;  5ADZ A;  4JI0 E;  2UXD E;  4TUG A;  4AQY E;  2UUA E;  2JWO A;  2V87 A;  5LMU E;  1HNX E;  4LF9 E;  1ZBT A;  4B3T E;  2M4I A;  4DUY E;  3F6H A;  2IHR 1;  3H09 A;  4LF4 E;  2B7T A;  4KHP E;  4BMJ A;  2V86 A;  2L2M A;  2F4V E;  2LRS A;  1SR9 A;  2CPN A;  2N3H A;  4DR4 E;  4WPY A;  1HR0 E;  1XNQ E;  3J80 C;  2VF1 A;  2LBS B;  2MDR A;  4WSP A;  2V83 A;  2FGG A;  2L2N A;  3AV0 A;  1IBK E;  2LUQ A;  4DR3 E;  2JOX A;  2L3C A;  2VQE E;  3RMP A;  2RS7 A;  4M2Z A;  2V8Q B;  2WZO A;  4B3R E;  1EKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...