2V83A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v83A01
2V86A 2V85A 2V88A 2V87A 2V89A 2JWOA 2V83A
chains in the Genus database with same CATH superfamily
4JI7E 3J7AG 2RS7A 2EP3A 2L33A 1JK2A 4MLVA 2EN6A 2YTOA 1WXRA 1RC7A 2GHFA 2BB8A 1BBOA 2VF1A 2DLQA 3OMLA 2UUBE 4F6MA 1G2FC 1P47A 5KL3A 1WHNA 2EMHA 2L92A 2JR1A 3J7Yp 1PJSA 2E1MA 2F8BA 2VE7C 3P1XA 2EOOA 4BBYA 2LTRA 5A6BA 4DV5E 4HTGA 4OOGC 3BBGA 3AV0A 1NEIA 4HEIA 4LF7E 4WXDA 5A69A 2EPNA 2EE8A 2EMLA 2MDGA 3C6KA 4F9AB 4GKJE 2EMBA 4JI2E 1IQSA 2GLIA 3HPZA 3IWDA 4L8NA 2LTSA 1BBGA 1EH7A 4BHBA 5DNYA 4DV7E 4JI3E 2WZOA 1AH5A 2MKDA 3FIGA 3HQ1A 2KONA 2EPXA 2EN7A 1X6EA 1YPNA 1UN6B 4DMIA 3MSWA 2NUGA 4BHCA 2YT4A 1TF3A 2M4IA 2EPLX 2B7VA 2LT7A 2EOHA 3ECRA 4LF4E 2LMZA 3QG5C 4F9BB 4ZYGA 4ZYHA 2DGCA 4RHBB 2ELYA 2EMYA 1IBLE 1YYKA 5KL7A 4DV1E 5T6JA 4GZNC 3ADJA 2EPUA 2JOXA 3HPSA 2EM3A 2LBSB 2ADRA 5KL5A 4JV5E 1UILA 2DSYA 2VQEE 2L3JA 2EOEA 5KL4A 2NUFA 2EN3A 2LV2A 4GKKE 2LE2A 3C4TA 2H36X 4IS1C 4TUIA 4YY3E 1RMDA 1IBME 2EMGA 1XMOE 2JOBA 5AC5A 4DR7E 4R8OA 2EPMX 1YZ9A 1XNRE 2EPCA 4JI0E 1TN9A 3VYXA 3EPHA 4LF8E 1TF6A 2EQ3A 1X5WA 4N4RB 4Q35B 2YTGA 2V85A 2EM2A 1X48A 1LLMC 2ODRC 4P7DA 2NUEA 2YTFA 2YRHA 2V88A 3HTXA 2G7HA 2YTIA 4X62E 5ADZA 4F54A 4R2EA 4JI1E 2DB2A 4R2RA 1GZ6A 2EORA 4X64E 2UXCE 2JYAA 1HNWE 4AQYE 4WSGA 3LLHA 2EPPA 2JY9A 2LCEA 1EKZA 2UUAE 1J5EE 3JTZA 2EPRA 2EMIA 4NZVA 1ZBQA 3K6QA 4OX9E 2FV4B 4F6NA 4DV2E 4F2JC 5IV8B 1WHQA 3T1YE 2RSMA 1A1KA 2I9IA 1QU6A 4WXCA 2V86A 2ENHA 2E5LE 4FK5C 4Q28A 4J8ZA 3ADLA 4O24A 4DUZE 2ELZA 3UK3C 3JU0A 4BC9A 1T4LB 2ODRD 3JAMC 4I8OA 3EQ1A 2EPKX 2EOIA 2DMYA 2EN1A 2V87A 4M2ZA 1N32E 2YWQA 2N8XA 2L6MA 1PDAA 1T39A 3L00A 4DV4E 1X49A 1A1HA 2LJHA 2L3CA 2B3TB 2EMZA 2EZ6A 1MGTA 3ADGA 3BGHA 4DR3E 2EL5A 2EPZA 1WJPA 4M9VC 4NXNE 2YSOA 2RQLA 4DV6E 3VK6A 5AE1A 1YSAC 1ZU1A 1SR9A 1YYOA 1SFEA 3EPLA 2KHXA 1EH6A 2YU5A 3EPJA 4R2CA 1YUIA 3T1HE 3DJWA 3VYYA 5AE2A 2MC6A 5IT9C 2UXBE 2EL6A 3AUZA 2RSIA 1N34E 2WBUA 1FKAE 5IXMB 4DR5E 1T4NA 1J26A 4LU9A 3THOB 4JI5E 2JPAA 2RS6A 2EOXA 2UU9E 4L5NC 2K4VA 1YYWA 2EM5A 2UUCE 2L8TA 1F2IG 1A1FA 4LFAE 5LMNE 1A1LA 1X6HA 2N3HA 2DMIA 1HNZE 2YTEA 4DUYE 2EWLA 1A1IA 2LVHA 4WYQB 1PJQA 2V83A 5A6AA 3BF2A 4R2SA 2EOFA 3HXLA 5KL6A 2EPAA 3KZYA 4P78A 2DLKA 5AASA 5LL6R 2L2KB 2M7QA 1FJGE 4WSPA 3F6GA 2LRSA 4MLQA 2UXDE 4DR6E 2K7IA 5AC4A 1HR0E 4B3TE 2EN4A 4R2DA 2EM4A 2YSPA 2ENAA 4DR4E 2NA2A 2HC5A 4X66E 1YFHA 1PKPA 2WBTA 2YTNA 2EN2A 2EL4A 2L2MA 5A6JA 3F6HA 4BS9A 4WFTA 2B7TA 1ZAAC 5CFFE 5A6BD 2ENCA 4B3RE 1N3GA 2FGGA 3VHTB 4KHPE 4IJDA 4DV3E 2CSHA 1N36E 1STUA 3C4BA 2V89A 3BIDA 3DF6A 4ZYEA 5BR8E 2EOJA 2YTDA 2HHHE 2B9DA 2J7JA 4X65E 2YTPA 1G2DC 4NHRA 3TQMA 3C6MA 4YHHE 1Z1BA 1PJTA 2YZTA 5F3WA 2KOUA 1I94E 2D9HA 1YUJA 1GQEA 3IWBA 1IMUA 2JXPA 1UHZA 2EOQA 4R2QA 2I13A 4NXME 3ADIA 2EMWA 2MC5A 2EQ0A 1GTKA 1X6FA 2EOYA 4TUGA 1A1JA 2LO3A 2R1FA 1DQ3A 2YU8A 4KZSA 5A2QC 2NABA 2LUQA 1ZBTA 1UBDC 4O4KA 2EMCA 4GEQB 2RTXA 2EPOA 3RMPA 4M0VA 4X9JA 1T4OA 3KZZA 1B69A 4ZYDA 1XMQE 3IWCA 2DRPA 1A1GA 4M30A 5FLXC 4LF9E 2EMAA 1BB8A 2JWOA 1QNTA 5KL2A 2M9AA 2MDRA 4KWYA 4DR1E 1NCSA 4R03A 4WX9A 4DV0E 2R76A 2EQ1A 4LFBE 1T38A 2CTDA 5AE3A 2PRTA 1RQ0A 3MHSC 2M1SA 2WCC3 1X3CA 4JYAE 2ZM6E 4LFCE 2EOMA 1DGCA 5LMUE 2JVAA 2EOZA 4RH8A 2YRKA 2CPNA 2DIXA 2EMKA 2WBSA 1IQOA 1XNQE 3MHHC 3H09A 3M99B 2HGHA 3LMLA 2EM7A 2LJUA 4K0KE 2V8QB 2EM9A 2IHR1 2EM6A 1HNXE 1KJKA 4BMJA 2YTQA 3EPKA 2A25A 2JP9A 2YTJA 2BBGA 2L2NA 4WPYA 4JI4E 4X8WA 2EMFA 1L4SA 2EM0A 4O5GA 4B3SE 1JK1A 3KWRA 3OTOE 1DI2A 2LUPB 4O43A 2EMXA 2Q8UA 3ZOQB 4F9CB 3J81C 1EH8A 1IBKE 2CT1A 3THNA 4B3ME 2N3GA 2EM8A 2EOSA 2RPCA 4LTYA 4R2AA 1MEYC 1N33E 4BC7A 2GPIA 1KYQA 5LLQA 4DR2E 1AAYA 2MKNA 1ZR9A 4LF6E 2FTXB 5TSEA 3J80C 1WRJA 4JI6E 4JI8E 4R2PA 1X47A 2E72A 1O0WA 4BCAA 2HJJA 4DKKA 5A6KA 2YPNA 5IWAE 4LF5E 2VRDA 2EJ4A 2EN8A 2YRMA 2VQFE 2F4VE
chains in the Genus database with same CATH topology
4JI7E 3J7AG 1N34E 2RS7A 2L33A 2LUQA 1FKAE 4DR7E 4R8OA 4DR5E 1YZ9A 1T4NA 1XNRE 1ZBTA 1J26A 4LU9A 4JI0E 4JI5E 3VYXA 4LF8E 2RS6A 4GEQB 2V85A 2RTXA 1WXRA 1RC7A 2UU9E 1X48A 3RMPA 4M0VA 4L5NC 1T4OA 2K4VA 2ODRC 1YYWA 4P7DA 2UUCE 2NUEA 2L8TA 2VF1A 4LFAE 5LMNE 3OMLA 1XMQE 3IWCA 2V88A 4M30A 5FLXC 2UUBE 2N3HA 1HNZE 3HTXA 4DUYE 2G7HA 1WHNA 2L92A 4X62E 4LF9E 2JR1A 3J7Yp 5ADZA 2EWLA 4F54A 2E1MA 4JI1E 2JWOA 2DB2A 2F8BA 2VE7C 1GZ6A 3P1XA 4WYQB 4BBYA 1XMOE 2V83A 4X64E 2UXCE 1HNWE 4AQYE 2MDRA 4DR1E 2LTRA 3LLHA 2JY9A 4R03A 1EKZA 3HXLA 2UUAE 4DV5E 4DV0E 4OOGC 4P78A 5AASA 1J5EE 5LL6R 3JTZA 3AV0A 2L2KB 1ZBQA 3K6QA 4OX9E 2FV4B 4LFBE 2M7QA 1FJGE 4LF7E 4WSPA 5AE3A 4DV2E 1RQ0A 3F6GA 2LRSA 2M1SA 2UXDE 4DR6E 1WHQA 4F9AB 2ZM6E 3T1YE 1HR0E 4B3TE 4LFCE 4JYAE 2RSMA 4GKJE 4DR4E 5LMUE 1QU6A 2JVAA 2NA2A 4JI2E 2V86A 2E5LE 4X66E 2CPNA 2DIXA 1XNQE 3HPZA 3IWDA 4Q28A 1PKPA 4L8NA 2LTSA 3H09A 4J8ZA 3LMLA 5DNYA 4DV7E 4JI3E 4K0KE 2L2MA 2V8QB 3F6HA 2WZOA 4BS9A 2IHR1 4WFTA 3ADLA 2B7TA 1HNXE 3FIGA 4DUZE 3JU0A 4BC9A 1T4LB 4BMJA 3HQ1A 2ODRD 5CFFE 2KONA 3JAMC 4I8OA 2L2NA 4WPYA 4JI4E 4B3RE 4X8WA 2V87A 4M2ZA 2DMYA 1N32E 2FGGA 4B3SE 4DMIA 3MSWA 2L6MA 2NUGA 3KWRA 3OTOE 4DV3E 4DV4E 1N36E 2LUPB 4KHPE 1DI2A 1STUA 1X49A 2YT4A 3C4BA 3ZOQB 4F9CB 2LJHA 2M4IA 2V89A 2B7VA 3J81C 3DF6A 2L3CA 1IBKE 2B3TB 5BR8E 4LF4E 2EZ6A 2LMZA 2HHHE 3ADGA 2B9DA 4X65E 4B3ME 4F9BB 2N3GA 4DR3E 4LTYA 1N33E 4BC7A 4YHHE 2YZTA 5F3WA 4NXNE 2KOUA 4DV6E 4DR2E 3VK6A 5AE1A 1I94E 1IBLE 1SR9A 1YYKA 4DV1E 5T6JA 1YYOA 4LF6E 1GQEA 2FTXB 3IWBA 3ADJA 3J80C 1UHZA 4JI8E 2JOXA 4JI6E 3HPSA 1X47A 1O0WA 2KHXA 2LBSB 4NXME 3ADIA 2MC5A 4BCAA 1UILA 4JV5E 2DSYA 4DKKA 2VQEE 2L3JA 3T1HE 3DJWA 3VYYA 4TUGA 5AE2A 2NUFA 2MC6A 5IWAE 4GKKE 2LE2A 5IT9C 4LF5E 1DQ3A 2UXBE 3C4TA 4KZSA 2H36X 2VQFE 4TUIA 4YY3E 5A2QC 2F4VE 1IBME 3AUZA 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V86 A;  2V85 A;  2V88 A;  2V87 A;  2V89 A;  2JWO A;  2V83 A; 
#chains in the Genus database with same CATH topology
 4JI7 E;  3J7A G;  2RS7 A;  2EP3 A;  2L33 A;  1JK2 A;  4MLV A;  2EN6 A;  2YTO A;  1WXR A;  1RC7 A;  2GHF A;  2BB8 A;  1BBO A;  2VF1 A;  2DLQ A;  3OML A;  2UUB E;  4F6M A;  1G2F C;  1P47 A;  5KL3 A;  1WHN A;  2EMH A;  2L92 A;  2JR1 A;  3J7Y p;  1PJS A;  2E1M A;  2F8B A;  2VE7 C;  3P1X A;  2EOO A;  4BBY A;  2LTR A;  5A6B A;  4DV5 E;  4HTG A;  4OOG C;  3BBG A;  3AV0 A;  1NEI A;  4HEI A;  4LF7 E;  4WXD A;  5A69 A;  2EPN A;  2EE8 A;  2EML A;  2MDG A;  3C6K A;  4F9A B;  4GKJ E;  2EMB A;  4JI2 E;  1IQS A;  2GLI A;  3HPZ A;  3IWD A;  4L8N A;  2LTS A;  1BBG A;  1EH7 A;  4BHB A;  5DNY A;  4DV7 E;  4JI3 E;  2WZO A;  1AH5 A;  2MKD A;  3FIG A;  3HQ1 A;  2KON A;  2EPX A;  2EN7 A;  1X6E A;  1YPN A;  1UN6 B;  4DMI A;  3MSW A;  2NUG A;  4BHC A;  2YT4 A;  1TF3 A;  2M4I A;  2EPL X;  2B7V A;  2LT7 A;  2EOH A;  3ECR A;  4LF4 E;  2LMZ A;  3QG5 C;  4F9B B;  4ZYG A;  4ZYH A;  2DGC A;  4RHB B;  2ELY A;  2EMY A;  1IBL E;  1YYK A;  5KL7 A;  4DV1 E;  5T6J A;  4GZN C;  3ADJ A;  2EPU A;  2JOX A;  3HPS A;  2EM3 A;  2LBS B;  2ADR A;  5KL5 A;  4JV5 E;  1UIL A;  2DSY A;  2VQE E;  2L3J A;  2EOE A;  5KL4 A;  2NUF A;  2EN3 A;  2LV2 A;  4GKK E;  2LE2 A;  3C4T A;  2H36 X;  4IS1 C;  4TUI A;  4YY3 E;  1RMD A;  1IBM E;  2EMG A;  1XMO E;  2JOB A;  5AC5 A;  4DR7 E;  4R8O A;  2EPM X;  1YZ9 A;  1XNR E;  2EPC A;  4JI0 E;  1TN9 A;  3VYX A;  3EPH A;  4LF8 E;  1TF6 A;  2EQ3 A;  1X5W A;  4N4R B;  4Q35 B;  2YTG A;  2V85 A;  2EM2 A;  1X48 A;  1LLM C;  2ODR C;  4P7D A;  2NUE A;  2YTF A;  2YRH A;  2V88 A;  3HTX A;  2G7H A;  2YTI A;  4X62 E;  5ADZ A;  4F54 A;  4R2E A;  4JI1 E;  2DB2 A;  4R2R A;  1GZ6 A;  2EOR A;  4X64 E;  2UXC E;  2JYA A;  1HNW E;  4AQY E;  4WSG A;  3LLH A;  2EPP A;  2JY9 A;  2LCE A;  1EKZ A;  2UUA E;  1J5E E;  3JTZ A;  2EPR A;  2EMI A;  4NZV A;  1ZBQ A;  3K6Q A;  4OX9 E;  2FV4 B;  4F6N A;  4DV2 E;  4F2J C;  5IV8 B;  1WHQ A;  3T1Y E;  2RSM A;  1A1K A;  2I9I A;  1QU6 A;  4WXC A;  2V86 A;  2ENH A;  2E5L E;  4FK5 C;  4Q28 A;  4J8Z A;  3ADL A;  4O24 A;  4DUZ E;  2ELZ A;  3UK3 C;  3JU0 A;  4BC9 A;  1T4L B;  2ODR D;  3JAM C;  4I8O A;  3EQ1 A;  2EPK X;  2EOI A;  2DMY A;  2EN1 A;  2V87 A;  4M2Z A;  1N32 E;  2YWQ A;  2N8X A;  2L6M A;  1PDA A;  1T39 A;  3L00 A;  4DV4 E;  1X49 A;  1A1H A;  2LJH A;  2L3C A;  2B3T B;  2EMZ A;  2EZ6 A;  1MGT A;  3ADG A;  3BGH A;  4DR3 E;  2EL5 A;  2EPZ A;  1WJP A;  4M9V C;  4NXN E;  2YSO A;  2RQL A;  4DV6 E;  3VK6 A;  5AE1 A;  1YSA C;  1ZU1 A;  1SR9 A;  1YYO A;  1SFE A;  3EPL A;  2KHX A;  1EH6 A;  2YU5 A;  3EPJ A;  4R2C A;  1YUI A;  3T1H E;  3DJW A;  3VYY A;  5AE2 A;  2MC6 A;  5IT9 C;  2UXB E;  2EL6 A;  3AUZ A;  2RSI A;  1N34 E;  2WBU A;  1FKA E;  5IXM B;  4DR5 E;  1T4N A;  1J26 A;  4LU9 A;  3THO B;  4JI5 E;  2JPA A;  2RS6 A;  2EOX A;  2UU9 E;  4L5N C;  2K4V A;  1YYW A;  2EM5 A;  2UUC E;  2L8T A;  1F2I G;  1A1F A;  4LFA E;  5LMN E;  1A1L A;  1X6H A;  2N3H A;  2DMI A;  1HNZ E;  2YTE A;  4DUY E;  2EWL A;  1A1I A;  2LVH A;  4WYQ B;  1PJQ A;  2V83 A;  5A6A A;  3BF2 A;  4R2S A;  2EOF A;  3HXL A;  5KL6 A;  2EPA A;  3KZY A;  4P78 A;  2DLK A;  5AAS A;  5LL6 R;  2L2K B;  2M7Q A;  1FJG E;  4WSP A;  3F6G A;  2LRS A;  4MLQ A;  2UXD E;  4DR6 E;  2K7I A;  5AC4 A;  1HR0 E;  4B3T E;  2EN4 A;  4R2D A;  2EM4 A;  2YSP A;  2ENA A;  4DR4 E;  2NA2 A;  2HC5 A;  4X66 E;  1YFH A;  1PKP A;  2WBT A;  2YTN A;  2EN2 A;  2EL4 A;  2L2M A;  5A6J A;  3F6H A;  4BS9 A;  4WFT A;  2B7T A;  1ZAA C;  5CFF E;  5A6B D;  2ENC A;  4B3R E;  1N3G A;  2FGG A;  3VHT B;  4KHP E;  4IJD A;  4DV3 E;  2CSH A;  1N36 E;  1STU A;  3C4B A;  2V89 A;  3BID A;  3DF6 A;  4ZYE A;  5BR8 E;  2EOJ A;  2YTD A;  2HHH E;  2B9D A;  2J7J A;  4X65 E;  2YTP A;  1G2D C;  4NHR A;  3TQM A;  3C6M A;  4YHH E;  1Z1B A;  1PJT A;  2YZT A;  5F3W A;  2KOU A;  1I94 E;  2D9H A;  1YUJ A;  1GQE A;  3IWB A;  1IMU A;  2JXP A;  1UHZ A;  2EOQ A;  4R2Q A;  2I13 A;  4NXM E;  3ADI A;  2EMW A;  2MC5 A;  2EQ0 A;  1GTK A;  1X6F A;  2EOY A;  4TUG A;  1A1J A;  2LO3 A;  2R1F A;  1DQ3 A;  2YU8 A;  4KZS A;  5A2Q C;  2NAB A;  2LUQ A;  1ZBT A;  1UBD C;  4O4K A;  2EMC A;  4GEQ B;  2RTX A;  2EPO A;  3RMP A;  4M0V A;  4X9J A;  1T4O A;  3KZZ A;  1B69 A;  4ZYD A;  1XMQ E;  3IWC A;  2DRP A;  1A1G A;  4M30 A;  5FLX C;  4LF9 E;  2EMA A;  1BB8 A;  2JWO A;  1QNT A;  5KL2 A;  2M9A A;  2MDR A;  4KWY A;  4DR1 E;  1NCS A;  4R03 A;  4WX9 A;  4DV0 E;  2R76 A;  2EQ1 A;  4LFB E;  1T38 A;  2CTD A;  5AE3 A;  2PRT A;  1RQ0 A;  3MHS C;  2M1S A;  2WCC 3;  1X3C A;  4JYA E;  2ZM6 E;  4LFC E;  2EOM A;  1DGC A;  5LMU E;  2JVA A;  2EOZ A;  4RH8 A;  2YRK A;  2CPN A;  2DIX A;  2EMK A;  2WBS A;  1IQO A;  1XNQ E;  3MHH C;  3H09 A;  3M99 B;  2HGH A;  3LML A;  2EM7 A;  2LJU A;  4K0K E;  2V8Q B;  2EM9 A;  2IHR 1;  2EM6 A;  1HNX E;  1KJK A;  4BMJ A;  2YTQ A;  3EPK A;  2A25 A;  2JP9 A;  2YTJ A;  2BBG A;  2L2N A;  4WPY A;  4JI4 E;  4X8W A;  2EMF A;  1L4S A;  2EM0 A;  4O5G A;  4B3S E;  1JK1 A;  3KWR A;  3OTO E;  1DI2 A;  2LUP B;  4O43 A;  2EMX A;  2Q8U A;  3ZOQ B;  4F9C B;  3J81 C;  1EH8 A;  1IBK E;  2CT1 A;  3THN A;  4B3M E;  2N3G A;  2EM8 A;  2EOS A;  2RPC A;  4LTY A;  4R2A A;  1MEY C;  1N33 E;  4BC7 A;  2GPI A;  1KYQ A;  5LLQ A;  4DR2 E;  1AAY A;  2MKN A;  1ZR9 A;  4LF6 E;  2FTX B;  5TSE A;  3J80 C;  1WRJ A;  4JI6 E;  4JI8 E;  4R2P A;  1X47 A;  2E72 A;  1O0W A;  4BCA A;  2HJJ A;  4DKK A;  5A6K A;  2YPN A;  5IWA E;  4LF5 E;  2VRD A;  2EJ4 A;  2EN8 A;  2YRM A;  2VQF E;  2F4V E; 
#chains in the Genus database with same CATH homology
 4JI7 E;  3J7A G;  1N34 E;  2RS7 A;  2L33 A;  2LUQ A;  1FKA E;  4DR7 E;  4R8O A;  4DR5 E;  1YZ9 A;  1T4N A;  1XNR E;  1ZBT A;  1J26 A;  4LU9 A;  4JI0 E;  4JI5 E;  3VYX A;  4LF8 E;  2RS6 A;  4GEQ B;  2V85 A;  2RTX A;  1WXR A;  1RC7 A;  2UU9 E;  1X48 A;  3RMP A;  4M0V A;  4L5N C;  1T4O A;  2K4V A;  2ODR C;  1YYW A;  4P7D A;  2UUC E;  2NUE A;  2L8T A;  2VF1 A;  4LFA E;  5LMN E;  3OML A;  1XMQ E;  3IWC A;  2V88 A;  4M30 A;  5FLX C;  2UUB E;  2N3H A;  1HNZ E;  3HTX A;  4DUY E;  2G7H A;  1WHN A;  2L92 A;  4X62 E;  4LF9 E;  2JR1 A;  3J7Y p;  5ADZ A;  2EWL A;  4F54 A;  2E1M A;  4JI1 E;  2JWO A;  2DB2 A;  2F8B A;  2VE7 C;  1GZ6 A;  3P1X A;  4WYQ B;  4BBY A;  1XMO E;  2V83 A;  4X64 E;  2UXC E;  1HNW E;  4AQY E;  2MDR A;  4DR1 E;  2LTR A;  3LLH A;  2JY9 A;  4R03 A;  1EKZ A;  3HXL A;  2UUA E;  4DV5 E;  4DV0 E;  4OOG C;  4P78 A;  5AAS A;  1J5E E;  5LL6 R;  3JTZ A;  3AV0 A;  2L2K B;  1ZBQ A;  3K6Q A;  4OX9 E;  2FV4 B;  4LFB E;  2M7Q A;  1FJG E;  4LF7 E;  4WSP A;  5AE3 A;  4DV2 E;  1RQ0 A;  3F6G A;  2LRS A;  2M1S A;  2UXD E;  4DR6 E;  1WHQ A;  4F9A B;  2ZM6 E;  3T1Y E;  1HR0 E;  4B3T E;  4LFC E;  4JYA E;  2RSM A;  4GKJ E;  4DR4 E;  5LMU E;  1QU6 A;  2JVA A;  2NA2 A;  4JI2 E;  2V86 A;  2E5L E;  4X66 E;  2CPN A;  2DIX A;  1XNQ E;  3HPZ A;  3IWD A;  4Q28 A;  1PKP A;  4L8N A;  2LTS A;  3H09 A;  4J8Z A;  3LML A;  5DNY A;  4DV7 E;  4JI3 E;  4K0K E;  2L2M A;  2V8Q B;  3F6H A;  2WZO A;  4BS9 A;  2IHR 1;  4WFT A;  3ADL A;  2B7T A;  1HNX E;  3FIG A;  4DUZ E;  3JU0 A;  4BC9 A;  1T4L B;  4BMJ A;  3HQ1 A;  2ODR D;  5CFF E;  2KON A;  3JAM C;  4I8O A;  2L2N A;  4WPY A;  4JI4 E;  4B3R E;  4X8W A;  2V87 A;  4M2Z A;  2DMY A;  1N32 E;  2FGG A;  4B3S E;  4DMI A;  3MSW A;  2L6M A;  2NUG A;  3KWR A;  3OTO E;  4DV3 E;  4DV4 E;  1N36 E;  2LUP B;  4KHP E;  1DI2 A;  1STU A;  1X49 A;  2YT4 A;  3C4B A;  3ZOQ B;  4F9C B;  2LJH A;  2M4I A;  2V89 A;  2B7V A;  3J81 C;  3DF6 A;  2L3C A;  1IBK E;  2B3T B;  5BR8 E;  4LF4 E;  2EZ6 A;  2LMZ A;  2HHH E;  3ADG A;  2B9D A;  4X65 E;  4B3M E;  4F9B B;  2N3G A;  4DR3 E;  4LTY A;  1N33 E;  4BC7 A;  4YHH E;  2YZT A;  5F3W A;  4NXN E;  2KOU A;  4DV6 E;  4DR2 E;  3VK6 A;  5AE1 A;  1I94 E;  1IBL E;  1SR9 A;  1YYK A;  4DV1 E;  5T6J A;  1YYO A;  4LF6 E;  1GQE A;  2FTX B;  3IWB A;  3ADJ A;  3J80 C;  1UHZ A;  4JI8 E;  2JOX A;  4JI6 E;  3HPS A;  1X47 A;  1O0W A;  2KHX A;  2LBS B;  4NXM E;  3ADI A;  2MC5 A;  4BCA A;  1UIL A;  4JV5 E;  2DSY A;  4DKK A;  2VQE E;  2L3J A;  3T1H E;  3DJW A;  3VYY A;  4TUG A;  5AE2 A;  2NUF A;  2MC6 A;  5IWA E;  4GKK E;  2LE2 A;  5IT9 C;  4LF5 E;  1DQ3 A;  2UXB E;  3C4T A;  4KZS A;  2H36 X;  2VQF E;  4TUI A;  4YY3 E;  5A2Q C;  2F4V E;  1IBM E;  3AUZ A;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...