2V83A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v83A01
2V83A 2V85A 2V89A 2JWOA 2V87A 2V88A 2V86A
chains in the Genus database with same CATH superfamily
3ECRA 2EM6A 2L2NA 2EJ4A 1RC7A 2EN4A 2D9HA 2NUGA 2YTPA 4DR1E 2EOOA 5AC4A 3KZYA 3IWCA 2LRSA 2EM2A 2EOXA 2EM0A 4JI2E 4DR5E 1ZBQA 4J8ZA 4NXNE 3J7Yp 1WRJA 5BR8E 3KWRA 5LL6R 5A2QC 2L92A 3EPLA 2ENCA 2UXCE 2GLIA 2IHR1 2VRDA 1XMOE 1F2IG 2H36X 5T6JA 4M0VA 4IS1C 1EH7A 3J80C 2ADRA 2VQEE 3RMPA 1FKAE 4X66E 1UN6B 4DR2E 4X65E 2V88A 1HNWE 4DR7E 1EH8A 2EPUA 1X49A 1ZBTA 4BC9A 1N33E 1STUA 3HPSA 4JV5E 1FJGE 1X6FA 1GZ6A 5CFFE 2M4IA 1JK2A 4Q28A 2YWQA 4IJDA 4AQYE 4GKKE 1EH6A 4DR3E 4F54A 4RH8A 4N4RB 4WX9A 3ADGA 3QG5C 1HNZE 2L8TA 2I9IA 2E5LE 1HNXE 2UU9E 5F3WA 1KYQA 4X9JA 1YYWA 2M9AA 4WXCA 2YTDA 1RQ0A 4DR4E 4KWYA 4B3SE 4I8OA 1A1HA 2F8BA 3HPZA 2YSOA 4LTYA 1A1GA 2ZM6E 1YFHA 2EPMX 2EM9A 2FV4B 2LJUA 2N3HA 2Q8UA 4GEQB 4WPYA 4JI8E 3ZOQB 2ENAA 1N3GA 2YTJA 2LMZA 2EPNA 3OTOE 2UUBE 3K6QA 1A1JA 2EOMA 4NZVA 1HR0E 4JI7E 1X47A 2EOZA 2LUQA 1YSAC 1YUJA 1WJPA 2EPKX 2JYAA 2EPRA 1IBKE 2B7VA 3THNA 1TF6A 3LLHA 3T1YE 5IWAE 2EM7A 4F6MA 3T1HE 2RS6A 2I13A 4LF5E 4R8OA 2N3GA 3H09A 4LFCE 2DLKA 4LFAE 2EQ0A 2V86A 2LV2A 3C6MA 1TF3A 1GQEA 1ZAAC 1QNTA 1PKPA 5LMNE 2EMGA 2YTFA 4O5GA 4R2PA 3BGHA 2MC5A 3VK6A 2EWLA 2JP9A 2EN3A 2CTDA 3FIGA 1KJKA 2EMYA 2EPPA 2L33A 2B7TA 3DJWA 2EOEA 1G2FC 5AE3A 2EOJA 2A25A 4M2ZA 4JI5E 4HTGA 2YU8A 2WBUA 2CPNA 3IWDA 4DUZE 1A1IA 1TN9A 2RSMA 2YRKA 2KONA 4M9VC 3VHTB 4DV7E 1N32E 4B3RE 2EL4A 1SFEA 1X5WA 2YRHA 4DKKA 5A6AA 2EMBA 1WHNA 1DI2A 2KHXA 4L5NC 2YTOA 2WCC3 1RMDA 2YTIA 4R2DA 5KL5A 1BBOA 3ADJA 2BB8A 4HEIA 3EQ1A 4JI1E 4BC7A 2EMXA 4R2AA 1N36E 2EMCA 2J7JA 4ZYDA 4X8WA 4GKJE 4BBYA 4KHPE 4K0KE 5AASA 2LE2A 4M30A 2EN7A 2JPAA 4MLQA 2NABA 5AE2A 4ZYHA 1YPNA 2L3CA 3VYXA 2LTRA 4BS9A 4BMJA 2LUPB 2GPIA 4F6NA 1J5EE 5A69A 2EN8A 2EN1A 1IBLE 2V89A 4JI6E 1XNRE 1A1KA 4ZYEA 2LTSA 1A1FA 1L4SA 3BBGA 3C4TA 2JOBA 1PJQA 4DV1E 1IQOA 5KL4A 2EPLX 2YTEA 4YHHE 4WYQB 1AAYA 4R2RA 2BBGA 4BCAA 1ZU1A 4NHRA 4O24A 2DB2A 3EPJA 3LMLA 1YYKA 2YTNA 2EOFA 3KZZA 4DV6E 2DRPA 2LO3A 2WBSA 4B3ME 4DR6E 2EPOA 3EPHA 2EM3A 2EORA 2R76A 1X48A 4WSGA 4WFTA 2YZTA 4DV0E 1O0WA 2YT4A 1UBDC 3UK3C 4DV3E 3HQ1A 4OOGC 2V87A 1AH5A 2FTXB 2YU5A 4OX9E 2PRTA 3J81C 2EZ6A 2DSYA 4WSPA 4LF8E 3OMLA 4R2CA 5KL2A 2WBTA 4O43A 2EOHA 3JTZA 2JOXA 5IT9C 4B3TE 3VYYA 2ODRD 4LFBE 2EPXA 2EOYA 3F6HA 2JVAA 1SR9A 2EL6A 3MSWA 1X6HA 2EE8A 4F9CB 1BB8A 4LF4E 2MKNA 2L2KB 2UUAE 2EL5A 2EM8A 2JR1A 2MDGA 4X62E 1NEIA 5FLXC 2L3JA 4NXME 2EOSA 2RPCA 4GZNC 1I94E 1T4NA 1G2DC 5KL7A 2EM5A 5TSEA 1YUIA 4R2SA 5KL6A 1WHQA 1MEYC 2V83A 1J26A 1QU6A 2EMWA 3F6GA 1T4OA 4F9AB 3EPKA 5ADZA 2LBSB 2HJJA 3AUZA 2DGCA 1IBME 4JI4E 5LMUE 2MDRA 2L2MA 4MLVA 2JXPA 2VE7C 5KL3A 5AC5A 2UXDE 2RS7A 4P78A 2ELYA 4WXDA 4BHCA 1DGCA 3HTXA 1YZ9A 1MGTA 2VF1A 1XMQE 2NUFA 2DLQA 2EN2A 2EMLA 2EM4A 2EMKA 4L8NA 2EQ1A 2ODRC 4LU9A 2NUEA 2B3TB 1X3CA 2JWOA 2ELZA 4LF6E 1JK1A 2F4VE 1ZR9A 2EMHA 2JY9A 2M1SA 2EMZA 2DMYA 2VQFE 1X6EA 2LJHA 2L6MA 2YRMA 1UHZA 1IQSA 4RHBB 2G7HA 2RSIA 3C6KA 4DMIA 2LVHA 2V85A 1N34E 1PJSA 2EMAA 2K4VA 1UILA 2RQLA 2EP3A 2NA2A 1PDAA 3MHSC 1LLMC 1BBGA 2HC5A 3P1XA 5A6JA 4KZSA 2CSHA 2MC6A 4R2QA 1PJTA 2N8XA 4F2JC 1YYOA 4LF9E 1XNQE 3JU0A 2RTXA 2YTGA 3THOB 2HGHA 5IXMB 3C4BA 4TUGA 4R03A 2B9DA 2YPNA 3J7AG 3MHHC 2FGGA 5IV8B 2V8QB 1A1LA 1T38A 2HHHE 5A6BD 2EQ3A 3L00A 2DIXA 5A6KA 1EKZA 2UUCE 4JI3E 3DF6A 2EN6A 5AE1A 4X64E 1GTKA 2EOQA 2YTQA 4DV2E 4ZYGA 4Q35B 4TUIA 3ADLA 5DNYA 1WXRA 4R2EA 2E1MA 2CT1A 4JI0E 3HXLA 3M99B 4DV5E 5LLQA 3AV0A 4O4KA 1T39A 3BIDA 2KOUA 2MKDA 2E72A 4DUYE 1T4LB 1IMUA 4JYAE 2ENHA 2K7IA 2EMFA 4P7DA 1Z1BA 2EPCA 3JAMC 1DQ3A 2R1FA 2M7QA 3ADIA 3IWBA 2EPZA 2UXBE 2YSPA 2GHFA 2DMIA 4LF7E 1P47A 4F9BB 3BF2A 5A6BA 2LT7A 1B69A 4BHBA 4YY3E 2EMIA 3TQMA 2EPAA 4FK5C 4DV4E 2EOIA 1NCSA 2WZOA 2LCEA
chains in the Genus database with same CATH topology
4BMJA 2VF1A 2L2NA 1XMQE 2NUFA 2LUPB 1N33E 1J5EE 1IBKE 2B7VA 1RC7A 4L8NA 1IBLE 3LLHA 2ODRC 2V89A 2NUGA 3T1YE 4DR1E 4LU9A 4JI6E 1XNRE 2NUEA 2JWOA 2LTSA 3IWCA 2LRSA 3C4TA 4LF6E 2JOBA 2F4VE 5IWAE 2JY9A 2M1SA 4DV1E 4JI2E 3T1HE 2RS6A 1ZBQA 4DR5E 4J8ZA 2DMYA 2VQFE 4NXNE 3J7Yp 4LF5E 5BR8E 4R8OA 4YHHE 2LJHA 2L6MA 2N3GA 3KWRA 4WYQB 5LL6R 5A2QC 2L92A 3H09A 1UHZA 4LFCE 2UXCE 2G7HA 4BCAA 4LFAE 2V86A 2IHR1 1XMOE 4DMIA 2H36X 5T6JA 2DB2A 1GQEA 4M0VA 2V85A 3LMLA 1YYKA 3J80C 1N34E 2VQEE 4DV6E 1PKPA 2K4VA 3RMPA 1UILA 5LMNE 1FKAE 4X66E 2NA2A 4DR2E 4B3ME 4DR6E 2MC5A 2V88A 4X65E 3VK6A 1HNWE 2EWLA 4DR7E 3P1XA 4KZSA 1X48A 2MC6A 3FIGA 4WFTA 1X49A 1ZBTA 2YZTA 4BC9A 1O0WA 2L33A 2YT4A 4DV0E 1YYOA 3JU0A 1STUA 2B7TA 2RTXA 3DJWA 3HPSA 4JV5E 1FJGE 3C4BA 1GZ6A 5CFFE 4DV3E 3HQ1A 4LF9E 4TUGA 2M4IA 5AE3A 4R03A 4OOGC 2B9DA 2V87A 2FTXB 3J7AG 4OX9E 4M2ZA 3J81C 4Q28A 4JI5E 2FGGA 4AQYE 2DSYA 2V8QB 2CPNA 3IWDA 4WSPA 4DUZE 4DR3E 2HHHE 4LF8E 2RSMA 3OMLA 4F54A 4GKKE 2DIXA 1EKZA 2UUCE 3ADGA 4JI3E 3JTZA 2KONA 2JOXA 3DF6A 5IT9C 1HNZE 4B3TE 3VYYA 2L8TA 5AE1A 4X64E 2E5LE 2ODRD 4DV7E 1HNXE 1XNQE 2UU9E 5F3WA 4DV2E 4LFBE 1N32E 3F6HA 2JVAA 1SR9A 3MSWA 4F9CB 4TUIA 1YYWA 5DNYA 3ADLA 4B3RE 4LF4E 1WXRA 2E1MA 2L2KB 2UUAE 4BS9A 4JI0E 1RQ0A 2JR1A 3HXLA 4DR4E 4B3SE 4I8OA 4X62E 2F8BA 3HPZA 5FLXC 4DV5E 4DKKA 3AV0A 1WHNA 1DI2A 2KHXA 4LTYA 2L3JA 4L5NC 2ZM6E 2KOUA 1T4LB 4DUYE 4NXME 1I94E 4JYAE 1T4NA 2FV4B 3ADJA 4P7DA 2N3HA 4GEQB 4WPYA 4JI8E 3ZOQB 1DQ3A 4BC7A 3JAMC 2M7QA 4JI1E 1N36E 1WHQA 1YZ9A 4X8WA 2LMZA 2V83A 3IWBA 3ADIA 4GKJE 1J26A 2UXBE 1QU6A 3OTOE 3F6GA 4BBYA 1T4OA 4F9AB 4LF7E 4KHPE 4K0KE 5ADZA 2LBSB 4F9BB 2UUBE 3K6QA 5AASA 2LE2A 3AUZA 4M30A 4JI4E 1IBME 2EZ6A 5LMUE 1HR0E 2MDRA 2L2MA 4JI7E 1X47A 2LUQA 5AE2A 4YY3E 2VE7C 2L3CA 2UXDE 4DV4E 2RS7A 4P78A 3VYXA 2LTRA 3HTXA 2B3TB 2WZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V85 A;  2V89 A;  2JWO A;  2V87 A;  2V88 A;  2V86 A; 
#chains in the Genus database with same CATH topology
 3ECR A;  2EM6 A;  2L2N A;  2EJ4 A;  1RC7 A;  2EN4 A;  2D9H A;  2NUG A;  2YTP A;  4DR1 E;  2EOO A;  5AC4 A;  3KZY A;  3IWC A;  2LRS A;  2EM2 A;  2EOX A;  2EM0 A;  4JI2 E;  4DR5 E;  1ZBQ A;  4J8Z A;  4NXN E;  3J7Y p;  1WRJ A;  5BR8 E;  3KWR A;  5LL6 R;  5A2Q C;  2L92 A;  3EPL A;  2ENC A;  2UXC E;  2GLI A;  2IHR 1;  2VRD A;  1XMO E;  1F2I G;  2H36 X;  5T6J A;  4M0V A;  4IS1 C;  1EH7 A;  3J80 C;  2ADR A;  2VQE E;  3RMP A;  1FKA E;  4X66 E;  1UN6 B;  4DR2 E;  4X65 E;  2V88 A;  1HNW E;  4DR7 E;  1EH8 A;  2EPU A;  1X49 A;  1ZBT A;  4BC9 A;  1N33 E;  1STU A;  3HPS A;  4JV5 E;  1FJG E;  1X6F A;  1GZ6 A;  5CFF E;  2M4I A;  1JK2 A;  4Q28 A;  2YWQ A;  4IJD A;  4AQY E;  4GKK E;  1EH6 A;  4DR3 E;  4F54 A;  4RH8 A;  4N4R B;  4WX9 A;  3ADG A;  3QG5 C;  1HNZ E;  2L8T A;  2I9I A;  2E5L E;  1HNX E;  2UU9 E;  5F3W A;  1KYQ A;  4X9J A;  1YYW A;  2M9A A;  4WXC A;  2YTD A;  1RQ0 A;  4DR4 E;  4KWY A;  4B3S E;  4I8O A;  1A1H A;  2F8B A;  3HPZ A;  2YSO A;  4LTY A;  1A1G A;  2ZM6 E;  1YFH A;  2EPM X;  2EM9 A;  2FV4 B;  2LJU A;  2N3H A;  2Q8U A;  4GEQ B;  4WPY A;  4JI8 E;  3ZOQ B;  2ENA A;  1N3G A;  2YTJ A;  2LMZ A;  2EPN A;  3OTO E;  2UUB E;  3K6Q A;  1A1J A;  2EOM A;  4NZV A;  1HR0 E;  4JI7 E;  1X47 A;  2EOZ A;  2LUQ A;  1YSA C;  1YUJ A;  1WJP A;  2EPK X;  2JYA A;  2EPR A;  1IBK E;  2B7V A;  3THN A;  1TF6 A;  3LLH A;  3T1Y E;  5IWA E;  2EM7 A;  4F6M A;  3T1H E;  2RS6 A;  2I13 A;  4LF5 E;  4R8O A;  2N3G A;  3H09 A;  4LFC E;  2DLK A;  4LFA E;  2EQ0 A;  2V86 A;  2LV2 A;  3C6M A;  1TF3 A;  1GQE A;  1ZAA C;  1QNT A;  1PKP A;  5LMN E;  2EMG A;  2YTF A;  4O5G A;  4R2P A;  3BGH A;  2MC5 A;  3VK6 A;  2EWL A;  2JP9 A;  2EN3 A;  2CTD A;  3FIG A;  1KJK A;  2EMY A;  2EPP A;  2L33 A;  2B7T A;  3DJW A;  2EOE A;  1G2F C;  5AE3 A;  2EOJ A;  2A25 A;  4M2Z A;  4JI5 E;  4HTG A;  2YU8 A;  2WBU A;  2CPN A;  3IWD A;  4DUZ E;  1A1I A;  1TN9 A;  2RSM A;  2YRK A;  2KON A;  4M9V C;  3VHT B;  4DV7 E;  1N32 E;  4B3R E;  2EL4 A;  1SFE A;  1X5W A;  2YRH A;  4DKK A;  5A6A A;  2EMB A;  1WHN A;  1DI2 A;  2KHX A;  4L5N C;  2YTO A;  2WCC 3;  1RMD A;  2YTI A;  4R2D A;  5KL5 A;  1BBO A;  3ADJ A;  2BB8 A;  4HEI A;  3EQ1 A;  4JI1 E;  4BC7 A;  2EMX A;  4R2A A;  1N36 E;  2EMC A;  2J7J A;  4ZYD A;  4X8W A;  4GKJ E;  4BBY A;  4KHP E;  4K0K E;  5AAS A;  2LE2 A;  4M30 A;  2EN7 A;  2JPA A;  4MLQ A;  2NAB A;  5AE2 A;  4ZYH A;  1YPN A;  2L3C A;  3VYX A;  2LTR A;  4BS9 A;  4BMJ A;  2LUP B;  2GPI A;  4F6N A;  1J5E E;  5A69 A;  2EN8 A;  2EN1 A;  1IBL E;  2V89 A;  4JI6 E;  1XNR E;  1A1K A;  4ZYE A;  2LTS A;  1A1F A;  1L4S A;  3BBG A;  3C4T A;  2JOB A;  1PJQ A;  4DV1 E;  1IQO A;  5KL4 A;  2EPL X;  2YTE A;  4YHH E;  4WYQ B;  1AAY A;  4R2R A;  2BBG A;  4BCA A;  1ZU1 A;  4NHR A;  4O24 A;  2DB2 A;  3EPJ A;  3LML A;  1YYK A;  2YTN A;  2EOF A;  3KZZ A;  4DV6 E;  2DRP A;  2LO3 A;  2WBS A;  4B3M E;  4DR6 E;  2EPO A;  3EPH A;  2EM3 A;  2EOR A;  2R76 A;  1X48 A;  4WSG A;  4WFT A;  2YZT A;  4DV0 E;  1O0W A;  2YT4 A;  1UBD C;  3UK3 C;  4DV3 E;  3HQ1 A;  4OOG C;  2V87 A;  1AH5 A;  2FTX B;  2YU5 A;  4OX9 E;  2PRT A;  3J81 C;  2EZ6 A;  2DSY A;  4WSP A;  4LF8 E;  3OML A;  4R2C A;  5KL2 A;  2WBT A;  4O43 A;  2EOH A;  3JTZ A;  2JOX A;  5IT9 C;  4B3T E;  3VYY A;  2ODR D;  4LFB E;  2EPX A;  2EOY A;  3F6H A;  2JVA A;  1SR9 A;  2EL6 A;  3MSW A;  1X6H A;  2EE8 A;  4F9C B;  1BB8 A;  4LF4 E;  2MKN A;  2L2K B;  2UUA E;  2EL5 A;  2EM8 A;  2JR1 A;  2MDG A;  4X62 E;  1NEI A;  5FLX C;  2L3J A;  4NXM E;  2EOS A;  2RPC A;  4GZN C;  1I94 E;  1T4N A;  1G2D C;  5KL7 A;  2EM5 A;  5TSE A;  1YUI A;  4R2S A;  5KL6 A;  1WHQ A;  1MEY C;  2V83 A;  1J26 A;  1QU6 A;  2EMW A;  3F6G A;  1T4O A;  4F9A B;  3EPK A;  5ADZ A;  2LBS B;  2HJJ A;  3AUZ A;  2DGC A;  1IBM E;  4JI4 E;  5LMU E;  2MDR A;  2L2M A;  4MLV A;  2JXP A;  2VE7 C;  5KL3 A;  5AC5 A;  2UXD E;  2RS7 A;  4P78 A;  2ELY A;  4WXD A;  4BHC A;  1DGC A;  3HTX A;  1YZ9 A;  1MGT A;  2VF1 A;  1XMQ E;  2NUF A;  2DLQ A;  2EN2 A;  2EML A;  2EM4 A;  2EMK A;  4L8N A;  2EQ1 A;  2ODR C;  4LU9 A;  2NUE A;  2B3T B;  1X3C A;  2JWO A;  2ELZ A;  4LF6 E;  1JK1 A;  2F4V E;  1ZR9 A;  2EMH A;  2JY9 A;  2M1S A;  2EMZ A;  2DMY A;  2VQF E;  1X6E A;  2LJH A;  2L6M A;  2YRM A;  1UHZ A;  1IQS A;  4RHB B;  2G7H A;  2RSI A;  3C6K A;  4DMI A;  2LVH A;  2V85 A;  1N34 E;  1PJS A;  2EMA A;  2K4V A;  1UIL A;  2RQL A;  2EP3 A;  2NA2 A;  1PDA A;  3MHS C;  1LLM C;  1BBG A;  2HC5 A;  3P1X A;  5A6J A;  4KZS A;  2CSH A;  2MC6 A;  4R2Q A;  1PJT A;  2N8X A;  4F2J C;  1YYO A;  4LF9 E;  1XNQ E;  3JU0 A;  2RTX A;  2YTG A;  3THO B;  2HGH A;  5IXM B;  3C4B A;  4TUG A;  4R03 A;  2B9D A;  2YPN A;  3J7A G;  3MHH C;  2FGG A;  5IV8 B;  2V8Q B;  1A1L A;  1T38 A;  2HHH E;  5A6B D;  2EQ3 A;  3L00 A;  2DIX A;  5A6K A;  1EKZ A;  2UUC E;  4JI3 E;  3DF6 A;  2EN6 A;  5AE1 A;  4X64 E;  1GTK A;  2EOQ A;  2YTQ A;  4DV2 E;  4ZYG A;  4Q35 B;  4TUI A;  3ADL A;  5DNY A;  1WXR A;  4R2E A;  2E1M A;  2CT1 A;  4JI0 E;  3HXL A;  3M99 B;  4DV5 E;  5LLQ A;  3AV0 A;  4O4K A;  1T39 A;  3BID A;  2KOU A;  2MKD A;  2E72 A;  4DUY E;  1T4L B;  1IMU A;  4JYA E;  2ENH A;  2K7I A;  2EMF A;  4P7D A;  1Z1B A;  2EPC A;  3JAM C;  1DQ3 A;  2R1F A;  2M7Q A;  3ADI A;  3IWB A;  2EPZ A;  2UXB E;  2YSP A;  2GHF A;  2DMI A;  4LF7 E;  1P47 A;  4F9B B;  3BF2 A;  5A6B A;  2LT7 A;  1B69 A;  4BHB A;  4YY3 E;  2EMI A;  3TQM A;  2EPA A;  4FK5 C;  4DV4 E;  2EOI A;  1NCS A;  2WZO A;  2LCE A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  2VF1 A;  2L2N A;  1XMQ E;  2NUF A;  2LUP B;  1N33 E;  1J5E E;  1IBK E;  2B7V A;  1RC7 A;  4L8N A;  1IBL E;  3LLH A;  2ODR C;  2V89 A;  2NUG A;  3T1Y E;  4DR1 E;  4LU9 A;  4JI6 E;  1XNR E;  2NUE A;  2JWO A;  2LTS A;  3IWC A;  2LRS A;  3C4T A;  4LF6 E;  2JOB A;  2F4V E;  5IWA E;  2JY9 A;  2M1S A;  4DV1 E;  4JI2 E;  3T1H E;  2RS6 A;  1ZBQ A;  4DR5 E;  4J8Z A;  2DMY A;  2VQF E;  4NXN E;  3J7Y p;  4LF5 E;  5BR8 E;  4R8O A;  4YHH E;  2LJH A;  2L6M A;  2N3G A;  3KWR A;  4WYQ B;  5LL6 R;  5A2Q C;  2L92 A;  3H09 A;  1UHZ A;  4LFC E;  2UXC E;  2G7H A;  4BCA A;  4LFA E;  2V86 A;  2IHR 1;  1XMO E;  4DMI A;  2H36 X;  5T6J A;  2DB2 A;  1GQE A;  4M0V A;  2V85 A;  3LML A;  1YYK A;  3J80 C;  1N34 E;  2VQE E;  4DV6 E;  1PKP A;  2K4V A;  3RMP A;  1UIL A;  5LMN E;  1FKA E;  4X66 E;  2NA2 A;  4DR2 E;  4B3M E;  4DR6 E;  2MC5 A;  2V88 A;  4X65 E;  3VK6 A;  1HNW E;  2EWL A;  4DR7 E;  3P1X A;  4KZS A;  1X48 A;  2MC6 A;  3FIG A;  4WFT A;  1X49 A;  1ZBT A;  2YZT A;  4BC9 A;  1O0W A;  2L33 A;  2YT4 A;  4DV0 E;  1YYO A;  3JU0 A;  1STU A;  2B7T A;  2RTX A;  3DJW A;  3HPS A;  4JV5 E;  1FJG E;  3C4B A;  1GZ6 A;  5CFF E;  4DV3 E;  3HQ1 A;  4LF9 E;  4TUG A;  2M4I A;  5AE3 A;  4R03 A;  4OOG C;  2B9D A;  2V87 A;  2FTX B;  3J7A G;  4OX9 E;  4M2Z A;  3J81 C;  4Q28 A;  4JI5 E;  2FGG A;  4AQY E;  2DSY A;  2V8Q B;  2CPN A;  3IWD A;  4WSP A;  4DUZ E;  4DR3 E;  2HHH E;  4LF8 E;  2RSM A;  3OML A;  4F54 A;  4GKK E;  2DIX A;  1EKZ A;  2UUC E;  3ADG A;  4JI3 E;  3JTZ A;  2KON A;  2JOX A;  3DF6 A;  5IT9 C;  1HNZ E;  4B3T E;  3VYY A;  2L8T A;  5AE1 A;  4X64 E;  2E5L E;  2ODR D;  4DV7 E;  1HNX E;  1XNQ E;  2UU9 E;  5F3W A;  4DV2 E;  4LFB E;  1N32 E;  3F6H A;  2JVA A;  1SR9 A;  3MSW A;  4F9C B;  4TUI A;  1YYW A;  5DNY A;  3ADL A;  4B3R E;  4LF4 E;  1WXR A;  2E1M A;  2L2K B;  2UUA E;  4BS9 A;  4JI0 E;  1RQ0 A;  2JR1 A;  3HXL A;  4DR4 E;  4B3S E;  4I8O A;  4X62 E;  2F8B A;  3HPZ A;  5FLX C;  4DV5 E;  4DKK A;  3AV0 A;  1WHN A;  1DI2 A;  2KHX A;  4LTY A;  2L3J A;  4L5N C;  2ZM6 E;  2KOU A;  1T4L B;  4DUY E;  4NXM E;  1I94 E;  4JYA E;  1T4N A;  2FV4 B;  3ADJ A;  4P7D A;  2N3H A;  4GEQ B;  4WPY A;  4JI8 E;  3ZOQ B;  1DQ3 A;  4BC7 A;  3JAM C;  2M7Q A;  4JI1 E;  1N36 E;  1WHQ A;  1YZ9 A;  4X8W A;  2LMZ A;  2V83 A;  3IWB A;  3ADI A;  4GKJ E;  1J26 A;  2UXB E;  1QU6 A;  3OTO E;  3F6G A;  4BBY A;  1T4O A;  4F9A B;  4LF7 E;  4KHP E;  4K0K E;  5ADZ A;  2LBS B;  4F9B B;  2UUB E;  3K6Q A;  5AAS A;  2LE2 A;  3AUZ A;  4M30 A;  4JI4 E;  1IBM E;  2EZ6 A;  5LMU E;  1HR0 E;  2MDR A;  2L2M A;  4JI7 E;  1X47 A;  2LUQ A;  5AE2 A;  4YY3 E;  2VE7 C;  2L3C A;  2UXD E;  4DV4 E;  2RS7 A;  4P78 A;  3VYX A;  2LTR A;  3HTX A;  2B3T B;  2WZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...