2V84A

Crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
319
structure length
319
Chain Sequence
DVLYLYNWTYYTPTSLIKKFEQQYNVQVVYDDYASNEDMFAKLSIGASGYDLVVPSGDFVSIMKRKHLLEKIDLSKIPNVQFIKESVRARIAYDPKMEYSVPYYLGAAGIAVNKKAVPSYARTWSIFSRKDLAYRMSMMDDMREVMGAALASLGYNVNTKNEQELAQAAILVTDHWKPNLVKFDSDGYAKSFASGDFVVAHGFAEAFFAETPEAMHEHIDFFIPQDVASPVYVDSFCIPKGARNRDLAHAFINFFLEPAHYAEFLDTFGFPSTIHREAAAYQKKTPYYSEHDLERGTLKTDVGAAIEHYNAHWNAVRFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Basis for Polyamine Binding to the Tp0655 Lipoprotein of Treponema Pallidum: Putative Role for Tp0655 (Tppotd) as a Polyamine Receptor.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Transport protein
molecule keywords SPERMIDINE/PUTRESCINE ABC TRANSPORTER, PERIPLASMIC BINDING P
total genus 119
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2v84A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2v84A01
1LCFA 4GF8A 1UTBB 4RPNA 4N6PA 3MVWA 1YAEA 1GV8A 2O68A 4EUOA 2XX9A 3TTRA 4XTCQ 3MJNA 4RPOA 4DIGA 3GBBA 4JBZA 4EF2A 2OBGA 4LQ2A 1VSOA 3RT6B 5AA2B 3UGWA 4HCYA 3MZ9A 1B0LA 3LSLA 3MPKA 3T22A 4QSEA 3OSRA 2GRVA 4PQJA 3O2AA 5DTBA 5CMMA 4YU0A 1MRPA 3MUQA 2A5SA 1LGBC 2XXHA 3RTWB 5ICTA 4EQBA 4UA8A 1Y4TA 2VHAA 3PPPA 3MBPA 3THIA 3LC8A 3B6TA 3H6TA 1R6ZA 1MS7A 4XKNA 3U72A 1ZJLA 2OWSA 2V25A 3OMBA 3IORA 1URDA 5AE4A 2X7QA 1MY1A 1QKAA 5H8FA 2XXUA 3I6VA 4GL8A 1CB6A 3FXQA 1ZU0A 2I0BA 1PDAA 4R75A 1MPCA 3RTFB 2D3IA 3C34A 1J1NA 1D9YA 2DSFA 3G3KA 3N26A 4K3FA 5DEXA 4E0WA 3V8XB 4EXLA 1DTZA 4F2OA 5I84A 1B4HA 3O6GA 5CRYA 1H3DA 1H76A 2UYFA 4EQ9A 1UTBA 4IO4A 4ELPA 4ZZAA 3W9VA 2F97A 2Q2CA 1UIVA 1FCKA 3LSXA 4LZ7A 4OFOA 5IAIA 2PYYA 2Y7KA 2O7IA 4O3BA 5I56A 3LSFB 1EU8A 3CG3A 1SQYA 1Y1MA 2E1SA 5B70A 2HCAA 3PGFA 4NF6A 2GH9A 4PFUA 5KCJA 4Q0CA 3WAEA 4BDQA 1UTHB 1OLCA 1MPBA 3EHUA 1ZTYA 4RA1A 4ZE8A 1SDXA 4OEUA 1P99A 3PD8A 1NMUA 3TAJA 2P1SA 1O7TA 4GLIA 2Q2AA 4JWOA 3OD7A 1URSA 1JW1A 4M4GA 3RNNA 5JEIA 1T0KA 2QMWA 1EZOA 1GVCA 4R72A 3TODA 3OENA 3HV1A 3QIMA 3QUJA 3RUMA 2HEUA 3FASA 3QUFA 1IQ7A 4KPTA 4NF4B 4TLLB 1IXGA 4YB7A 2UVGA 3Q27A 2F36A 4I1DA 3MQ9A 5M2VA 3ZKLA 3TTNA 2X26A 3GZGA 3MAMA 2ZMBA 3PUZE 1MM7A 4GVOA 1Y3PA 3B7DA 1H44A 2ESNA 3H3GA 4OHNA 4OEVA 1PB8A 2DE3A 4YAHX 4GD5A 4IO3A 4YICA 4BDLA 4X9TA 3S9LC 3PUYE 2ZYKA 1AL3A 1IXIA 3Q28A 4H67A 1XVYA 4PE5B 1SW1A 4R9GA 5TPAB 3TELA 3PD9A 3V89B 2Y7PA 3IB2A 1N76A 3FZVA 5DEXB 3T9UA 3RGYA 1JW5A 3VLUA 4BDOA 1B3GA 4XIGQ 2RKMA 3S4UA 1FTLA 3CG1A 5H8FB 1CE2A 4WXJA 1FTJA 3USDA 5H8SA 3ECRA 1GGGA 4POXA 1JEUA 5I57B 4L17A 2QS1A 5CBRA 3VDFA 3R7XA 2I6EA 4F1VA 1N04A 4WEPA 4GL0A 2XXYA 3M3LA 1Y3NA 1FQDA 1SVXB 3M8UA 1M5DA 1MH4A 5JK4A 3EN3A 3PMWA 3MPLA 3O97A 4OYVA 4H0WA 1MQIA 1NH8A 1URGA 4P0IA 2NXOA 1R9QA 2P0SA 4NF6B 5I2KA 1JNFA 3DP8A 3EQ1A 3H6VA 2NVUB 1H45A 1IITA 3OO8A 1ELJA 3C36A 3KN3A 1PB7A 4YMBA 1SYHA 2W7YA 3CR9A 4EXKA 1JEVA 4AB6A 3H03A 4H5FA 1I6QA 3RQTA 4PFYA 5DVJA 4H65A 1N0TA 1N3XA 2F35A 5CC2A 3FIRA 4RY1A 3PUVE 4G8MA 1N7WA 1SI1A 2FNCA 2PMSA 1BLFA 3KJTA 1Y9UA 5FHOA 3KBRA 5TP9A 3K2DA 2RCAA 2DE2A 4R2BA 5TP9B 3RLFE 3G3FA 5I58A 1FQAA 3SKPA 4DCXA 3FJ7A 1MQDA 4KD5A 3PPOA 1LBCA 3EHSA 2ABHA 2HZLA 2V3UA 2OZZA 2THIA 4H8IA 4NWDA 1QUKA 3DELB 4BDRA 4ESWA 4MF3A 3SDFA 3MVXA 4ZEKA 1ZMGA 2F8DA 4KFQA 1YCJA 2RINA 4IO7A 4NEDA 2I0CA 3H06B 1MPDA 3EHTA 1MQHA 2B3BA 1MY3A 1OMPA 1XS5A 3S9EA 1M5FA 1B0HA 4KYEA 3K6WA 2G29A 4TOZA 1ZLQA 3HHGA 1JQFA 3VXBA 4NMYA 2ZNSA 4ND9A 2V3QA 2DXRA 3VVEA 3I3VA 3O6IA 1LAGE 3TQWA 3U1OA 4YMAA 5LOMA 4NF4A 4U1OA 3SEYA 1DPEA 1Q1KA 1NKXA 4NE4A 4YKKA 4OETA 1PC3A 3QK6A 4H1XA 2R6GE 4RNSA 4WKMA 4QFLA 3SETA 3T9HB 3TKDA 2XXPA 2BJJX 2VGQA 4GFRA 4U21A 4ZE9A 2QL3A 5I58B 2HAVA 2QS3A 1A54A 2Y84A 2AL4A 4ZS9A 1N3WA 3A09A 4ZECA 3QSLA 3PU5A 4H6DA 1B52A 3IJOB 3TUSA 1B3FA 1PB9A 1XC1A 4U2RA 3PPRA 2DWIA 4JSOA 1B5IA 4KI0E 4TLMB 4YKIA 5CI5A 2ANJA 1FW0A 3LSWA 1B51A 1R1NA 3U93A 2I4BA 3KOTA 3W15C 3S9NC 4RK2A 3TYHA 2ZNUA 3OO9A 1ANFA 1JVXA 2RCBA 4KCCA 1QKBA 4N07A 2NUVA 4ZEBA 3IAZA 1SYIA 3PMXA 1MXVA 4FATA 3GBAA 1B05A 1MXWA 3IK6B 4IGRA 4R6YA 4X48A 1USYH 3FATA 4LATA 4LZ8A 5JTYB 4QFNA 2LAOA 3FVGA 5HPQA 4KHZE 5L8DA 1MDQA 1MXXA 3VVDA 3E4RA 3GXAA 4G68C 3TCHA 3U94A 3PUXE 1MQGA 2I4CA 4MH5A 1US4A 4G68A 2F7BA 2OCUA 2G93A 2ZYMA 3DLNA 1B6HA 4G68B 3HPIA 3MW0A 3T9VA 5IKBA 4E0XA 4EDPA 5H8HA 4U4XA 3UA8A 3VV5A 4HCWA 5HM4B 1SW4A 2Z8DA 4R9FA 1UTHA 4QFPA 1B7UA 1FQCA 4FJPA 3A3UA 3EPEA 1M5EA 4F31B 1POY1 3KFMA 4ONYA 3UP9A 1OQGA 4F2QA 1DMBA 1FTOA 1QVSA 1Q35A 2B65A 3E3KA 4KYDA 4O3AA 3R26A 4POWA 1O64A 4DXCA 3VFJA 1MY4A 2ONSA 3M3FA 4HW8A 2XXTA 1NNKA 4WEDA 3KSJA 2PT1A 3IR1A 1WVJA 3PUWE 4MLVA 4P11A 4QSCA 3JYRA 5I59B 3H6UA 2CZLA 3QYTA 3U8QA 3CI8A 1OIBA 3FVNA 2XXXA 2VD3A 4KQPA 1L5TA 1DSNA 1BP5A 1VFEA 2Q88A 4F3BA 2I49A 1YPNA 3N94A 1H43A 1B3LA 1QJMA 1TXFA 2F7CA 2F5XA 2GHAA 1SBPA 2OLBA 2Z8FA 4IY5A 4QFOA 3VLWA 3OEMA 1TFDA 2XD2A 3UN6A 3FXUA 1I6AA 2DOJA 5H8NA 5CMCA 4JWXA 1EH3A 4IO2A 5B7DA 1POTA 3B6QA 4XXUA 3FXRA 1HSJA 1DTGA 2GFEA 1LAXA 5H8HB 5BUUA 4GXSB 3F11A 1II5A 4BDMA 1LBBA 4LONB 3IOWA 1BKAA 4YB6A 4QSDA 3MZBA 3SEWA 2WKYA 5DVFA 5ITPA 2OJTA 1S7YA 3FJMA 4LQ5A 4F39A 4EF1A 4G77A 1UQWA 1LCTA 4IY6A 1AMFA 1LAHE 3HO7A 5KCJB 4ELOA 5AA3A 2O1MA 3FGSA 3K02A 3DP6A 1A99A 1FQBA 2ONRA 3FV2A 2PX1A 2Q89A 1IUDA 4JDFA 1Y4CA 2HQ0A 1Z7ME 2I48A 4XKRA 5BWJA 2Z8EA 1RYOA 2HAUA 4KR5A 4F3SA 4OFJA 4G4PA 5AA1A 3KN7A 1B1XA 4YZZA 3N6UA 4DXBA 4FEDA 2PVUA 3SEVA 3K4UA 4QF9A 1XVXA 3C9HA 1JVYA 1HSEA 1QUJA 1KWHA 1MDP1 1MY0A 3Q26A 3H6WA 3TCFA 4M1VA 4NF8B 5I2NA 2UXAA 3DP4A 3R6UA 3N6TA 1A40A 3TZAA 3Q29A 2Q9TA 4RXLA 3BFTA 1FQEA 4R6HA 1SI0A 2R9JA 5ISUA 1XHYA 3O66A 1D4NA 1I6BA 4FEBA 4I62A 4EQ7A 1PBQA 2H9BA 2ZYOA 4KYSA 1P1QA 4MLQA 5EHMA 3TDJA 3SERA 1B7HA 2H4IA 1P1WA 1VE4A 4R6KA 4PFTA 1PEBA 5EYFA 4ZEFA 1ZIUA 4KCDA 1JW4A 1FTKA 1MXYA 3VE1B 5FHNA 3TTMA 1AH5A 3IB1A 3LR1A 4H8JA 2QMXA 3JV9A 3E13X 3GLBA 1QULA 4GWOA 3S2VA 1B2HA 3VXCA 1LB8A 1S9TA 3CFLA 4ISUA 5F7VA 4O3CA 2NOOA 2Y7IA 3V5AA 2QJEA 4ELQA 2NWJA 4Q8RA 1MM6A 5K2XA 4U4SA 1ATGA 2QSXA 4ECFA 3MP8A 4LP2B 4RK9A 1B4ZA 2P2AA 4ZDMA 1S50A 4LZ5A 1D9VA 2I3VA 3CSBA 4LUBA 1GTKA 2UYEA 3ILUB 1SW2A 3K1PA 3RT8A 5EHSA 3IOTA 3FD3A 5AA4A 1AOVA 3K1MA 1P1NA 4C1TA 1D3KA 5CBSA 2ONKE 3KG2A 5I59A 5JTYA 1GR2A 3CRBA 2HXWA 3CVGA 3ILTB 4IO5A 4GOTA 3TCGA 3TEPA 2R71A 3PPNA 2ZXTA 3RN8A 3ONMA 3FVOA 2YLNA 2OWTA 4OFLA 1ZBMA 3P7IA 4IGTA 3TPAA 4FIMA 1AIVA 1N7XA 3K6XA 3ODBA 4GXAA 1P1UA 3KJ7A 3G3IA 4F18A 1LFHA 1LLSA 1F9BA 2DP8A 2REGA 4YKPA 1VR5A 4BDNA 1TWYA 2A5TB 2O51A 2I58A 2V3TA 3JZJA 2B3FA 3K00A 4H5GA 4HS7A 2XD3A 2YPNA 3W9WA 4DCYA 4XKPA 5J1DA 5ELVA 1MH3A 3CIJA 4DLDA 3DM0A 5CMBA 5H8QB 5CM6A 1OLAA 1RKMA 2QPQA 1Z7NE 2HFBA 3KN8A 3BKIB 4G2ZA 4MFIA 3VLVA 2VP1A 4C1UA 5FHMA 3AXFA 1B58A 1IZ1A 5KZTA 5HBCA 3G3GA 3HHFA 2M8CA 3IL1B 3HSTA 3ZKKA 3OO7A 1B9JA 1WODA 2E0SA 1B7ZA 1MG1A 3L6GA 3CFXA 3SEUA 1LAFE 3K6VA 2Y7RA 3V83A 2VOZA 2AYSA 3I5OA 1JETA 4OQOA 1IEJA 3K1NA 3M3KA 1SW5A 1A55A 5H8NB 2DVZA 2GHBA 1XOCA 3G7WA 2REJA 3OEKA 3KGCA 3SEXA 3IOUA 4AB5A 1M5BA 1MY2A 3IO6A 4JXIA 4U1ZA 1USYE 3OELA 5DVIA 2Q8JA 3EF7A 2HZKA 5L9SA 2X7PA 4DZ1A 1P1OA 4ESXA 4FE8A 1NH7A 5I2KB 2D5WA 1NNPA 2DYXA 3CFZA 3TTLA 3K01A 3O9PA 3Q25A 1OVTA 3QXMA 3C33A 4BLAA 2Z22A 2O69A 3C32A 1O63A 2QS4A 2O1LA 3QAXA 3BBRA 5F1QA 5ICQA 2F6PA 5KDTA 2ZNTA 4GQOA 3UIFA 1IIWA 4OERA 3C4MA 2UVHA 1BIYA 2H99A 4G8HA 2XX7A 1DPPA 1EZ9A 1B5JA 2XXIA 2H98A 2QS2A 4OZ9A 4ZZEA 3TFLA 3UK4A 2Z23A 4AQ4A 1B32A 1DOTA 2RC7A 4DE8A 4RJZA 4OVJA 3D4GA 1B3EA 4F1UA 2FYIA 3WAFA 4G8NA 2AIXA 5K2YA 4X1DA 2DVCA 1MXUA 1A8FA 3KEIA 3LUYA 3BFUA 4GRKA 3A3CA 4OWDA 3T66A 2XX8A 4OXVA 4Q5TA 3ZSFA 3MC2A 2CMOA 4F22A 4QHQA 1IXCA 1OVBA 4F29A 1MQJA 1MXZA 3OXNA 5TU0A 1Y20A 2XXQA 2F6GA 5FTIA 3MZ1A 4FECA 2V93A 2RC8A 2F78A 3FVKA 3S9MC 2QRYA 2ALUA 4JWYA 4QRZA 3RPWA 3SESA 4PETA 5KDTB 5I56B 1LSTA 2OK2A 3TMGA 3IX1A 2AL5A 3PMVA 1B40A 1NNTA 5FTHA 4DDDA 2PBWA 3IOVA 3TQLA 1TT1A 2FA7A 3FJGA 4I8CA 1UIUA 2XXWA 4OESA 4RYAA 4IB2A 4ELRA 4UACA 3H7MA 2O84X 5CMKA 3LBSA 3IB0A 1A7LA 1BTJA 4YKJA 4X1BA 2H5YA 2H25A 4NF5B 4LA9A 4FORA 3D4CA 4THIA 5AA4B 1RYXA 2RF1A 4XKQA 2XHDA 1OQHA 1NFTA 1LB9A 1QUIA 4MBPA 3OSQA 5I57A 3B6WA 4JB7A 2UVIA 4Z0IA 2DWHA 1R9LA 4I9DA 4Z7EA 4U23A 1HSLA 1IXHA 3G3HA 4U22A 4R2FA 1QW0A 4F3GA 1B3HA 4ZEIA 1ZKBA 2DWAA 4NF8A 1B1HA 3O28A 5DYHA 3C31A 1A8EA 4TQUQ 3HCQA 4NTLA 1US5A 4P0GA 2XXRA 1M5CA 2DS9A 3HN0A 1Y3QA 1LFGA 3K0VA 3OOAA 5DT6A 3MWBA 4R73A 5A5XB 4Q30B 5AA2A 3N5LA 5H8QA 4C0RA 4OMBA 1WDNA 4QFKA 5ITOA 5TPAA 4F19A 4GIZA 2UVJA 2V84A 2D21A 1VFDA 2A5TA 2PT2A 2XXVA 3MVZA 2DWJA 3E9XA 3T9XB 3VVFA 4F3PA 5A5XA 2F34A 3IJXB 2Y7WA 2DXYA 4N13A 3K6UA 3MVYA 2O7UA 3T93B 3MP6A 3O29A 4HTGA 4YB5A 3IO4A 3MP1A 2IEEA 4PP0A 3H4ZA 4LVQA 2ZYNA 5I2NB 2RC9A 1EZPA 1NNFA 2I3WA 3L6HA 1B5HA 3KOSA 3RY3A 2F7AA 1FTMA 1Y1ZA 2O6AA 3G3JA 3KSXA 3OO6A 2VD2A 5L9MA 2DE4A 3TTKA 5AA2D 1TFAA 4PFWA 1NL5A 1I69A 3KZGA 4R74A 3O6HA 3C35A 3CSGA 4NF5A 1SD3A 3UORA 1LFIA 4JSDA 2IA4A 2KLFA 3FV1A 4NWCA 4F1YA 4FAJA 4ZEDA 4OENA 2YJPA 3PV0E 4IO6A 4OTEA 3T96B 1B46A 3U92A 1FQFA 1N84A 5L9OA 1YTVA 2DQVA 3PPQA 3ZS6A 1PBPA 3FUZA 4DXUA 1XT8A
chains in the Genus database with same CATH superfamily
4GF8A 3MVWA 1GV8A 4EUOA 2XX9A 4NG7A 4EF2A 1DK4A 2WYPA 3RT6B 3MZ9A 3MPKA 4P47A 4PF6A 5CMMA 4YU0A 1FJ9A 2B4MA 1MS7A 2XWIA 1ZJLA 5IZZA 1FRPA 2KQZA 3B50A 2I0BA 4R75A 3RTFB 2D3IA 3V8XB 3O6GA 1H76A 4OFOA 5IZ1A 2Y7KA 3CG3A 4NF6A 4PFUA 4Q0CA 4RA1A 2JJKA 1SDXA 2P1SA 1O7TA 4GLIA 2Q2AA 3OD7A 3OENA 3HV1A 3RUMA 2P3VA 2HEUA 3FASA 3QUFA 1IXGA 4YB7A 3Q27A 3ZKLA 3THIA 3RPLB 4OEVA 1H44A 4PAFA 1AL3A 4PE5B 1XVYA 2Y7PA 5DEXB 4BDOA 3RGYA 1JW5A 4PE3A 4WXJA 1FTJA 3KC0A 5H8SA 1GGGA 5CBRA 3R7XA 4WEPA 1M5DA 5JK4A 3MPLA 4H0WA 4PBHA 1R9QA 1JNFA 3DP8A 5I59A 3C36A 3KN3A 1SYHA 3CR9A 4MNCA 5DVJA 4H65A 2HHMA 3FIRA 3PUVE 1SI1A 2PMSA 1BLFA 1BK4A 3KJTA 2RCAA 1YYZA 2V3UA 1NV2A 2THIA 4H8IA 1QUKA 3SDFA 2CZKA 2F8DA 1YCJA 4KFQA 3U65A 1MY3A 1XS5A 3B8BA 3K6WA 4O7MA 2ZNSA 4GX4A 3TQWA 2FVZA 5LOMA 3QK6A 3SETA 4QFLA 2BJJX 4U21A 1N3WA 3A09A 4H6DA 1PB9A 1B5IA 3D1RA 5CI5A 2ANJA 3U93A 3W15C 2Y5LA 4KXPA 4FATA 1B05A 3IK6B 4IGRA 4LATA 1RDZA 5LDZA 2LAOA 4XFEA 3GXAA 4MAGA 1JP4A 4YKIA 2I4CA 1US4A 4G68A 3DLNA 2G93A 4G68B 3HPIA 2OX3A 2Q8MA 4E0XA 2Z8DA 1FQCA 4FJPA 3A3UA 4F31B 4ONYA 1OQGA 1FTOA 1Q35A 1O64A 4DXCA 1MY4A 3IFCA 3KSJA 4MLVA 1OIBA 3FVNA 1BP5A 1IMCA 1QJMA 2F7CA 1SBPA 3UN6A 3FXUA 1FBCA 5CMCA 4JWXA 4IO2A 3FXRA 2GFEA 1LAXA 4BDMA 1LBBA 4QSDA 2OJTA 1S7YA 4G77A 1LCTA 2QFLA 3DP6A 1FQBA 4JDFA 1IUDA 2HQ0A 2XWVA 1YZ0A 2HAUA 4F3SA 4G4PA 4PAKA 4FEDA 4QF9A 1MDP1 4N6KA 1MY0A 2CZIA 4N91A 4DI4B 5I2NA 2UXAA 3TZAA 2Q9TA 3BFTA 1SI0A 5ISUA 3O66A 4FEBA 1I6BA 4EQ7A 4KYSA 2ZYOA 2PFYA 1B7HA 2H4IA 1VE4A 4GWWA 1PEBA 5EYFA 4KCDA 3IB1A 2QMXA 4I3EA 4GWOA 1SPIA 2NOOA 1FTAA 5EQ7A 4ECFA 1B4ZA 4IR8A 3CSBA 1FBDA 3RYDA 2ONKE 4P8BA 2HXWA 3TEPA 2R71A 3ONMA 2YLNA 5EYHA 4FIMA 3K6XA 1LFHA 2B4LA 1F9BA 1VR5A 4BDNA 5AA3A 2O51A 3LUZA 2YPNA 3W9WA 5EQ9A 2VPOA 1MH3A 3CIJA 5CMBA 5H8QB 1OLAA 2HFBA 3BKIB 4G2ZA 3VLVA 5HBCA 3G3GA 3HSTA 3ZKKA 1B7ZA 3K6VA 2PCRA 1JETA 4PFRA 2GHBA 2REJA 3IOUA 4AB5A 1M5BA 4JXIA 1USYE 3OELA 3EF7A 1NH7A 2DYXA 1NNPA 3K01A 3C32A 2O69A 2QS4A 3QAXA 3PTYA 4GQOA 4OERA 1BIYA 2XXIA 4OZ9A 1B32A 4RJZA 3WAFA 4NX1A 5K2YA 2DVCA 1A8FA 4P1LA 3MC2A 4F22A 4QHQA 2F3DA 4F29A 2XXQA 2F6GA 2RC8A 2F78A 3S9MC 4JWYA 5I56B 4GWXA 1NNTA 2PBWA 4I8CA 3ISPA 4OESA 3H7MA 2O84X 3IB0A 1VDWA 2H5YA 2QVUA 3D4CA 4THIA 5AA4B 4O7IA 4JB7A 3E79A 4I9DA 2XA5A 4JVCA 1B3HA 2DWAA 3C31A 4TQUQ 2L5VA 2XXRA 5DT6A 5A5XB 2BJIA 5H8QA 4F19A 2UVJA 4F3PA 1IMEA 3E9XA 3VVFA 3IJXB 3MVYA 4YB5A 2MKZA 4LVQA 2I3WA 3OO6A 1Y1ZA 2DE4A 1NL5A 4GWUA 3O6HA 3CSGA 4HE1A 1SD3A 4F1YA 3T96B 1FPIA 3FUZA 1LCFA 1UTBB 4N6PA 1YAEA 3TTRA 4XTCQ 4RPOA 4DIGA 3GBBA 2OBGA 1VSOA 4HCYA 1B0LA 3IFAA 3T22A 4QSEA 4PQJA 1KZ8A 3MUQA 5ICTA 4EQBA 4UA8A 3PPPA 3MBPA 4I40A 3B6TA 3H6TA 1FPFA 4XKNA 4N81A 3U72A 1EYKA 2OWSA 3IORA 5AE4A 2X7QA 3I6VA 4GL8A 1PDAA 1MPCA 3G3KA 4K3FA 2DSFA 1DTZA 1B4HA 4ZZAA 4GWSA 5IAIA 2PYYA 3LSFB 1SQYA 2E1SA 3PGFA 1OLCA 1MPBA 3EHUA 1ZTYA 1JW1A 3RNNA 5JEIA 1T0KA 2QMWA 3QIMA 4KPTA 2F36A 3MAMA 4P56A 1FBGA 1MM7A 4GVOA 3H3GA 2ESNA 5IGAA 2DE3A 4YAHX 4IO3A 1NV7A 2ZYKA 4H67A 3FZVA 4MIJA 3CG1A 1CE2A 3KBZA 5I5PA 4POXA 1JEUA 5I57B 2DDKA 4MEVA 1N04A 4GL0A 3M3LA 1FQDA 1SVXB 1MH4A 3PMWA 4OYVA 1MQIA 3A29A 4QXDA 5ET5A 2FBPA 5ET7A 2NXOA 3TCFA 2NVUB 4YMBA 3OO8A 1ELJA 1PB7A 4MJOA 2W7YA 4AB6A 1I6QA 4P1EA 2CZHA 2F35A 1NV5A 1AWBA 2FNCA 1Y9UA 5FHOA 3KBRA 1FQAA 4DCXA 3FJ7A 1MQDA 3PPOA 3EHSA 2ABHA 2HZLA 2OZZA 4ESWA 4ZEKA 1ZMGA 2I0CA 3H06B 3EHTA 1OMPA 2QVRA 4TOZA 1ZLQA 1JQFA 4NMYA 2V3QA 1IMFA 4QBAA 3I3VA 1LAGE 4NF4A 1Q1KA 4YKKA 2HXRA 2R6GE 3TKDA 4GFRA 4PFIA 2HAVA 2Y84A 4ZS9A 1FBEA 3QSLA 3TUSA 3PPRA 2DWIA 1NUYA 3LSWA 4PC9A 3KOTA 3TYHA 2ZNUA 1RDXA 4N07A 2RCBA 2NUVA 3IAZA 3FBPA 3GBAA 1MXWA 5EYGA 4X48A 5JTYB 4KHZE 5L8DA 3U94A 1MQGA 2OCUA 1B6HA 3MW0A 3UA8A 3VV5A 1SW4A 4R9FA 1B7UA 1RDYA 1M5EA 1POY1 3KFMA 2B65A 5ESYA 1NNKA 1WVJA 1LBXA 3H6UA 2HPGA 3CI8A 2XXXA 5I7IA 4KQPA 1VFEA 2Q88A 4F3BA 2I49A 3N94A 2VPNA 2F5XA 2OLBA 2Z8FA 1EH3A 1POTA 4XXUA 5H8HB 3MSTA 3F11A 4LONB 3IOWA 3MZBA 2WKYA 5DVFA 3FJMA 4PAIA 2XWOA 4IY6A 1AMFA 4ELOA 4P3LA 3FGSA 3K02A 4JVDA 1A99A 3EKIA 2ONRA 2PX1A 2I48A 1RYOA 3KN7A 1FPLA 4DXBA 2PVUA 3SEVA 1LBWA 4O8MA 1HSEA 3H6WA 4NF8B 3DP4A 4AS5A 3R6UA 3GYYA 1A40A 3LV0A 3Q29A 1XHYA 3T1BA 5LTCA 4N4UA 1P1QA 3SERA 4MNIA 4PFTA 2WX9A 4ZEFA 1ZIUA 3VE1B 3TTMA 3LR1A 4H8JA 3JV9A 3E13X 1S9TA 3CFLA 5F7VA 4O3CA 2NWJA 5K2XA 3HFUA 2QSXA 4ZDMA 3SESA 2WYKA 2UYEA 3ILUB 1SW2A 5ET8A 5A5LA 3FD3A 5AA4A 3K1MA 4C1TA 1D3KA 5JTYA 3CRBA 3CVGA 3ILTB 3TCGA 1IMDA 4GOTA 2XXKA 4UABA 3P7IA 1LLSA 2DP8A 2A5TB 3K00A 4H5GA 4MX6A 4DCYA 4XKPA 4DLDA 3DM0A 2QPQA 4MFIA 3KN8A 4C1UA 5FHMA 1KA0A 2M8CA 1MG1A 2VOZA 2AYSA 4OQOA 1SW5A 2DVZA 2FIEA 3SZPA 1FBHA 5L9SA 4DZ1A 4ESXA 2D5WA 3O9PA 4BLAA 5KDTA 4GWYA 3UIFA 1IIWA 3C4MA 2UVHA 4G8HA 1DPPA 3TFLA 3UK4A 2H98A 2QS2A 1NV4A 1DOTA 4DE8A 4F1UA 4OVJA 2FYIA 4G8NA 4X1DA 1MXUA 3KEIA 3T66A 3BFUA 4OWDA 2XX8A 4OXVA 2CMOA 1MQJA 5TU0A 5FTIA 4FECA 4N17A 2ALUA 4QRZA 3RPWA 4PETA 2OK2A 3PMVA 1B40A 3IOVA 3TQLA 4RYAA 2XXWA 5IZ3B 1A7LA 1BTJA 4NF5B 1RYXA 2RF1A 1QUIA 5I57A 2UVIA 4Z0IA 2DWHA 1QW0A 4ZEIA 3O28A 4N6DA 2WBDA 5AA2A 1LFGA 3MWBA 4C0RA 1WDNA 5TPAA 4NF0A 5ITOA 2PT2A 3MVZA 2DWJA 4GX3A 1DCUA 2KR0A 4HE0A 3O29A 5I2NB 2ZYNA 1FTMA 2O6AA 4R74A 3KZGA 3C35A 4JSDA 2IA4A 2KLFA 3FV1A 4OTEA 3U92A 1B46A 1N84A 1YTVA 5ET6A 1YXIA 1XT8A 4RPNA 4H46A 4I3YA 4JBZA 4LQ2A 3LSLA 3OSRA 5DTBA 1MRPA 2A5SA 3RTWB 4X04A 2VHAA 1FPDA 1R6ZA 2V25A 1QKAA 2XXUA 1CB6A 4OANA 3FXQA 1CNQA 3N26A 4E0WA 1J1NA 4EXLA 4PTKA 5DEXA 4NAPA 2VT5A 1UTBA 4ELPA 2Q2CA 3LSXA 1FCKA 4LZ7A 4O3BA 2Q74A 1EU8A 2GH9A 4BDQA 1NV1A 4ZE8A 4OEUA 3PD8A 1NMUA 3TAJA 2V4CA 4JWOA 1URSA 4M4GA 3QUJA 1NUXA 4PCDA 4TLLB 3TTNA 2X26A 3PUZE 4OHNA 1PB8A 4GD5A 4YICA 2QVVA 4X9TA 3PUYE 4R9GA 1IXIA 3V89B 1SW1A 3PD9A 3T9UA 1B3GA 3USDA 3ECRA 3VDFA 2I6EA 1FPKA 3M8UA 3EN3A 1NH8A 4OVQA 3H6VA 3EQ1A 1H45A 1IITA 4EXKA 4H5FA 3RQTA 1LBZA 4G8MA 2XWKA 3K2DA 4KD5A 1LBCA 3DELB 4GX6A 3MVXA 2RINA 4IO7A 1MPDA 1MQHA 1M5FA 1B0HA 2DXRA 4YMAA 1DPEA 1NKXA 4NE4A 4OETA 1PC3A 4WKMA 5EQ8A 2QL3A 2WBBA 2QS3A 5I58B 4XF5A 4GBWA 3PU5A 4MCOA 4N15A 1B52A 3IJOB 1B3FA 4U2RA 4JSOA 4TLMB 1B51A 2I4BA 4RK2A 1ANFA 1JVXA 4KCCA 1DBZA 1MXVA 4LZ8A 1MXXA 3E4RA 2CEXA 4MH5A 2ZYMA 5IKBA 4EDPA 5H8HA 4U4XA 5HM4B 4HCWA 4QFPA 1K9ZA 3UP9A 4F2QA 1DMBA 3E3KA 3U1OA 3W9VA 4GBVA 2ONSA 3M3FA 2XXTA 2PT1A 3BIHA 4P11A 3QYTA 2CZLA 4NGUA 3U8QA 2VD3A 1YPNA 1TXFA 3VLWA 4IY5A 3OEMA 1I6AA 2DOJA 3CHGA 5H8NA 4MMPA 3B6QA 1DTGA 4YB6A 3SEWA 4MNPA 4LQ5A 4NN3A 4EF1A 1UQWA 1LAHE 5KCJB 4PDHA 4PF8A 2Y5KA 3FV2A 5BWJA 4XKRA 1Z7ME 2Z8EA 4OFJA 1B1XA 3E78A 3K4UA 3C9HA 1JVYA 1QUJA 2ZZWA 1KWHA 3Q26A 3N6TA 4RXLA 1FQEA 4R6HA 4I62A 4MLQA 5EHMA 4R6KA 1P1WA 1MXYA 1FTKA 5FHNA 1AH5A 3GLBA 1QULA 1LB8A 2Y7IA 4Q8RA 3V5AA 4ELQA 4U4SA 1ATGA 3MP8A 4RK9A 4PGNA 4LZ5A 4LUBA 1D9VA 1IMBA 3IOTA 1GR2A 3PPNA 2ZXTA 5EQAA 3ODBA 4GXAA 3G3IA 3JZJA 2I58A 4PGPA 2B3FA 4HS7A 2XD3A 5ELVA 5CM6A 1Z7NE 2VP1A 3AXFA 1B58A 1IZ1A 3HHFA 3IL1B 3OO7A 1B9JA 1WODA 2OWZA 3L6GA 2Y7RA 3V83A 3M3KA 1A55A 1XOCA 1G0IA 3OEKA 4U1ZA 5DVIA 1NV3A 2X7PA 5I2KB 3TTLA 3Q25A 1OVTA 3C33A 4PFBA 5ICQA 2O1LA 5F1QA 2F6PA 2ZNTA 1KA1A 2XX7A 4ZZEA 4AQ4A 2RC7A 1B3EA 4XEQA 2P3NA 3ZSFA 4Q5TA 1IXCA 1LEVA 1MXZA 2V93A 4NHBA 3FVKA 2QRYA 1XI6A 1LSTA 3TMGA 5FTHA 1TT1A 3FJGA 5CMKA 4IB2A 4UACA 3LBSA 4PBQA 3BIGA 4X1BA 2H25A 4LA9A 4FORA 1NI9A 2XHDA 1OQHA 1NFTA 1LB9A 4MBPA 3OSQA 3B6WA 4Z7EA 4U23A 1IXHA 3G3HA 4U22A 4F3GA 4P9KA 1ZKBA 4NF8A 1B1HA 5DYHA 3HCQA 4NTLA 1M5CA 2DS9A 3HN0A 1Y3QA 3K0VA 4Q30B 4QFKA 4GIZA 2V84A 2XXVA 4NQ8A 5AA2B 2Y7WA 2DXYA 4N13A 3K6UA 5F24A 4HTGA 4PP0A 1EZPA 3H4ZA 2RC9A 3KOSA 2F7AA 3VLUA 5AA2D 2VD2A 1TFAA 4PFWA 3UORA 4NF5A 1LFIA 1FPBA 4NWCA 4OENA 3PV0E 5L9OA 1FQFA 4OVPA 1PBPA 2O68A 3MJNA 1Q9DA 1FJ6A 3UGWA 2GRVA 3O2AA 2XXHA 1LGBC 1Y4TA 2GQ1A 3LC8A 2WEFA 3OMBA 1URDA 4GWZA 5I3SA 1MY1A 5H8FA 4LN5A 1K9YA 1ZU0A 3TPAA 3C34A 1D9YA 5J1DA 5I84A 4F2OA 5CRYA 1H3DA 2UYFA 4EQ9A 4IO4A 2F97A 1UIVA 2O7IA 5I56A 4HXVA 1Y1MA 5B70A 2HCAA 5KCJA 3WAEA 1UTHB 1P99A 4O94A 1EZOA 1FBFA 1GVCA 4R72A 3TODA 1IQ7A 4NF4B 2UVGA 4I1DA 5M2VA 3MQ9A 3GZGA 2ZMBA 2Q8JA 1Y3PA 3B7DA 4BDLA 3S9LC 4G61A 3Q28A 5TPAB 3TELA 3IB2A 1N76A 4XIGQ 2RKMA 3S4UA 1FBPA 1FTLA 5H8FB 4HE2A 4PDDA 4L17A 2QS1A 4F1VA 2XXYA 1Y3NA 3O97A 1URGA 4P0IA 2P0SA 4NF6B 5I2KA 4N8GA 5IZ3A 1JEVA 3H03A 4PFYA 1N0TA 1N3XA 5CC2A 4RY1A 1N7WA 5TP9A 2DE2A 4R2BA 5TP9B 3RLFE 3G3FA 5I58A 3SKPA 3QMFA 4NWDA 4BDRA 4MF3A 1EYJA 4NEDA 1NV0A 2B3BA 4MHFA 4KYEA 5T3JA 2G29A 3HHGA 3VXBA 4ND9A 4OA4A 3VVEA 2CEYA 3O6IA 1FPGA 4U1OA 3SEYA 4H1XA 4RNSA 3T9HB 2XXPA 2VGQA 4ZE9A 1A54A 2AL4A 1D9QA 4ZECA 1XC1A 4KI0E 1FW0A 1R1NA 3S9NC 3OO9A 1QKBA 4ZEBA 1SYIA 3PMXA 4R6YA 1USYH 3FATA 4QFNA 3FVGA 5HPQA 1MDQA 3VVDA 2R8TA 4G68C 3TCHA 3PUXE 2F7BA 3T9VA 1UTHA 3EPEA 1QVSA 4O3AA 4POWA 4KYDA 3R26A 3VFJA 4WEDA 3IR1A 3PUWE 5I59B 4QSCA 3JYRA 5FBPA 1L5TA 1DSNA 4OVTA 1H43A 1B3LA 4HW8A 2GHAA 4QFOA 1TFDA 2XD2A 1FPEA 5B7DA 4DI3D 1HSJA 5BUUA 4GXSB 1II5A 1BKAA 3ROJA 5ITPA 4F39A 3HO7A 2O1MA 2ZZXA 5DW8A 4H45A 2Q89A 1Y4CA 4KR5A 5AA1A 4YZZA 3N6UA 1XVXA 4M1VA 1EYIA 2R9JA 3T0JA 1D4NA 1PBQA 2H9BA 3TDJA 1JW4A 3FXBA 2ZZVA 4OVSA 3S2VA 1B2HA 3VXCA 4ISUA 2QJEA 1MM6A 4LP2B 1NUWA 2P2AA 1S50A 2I3VA 3RT8A 1GTKA 3K1PA 5EHSA 1AOVA 5J16A 1P1NA 5CBSA 1FPJA 3KG2A 4IO5A 1INPA 3RN8A 3FVOA 2OWTA 4OFLA 1ZBMA 4IGTA 1AIVA 1N7XA 1P1UA 3KJ7A 4F18A 4YKPA 2REGA 1QGXA 1TWYA 2V3TA 2PFZA 1RKMA 4OVRA 5KZTA 2E0SA 3CFXA 3SEUA 1LAFE 1NUZA 3I5OA 1IEJA 3K1NA 5H8NB 3G7WA 3KGCA 3SEXA 1MY2A 3IO6A 2F3BA 2HZKA 1LBVA 1P1OA 4FE8A 1NV6A 3CFZA 3QXMA 1FSAA 2Z22A 1O63A 5IM2A 3RPLA 3BBRA 2H99A 1EZ9A 1B5JA 2Z23A 3D4GA 2AIXA 3LUYA 4GRKA 3A3CA 1OVBA 3KC1A 3OXNA 1Y20A 3MZ1A 4FBPA 5KDTB 3IX1A 2AL5A 4DDDA 4AS4A 4ELRA 2FA7A 1UIUA 4YKJA 4XKQA 2FIXA 1R9LA 1HSLA 4JVIA 4R2FA 3MYUA 1A8EA 2FHYA 1US5A 4P0GA 3OOAA 4R73A 3N5LA 4N8YA 4OMBA 4X8RA 1G0HA 2D21A 1VFDA 2A5TA 5A5XA 3T9XB 2F34A 2O7UA 3T93B 3MP6A 3IO4A 3MP1A 2IEEA 1NNFA 3L6HA 1B5HA 3RY3A 3KSXA 1LBYA 3G3JA 3TTKA 5L9MA 1I69A 1IMAA 3NOHA 4FAJA 4ZEDA 2YJPA 3S9EA 4IO6A 2DQVA 3ZS6A 3PPQA 4DXUA
chains in the Genus database with same CATH topology
1LCFA 4GF8A 1UTBB 4RPNA 4N6PA 3MVWA 1YAEA 1GV8A 2O68A 4EUOA 2XX9A 3TTRA 4XTCQ 3MJNA 4RPOA 4DIGA 3GBBA 4JBZA 4EF2A 2OBGA 4LQ2A 1VSOA 3RT6B 5AA2B 3UGWA 4HCYA 3MZ9A 1B0LA 3LSLA 3MPKA 3T22A 4QSEA 3OSRA 2GRVA 4PQJA 3O2AA 5DTBA 5CMMA 4YU0A 1MRPA 3MUQA 2A5SA 1LGBC 2XXHA 3RTWB 5ICTA 4EQBA 4UA8A 1Y4TA 2VHAA 3PPPA 3MBPA 3THIA 3LC8A 3B6TA 3H6TA 1R6ZA 1MS7A 4XKNA 3U72A 1ZJLA 2OWSA 2V25A 3OMBA 3IORA 1URDA 5AE4A 2X7QA 1MY1A 1QKAA 5H8FA 2XXUA 3I6VA 4GL8A 1CB6A 3FXQA 1ZU0A 2I0BA 1PDAA 4R75A 1MPCA 3RTFB 2D3IA 3C34A 1J1NA 1D9YA 2DSFA 3G3KA 3N26A 4K3FA 5DEXA 4E0WA 3V8XB 4EXLA 1DTZA 4F2OA 5I84A 1B4HA 3O6GA 5CRYA 1H3DA 1H76A 2UYFA 4EQ9A 1UTBA 4IO4A 4ELPA 4ZZAA 3W9VA 2F97A 2Q2CA 1UIVA 1FCKA 3LSXA 4LZ7A 4OFOA 5IAIA 2PYYA 2Y7KA 2O7IA 4O3BA 5I56A 3LSFB 1EU8A 3CG3A 1SQYA 1Y1MA 2E1SA 5B70A 2HCAA 3PGFA 4NF6A 2GH9A 4PFUA 5KCJA 4Q0CA 3WAEA 4BDQA 1UTHB 1OLCA 1MPBA 3EHUA 1ZTYA 4RA1A 4ZE8A 1SDXA 4OEUA 1P99A 3PD8A 1NMUA 3TAJA 2P1SA 1O7TA 4GLIA 2Q2AA 4JWOA 3OD7A 1URSA 1JW1A 4M4GA 3RNNA 5JEIA 1T0KA 2QMWA 1EZOA 1GVCA 4R72A 3TODA 3OENA 3HV1A 3QIMA 3QUJA 3RUMA 2HEUA 3FASA 3QUFA 1IQ7A 4KPTA 4NF4B 4TLLB 1IXGA 4YB7A 2UVGA 3Q27A 2F36A 4I1DA 3MQ9A 5M2VA 3ZKLA 3TTNA 2X26A 3GZGA 3MAMA 2ZMBA 3PUZE 1MM7A 4GVOA 1Y3PA 3B7DA 1H44A 2ESNA 3H3GA 4OHNA 4OEVA 1PB8A 2DE3A 4YAHX 4GD5A 4IO3A 4YICA 4BDLA 4X9TA 3S9LC 3PUYE 2ZYKA 1AL3A 1IXIA 3Q28A 4H67A 1XVYA 4PE5B 1SW1A 4R9GA 5TPAB 3TELA 3PD9A 3V89B 2Y7PA 3IB2A 1N76A 3FZVA 5DEXB 3T9UA 3RGYA 1JW5A 3VLUA 4BDOA 1B3GA 4XIGQ 2RKMA 3S4UA 1FTLA 3CG1A 5H8FB 1CE2A 4WXJA 1FTJA 3USDA 5H8SA 3ECRA 1GGGA 4POXA 1JEUA 5I57B 4L17A 2QS1A 5CBRA 3VDFA 3R7XA 2I6EA 4F1VA 1N04A 4WEPA 4GL0A 2XXYA 3M3LA 1Y3NA 1FQDA 1SVXB 3M8UA 1M5DA 1MH4A 5JK4A 3EN3A 3PMWA 3MPLA 3O97A 4OYVA 4H0WA 1MQIA 1NH8A 1URGA 4P0IA 2NXOA 1R9QA 2P0SA 4NF6B 5I2KA 1JNFA 3DP8A 3EQ1A 3H6VA 2NVUB 1H45A 1IITA 3OO8A 1ELJA 3C36A 3KN3A 1PB7A 4YMBA 1SYHA 2W7YA 3CR9A 4EXKA 1JEVA 4AB6A 3H03A 4H5FA 1I6QA 3RQTA 4PFYA 5DVJA 4H65A 1N0TA 1N3XA 2F35A 5CC2A 3FIRA 4RY1A 3PUVE 4G8MA 1N7WA 1SI1A 2FNCA 2PMSA 1BLFA 3KJTA 1Y9UA 5FHOA 3KBRA 5TP9A 3K2DA 2RCAA 2DE2A 4R2BA 5TP9B 3RLFE 3G3FA 5I58A 1FQAA 3SKPA 4DCXA 3FJ7A 1MQDA 4KD5A 3PPOA 1LBCA 3EHSA 2ABHA 2HZLA 2V3UA 2OZZA 2THIA 4H8IA 4NWDA 1QUKA 3DELB 4BDRA 4ESWA 4MF3A 3SDFA 3MVXA 4ZEKA 1ZMGA 2F8DA 4KFQA 1YCJA 2RINA 4IO7A 4NEDA 2I0CA 3H06B 1MPDA 3EHTA 1MQHA 2B3BA 1MY3A 1OMPA 1XS5A 3S9EA 1M5FA 1B0HA 4KYEA 3K6WA 2G29A 4TOZA 1ZLQA 3HHGA 1JQFA 3VXBA 4NMYA 2ZNSA 4ND9A 2V3QA 2DXRA 3VVEA 3I3VA 3O6IA 1LAGE 3TQWA 3U1OA 4YMAA 5LOMA 4NF4A 4U1OA 3SEYA 1DPEA 1Q1KA 1NKXA 4NE4A 4YKKA 4OETA 1PC3A 3QK6A 4H1XA 2R6GE 4RNSA 4WKMA 4QFLA 3SETA 3T9HB 3TKDA 2XXPA 2BJJX 2VGQA 4GFRA 4U21A 4ZE9A 2QL3A 5I58B 2HAVA 2QS3A 1A54A 2Y84A 2AL4A 4ZS9A 1N3WA 3A09A 4ZECA 3QSLA 3PU5A 4H6DA 1B52A 3IJOB 3TUSA 1B3FA 1PB9A 1XC1A 4U2RA 3PPRA 2DWIA 4JSOA 1B5IA 4KI0E 4TLMB 4YKIA 5CI5A 2ANJA 1FW0A 3LSWA 1B51A 1R1NA 3U93A 2I4BA 3KOTA 3W15C 3S9NC 4RK2A 3TYHA 2ZNUA 3OO9A 1ANFA 1JVXA 2RCBA 4KCCA 1QKBA 4N07A 2NUVA 4ZEBA 3IAZA 1SYIA 3PMXA 1MXVA 4FATA 3GBAA 1B05A 1MXWA 3IK6B 4IGRA 4R6YA 4X48A 1USYH 3FATA 4LATA 4LZ8A 5JTYB 4QFNA 2LAOA 3FVGA 5HPQA 4KHZE 5L8DA 1MDQA 1MXXA 3VVDA 3E4RA 3GXAA 4G68C 3TCHA 3U94A 3PUXE 1MQGA 2I4CA 4MH5A 1US4A 4G68A 2F7BA 2OCUA 2G93A 2ZYMA 3DLNA 1B6HA 4G68B 3HPIA 3MW0A 3T9VA 5IKBA 4E0XA 4EDPA 5H8HA 4U4XA 3UA8A 3VV5A 4HCWA 5HM4B 1SW4A 2Z8DA 4R9FA 1UTHA 4QFPA 1B7UA 1FQCA 4FJPA 3A3UA 3EPEA 1M5EA 4F31B 1POY1 3KFMA 4ONYA 3UP9A 1OQGA 4F2QA 1DMBA 1FTOA 1QVSA 1Q35A 2B65A 3E3KA 4KYDA 4O3AA 3R26A 4POWA 1O64A 4DXCA 3VFJA 1MY4A 2ONSA 3M3FA 4HW8A 2XXTA 1NNKA 4WEDA 3KSJA 2PT1A 3IR1A 1WVJA 3PUWE 4MLVA 4P11A 4QSCA 3JYRA 5I59B 3H6UA 2CZLA 3QYTA 3U8QA 3CI8A 1OIBA 3FVNA 2XXXA 2VD3A 4KQPA 1L5TA 1DSNA 1BP5A 1VFEA 2Q88A 4F3BA 2I49A 1YPNA 3N94A 1H43A 1B3LA 1QJMA 1TXFA 2F7CA 2F5XA 2GHAA 1SBPA 2OLBA 2Z8FA 4IY5A 4QFOA 3VLWA 3OEMA 1TFDA 2XD2A 3UN6A 3FXUA 1I6AA 2DOJA 5H8NA 5CMCA 4JWXA 1EH3A 4IO2A 5B7DA 1POTA 3B6QA 4XXUA 3FXRA 1HSJA 1DTGA 2GFEA 1LAXA 5H8HB 5BUUA 4GXSB 3F11A 1II5A 4BDMA 1LBBA 4LONB 3IOWA 1BKAA 4YB6A 4QSDA 3MZBA 3SEWA 2WKYA 5DVFA 5ITPA 2OJTA 1S7YA 3FJMA 4LQ5A 4F39A 4EF1A 4G77A 1UQWA 1LCTA 4IY6A 1AMFA 1LAHE 3HO7A 5KCJB 4ELOA 5AA3A 2O1MA 3FGSA 3K02A 3DP6A 1A99A 1FQBA 2ONRA 3FV2A 2PX1A 2Q89A 1IUDA 4JDFA 1Y4CA 2HQ0A 1Z7ME 2I48A 4XKRA 5BWJA 2Z8EA 1RYOA 2HAUA 4KR5A 4F3SA 4OFJA 4G4PA 5AA1A 3KN7A 1B1XA 4YZZA 3N6UA 4DXBA 4FEDA 2PVUA 3SEVA 3K4UA 4QF9A 1XVXA 3C9HA 1JVYA 1HSEA 1QUJA 1KWHA 1MDP1 1MY0A 3Q26A 3H6WA 3TCFA 4M1VA 4NF8B 5I2NA 2UXAA 3DP4A 3R6UA 3N6TA 1A40A 3TZAA 3Q29A 2Q9TA 4RXLA 3BFTA 1FQEA 4R6HA 1SI0A 2R9JA 5ISUA 1XHYA 3O66A 1D4NA 1I6BA 4FEBA 4I62A 4EQ7A 1PBQA 2H9BA 2ZYOA 4KYSA 1P1QA 4MLQA 5EHMA 3TDJA 3SERA 1B7HA 2H4IA 1P1WA 1VE4A 4R6KA 4PFTA 1PEBA 5EYFA 4ZEFA 1ZIUA 4KCDA 1JW4A 1FTKA 1MXYA 3VE1B 5FHNA 3TTMA 1AH5A 3IB1A 3LR1A 4H8JA 2QMXA 3JV9A 3E13X 3GLBA 1QULA 4GWOA 3S2VA 1B2HA 3VXCA 1LB8A 1S9TA 3CFLA 4ISUA 5F7VA 4O3CA 2NOOA 2Y7IA 3V5AA 2QJEA 4ELQA 2NWJA 4Q8RA 1MM6A 5K2XA 4U4SA 1ATGA 2QSXA 4ECFA 3MP8A 4LP2B 4RK9A 1B4ZA 2P2AA 4ZDMA 1S50A 4LZ5A 1D9VA 2I3VA 3CSBA 4LUBA 1GTKA 2UYEA 3ILUB 1SW2A 3K1PA 3RT8A 5EHSA 3IOTA 3FD3A 5AA4A 1AOVA 3K1MA 1P1NA 4C1TA 1D3KA 5CBSA 2ONKE 3KG2A 5I59A 5JTYA 1GR2A 3CRBA 2HXWA 3CVGA 3ILTB 4IO5A 4GOTA 3TCGA 3TEPA 2R71A 3PPNA 2ZXTA 3RN8A 3ONMA 3FVOA 2YLNA 2OWTA 4OFLA 1ZBMA 3P7IA 4IGTA 3TPAA 4FIMA 1AIVA 1N7XA 3K6XA 3ODBA 4GXAA 1P1UA 3KJ7A 3G3IA 4F18A 1LFHA 1LLSA 1F9BA 2DP8A 2REGA 4YKPA 1VR5A 4BDNA 1TWYA 2A5TB 2O51A 2I58A 2V3TA 3JZJA 2B3FA 3K00A 4H5GA 4HS7A 2XD3A 2YPNA 3W9WA 4DCYA 4XKPA 5J1DA 5ELVA 1MH3A 3CIJA 4DLDA 3DM0A 5CMBA 5H8QB 5CM6A 1OLAA 1RKMA 2QPQA 1Z7NE 2HFBA 3KN8A 3BKIB 4G2ZA 4MFIA 3VLVA 2VP1A 4C1UA 5FHMA 3AXFA 1B58A 1IZ1A 5KZTA 5HBCA 3G3GA 3HHFA 2M8CA 3IL1B 3HSTA 3ZKKA 3OO7A 1B9JA 1WODA 2E0SA 1B7ZA 1MG1A 3L6GA 3CFXA 3SEUA 1LAFE 3K6VA 2Y7RA 3V83A 2VOZA 2AYSA 3I5OA 1JETA 4OQOA 1IEJA 3K1NA 3M3KA 1SW5A 1A55A 5H8NB 2DVZA 2GHBA 1XOCA 3G7WA 2REJA 3OEKA 3KGCA 3SEXA 3IOUA 4AB5A 1M5BA 1MY2A 3IO6A 4JXIA 4U1ZA 1USYE 3OELA 5DVIA 2Q8JA 3EF7A 2HZKA 5L9SA 2X7PA 4DZ1A 1P1OA 4ESXA 4FE8A 1NH7A 5I2KB 2D5WA 1NNPA 2DYXA 3CFZA 3TTLA 3K01A 3O9PA 3Q25A 1OVTA 3QXMA 3C33A 4BLAA 2Z22A 2O69A 3C32A 1O63A 2QS4A 2O1LA 3QAXA 3BBRA 5F1QA 5ICQA 2F6PA 5KDTA 2ZNTA 4GQOA 3UIFA 1IIWA 4OERA 3C4MA 2UVHA 1BIYA 2H99A 4G8HA 2XX7A 1DPPA 1EZ9A 1B5JA 2XXIA 2H98A 2QS2A 4OZ9A 4ZZEA 3TFLA 3UK4A 2Z23A 4AQ4A 1B32A 1DOTA 2RC7A 4DE8A 4RJZA 4OVJA 3D4GA 1B3EA 4F1UA 2FYIA 3WAFA 4G8NA 2AIXA 5K2YA 4X1DA 2DVCA 1MXUA 1A8FA 3KEIA 3LUYA 3BFUA 4GRKA 3A3CA 4OWDA 3T66A 2XX8A 4OXVA 4Q5TA 3ZSFA 3MC2A 2CMOA 4F22A 4QHQA 1IXCA 1OVBA 4F29A 1MQJA 1MXZA 3OXNA 5TU0A 1Y20A 2XXQA 2F6GA 5FTIA 3MZ1A 4FECA 2V93A 2RC8A 2F78A 3FVKA 3S9MC 2QRYA 2ALUA 4JWYA 4QRZA 3RPWA 3SESA 4PETA 5KDTB 5I56B 1LSTA 2OK2A 3TMGA 3IX1A 2AL5A 3PMVA 1B40A 1NNTA 5FTHA 4DDDA 2PBWA 3IOVA 3TQLA 1TT1A 2FA7A 3FJGA 4I8CA 1UIUA 2XXWA 4OESA 4RYAA 4IB2A 4ELRA 4UACA 3H7MA 2O84X 5CMKA 3LBSA 3IB0A 1A7LA 1BTJA 4YKJA 4X1BA 2H5YA 2H25A 4NF5B 4LA9A 4FORA 3D4CA 4THIA 5AA4B 1RYXA 2RF1A 4XKQA 2XHDA 1OQHA 1NFTA 1LB9A 1QUIA 4MBPA 3OSQA 5I57A 3B6WA 4JB7A 2UVIA 4Z0IA 2DWHA 1R9LA 4I9DA 4Z7EA 4U23A 1HSLA 1IXHA 3G3HA 4U22A 4R2FA 1QW0A 4F3GA 1B3HA 4ZEIA 1ZKBA 2DWAA 4NF8A 1B1HA 3O28A 5DYHA 3C31A 1A8EA 4TQUQ 3HCQA 4NTLA 1US5A 4P0GA 2XXRA 1M5CA 2DS9A 3HN0A 1Y3QA 1LFGA 3K0VA 3OOAA 5DT6A 3MWBA 4R73A 5A5XB 4Q30B 5AA2A 3N5LA 5H8QA 4C0RA 4OMBA 1WDNA 4QFKA 5ITOA 5TPAA 4F19A 4GIZA 2UVJA 2V84A 2D21A 1VFDA 2A5TA 2PT2A 2XXVA 3MVZA 2DWJA 3E9XA 3T9XB 3VVFA 4F3PA 5A5XA 2F34A 3IJXB 2Y7WA 2DXYA 4N13A 3K6UA 3MVYA 2O7UA 3T93B 3MP6A 3O29A 4HTGA 4YB5A 3IO4A 3MP1A 2IEEA 4PP0A 3H4ZA 4LVQA 2ZYNA 5I2NB 2RC9A 1EZPA 1NNFA 2I3WA 3L6HA 1B5HA 3KOSA 3RY3A 2F7AA 1FTMA 1Y1ZA 2O6AA 3G3JA 3KSXA 3OO6A 2VD2A 5L9MA 2DE4A 3TTKA 5AA2D 1TFAA 4PFWA 1NL5A 1I69A 3KZGA 4R74A 3O6HA 3C35A 3CSGA 4NF5A 1SD3A 3UORA 1LFIA 4JSDA 2IA4A 2KLFA 3FV1A 4NWCA 4F1YA 4FAJA 4ZEDA 4OENA 2YJPA 3PV0E 4IO6A 4OTEA 3T96B 1B46A 3U92A 1FQFA 1N84A 5L9OA 1YTVA 2DQVA 3PPQA 3ZS6A 1PBPA 3FUZA 4DXUA 1XT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCF A;  4GF8 A;  1UTB B;  4RPN A;  4N6P A;  3MVW A;  1YAE A;  1GV8 A;  2O68 A;  4EUO A;  2XX9 A;  3TTR A;  4XTC Q;  3MJN A;  4RPO A;  4DIG A;  3GBB A;  4JBZ A;  4EF2 A;  2OBG A;  4LQ2 A;  1VSO A;  3RT6 B;  5AA2 B;  3UGW A;  4HCY A;  3MZ9 A;  1B0L A;  3LSL A;  3MPK A;  3T22 A;  4QSE A;  3OSR A;  2GRV A;  4PQJ A;  3O2A A;  5DTB A;  5CMM A;  4YU0 A;  1MRP A;  3MUQ A;  2A5S A;  1LGB C;  2XXH A;  3RTW B;  5ICT A;  4EQB A;  4UA8 A;  1Y4T A;  2VHA A;  3PPP A;  3MBP A;  3THI A;  3LC8 A;  3B6T A;  3H6T A;  1R6Z A;  1MS7 A;  4XKN A;  3U72 A;  1ZJL A;  2OWS A;  2V25 A;  3OMB A;  3IOR A;  1URD A;  5AE4 A;  2X7Q A;  1MY1 A;  1QKA A;  5H8F A;  2XXU A;  3I6V A;  4GL8 A;  1CB6 A;  3FXQ A;  1ZU0 A;  2I0B A;  1PDA A;  4R75 A;  1MPC A;  3RTF B;  2D3I A;  3C34 A;  1J1N A;  1D9Y A;  2DSF A;  3G3K A;  3N26 A;  4K3F A;  5DEX A;  4E0W A;  3V8X B;  4EXL A;  1DTZ A;  4F2O A;  5I84 A;  1B4H A;  3O6G A;  5CRY A;  1H3D A;  1H76 A;  2UYF A;  4EQ9 A;  1UTB A;  4IO4 A;  4ELP A;  4ZZA A;  3W9V A;  2F97 A;  2Q2C A;  1UIV A;  1FCK A;  3LSX A;  4LZ7 A;  4OFO A;  5IAI A;  2PYY A;  2Y7K A;  2O7I A;  4O3B A;  5I56 A;  3LSF B;  1EU8 A;  3CG3 A;  1SQY A;  1Y1M A;  2E1S A;  5B70 A;  2HCA A;  3PGF A;  4NF6 A;  2GH9 A;  4PFU A;  5KCJ A;  4Q0C A;  3WAE A;  4BDQ A;  1UTH B;  1OLC A;  1MPB A;  3EHU A;  1ZTY A;  4RA1 A;  4ZE8 A;  1SDX A;  4OEU A;  1P99 A;  3PD8 A;  1NMU A;  3TAJ A;  2P1S A;  1O7T A;  4GLI A;  2Q2A A;  4JWO A;  3OD7 A;  1URS A;  1JW1 A;  4M4G A;  3RNN A;  5JEI A;  1T0K A;  2QMW A;  1EZO A;  1GVC A;  4R72 A;  3TOD A;  3OEN A;  3HV1 A;  3QIM A;  3QUJ A;  3RUM A;  2HEU A;  3FAS A;  3QUF A;  1IQ7 A;  4KPT A;  4NF4 B;  4TLL B;  1IXG A;  4YB7 A;  2UVG A;  3Q27 A;  2F36 A;  4I1D A;  3MQ9 A;  5M2V A;  3ZKL A;  3TTN A;  2X26 A;  3GZG A;  3MAM A;  2ZMB A;  3PUZ E;  1MM7 A;  4GVO A;  1Y3P A;  3B7D A;  1H44 A;  2ESN A;  3H3G A;  4OHN A;  4OEV A;  1PB8 A;  2DE3 A;  4YAH X;  4GD5 A;  4IO3 A;  4YIC A;  4BDL A;  4X9T A;  3S9L C;  3PUY E;  2ZYK A;  1AL3 A;  1IXI A;  3Q28 A;  4H67 A;  1XVY A;  4PE5 B;  1SW1 A;  4R9G A;  5TPA B;  3TEL A;  3PD9 A;  3V89 B;  2Y7P A;  3IB2 A;  1N76 A;  3FZV A;  5DEX B;  3T9U A;  3RGY A;  1JW5 A;  3VLU A;  4BDO A;  1B3G A;  4XIG Q;  2RKM A;  3S4U A;  1FTL A;  3CG1 A;  5H8F B;  1CE2 A;  4WXJ A;  1FTJ A;  3USD A;  5H8S A;  3ECR A;  1GGG A;  4POX A;  1JEU A;  5I57 B;  4L17 A;  2QS1 A;  5CBR A;  3VDF A;  3R7X A;  2I6E A;  4F1V A;  1N04 A;  4WEP A;  4GL0 A;  2XXY A;  3M3L A;  1Y3N A;  1FQD A;  1SVX B;  3M8U A;  1M5D A;  1MH4 A;  5JK4 A;  3EN3 A;  3PMW A;  3MPL A;  3O97 A;  4OYV A;  4H0W A;  1MQI A;  1NH8 A;  1URG A;  4P0I A;  2NXO A;  1R9Q A;  2P0S A;  4NF6 B;  5I2K A;  1JNF A;  3DP8 A;  3EQ1 A;  3H6V A;  2NVU B;  1H45 A;  1IIT A;  3OO8 A;  1ELJ A;  3C36 A;  3KN3 A;  1PB7 A;  4YMB A;  1SYH A;  2W7Y A;  3CR9 A;  4EXK A;  1JEV A;  4AB6 A;  3H03 A;  4H5F A;  1I6Q A;  3RQT A;  4PFY A;  5DVJ A;  4H65 A;  1N0T A;  1N3X A;  2F35 A;  5CC2 A;  3FIR A;  4RY1 A;  3PUV E;  4G8M A;  1N7W A;  1SI1 A;  2FNC A;  2PMS A;  1BLF A;  3KJT A;  1Y9U A;  5FHO A;  3KBR A;  5TP9 A;  3K2D A;  2RCA A;  2DE2 A;  4R2B A;  5TP9 B;  3RLF E;  3G3F A;  5I58 A;  1FQA A;  3SKP A;  4DCX A;  3FJ7 A;  1MQD A;  4KD5 A;  3PPO A;  1LBC A;  3EHS A;  2ABH A;  2HZL A;  2V3U A;  2OZZ A;  2THI A;  4H8I A;  4NWD A;  1QUK A;  3DEL B;  4BDR A;  4ESW A;  4MF3 A;  3SDF A;  3MVX A;  4ZEK A;  1ZMG A;  2F8D A;  4KFQ A;  1YCJ A;  2RIN A;  4IO7 A;  4NED A;  2I0C A;  3H06 B;  1MPD A;  3EHT A;  1MQH A;  2B3B A;  1MY3 A;  1OMP A;  1XS5 A;  3S9E A;  1M5F A;  1B0H A;  4KYE A;  3K6W A;  2G29 A;  4TOZ A;  1ZLQ A;  3HHG A;  1JQF A;  3VXB A;  4NMY A;  2ZNS A;  4ND9 A;  2V3Q A;  2DXR A;  3VVE A;  3I3V A;  3O6I A;  1LAG E;  3TQW A;  3U1O A;  4YMA A;  5LOM A;  4NF4 A;  4U1O A;  3SEY A;  1DPE A;  1Q1K A;  1NKX A;  4NE4 A;  4YKK A;  4OET A;  1PC3 A;  3QK6 A;  4H1X A;  2R6G E;  4RNS A;  4WKM A;  4QFL A;  3SET A;  3T9H B;  3TKD A;  2XXP A;  2BJJ X;  2VGQ A;  4GFR A;  4U21 A;  4ZE9 A;  2QL3 A;  5I58 B;  2HAV A;  2QS3 A;  1A54 A;  2Y84 A;  2AL4 A;  4ZS9 A;  1N3W A;  3A09 A;  4ZEC A;  3QSL A;  3PU5 A;  4H6D A;  1B52 A;  3IJO B;  3TUS A;  1B3F A;  1PB9 A;  1XC1 A;  4U2R A;  3PPR A;  2DWI A;  4JSO A;  1B5I A;  4KI0 E;  4TLM B;  4YKI A;  5CI5 A;  2ANJ A;  1FW0 A;  3LSW A;  1B51 A;  1R1N A;  3U93 A;  2I4B A;  3KOT A;  3W15 C;  3S9N C;  4RK2 A;  3TYH A;  2ZNU A;  3OO9 A;  1ANF A;  1JVX A;  2RCB A;  4KCC A;  1QKB A;  4N07 A;  2NUV A;  4ZEB A;  3IAZ A;  1SYI A;  3PMX A;  1MXV A;  4FAT A;  3GBA A;  1B05 A;  1MXW A;  3IK6 B;  4IGR A;  4R6Y A;  4X48 A;  1USY H;  3FAT A;  4LAT A;  4LZ8 A;  5JTY B;  4QFN A;  2LAO A;  3FVG A;  5HPQ A;  4KHZ E;  5L8D A;  1MDQ A;  1MXX A;  3VVD A;  3E4R A;  3GXA A;  4G68 C;  3TCH A;  3U94 A;  3PUX E;  1MQG A;  2I4C A;  4MH5 A;  1US4 A;  4G68 A;  2F7B A;  2OCU A;  2G93 A;  2ZYM A;  3DLN A;  1B6H A;  4G68 B;  3HPI A;  3MW0 A;  3T9V A;  5IKB A;  4E0X A;  4EDP A;  5H8H A;  4U4X A;  3UA8 A;  3VV5 A;  4HCW A;  5HM4 B;  1SW4 A;  2Z8D A;  4R9F A;  1UTH A;  4QFP A;  1B7U A;  1FQC A;  4FJP A;  3A3U A;  3EPE A;  1M5E A;  4F31 B;  1POY 1;  3KFM A;  4ONY A;  3UP9 A;  1OQG A;  4F2Q A;  1DMB A;  1FTO A;  1QVS A;  1Q35 A;  2B65 A;  3E3K A;  4KYD A;  4O3A A;  3R26 A;  4POW A;  1O64 A;  4DXC A;  3VFJ A;  1MY4 A;  2ONS A;  3M3F A;  4HW8 A;  2XXT A;  1NNK A;  4WED A;  3KSJ A;  2PT1 A;  3IR1 A;  1WVJ A;  3PUW E;  4MLV A;  4P11 A;  4QSC A;  3JYR A;  5I59 B;  3H6U A;  2CZL A;  3QYT A;  3U8Q A;  3CI8 A;  1OIB A;  3FVN A;  2XXX A;  2VD3 A;  4KQP A;  1L5T A;  1DSN A;  1BP5 A;  1VFE A;  2Q88 A;  4F3B A;  2I49 A;  1YPN A;  3N94 A;  1H43 A;  1B3L A;  1QJM A;  1TXF A;  2F7C A;  2F5X A;  2GHA A;  1SBP A;  2OLB A;  2Z8F A;  4IY5 A;  4QFO A;  3VLW A;  3OEM A;  1TFD A;  2XD2 A;  3UN6 A;  3FXU A;  1I6A A;  2DOJ A;  5H8N A;  5CMC A;  4JWX A;  1EH3 A;  4IO2 A;  5B7D A;  1POT A;  3B6Q A;  4XXU A;  3FXR A;  1HSJ A;  1DTG A;  2GFE A;  1LAX A;  5H8H B;  5BUU A;  4GXS B;  3F11 A;  1II5 A;  4BDM A;  1LBB A;  4LON B;  3IOW A;  1BKA A;  4YB6 A;  4QSD A;  3MZB A;  3SEW A;  2WKY A;  5DVF A;  5ITP A;  2OJT A;  1S7Y A;  3FJM A;  4LQ5 A;  4F39 A;  4EF1 A;  4G77 A;  1UQW A;  1LCT A;  4IY6 A;  1AMF A;  1LAH E;  3HO7 A;  5KCJ B;  4ELO A;  5AA3 A;  2O1M A;  3FGS A;  3K02 A;  3DP6 A;  1A99 A;  1FQB A;  2ONR A;  3FV2 A;  2PX1 A;  2Q89 A;  1IUD A;  4JDF A;  1Y4C A;  2HQ0 A;  1Z7M E;  2I48 A;  4XKR A;  5BWJ A;  2Z8E A;  1RYO A;  2HAU A;  4KR5 A;  4F3S A;  4OFJ A;  4G4P A;  5AA1 A;  3KN7 A;  1B1X A;  4YZZ A;  3N6U A;  4DXB A;  4FED A;  2PVU A;  3SEV A;  3K4U A;  4QF9 A;  1XVX A;  3C9H A;  1JVY A;  1HSE A;  1QUJ A;  1KWH A;  1MDP 1;  1MY0 A;  3Q26 A;  3H6W A;  3TCF A;  4M1V A;  4NF8 B;  5I2N A;  2UXA A;  3DP4 A;  3R6U A;  3N6T A;  1A40 A;  3TZA A;  3Q29 A;  2Q9T A;  4RXL A;  3BFT A;  1FQE A;  4R6H A;  1SI0 A;  2R9J A;  5ISU A;  1XHY A;  3O66 A;  1D4N A;  1I6B A;  4FEB A;  4I62 A;  4EQ7 A;  1PBQ A;  2H9B A;  2ZYO A;  4KYS A;  1P1Q A;  4MLQ A;  5EHM A;  3TDJ A;  3SER A;  1B7H A;  2H4I A;  1P1W A;  1VE4 A;  4R6K A;  4PFT A;  1PEB A;  5EYF A;  4ZEF A;  1ZIU A;  4KCD A;  1JW4 A;  1FTK A;  1MXY A;  3VE1 B;  5FHN A;  3TTM A;  1AH5 A;  3IB1 A;  3LR1 A;  4H8J A;  2QMX A;  3JV9 A;  3E13 X;  3GLB A;  1QUL A;  4GWO A;  3S2V A;  1B2H A;  3VXC A;  1LB8 A;  1S9T A;  3CFL A;  4ISU A;  5F7V A;  4O3C A;  2NOO A;  2Y7I A;  3V5A A;  2QJE A;  4ELQ A;  2NWJ A;  4Q8R A;  1MM6 A;  5K2X A;  4U4S A;  1ATG A;  2QSX A;  4ECF A;  3MP8 A;  4LP2 B;  4RK9 A;  1B4Z A;  2P2A A;  4ZDM A;  1S50 A;  4LZ5 A;  1D9V A;  2I3V A;  3CSB A;  4LUB A;  1GTK A;  2UYE A;  3ILU B;  1SW2 A;  3K1P A;  3RT8 A;  5EHS A;  3IOT A;  3FD3 A;  5AA4 A;  1AOV A;  3K1M A;  1P1N A;  4C1T A;  1D3K A;  5CBS A;  2ONK E;  3KG2 A;  5I59 A;  5JTY A;  1GR2 A;  3CRB A;  2HXW A;  3CVG A;  3ILT B;  4IO5 A;  4GOT A;  3TCG A;  3TEP A;  2R71 A;  3PPN A;  2ZXT A;  3RN8 A;  3ONM A;  3FVO A;  2YLN A;  2OWT A;  4OFL A;  1ZBM A;  3P7I A;  4IGT A;  3TPA A;  4FIM A;  1AIV A;  1N7X A;  3K6X A;  3ODB A;  4GXA A;  1P1U A;  3KJ7 A;  3G3I A;  4F18 A;  1LFH A;  1LLS A;  1F9B A;  2DP8 A;  2REG A;  4YKP A;  1VR5 A;  4BDN A;  1TWY A;  2A5T B;  2O51 A;  2I58 A;  2V3T A;  3JZJ A;  2B3F A;  3K00 A;  4H5G A;  4HS7 A;  2XD3 A;  2YPN A;  3W9W A;  4DCY A;  4XKP A;  5J1D A;  5ELV A;  1MH3 A;  3CIJ A;  4DLD A;  3DM0 A;  5CMB A;  5H8Q B;  5CM6 A;  1OLA A;  1RKM A;  2QPQ A;  1Z7N E;  2HFB A;  3KN8 A;  3BKI B;  4G2Z A;  4MFI A;  3VLV A;  2VP1 A;  4C1U A;  5FHM A;  3AXF A;  1B58 A;  1IZ1 A;  5KZT A;  5HBC A;  3G3G A;  3HHF A;  2M8C A;  3IL1 B;  3HST A;  3ZKK A;  3OO7 A;  1B9J A;  1WOD A;  2E0S A;  1B7Z A;  1MG1 A;  3L6G A;  3CFX A;  3SEU A;  1LAF E;  3K6V A;  2Y7R A;  3V83 A;  2VOZ A;  2AYS A;  3I5O A;  1JET A;  4OQO A;  1IEJ A;  3K1N A;  3M3K A;  1SW5 A;  1A55 A;  5H8N B;  2DVZ A;  2GHB A;  1XOC A;  3G7W A;  2REJ A;  3OEK A;  3KGC A;  3SEX A;  3IOU A;  4AB5 A;  1M5B A;  1MY2 A;  3IO6 A;  4JXI A;  4U1Z A;  1USY E;  3OEL A;  5DVI A;  2Q8J A;  3EF7 A;  2HZK A;  5L9S A;  2X7P A;  4DZ1 A;  1P1O A;  4ESX A;  4FE8 A;  1NH7 A;  5I2K B;  2D5W A;  1NNP A;  2DYX A;  3CFZ A;  3TTL A;  3K01 A;  3O9P A;  3Q25 A;  1OVT A;  3QXM A;  3C33 A;  4BLA A;  2Z22 A;  2O69 A;  3C32 A;  1O63 A;  2QS4 A;  2O1L A;  3QAX A;  3BBR A;  5F1Q A;  5ICQ A;  2F6P A;  5KDT A;  2ZNT A;  4GQO A;  3UIF A;  1IIW A;  4OER A;  3C4M A;  2UVH A;  1BIY A;  2H99 A;  4G8H A;  2XX7 A;  1DPP A;  1EZ9 A;  1B5J A;  2XXI A;  2H98 A;  2QS2 A;  4OZ9 A;  4ZZE A;  3TFL A;  3UK4 A;  2Z23 A;  4AQ4 A;  1B32 A;  1DOT A;  2RC7 A;  4DE8 A;  4RJZ A;  4OVJ A;  3D4G A;  1B3E A;  4F1U A;  2FYI A;  3WAF A;  4G8N A;  2AIX A;  5K2Y A;  4X1D A;  2DVC A;  1MXU A;  1A8F A;  3KEI A;  3LUY A;  3BFU A;  4GRK A;  3A3C A;  4OWD A;  3T66 A;  2XX8 A;  4OXV A;  4Q5T A;  3ZSF A;  3MC2 A;  2CMO A;  4F22 A;  4QHQ A;  1IXC A;  1OVB A;  4F29 A;  1MQJ A;  1MXZ A;  3OXN A;  5TU0 A;  1Y20 A;  2XXQ A;  2F6G A;  5FTI A;  3MZ1 A;  4FEC A;  2V93 A;  2RC8 A;  2F78 A;  3FVK A;  3S9M C;  2QRY A;  2ALU A;  4JWY A;  4QRZ A;  3RPW A;  3SES A;  4PET A;  5KDT B;  5I56 B;  1LST A;  2OK2 A;  3TMG A;  3IX1 A;  2AL5 A;  3PMV A;  1B40 A;  1NNT A;  5FTH A;  4DDD A;  2PBW A;  3IOV A;  3TQL A;  1TT1 A;  2FA7 A;  3FJG A;  4I8C A;  1UIU A;  2XXW A;  4OES A;  4RYA A;  4IB2 A;  4ELR A;  4UAC A;  3H7M A;  2O84 X;  5CMK A;  3LBS A;  3IB0 A;  1A7L A;  1BTJ A;  4YKJ A;  4X1B A;  2H5Y A;  2H25 A;  4NF5 B;  4LA9 A;  4FOR A;  3D4C A;  4THI A;  5AA4 B;  1RYX A;  2RF1 A;  4XKQ A;  2XHD A;  1OQH A;  1NFT A;  1LB9 A;  1QUI A;  4MBP A;  3OSQ A;  5I57 A;  3B6W A;  4JB7 A;  2UVI A;  4Z0I A;  2DWH A;  1R9L A;  4I9D A;  4Z7E A;  4U23 A;  1HSL A;  1IXH A;  3G3H A;  4U22 A;  4R2F A;  1QW0 A;  4F3G A;  1B3H A;  4ZEI A;  1ZKB A;  2DWA A;  4NF8 A;  1B1H A;  3O28 A;  5DYH A;  3C31 A;  1A8E A;  4TQU Q;  3HCQ A;  4NTL A;  1US5 A;  4P0G A;  2XXR A;  1M5C A;  2DS9 A;  3HN0 A;  1Y3Q A;  1LFG A;  3K0V A;  3OOA A;  5DT6 A;  3MWB A;  4R73 A;  5A5X B;  4Q30 B;  5AA2 A;  3N5L A;  5H8Q A;  4C0R A;  4OMB A;  1WDN A;  4QFK A;  5ITO A;  5TPA A;  4F19 A;  4GIZ A;  2UVJ A;  2V84 A;  2D21 A;  1VFD A;  2A5T A;  2PT2 A;  2XXV A;  3MVZ A;  2DWJ A;  3E9X A;  3T9X B;  3VVF A;  4F3P A;  5A5X A;  2F34 A;  3IJX B;  2Y7W A;  2DXY A;  4N13 A;  3K6U A;  3MVY A;  2O7U A;  3T93 B;  3MP6 A;  3O29 A;  4HTG A;  4YB5 A;  3IO4 A;  3MP1 A;  2IEE A;  4PP0 A;  3H4Z A;  4LVQ A;  2ZYN A;  5I2N B;  2RC9 A;  1EZP A;  1NNF A;  2I3W A;  3L6H A;  1B5H A;  3KOS A;  3RY3 A;  2F7A A;  1FTM A;  1Y1Z A;  2O6A A;  3G3J A;  3KSX A;  3OO6 A;  2VD2 A;  5L9M A;  2DE4 A;  3TTK A;  5AA2 D;  1TFA A;  4PFW A;  1NL5 A;  1I69 A;  3KZG A;  4R74 A;  3O6H A;  3C35 A;  3CSG A;  4NF5 A;  1SD3 A;  3UOR A;  1LFI A;  4JSD A;  2IA4 A;  2KLF A;  3FV1 A;  4NWC A;  4F1Y A;  4FAJ A;  4ZED A;  4OEN A;  2YJP A;  3PV0 E;  4IO6 A;  4OTE A;  3T96 B;  1B46 A;  3U92 A;  1FQF A;  1N84 A;  5L9O A;  1YTV A;  2DQV A;  3PPQ A;  3ZS6 A;  1PBP A;  3FUZ A;  4DXU A;  1XT8 A; 
#chains in the Genus database with same CATH topology
 4GF8 A;  3MVW A;  1GV8 A;  4EUO A;  2XX9 A;  4NG7 A;  4EF2 A;  1DK4 A;  2WYP A;  3RT6 B;  3MZ9 A;  3MPK A;  4P47 A;  4PF6 A;  5CMM A;  4YU0 A;  1FJ9 A;  2B4M A;  1MS7 A;  2XWI A;  1ZJL A;  5IZZ A;  1FRP A;  2KQZ A;  3B50 A;  2I0B A;  4R75 A;  3RTF B;  2D3I A;  3V8X B;  3O6G A;  1H76 A;  4OFO A;  5IZ1 A;  2Y7K A;  3CG3 A;  4NF6 A;  4PFU A;  4Q0C A;  4RA1 A;  2JJK A;  1SDX A;  2P1S A;  1O7T A;  4GLI A;  2Q2A A;  3OD7 A;  3OEN A;  3HV1 A;  3RUM A;  2P3V A;  2HEU A;  3FAS A;  3QUF A;  1IXG A;  4YB7 A;  3Q27 A;  3ZKL A;  3THI A;  3RPL B;  4OEV A;  1H44 A;  4PAF A;  1AL3 A;  4PE5 B;  1XVY A;  2Y7P A;  5DEX B;  4BDO A;  3RGY A;  1JW5 A;  4PE3 A;  4WXJ A;  1FTJ A;  3KC0 A;  5H8S A;  1GGG A;  5CBR A;  3R7X A;  4WEP A;  1M5D A;  5JK4 A;  3MPL A;  4H0W A;  4PBH A;  1R9Q A;  1JNF A;  3DP8 A;  5I59 A;  3C36 A;  3KN3 A;  1SYH A;  3CR9 A;  4MNC A;  5DVJ A;  4H65 A;  2HHM A;  3FIR A;  3PUV E;  1SI1 A;  2PMS A;  1BLF A;  1BK4 A;  3KJT A;  2RCA A;  1YYZ A;  2V3U A;  1NV2 A;  2THI A;  4H8I A;  1QUK A;  3SDF A;  2CZK A;  2F8D A;  1YCJ A;  4KFQ A;  3U65 A;  1MY3 A;  1XS5 A;  3B8B A;  3K6W A;  4O7M A;  2ZNS A;  4GX4 A;  3TQW A;  2FVZ A;  5LOM A;  3QK6 A;  3SET A;  4QFL A;  2BJJ X;  4U21 A;  1N3W A;  3A09 A;  4H6D A;  1PB9 A;  1B5I A;  3D1R A;  5CI5 A;  2ANJ A;  3U93 A;  3W15 C;  2Y5L A;  4KXP A;  4FAT A;  1B05 A;  3IK6 B;  4IGR A;  4LAT A;  1RDZ A;  5LDZ A;  2LAO A;  4XFE A;  3GXA A;  4MAG A;  1JP4 A;  4YKI A;  2I4C A;  1US4 A;  4G68 A;  3DLN A;  2G93 A;  4G68 B;  3HPI A;  2OX3 A;  2Q8M A;  4E0X A;  2Z8D A;  1FQC A;  4FJP A;  3A3U A;  4F31 B;  4ONY A;  1OQG A;  1FTO A;  1Q35 A;  1O64 A;  4DXC A;  1MY4 A;  3IFC A;  3KSJ A;  4MLV A;  1OIB A;  3FVN A;  1BP5 A;  1IMC A;  1QJM A;  2F7C A;  1SBP A;  3UN6 A;  3FXU A;  1FBC A;  5CMC A;  4JWX A;  4IO2 A;  3FXR A;  2GFE A;  1LAX A;  4BDM A;  1LBB A;  4QSD A;  2OJT A;  1S7Y A;  4G77 A;  1LCT A;  2QFL A;  3DP6 A;  1FQB A;  4JDF A;  1IUD A;  2HQ0 A;  2XWV A;  1YZ0 A;  2HAU A;  4F3S A;  4G4P A;  4PAK A;  4FED A;  4QF9 A;  1MDP 1;  4N6K A;  1MY0 A;  2CZI A;  4N91 A;  4DI4 B;  5I2N A;  2UXA A;  3TZA A;  2Q9T A;  3BFT A;  1SI0 A;  5ISU A;  3O66 A;  4FEB A;  1I6B A;  4EQ7 A;  4KYS A;  2ZYO A;  2PFY A;  1B7H A;  2H4I A;  1VE4 A;  4GWW A;  1PEB A;  5EYF A;  4KCD A;  3IB1 A;  2QMX A;  4I3E A;  4GWO A;  1SPI A;  2NOO A;  1FTA A;  5EQ7 A;  4ECF A;  1B4Z A;  4IR8 A;  3CSB A;  1FBD A;  3RYD A;  2ONK E;  4P8B A;  2HXW A;  3TEP A;  2R71 A;  3ONM A;  2YLN A;  5EYH A;  4FIM A;  3K6X A;  1LFH A;  2B4L A;  1F9B A;  1VR5 A;  4BDN A;  5AA3 A;  2O51 A;  3LUZ A;  2YPN A;  3W9W A;  5EQ9 A;  2VPO A;  1MH3 A;  3CIJ A;  5CMB A;  5H8Q B;  1OLA A;  2HFB A;  3BKI B;  4G2Z A;  3VLV A;  5HBC A;  3G3G A;  3HST A;  3ZKK A;  1B7Z A;  3K6V A;  2PCR A;  1JET A;  4PFR A;  2GHB A;  2REJ A;  3IOU A;  4AB5 A;  1M5B A;  4JXI A;  1USY E;  3OEL A;  3EF7 A;  1NH7 A;  2DYX A;  1NNP A;  3K01 A;  3C32 A;  2O69 A;  2QS4 A;  3QAX A;  3PTY A;  4GQO A;  4OER A;  1BIY A;  2XXI A;  4OZ9 A;  1B32 A;  4RJZ A;  3WAF A;  4NX1 A;  5K2Y A;  2DVC A;  1A8F A;  4P1L A;  3MC2 A;  4F22 A;  4QHQ A;  2F3D A;  4F29 A;  2XXQ A;  2F6G A;  2RC8 A;  2F78 A;  3S9M C;  4JWY A;  5I56 B;  4GWX A;  1NNT A;  2PBW A;  4I8C A;  3ISP A;  4OES A;  3H7M A;  2O84 X;  3IB0 A;  1VDW A;  2H5Y A;  2QVU A;  3D4C A;  4THI A;  5AA4 B;  4O7I A;  4JB7 A;  3E79 A;  4I9D A;  2XA5 A;  4JVC A;  1B3H A;  2DWA A;  3C31 A;  4TQU Q;  2L5V A;  2XXR A;  5DT6 A;  5A5X B;  2BJI A;  5H8Q A;  4F19 A;  2UVJ A;  4F3P A;  1IME A;  3E9X A;  3VVF A;  3IJX B;  3MVY A;  4YB5 A;  2MKZ A;  4LVQ A;  2I3W A;  3OO6 A;  1Y1Z A;  2DE4 A;  1NL5 A;  4GWU A;  3O6H A;  3CSG A;  4HE1 A;  1SD3 A;  4F1Y A;  3T96 B;  1FPI A;  3FUZ A;  1LCF A;  1UTB B;  4N6P A;  1YAE A;  3TTR A;  4XTC Q;  4RPO A;  4DIG A;  3GBB A;  2OBG A;  1VSO A;  4HCY A;  1B0L A;  3IFA A;  3T22 A;  4QSE A;  4PQJ A;  1KZ8 A;  3MUQ A;  5ICT A;  4EQB A;  4UA8 A;  3PPP A;  3MBP A;  4I40 A;  3B6T A;  3H6T A;  1FPF A;  4XKN A;  4N81 A;  3U72 A;  1EYK A;  2OWS A;  3IOR A;  5AE4 A;  2X7Q A;  3I6V A;  4GL8 A;  1PDA A;  1MPC A;  3G3K A;  4K3F A;  2DSF A;  1DTZ A;  1B4H A;  4ZZA A;  4GWS A;  5IAI A;  2PYY A;  3LSF B;  1SQY A;  2E1S A;  3PGF A;  1OLC A;  1MPB A;  3EHU A;  1ZTY A;  1JW1 A;  3RNN A;  5JEI A;  1T0K A;  2QMW A;  3QIM A;  4KPT A;  2F36 A;  3MAM A;  4P56 A;  1FBG A;  1MM7 A;  4GVO A;  3H3G A;  2ESN A;  5IGA A;  2DE3 A;  4YAH X;  4IO3 A;  1NV7 A;  2ZYK A;  4H67 A;  3FZV A;  4MIJ A;  3CG1 A;  1CE2 A;  3KBZ A;  5I5P A;  4POX A;  1JEU A;  5I57 B;  2DDK A;  4MEV A;  1N04 A;  4GL0 A;  3M3L A;  1FQD A;  1SVX B;  1MH4 A;  3PMW A;  4OYV A;  1MQI A;  3A29 A;  4QXD A;  5ET5 A;  2FBP A;  5ET7 A;  2NXO A;  3TCF A;  2NVU B;  4YMB A;  3OO8 A;  1ELJ A;  1PB7 A;  4MJO A;  2W7Y A;  4AB6 A;  1I6Q A;  4P1E A;  2CZH A;  2F35 A;  1NV5 A;  1AWB A;  2FNC A;  1Y9U A;  5FHO A;  3KBR A;  1FQA A;  4DCX A;  3FJ7 A;  1MQD A;  3PPO A;  3EHS A;  2ABH A;  2HZL A;  2OZZ A;  4ESW A;  4ZEK A;  1ZMG A;  2I0C A;  3H06 B;  3EHT A;  1OMP A;  2QVR A;  4TOZ A;  1ZLQ A;  1JQF A;  4NMY A;  2V3Q A;  1IMF A;  4QBA A;  3I3V A;  1LAG E;  4NF4 A;  1Q1K A;  4YKK A;  2HXR A;  2R6G E;  3TKD A;  4GFR A;  4PFI A;  2HAV A;  2Y84 A;  4ZS9 A;  1FBE A;  3QSL A;  3TUS A;  3PPR A;  2DWI A;  1NUY A;  3LSW A;  4PC9 A;  3KOT A;  3TYH A;  2ZNU A;  1RDX A;  4N07 A;  2RCB A;  2NUV A;  3IAZ A;  3FBP A;  3GBA A;  1MXW A;  5EYG A;  4X48 A;  5JTY B;  4KHZ E;  5L8D A;  3U94 A;  1MQG A;  2OCU A;  1B6H A;  3MW0 A;  3UA8 A;  3VV5 A;  1SW4 A;  4R9F A;  1B7U A;  1RDY A;  1M5E A;  1POY 1;  3KFM A;  2B65 A;  5ESY A;  1NNK A;  1WVJ A;  1LBX A;  3H6U A;  2HPG A;  3CI8 A;  2XXX A;  5I7I A;  4KQP A;  1VFE A;  2Q88 A;  4F3B A;  2I49 A;  3N94 A;  2VPN A;  2F5X A;  2OLB A;  2Z8F A;  1EH3 A;  1POT A;  4XXU A;  5H8H B;  3MST A;  3F11 A;  4LON B;  3IOW A;  3MZB A;  2WKY A;  5DVF A;  3FJM A;  4PAI A;  2XWO A;  4IY6 A;  1AMF A;  4ELO A;  4P3L A;  3FGS A;  3K02 A;  4JVD A;  1A99 A;  3EKI A;  2ONR A;  2PX1 A;  2I48 A;  1RYO A;  3KN7 A;  1FPL A;  4DXB A;  2PVU A;  3SEV A;  1LBW A;  4O8M A;  1HSE A;  3H6W A;  4NF8 B;  3DP4 A;  4AS5 A;  3R6U A;  3GYY A;  1A40 A;  3LV0 A;  3Q29 A;  1XHY A;  3T1B A;  5LTC A;  4N4U A;  1P1Q A;  3SER A;  4MNI A;  4PFT A;  2WX9 A;  4ZEF A;  1ZIU A;  3VE1 B;  3TTM A;  3LR1 A;  4H8J A;  3JV9 A;  3E13 X;  1S9T A;  3CFL A;  5F7V A;  4O3C A;  2NWJ A;  5K2X A;  3HFU A;  2QSX A;  4ZDM A;  3SES A;  2WYK A;  2UYE A;  3ILU B;  1SW2 A;  5ET8 A;  5A5L A;  3FD3 A;  5AA4 A;  3K1M A;  4C1T A;  1D3K A;  5JTY A;  3CRB A;  3CVG A;  3ILT B;  3TCG A;  1IMD A;  4GOT A;  2XXK A;  4UAB A;  3P7I A;  1LLS A;  2DP8 A;  2A5T B;  3K00 A;  4H5G A;  4MX6 A;  4DCY A;  4XKP A;  4DLD A;  3DM0 A;  2QPQ A;  4MFI A;  3KN8 A;  4C1U A;  5FHM A;  1KA0 A;  2M8C A;  1MG1 A;  2VOZ A;  2AYS A;  4OQO A;  1SW5 A;  2DVZ A;  2FIE A;  3SZP A;  1FBH A;  5L9S A;  4DZ1 A;  4ESX A;  2D5W A;  3O9P A;  4BLA A;  5KDT A;  4GWY A;  3UIF A;  1IIW A;  3C4M A;  2UVH A;  4G8H A;  1DPP A;  3TFL A;  3UK4 A;  2H98 A;  2QS2 A;  1NV4 A;  1DOT A;  4DE8 A;  4F1U A;  4OVJ A;  2FYI A;  4G8N A;  4X1D A;  1MXU A;  3KEI A;  3T66 A;  3BFU A;  4OWD A;  2XX8 A;  4OXV A;  2CMO A;  1MQJ A;  5TU0 A;  5FTI A;  4FEC A;  4N17 A;  2ALU A;  4QRZ A;  3RPW A;  4PET A;  2OK2 A;  3PMV A;  1B40 A;  3IOV A;  3TQL A;  4RYA A;  2XXW A;  5IZ3 B;  1A7L A;  1BTJ A;  4NF5 B;  1RYX A;  2RF1 A;  1QUI A;  5I57 A;  2UVI A;  4Z0I A;  2DWH A;  1QW0 A;  4ZEI A;  3O28 A;  4N6D A;  2WBD A;  5AA2 A;  1LFG A;  3MWB A;  4C0R A;  1WDN A;  5TPA A;  4NF0 A;  5ITO A;  2PT2 A;  3MVZ A;  2DWJ A;  4GX3 A;  1DCU A;  2KR0 A;  4HE0 A;  3O29 A;  5I2N B;  2ZYN A;  1FTM A;  2O6A A;  4R74 A;  3KZG A;  3C35 A;  4JSD A;  2IA4 A;  2KLF A;  3FV1 A;  4OTE A;  3U92 A;  1B46 A;  1N84 A;  1YTV A;  5ET6 A;  1YXI A;  1XT8 A;  4RPN A;  4H46 A;  4I3Y A;  4JBZ A;  4LQ2 A;  3LSL A;  3OSR A;  5DTB A;  1MRP A;  2A5S A;  3RTW B;  4X04 A;  2VHA A;  1FPD A;  1R6Z A;  2V25 A;  1QKA A;  2XXU A;  1CB6 A;  4OAN A;  3FXQ A;  1CNQ A;  3N26 A;  4E0W A;  1J1N A;  4EXL A;  4PTK A;  5DEX A;  4NAP A;  2VT5 A;  1UTB A;  4ELP A;  2Q2C A;  3LSX A;  1FCK A;  4LZ7 A;  4O3B A;  2Q74 A;  1EU8 A;  2GH9 A;  4BDQ A;  1NV1 A;  4ZE8 A;  4OEU A;  3PD8 A;  1NMU A;  3TAJ A;  2V4C A;  4JWO A;  1URS A;  4M4G A;  3QUJ A;  1NUX A;  4PCD A;  4TLL B;  3TTN A;  2X26 A;  3PUZ E;  4OHN A;  1PB8 A;  4GD5 A;  4YIC A;  2QVV A;  4X9T A;  3PUY E;  4R9G A;  1IXI A;  3V89 B;  1SW1 A;  3PD9 A;  3T9U A;  1B3G A;  3USD A;  3ECR A;  3VDF A;  2I6E A;  1FPK A;  3M8U A;  3EN3 A;  1NH8 A;  4OVQ A;  3H6V A;  3EQ1 A;  1H45 A;  1IIT A;  4EXK A;  4H5F A;  3RQT A;  1LBZ A;  4G8M A;  2XWK A;  3K2D A;  4KD5 A;  1LBC A;  3DEL B;  4GX6 A;  3MVX A;  2RIN A;  4IO7 A;  1MPD A;  1MQH A;  1M5F A;  1B0H A;  2DXR A;  4YMA A;  1DPE A;  1NKX A;  4NE4 A;  4OET A;  1PC3 A;  4WKM A;  5EQ8 A;  2QL3 A;  2WBB A;  2QS3 A;  5I58 B;  4XF5 A;  4GBW A;  3PU5 A;  4MCO A;  4N15 A;  1B52 A;  3IJO B;  1B3F A;  4U2R A;  4JSO A;  4TLM B;  1B51 A;  2I4B A;  4RK2 A;  1ANF A;  1JVX A;  4KCC A;  1DBZ A;  1MXV A;  4LZ8 A;  1MXX A;  3E4R A;  2CEX A;  4MH5 A;  2ZYM A;  5IKB A;  4EDP A;  5H8H A;  4U4X A;  5HM4 B;  4HCW A;  4QFP A;  1K9Z A;  3UP9 A;  4F2Q A;  1DMB A;  3E3K A;  3U1O A;  3W9V A;  4GBV A;  2ONS A;  3M3F A;  2XXT A;  2PT1 A;  3BIH A;  4P11 A;  3QYT A;  2CZL A;  4NGU A;  3U8Q A;  2VD3 A;  1YPN A;  1TXF A;  3VLW A;  4IY5 A;  3OEM A;  1I6A A;  2DOJ A;  3CHG A;  5H8N A;  4MMP A;  3B6Q A;  1DTG A;  4YB6 A;  3SEW A;  4MNP A;  4LQ5 A;  4NN3 A;  4EF1 A;  1UQW A;  1LAH E;  5KCJ B;  4PDH A;  4PF8 A;  2Y5K A;  3FV2 A;  5BWJ A;  4XKR A;  1Z7M E;  2Z8E A;  4OFJ A;  1B1X A;  3E78 A;  3K4U A;  3C9H A;  1JVY A;  1QUJ A;  2ZZW A;  1KWH A;  3Q26 A;  3N6T A;  4RXL A;  1FQE A;  4R6H A;  4I62 A;  4MLQ A;  5EHM A;  4R6K A;  1P1W A;  1MXY A;  1FTK A;  5FHN A;  1AH5 A;  3GLB A;  1QUL A;  1LB8 A;  2Y7I A;  4Q8R A;  3V5A A;  4ELQ A;  4U4S A;  1ATG A;  3MP8 A;  4RK9 A;  4PGN A;  4LZ5 A;  4LUB A;  1D9V A;  1IMB A;  3IOT A;  1GR2 A;  3PPN A;  2ZXT A;  5EQA A;  3ODB A;  4GXA A;  3G3I A;  3JZJ A;  2I58 A;  4PGP A;  2B3F A;  4HS7 A;  2XD3 A;  5ELV A;  5CM6 A;  1Z7N E;  2VP1 A;  3AXF A;  1B58 A;  1IZ1 A;  3HHF A;  3IL1 B;  3OO7 A;  1B9J A;  1WOD A;  2OWZ A;  3L6G A;  2Y7R A;  3V83 A;  3M3K A;  1A55 A;  1XOC A;  1G0I A;  3OEK A;  4U1Z A;  5DVI A;  1NV3 A;  2X7P A;  5I2K B;  3TTL A;  3Q25 A;  1OVT A;  3C33 A;  4PFB A;  5ICQ A;  2O1L A;  5F1Q A;  2F6P A;  2ZNT A;  1KA1 A;  2XX7 A;  4ZZE A;  4AQ4 A;  2RC7 A;  1B3E A;  4XEQ A;  2P3N A;  3ZSF A;  4Q5T A;  1IXC A;  1LEV A;  1MXZ A;  2V93 A;  4NHB A;  3FVK A;  2QRY A;  1XI6 A;  1LST A;  3TMG A;  5FTH A;  1TT1 A;  3FJG A;  5CMK A;  4IB2 A;  4UAC A;  3LBS A;  4PBQ A;  3BIG A;  4X1B A;  2H25 A;  4LA9 A;  4FOR A;  1NI9 A;  2XHD A;  1OQH A;  1NFT A;  1LB9 A;  4MBP A;  3OSQ A;  3B6W A;  4Z7E A;  4U23 A;  1IXH A;  3G3H A;  4U22 A;  4F3G A;  4P9K A;  1ZKB A;  4NF8 A;  1B1H A;  5DYH A;  3HCQ A;  4NTL A;  1M5C A;  2DS9 A;  3HN0 A;  1Y3Q A;  3K0V A;  4Q30 B;  4QFK A;  4GIZ A;  2V84 A;  2XXV A;  4NQ8 A;  5AA2 B;  2Y7W A;  2DXY A;  4N13 A;  3K6U A;  5F24 A;  4HTG A;  4PP0 A;  1EZP A;  3H4Z A;  2RC9 A;  3KOS A;  2F7A A;  3VLU A;  5AA2 D;  2VD2 A;  1TFA A;  4PFW A;  3UOR A;  4NF5 A;  1LFI A;  1FPB A;  4NWC A;  4OEN A;  3PV0 E;  5L9O A;  1FQF A;  4OVP A;  1PBP A;  2O68 A;  3MJN A;  1Q9D A;  1FJ6 A;  3UGW A;  2GRV A;  3O2A A;  2XXH A;  1LGB C;  1Y4T A;  2GQ1 A;  3LC8 A;  2WEF A;  3OMB A;  1URD A;  4GWZ A;  5I3S A;  1MY1 A;  5H8F A;  4LN5 A;  1K9Y A;  1ZU0 A;  3TPA A;  3C34 A;  1D9Y A;  5J1D A;  5I84 A;  4F2O A;  5CRY A;  1H3D A;  2UYF A;  4EQ9 A;  4IO4 A;  2F97 A;  1UIV A;  2O7I A;  5I56 A;  4HXV A;  1Y1M A;  5B70 A;  2HCA A;  5KCJ A;  3WAE A;  1UTH B;  1P99 A;  4O94 A;  1EZO A;  1FBF A;  1GVC A;  4R72 A;  3TOD A;  1IQ7 A;  4NF4 B;  2UVG A;  4I1D A;  5M2V A;  3MQ9 A;  3GZG A;  2ZMB A;  2Q8J A;  1Y3P A;  3B7D A;  4BDL A;  3S9L C;  4G61 A;  3Q28 A;  5TPA B;  3TEL A;  3IB2 A;  1N76 A;  4XIG Q;  2RKM A;  3S4U A;  1FBP A;  1FTL A;  5H8F B;  4HE2 A;  4PDD A;  4L17 A;  2QS1 A;  4F1V A;  2XXY A;  1Y3N A;  3O97 A;  1URG A;  4P0I A;  2P0S A;  4NF6 B;  5I2K A;  4N8G A;  5IZ3 A;  1JEV A;  3H03 A;  4PFY A;  1N0T A;  1N3X A;  5CC2 A;  4RY1 A;  1N7W A;  5TP9 A;  2DE2 A;  4R2B A;  5TP9 B;  3RLF E;  3G3F A;  5I58 A;  3SKP A;  3QMF A;  4NWD A;  4BDR A;  4MF3 A;  1EYJ A;  4NED A;  1NV0 A;  2B3B A;  4MHF A;  4KYE A;  5T3J A;  2G29 A;  3HHG A;  3VXB A;  4ND9 A;  4OA4 A;  3VVE A;  2CEY A;  3O6I A;  1FPG A;  4U1O A;  3SEY A;  4H1X A;  4RNS A;  3T9H B;  2XXP A;  2VGQ A;  4ZE9 A;  1A54 A;  2AL4 A;  1D9Q A;  4ZEC A;  1XC1 A;  4KI0 E;  1FW0 A;  1R1N A;  3S9N C;  3OO9 A;  1QKB A;  4ZEB A;  1SYI A;  3PMX A;  4R6Y A;  1USY H;  3FAT A;  4QFN A;  3FVG A;  5HPQ A;  1MDQ A;  3VVD A;  2R8T A;  4G68 C;  3TCH A;  3PUX E;  2F7B A;  3T9V A;  1UTH A;  3EPE A;  1QVS A;  4O3A A;  4POW A;  4KYD A;  3R26 A;  3VFJ A;  4WED A;  3IR1 A;  3PUW E;  5I59 B;  4QSC A;  3JYR A;  5FBP A;  1L5T A;  1DSN A;  4OVT A;  1H43 A;  1B3L A;  4HW8 A;  2GHA A;  4QFO A;  1TFD A;  2XD2 A;  1FPE A;  5B7D A;  4DI3 D;  1HSJ A;  5BUU A;  4GXS B;  1II5 A;  1BKA A;  3ROJ A;  5ITP A;  4F39 A;  3HO7 A;  2O1M A;  2ZZX A;  5DW8 A;  4H45 A;  2Q89 A;  1Y4C A;  4KR5 A;  5AA1 A;  4YZZ A;  3N6U A;  1XVX A;  4M1V A;  1EYI A;  2R9J A;  3T0J A;  1D4N A;  1PBQ A;  2H9B A;  3TDJ A;  1JW4 A;  3FXB A;  2ZZV A;  4OVS A;  3S2V A;  1B2H A;  3VXC A;  4ISU A;  2QJE A;  1MM6 A;  4LP2 B;  1NUW A;  2P2A A;  1S50 A;  2I3V A;  3RT8 A;  1GTK A;  3K1P A;  5EHS A;  1AOV A;  5J16 A;  1P1N A;  5CBS A;  1FPJ A;  3KG2 A;  4IO5 A;  1INP A;  3RN8 A;  3FVO A;  2OWT A;  4OFL A;  1ZBM A;  4IGT A;  1AIV A;  1N7X A;  1P1U A;  3KJ7 A;  4F18 A;  4YKP A;  2REG A;  1QGX A;  1TWY A;  2V3T A;  2PFZ A;  1RKM A;  4OVR A;  5KZT A;  2E0S A;  3CFX A;  3SEU A;  1LAF E;  1NUZ A;  3I5O A;  1IEJ A;  3K1N A;  5H8N B;  3G7W A;  3KGC A;  3SEX A;  1MY2 A;  3IO6 A;  2F3B A;  2HZK A;  1LBV A;  1P1O A;  4FE8 A;  1NV6 A;  3CFZ A;  3QXM A;  1FSA A;  2Z22 A;  1O63 A;  5IM2 A;  3RPL A;  3BBR A;  2H99 A;  1EZ9 A;  1B5J A;  2Z23 A;  3D4G A;  2AIX A;  3LUY A;  4GRK A;  3A3C A;  1OVB A;  3KC1 A;  3OXN A;  1Y20 A;  3MZ1 A;  4FBP A;  5KDT B;  3IX1 A;  2AL5 A;  4DDD A;  4AS4 A;  4ELR A;  2FA7 A;  1UIU A;  4YKJ A;  4XKQ A;  2FIX A;  1R9L A;  1HSL A;  4JVI A;  4R2F A;  3MYU A;  1A8E A;  2FHY A;  1US5 A;  4P0G A;  3OOA A;  4R73 A;  3N5L A;  4N8Y A;  4OMB A;  4X8R A;  1G0H A;  2D21 A;  1VFD A;  2A5T A;  5A5X A;  3T9X B;  2F34 A;  2O7U A;  3T93 B;  3MP6 A;  3IO4 A;  3MP1 A;  2IEE A;  1NNF A;  3L6H A;  1B5H A;  3RY3 A;  3KSX A;  1LBY A;  3G3J A;  3TTK A;  5L9M A;  1I69 A;  1IMA A;  3NOH A;  4FAJ A;  4ZED A;  2YJP A;  3S9E A;  4IO6 A;  2DQV A;  3ZS6 A;  3PPQ A;  4DXU A; 
#chains in the Genus database with same CATH homology
 1LCF A;  4GF8 A;  1UTB B;  4RPN A;  4N6P A;  3MVW A;  1YAE A;  1GV8 A;  2O68 A;  4EUO A;  2XX9 A;  3TTR A;  4XTC Q;  3MJN A;  4RPO A;  4DIG A;  3GBB A;  4JBZ A;  4EF2 A;  2OBG A;  4LQ2 A;  1VSO A;  3RT6 B;  5AA2 B;  3UGW A;  4HCY A;  3MZ9 A;  1B0L A;  3LSL A;  3MPK A;  3T22 A;  4QSE A;  3OSR A;  2GRV A;  4PQJ A;  3O2A A;  5DTB A;  5CMM A;  4YU0 A;  1MRP A;  3MUQ A;  2A5S A;  1LGB C;  2XXH A;  3RTW B;  5ICT A;  4EQB A;  4UA8 A;  1Y4T A;  2VHA A;  3PPP A;  3MBP A;  3THI A;  3LC8 A;  3B6T A;  3H6T A;  1R6Z A;  1MS7 A;  4XKN A;  3U72 A;  1ZJL A;  2OWS A;  2V25 A;  3OMB A;  3IOR A;  1URD A;  5AE4 A;  2X7Q A;  1MY1 A;  1QKA A;  5H8F A;  2XXU A;  3I6V A;  4GL8 A;  1CB6 A;  3FXQ A;  1ZU0 A;  2I0B A;  1PDA A;  4R75 A;  1MPC A;  3RTF B;  2D3I A;  3C34 A;  1J1N A;  1D9Y A;  2DSF A;  3G3K A;  3N26 A;  4K3F A;  5DEX A;  4E0W A;  3V8X B;  4EXL A;  1DTZ A;  4F2O A;  5I84 A;  1B4H A;  3O6G A;  5CRY A;  1H3D A;  1H76 A;  2UYF A;  4EQ9 A;  1UTB A;  4IO4 A;  4ELP A;  4ZZA A;  3W9V A;  2F97 A;  2Q2C A;  1UIV A;  1FCK A;  3LSX A;  4LZ7 A;  4OFO A;  5IAI A;  2PYY A;  2Y7K A;  2O7I A;  4O3B A;  5I56 A;  3LSF B;  1EU8 A;  3CG3 A;  1SQY A;  1Y1M A;  2E1S A;  5B70 A;  2HCA A;  3PGF A;  4NF6 A;  2GH9 A;  4PFU A;  5KCJ A;  4Q0C A;  3WAE A;  4BDQ A;  1UTH B;  1OLC A;  1MPB A;  3EHU A;  1ZTY A;  4RA1 A;  4ZE8 A;  1SDX A;  4OEU A;  1P99 A;  3PD8 A;  1NMU A;  3TAJ A;  2P1S A;  1O7T A;  4GLI A;  2Q2A A;  4JWO A;  3OD7 A;  1URS A;  1JW1 A;  4M4G A;  3RNN A;  5JEI A;  1T0K A;  2QMW A;  1EZO A;  1GVC A;  4R72 A;  3TOD A;  3OEN A;  3HV1 A;  3QIM A;  3QUJ A;  3RUM A;  2HEU A;  3FAS A;  3QUF A;  1IQ7 A;  4KPT A;  4NF4 B;  4TLL B;  1IXG A;  4YB7 A;  2UVG A;  3Q27 A;  2F36 A;  4I1D A;  3MQ9 A;  5M2V A;  3ZKL A;  3TTN A;  2X26 A;  3GZG A;  3MAM A;  2ZMB A;  3PUZ E;  1MM7 A;  4GVO A;  1Y3P A;  3B7D A;  1H44 A;  2ESN A;  3H3G A;  4OHN A;  4OEV A;  1PB8 A;  2DE3 A;  4YAH X;  4GD5 A;  4IO3 A;  4YIC A;  4BDL A;  4X9T A;  3S9L C;  3PUY E;  2ZYK A;  1AL3 A;  1IXI A;  3Q28 A;  4H67 A;  1XVY A;  4PE5 B;  1SW1 A;  4R9G A;  5TPA B;  3TEL A;  3PD9 A;  3V89 B;  2Y7P A;  3IB2 A;  1N76 A;  3FZV A;  5DEX B;  3T9U A;  3RGY A;  1JW5 A;  3VLU A;  4BDO A;  1B3G A;  4XIG Q;  2RKM A;  3S4U A;  1FTL A;  3CG1 A;  5H8F B;  1CE2 A;  4WXJ A;  1FTJ A;  3USD A;  5H8S A;  3ECR A;  1GGG A;  4POX A;  1JEU A;  5I57 B;  4L17 A;  2QS1 A;  5CBR A;  3VDF A;  3R7X A;  2I6E A;  4F1V A;  1N04 A;  4WEP A;  4GL0 A;  2XXY A;  3M3L A;  1Y3N A;  1FQD A;  1SVX B;  3M8U A;  1M5D A;  1MH4 A;  5JK4 A;  3EN3 A;  3PMW A;  3MPL A;  3O97 A;  4OYV A;  4H0W A;  1MQI A;  1NH8 A;  1URG A;  4P0I A;  2NXO A;  1R9Q A;  2P0S A;  4NF6 B;  5I2K A;  1JNF A;  3DP8 A;  3EQ1 A;  3H6V A;  2NVU B;  1H45 A;  1IIT A;  3OO8 A;  1ELJ A;  3C36 A;  3KN3 A;  1PB7 A;  4YMB A;  1SYH A;  2W7Y A;  3CR9 A;  4EXK A;  1JEV A;  4AB6 A;  3H03 A;  4H5F A;  1I6Q A;  3RQT A;  4PFY A;  5DVJ A;  4H65 A;  1N0T A;  1N3X A;  2F35 A;  5CC2 A;  3FIR A;  4RY1 A;  3PUV E;  4G8M A;  1N7W A;  1SI1 A;  2FNC A;  2PMS A;  1BLF A;  3KJT A;  1Y9U A;  5FHO A;  3KBR A;  5TP9 A;  3K2D A;  2RCA A;  2DE2 A;  4R2B A;  5TP9 B;  3RLF E;  3G3F A;  5I58 A;  1FQA A;  3SKP A;  4DCX A;  3FJ7 A;  1MQD A;  4KD5 A;  3PPO A;  1LBC A;  3EHS A;  2ABH A;  2HZL A;  2V3U A;  2OZZ A;  2THI A;  4H8I A;  4NWD A;  1QUK A;  3DEL B;  4BDR A;  4ESW A;  4MF3 A;  3SDF A;  3MVX A;  4ZEK A;  1ZMG A;  2F8D A;  4KFQ A;  1YCJ A;  2RIN A;  4IO7 A;  4NED A;  2I0C A;  3H06 B;  1MPD A;  3EHT A;  1MQH A;  2B3B A;  1MY3 A;  1OMP A;  1XS5 A;  3S9E A;  1M5F A;  1B0H A;  4KYE A;  3K6W A;  2G29 A;  4TOZ A;  1ZLQ A;  3HHG A;  1JQF A;  3VXB A;  4NMY A;  2ZNS A;  4ND9 A;  2V3Q A;  2DXR A;  3VVE A;  3I3V A;  3O6I A;  1LAG E;  3TQW A;  3U1O A;  4YMA A;  5LOM A;  4NF4 A;  4U1O A;  3SEY A;  1DPE A;  1Q1K A;  1NKX A;  4NE4 A;  4YKK A;  4OET A;  1PC3 A;  3QK6 A;  4H1X A;  2R6G E;  4RNS A;  4WKM A;  4QFL A;  3SET A;  3T9H B;  3TKD A;  2XXP A;  2BJJ X;  2VGQ A;  4GFR A;  4U21 A;  4ZE9 A;  2QL3 A;  5I58 B;  2HAV A;  2QS3 A;  1A54 A;  2Y84 A;  2AL4 A;  4ZS9 A;  1N3W A;  3A09 A;  4ZEC A;  3QSL A;  3PU5 A;  4H6D A;  1B52 A;  3IJO B;  3TUS A;  1B3F A;  1PB9 A;  1XC1 A;  4U2R A;  3PPR A;  2DWI A;  4JSO A;  1B5I A;  4KI0 E;  4TLM B;  4YKI A;  5CI5 A;  2ANJ A;  1FW0 A;  3LSW A;  1B51 A;  1R1N A;  3U93 A;  2I4B A;  3KOT A;  3W15 C;  3S9N C;  4RK2 A;  3TYH A;  2ZNU A;  3OO9 A;  1ANF A;  1JVX A;  2RCB A;  4KCC A;  1QKB A;  4N07 A;  2NUV A;  4ZEB A;  3IAZ A;  1SYI A;  3PMX A;  1MXV A;  4FAT A;  3GBA A;  1B05 A;  1MXW A;  3IK6 B;  4IGR A;  4R6Y A;  4X48 A;  1USY H;  3FAT A;  4LAT A;  4LZ8 A;  5JTY B;  4QFN A;  2LAO A;  3FVG A;  5HPQ A;  4KHZ E;  5L8D A;  1MDQ A;  1MXX A;  3VVD A;  3E4R A;  3GXA A;  4G68 C;  3TCH A;  3U94 A;  3PUX E;  1MQG A;  2I4C A;  4MH5 A;  1US4 A;  4G68 A;  2F7B A;  2OCU A;  2G93 A;  2ZYM A;  3DLN A;  1B6H A;  4G68 B;  3HPI A;  3MW0 A;  3T9V A;  5IKB A;  4E0X A;  4EDP A;  5H8H A;  4U4X A;  3UA8 A;  3VV5 A;  4HCW A;  5HM4 B;  1SW4 A;  2Z8D A;  4R9F A;  1UTH A;  4QFP A;  1B7U A;  1FQC A;  4FJP A;  3A3U A;  3EPE A;  1M5E A;  4F31 B;  1POY 1;  3KFM A;  4ONY A;  3UP9 A;  1OQG A;  4F2Q A;  1DMB A;  1FTO A;  1QVS A;  1Q35 A;  2B65 A;  3E3K A;  4KYD A;  4O3A A;  3R26 A;  4POW A;  1O64 A;  4DXC A;  3VFJ A;  1MY4 A;  2ONS A;  3M3F A;  4HW8 A;  2XXT A;  1NNK A;  4WED A;  3KSJ A;  2PT1 A;  3IR1 A;  1WVJ A;  3PUW E;  4MLV A;  4P11 A;  4QSC A;  3JYR A;  5I59 B;  3H6U A;  2CZL A;  3QYT A;  3U8Q A;  3CI8 A;  1OIB A;  3FVN A;  2XXX A;  2VD3 A;  4KQP A;  1L5T A;  1DSN A;  1BP5 A;  1VFE A;  2Q88 A;  4F3B A;  2I49 A;  1YPN A;  3N94 A;  1H43 A;  1B3L A;  1QJM A;  1TXF A;  2F7C A;  2F5X A;  2GHA A;  1SBP A;  2OLB A;  2Z8F A;  4IY5 A;  4QFO A;  3VLW A;  3OEM A;  1TFD A;  2XD2 A;  3UN6 A;  3FXU A;  1I6A A;  2DOJ A;  5H8N A;  5CMC A;  4JWX A;  1EH3 A;  4IO2 A;  5B7D A;  1POT A;  3B6Q A;  4XXU A;  3FXR A;  1HSJ A;  1DTG A;  2GFE A;  1LAX A;  5H8H B;  5BUU A;  4GXS B;  3F11 A;  1II5 A;  4BDM A;  1LBB A;  4LON B;  3IOW A;  1BKA A;  4YB6 A;  4QSD A;  3MZB A;  3SEW A;  2WKY A;  5DVF A;  5ITP A;  2OJT A;  1S7Y A;  3FJM A;  4LQ5 A;  4F39 A;  4EF1 A;  4G77 A;  1UQW A;  1LCT A;  4IY6 A;  1AMF A;  1LAH E;  3HO7 A;  5KCJ B;  4ELO A;  5AA3 A;  2O1M A;  3FGS A;  3K02 A;  3DP6 A;  1A99 A;  1FQB A;  2ONR A;  3FV2 A;  2PX1 A;  2Q89 A;  1IUD A;  4JDF A;  1Y4C A;  2HQ0 A;  1Z7M E;  2I48 A;  4XKR A;  5BWJ A;  2Z8E A;  1RYO A;  2HAU A;  4KR5 A;  4F3S A;  4OFJ A;  4G4P A;  5AA1 A;  3KN7 A;  1B1X A;  4YZZ A;  3N6U A;  4DXB A;  4FED A;  2PVU A;  3SEV A;  3K4U A;  4QF9 A;  1XVX A;  3C9H A;  1JVY A;  1HSE A;  1QUJ A;  1KWH A;  1MDP 1;  1MY0 A;  3Q26 A;  3H6W A;  3TCF A;  4M1V A;  4NF8 B;  5I2N A;  2UXA A;  3DP4 A;  3R6U A;  3N6T A;  1A40 A;  3TZA A;  3Q29 A;  2Q9T A;  4RXL A;  3BFT A;  1FQE A;  4R6H A;  1SI0 A;  2R9J A;  5ISU A;  1XHY A;  3O66 A;  1D4N A;  1I6B A;  4FEB A;  4I62 A;  4EQ7 A;  1PBQ A;  2H9B A;  2ZYO A;  4KYS A;  1P1Q A;  4MLQ A;  5EHM A;  3TDJ A;  3SER A;  1B7H A;  2H4I A;  1P1W A;  1VE4 A;  4R6K A;  4PFT A;  1PEB A;  5EYF A;  4ZEF A;  1ZIU A;  4KCD A;  1JW4 A;  1FTK A;  1MXY A;  3VE1 B;  5FHN A;  3TTM A;  1AH5 A;  3IB1 A;  3LR1 A;  4H8J A;  2QMX A;  3JV9 A;  3E13 X;  3GLB A;  1QUL A;  4GWO A;  3S2V A;  1B2H A;  3VXC A;  1LB8 A;  1S9T A;  3CFL A;  4ISU A;  5F7V A;  4O3C A;  2NOO A;  2Y7I A;  3V5A A;  2QJE A;  4ELQ A;  2NWJ A;  4Q8R A;  1MM6 A;  5K2X A;  4U4S A;  1ATG A;  2QSX A;  4ECF A;  3MP8 A;  4LP2 B;  4RK9 A;  1B4Z A;  2P2A A;  4ZDM A;  1S50 A;  4LZ5 A;  1D9V A;  2I3V A;  3CSB A;  4LUB A;  1GTK A;  2UYE A;  3ILU B;  1SW2 A;  3K1P A;  3RT8 A;  5EHS A;  3IOT A;  3FD3 A;  5AA4 A;  1AOV A;  3K1M A;  1P1N A;  4C1T A;  1D3K A;  5CBS A;  2ONK E;  3KG2 A;  5I59 A;  5JTY A;  1GR2 A;  3CRB A;  2HXW A;  3CVG A;  3ILT B;  4IO5 A;  4GOT A;  3TCG A;  3TEP A;  2R71 A;  3PPN A;  2ZXT A;  3RN8 A;  3ONM A;  3FVO A;  2YLN A;  2OWT A;  4OFL A;  1ZBM A;  3P7I A;  4IGT A;  3TPA A;  4FIM A;  1AIV A;  1N7X A;  3K6X A;  3ODB A;  4GXA A;  1P1U A;  3KJ7 A;  3G3I A;  4F18 A;  1LFH A;  1LLS A;  1F9B A;  2DP8 A;  2REG A;  4YKP A;  1VR5 A;  4BDN A;  1TWY A;  2A5T B;  2O51 A;  2I58 A;  2V3T A;  3JZJ A;  2B3F A;  3K00 A;  4H5G A;  4HS7 A;  2XD3 A;  2YPN A;  3W9W A;  4DCY A;  4XKP A;  5J1D A;  5ELV A;  1MH3 A;  3CIJ A;  4DLD A;  3DM0 A;  5CMB A;  5H8Q B;  5CM6 A;  1OLA A;  1RKM A;  2QPQ A;  1Z7N E;  2HFB A;  3KN8 A;  3BKI B;  4G2Z A;  4MFI A;  3VLV A;  2VP1 A;  4C1U A;  5FHM A;  3AXF A;  1B58 A;  1IZ1 A;  5KZT A;  5HBC A;  3G3G A;  3HHF A;  2M8C A;  3IL1 B;  3HST A;  3ZKK A;  3OO7 A;  1B9J A;  1WOD A;  2E0S A;  1B7Z A;  1MG1 A;  3L6G A;  3CFX A;  3SEU A;  1LAF E;  3K6V A;  2Y7R A;  3V83 A;  2VOZ A;  2AYS A;  3I5O A;  1JET A;  4OQO A;  1IEJ A;  3K1N A;  3M3K A;  1SW5 A;  1A55 A;  5H8N B;  2DVZ A;  2GHB A;  1XOC A;  3G7W A;  2REJ A;  3OEK A;  3KGC A;  3SEX A;  3IOU A;  4AB5 A;  1M5B A;  1MY2 A;  3IO6 A;  4JXI A;  4U1Z A;  1USY E;  3OEL A;  5DVI A;  2Q8J A;  3EF7 A;  2HZK A;  5L9S A;  2X7P A;  4DZ1 A;  1P1O A;  4ESX A;  4FE8 A;  1NH7 A;  5I2K B;  2D5W A;  1NNP A;  2DYX A;  3CFZ A;  3TTL A;  3K01 A;  3O9P A;  3Q25 A;  1OVT A;  3QXM A;  3C33 A;  4BLA A;  2Z22 A;  2O69 A;  3C32 A;  1O63 A;  2QS4 A;  2O1L A;  3QAX A;  3BBR A;  5F1Q A;  5ICQ A;  2F6P A;  5KDT A;  2ZNT A;  4GQO A;  3UIF A;  1IIW A;  4OER A;  3C4M A;  2UVH A;  1BIY A;  2H99 A;  4G8H A;  2XX7 A;  1DPP A;  1EZ9 A;  1B5J A;  2XXI A;  2H98 A;  2QS2 A;  4OZ9 A;  4ZZE A;  3TFL A;  3UK4 A;  2Z23 A;  4AQ4 A;  1B32 A;  1DOT A;  2RC7 A;  4DE8 A;  4RJZ A;  4OVJ A;  3D4G A;  1B3E A;  4F1U A;  2FYI A;  3WAF A;  4G8N A;  2AIX A;  5K2Y A;  4X1D A;  2DVC A;  1MXU A;  1A8F A;  3KEI A;  3LUY A;  3BFU A;  4GRK A;  3A3C A;  4OWD A;  3T66 A;  2XX8 A;  4OXV A;  4Q5T A;  3ZSF A;  3MC2 A;  2CMO A;  4F22 A;  4QHQ A;  1IXC A;  1OVB A;  4F29 A;  1MQJ A;  1MXZ A;  3OXN A;  5TU0 A;  1Y20 A;  2XXQ A;  2F6G A;  5FTI A;  3MZ1 A;  4FEC A;  2V93 A;  2RC8 A;  2F78 A;  3FVK A;  3S9M C;  2QRY A;  2ALU A;  4JWY A;  4QRZ A;  3RPW A;  3SES A;  4PET A;  5KDT B;  5I56 B;  1LST A;  2OK2 A;  3TMG A;  3IX1 A;  2AL5 A;  3PMV A;  1B40 A;  1NNT A;  5FTH A;  4DDD A;  2PBW A;  3IOV A;  3TQL A;  1TT1 A;  2FA7 A;  3FJG A;  4I8C A;  1UIU A;  2XXW A;  4OES A;  4RYA A;  4IB2 A;  4ELR A;  4UAC A;  3H7M A;  2O84 X;  5CMK A;  3LBS A;  3IB0 A;  1A7L A;  1BTJ A;  4YKJ A;  4X1B A;  2H5Y A;  2H25 A;  4NF5 B;  4LA9 A;  4FOR A;  3D4C A;  4THI A;  5AA4 B;  1RYX A;  2RF1 A;  4XKQ A;  2XHD A;  1OQH A;  1NFT A;  1LB9 A;  1QUI A;  4MBP A;  3OSQ A;  5I57 A;  3B6W A;  4JB7 A;  2UVI A;  4Z0I A;  2DWH A;  1R9L A;  4I9D A;  4Z7E A;  4U23 A;  1HSL A;  1IXH A;  3G3H A;  4U22 A;  4R2F A;  1QW0 A;  4F3G A;  1B3H A;  4ZEI A;  1ZKB A;  2DWA A;  4NF8 A;  1B1H A;  3O28 A;  5DYH A;  3C31 A;  1A8E A;  4TQU Q;  3HCQ A;  4NTL A;  1US5 A;  4P0G A;  2XXR A;  1M5C A;  2DS9 A;  3HN0 A;  1Y3Q A;  1LFG A;  3K0V A;  3OOA A;  5DT6 A;  3MWB A;  4R73 A;  5A5X B;  4Q30 B;  5AA2 A;  3N5L A;  5H8Q A;  4C0R A;  4OMB A;  1WDN A;  4QFK A;  5ITO A;  5TPA A;  4F19 A;  4GIZ A;  2UVJ A;  2V84 A;  2D21 A;  1VFD A;  2A5T A;  2PT2 A;  2XXV A;  3MVZ A;  2DWJ A;  3E9X A;  3T9X B;  3VVF A;  4F3P A;  5A5X A;  2F34 A;  3IJX B;  2Y7W A;  2DXY A;  4N13 A;  3K6U A;  3MVY A;  2O7U A;  3T93 B;  3MP6 A;  3O29 A;  4HTG A;  4YB5 A;  3IO4 A;  3MP1 A;  2IEE A;  4PP0 A;  3H4Z A;  4LVQ A;  2ZYN A;  5I2N B;  2RC9 A;  1EZP A;  1NNF A;  2I3W A;  3L6H A;  1B5H A;  3KOS A;  3RY3 A;  2F7A A;  1FTM A;  1Y1Z A;  2O6A A;  3G3J A;  3KSX A;  3OO6 A;  2VD2 A;  5L9M A;  2DE4 A;  3TTK A;  5AA2 D;  1TFA A;  4PFW A;  1NL5 A;  1I69 A;  3KZG A;  4R74 A;  3O6H A;  3C35 A;  3CSG A;  4NF5 A;  1SD3 A;  3UOR A;  1LFI A;  4JSD A;  2IA4 A;  2KLF A;  3FV1 A;  4NWC A;  4F1Y A;  4FAJ A;  4ZED A;  4OEN A;  2YJP A;  3PV0 E;  4IO6 A;  4OTE A;  3T96 B;  1B46 A;  3U92 A;  1FQF A;  1N84 A;  5L9O A;  1YTV A;  2DQV A;  3PPQ A;  3ZS6 A;  1PBP A;  3FUZ A;  4DXU A;  1XT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...