2V8BA

Sad structure solution of proteinase k grown in selenate solution
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Selenate Substitution: Application in Protein Crystallography
rcsb
molecule tags Hydrolase
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2v8bA00
3WQBA 5AMXA 3DE5X 4CG0A 2X8JA 1GTG1 2W2PA 4DZTA 2WUWE 1SBHA 1SIUA 1TK2A 3D9QX 4GI3A 1T1IA 1KE1A 3DYBA 4JP8A 1SUBA 3LPCA 2DQKA 2W2MA 1C9NA 4KG7A 2SBTA 2DP4E 1NDUA 4DWWA 1TM3E 4ZOQI 3DE7X 4BWGA 1EGQA 2ZWPA 4K8RB 3D43A 1SBTA 4OV6B 1P8JA 3BPSA 1GTJ1 2W2QA 4ZARA 3I2YX 1Y4DE 1DBIA 2V8BA 1VSBA 3VV2A 3GCWA 1SUAA 3A3PA 1CNMA 1C9JA 1KDVA 1Y34E 1SELA 1KDYA 2P4EA 1HT3A 2Z2YA 2SICE 3Q40A 1R6VA 5JXGA 2XTJA 4OMDA 1SUPA 1V6CA 2ID4A 4LVOA 3WIVA 4C3UA 5JXIA 2IY9A 3WHIA 2Z56A 3HJRA 2WV7A 3QFHA 5FFNA 1IC6A 1PTKA 1Y1KE 4LVNA 4OMCA 3PTLA 1GNSA 4AKSA 3Q5GA 5ARBA 3LXUX 4H6VA 5ARCA 3DE4X 3AFGA 4DJ5X 3CO0S 1ZVKA 1SIOA 1SVNA 2E1PA 3ZXYA 3F7MA 4H6WA 1OYVA 5FBZA 1YJAA 3GT3A 3VTAA 3EDYA 3F49S 1SUEA 4B5LA 3GT4A 5JXJA 4KB5A 1GTL1 4CFYA 3CNQS 3DE0X 1MPTA 4MZDA 4CFZA 3EE6A 1ZVJA 4I0WB 1TO2E 3AJ8A 3I30X 1OT5A 1KDZA 3UNXA 1Y3BE 1YJBA 1AF4A 3QTLA 1Y3FE 1BFKA 1ST2A 1SCAA 1Y3CE 3VSBA 1SBIA 1C9MA 1S2NA 5CW1A 1SPBS 1GNVA 1SN7A 1GA4A 2GKOA 2PQ2A 3L1KA 3ZXXA 4FONA 1Y4AE 1BJRE 5I9SA 1V5IA 3DE2X 5SICE 1BH6A 4RYDA 2SNIE 1SCNE 2Z57A 1SCJA 1TM4E 3A3OA 2DUJA 5ARDA 4WOCA 3TI7A 1SUDA 4HX2A 3DDZX 1T1EA 2PYZA 1WMEA 1P7VA 3I34X 2PKCA 2PWBA 1T1GA 2HD4A 4NE9A 1YU6A 1GA1A 2Z2XA 5JXHA 1S01A 3VHQA 3QMPA 3T41A 2WWTA 3LPDA 3VYVA 1P7WA 1AU9A 1PJ8A 3P5BA 3PRKE 2XRMA 2W2OA 1Q5PA 1SIBE 1ST3A 1AH2A 1AVTA 1YJCA 2Z58A 2ID8A 1SBCA 1KE2A 1TM7E 1UBNA 1AV7A 3DVQX 3BX1A 1WSDA 1TECE 1WVMA 3LPAA 1CSEE 1DUIA 3WIUA 4H6XA 5AQEA 4Z2AA 3GCXA 4C3VA 1R64A 1TMGE 3F7OA 4AKTA 4J94A 3VV3A 2X8JB 5B1DA 1SUCA 2TECE 3EIFA 4M1ZA 3H42B 2PMWB 1AK9A 2Z2ZA 3DW3X 2Z30A 1BFUA 1LW6E 1BE6A 1Y33E 5AVJA 1WMDA 2SECE 2PRKA 2B6NA 1THMA 2IXTA 3AJ9A 2ZRQA 3TECE 2G4VA 3OSZA 1WMFA 1OYOA 2W2NA 1AQNA 1SBNE 5FAXA 1GA6A 1Y48E 4NE7A 1JEAA 5JMOA 1SH7A 4YN3A 3SQOA 3DW1X 1PFGA 1TO1E 1MEEA 3DE3X 2WUVA 1TM5E 1A2QA 2HPZA 4KPGA 1TM1E 3DE1X 4NMXB 3BGOS 4WOBA 2PWAA 1S02A 1IAVA 1Y9ZA 3I37X 3DE6X 1SCBA 5B1EA 1Y3DE 1NLUA 2ZWOA 2QTWB 4HVLA 1EA7A 1BE8A 1GT91 3A3NA 5K7SA 1GCIA 1R0RE 3DVRX 1SCDA 3SICE 1NDQA 5AVKA 3TI9A 2ST1A 1XF1A 1C3LA 3DWEX 3DVSX 1PEKE
chains in the Genus database with same CATH superfamily
2K2QB 2H5IA 1DC4A 4QQRA 5JZ9A 3PKJA 1Y5RA 2C5HA 1AKQA 2H00A 5BSHA 2G72A 1LY1A 2FSVC 4FD2A 1R16A 6GPBA 1XMOB 1XCOA 2Q9CA 5L3QB 2H1CA 2X2PA 4CG0A 5TLSA 2XBUA 4RVHA 2HJRA 4DR6B 4F6RB 4NABA 5A1JA 5K0NA 2XBLA 3VXKA 5ALSA 3P9XA 3NHAA 3U3XA 1T2VA 1Z4NA 1NNUA 1RBMA 1UZLA 2ODTX 2P78A 3ZBUA 4DOMA 5IFKA 1G42A 1W25A 1A9ZA 3R5XA 2ODWA 3TW6A 3AEYA 3EVNA 1MG5A 3ASVA 2DTXA 1G3MA 3C3EA 1N5DA 1ZN2A 3BE4A 3UOGA 1KZGB 1X42A 2FKNA 4M7PA 1YO6A 3AR9A 1A4XA 1MJGM 1F4LA 1S4QA 3SSMA 1MLDA 3E1GA 4Q3AA 5D1HA 3BHMA 3IVRA 3VKUA 3E5MA 1QSGA 3KQMA 1K3UB 4DLUA 1EUYA 4UTRA 3PEFA 3T5DA 1JA0A 1E6MA 4B3HA 1QHHA 3U4MA 3E9EA 2R6JA 1WD5A 2EX0A 5IU6A 5FBLB 1U0JA 3I2JA 3LDFA 4XD7D 1DOAA 1YVEI 1WXDA 1U28C 3W3AD 4BX0A 4ERXA 5F3RA 4DW8A 3NXKA 5EZSA 2FQXA 4IIHA 3ISVA 1O03A 4TWJA 1U0EA 3DPIA 4XLZA 2NPFA 3ROGA 4BFYA 1N3IA 3OFVA 4EF4A 3B78A 3PA6A 2O8NA 3FM9A 4EG4A 3OCZA 3QXXA 4X62B 1YL5A 2X40A 1SHJA 4F2PA 1U3DA 3VOSA 3UCFA 3FNHA 4EB6B 1B00A 3CHYA 1PHRA 5JBQA 5EXSA 4X7RA 1QF7A 1QHHB 1KVUA 1NF8A 1TYZA 1E1KA 2RI6A 4ZT3A 2C5EA 4F8YA 4C3ZA 4B3GA 4J3JA 2J3KA 5E9JA 4LJAA 5CU7A 5A3JA 1PJ2A 2CNLA 2ZTVA 2O19A 1WUIS 1YB6A 1NW6A 3GVCA 3IPXA 1V3VA 3ZE8A 1IK6A 5HOQA 5LUAA 1SZJG 4B4KA 1H2FA 3RUHA 2DX7A 3RFTA 3D1LA 4GNRA 1NN5A 4F6LA 3KTAB 3DEFA 2JJ1A 3ZQ4A 3LOPA 3A4MA 3D6TB 1M73E 4B48A 4M1SA 4WJZA 3VA7A 3JQFA 4DN6A 4KQ2A 4E33A 4Y2XA 2ZRAA 2JHPA 1KL7A 2ZROA 4TQGA 1FIUA 2QVYX 1SXJE 2WNSA 4CR7A 5HG0A 3OOSA 3I32A 3DQPA 3M83A 4R1TA 1S89A 2HCBA 2HQ1A 4YUZA 5L4NA 1BQ4A 2AK3A 2GT1A 3B12A 2XE4A 4FOLA 3IT0A 5F4BA 1FMFA 3I9JA 5BP7A 1WTCA 3WK5A 3ZBPA 1YQQA 2FW9A 4GQAA 3VH1A 4CU2A 4LVOA 4KVFA 2PSEA 4DSUA 2FUG1 3CRRA 3HKBA 4KXMA 2CVHA 5CB8A 3Q7IA 4ZZ0A 5AHRA 3NALA 1JLLA 2ZB2A 4KNWA 4Y6PA 4RMIA 4C03A 3NATA 2IOYA 4BNUA 3EFEA 1Y7LA 3GRUA 3BB1A 2XMCA 3GP5A 3K9FC 4WGFA 3Q7PA 4LX0A 4L4RA 2ZYVX 4OHFA 3UV6A 2AR7A 4N3CA 4RM2A 4F7DA 1KRXA 2Q4OA 2BUBA 4J29A 3G0OA 1XBTA 3DBLB 5LBIA 1XJ0A 1LRLA 4MEBA 1AS0A 2AF3C 1NAIA 5FV7A 2PT7A 4FQ5A 3EIEA 4DABA 3RTCA 2WYIA 4KSYA 4E2FA 2AUTA 4YCMA 2QD4A 1JLLB 4V2UA 1J4AA 1T9ZA 1EUCA 1S2DA 3ND9A 1DIGA 3GCZA 4KV7A 3NORA 3HS3A 3OQVA 2PGIA 2C95A 2XVAA 4P3PA 4YWHA 3LDAA 4TRNA 2YJTD 3P4UA 1Q6ZA 4O2RA 2VHQA 3S8MA 3GFFA 4DRXA 4JB3A 1GOTA 5JJLA 1QF9A 3IMFA 3LWNA 4U6NA 1PV4A 2YN4A 4PFJA 3S2SA 3AFGA 5H59A 1Q7EA 3GEIA 1Z34A 2IPLA 2NT3A 3O47A 1HRDA 1Y98A 1XZBA 1M67A 3OH8A 4O4JA 4V0NA 3SHOA 5CDYA 2G9ZA 1ZVKA 3JVUA 2DT5A 1KMCA 3CJRA 2REOA 3QLTA 1EUCB 4JLBA 4MW6A 4MWTA 1PG5A 1FFDA 2N9UA 2OOKA 1RS0A 4UVGA 2H1HA 2IQ5A 3K96A 1J8FA 5A7GA 5KX5A 3L8GA 3L04A 4XRRA 5KYXA 4MIEA 4DRXB 5FH9A 1XVTA 2EKPA 3L7LA 4K87A 3NASA 3DF9A 5DYNA 1QP4A 2JAHA 1ZA2A 4BEWA 5AVVA 5CCBA 3DV0B 2AR0A 2QL9A 1F7UA 3F6CA 2XMRA 1KMIY 4BNYA 1ZGCA 2IEYA 2F1RA 1R0CA 4O4JB 1V8ZA 4F93B 3C14C 3Q6IA 3QYFA 2VOEA 4KR0A 4KB5A 5D7BA 1LDBA 2EZTA 1LDGA 5IZCA 1D09A 3PXUA 3THSA 3TL2A 1N2ZA 3AP1A 2JH8A 3BRWA 1H1LA 3CX3A 4OUKX 5IBPA 4B34A 5KX5B 5KYXB 3J7AC 3RYHB 1W4BA 4DJEC 2QTHA 3KYJB 2AD1A 2QN6A 3K9WA 1KQPA 3PUHA 5TPZD 2YZGA 2VTBA 4NZOA 2FPSA 1KVRA 3TRKA 4R2JA 1FUUA 3L77A 4BQNA 3F2IA 2FFAA 1GJRA 5DULA 2R6CA 3CH5A 4RPKA 3TBKA 3DDUA 1ZGBA 1YJBA 2Y8EA 4UNPA 5J9FA 1GXSA 3G7SA 2DE0X 2ZSHA 3PYMA 4LCEA 4F8EA 3GLHA 1MU0A 3GOHA 4TSFA 2P9QA 4GI5A 3IIMA 1N9ZA 5BNFA 2GBLC 3V8MA 3VR4A 4QLBA 1H1LB 2XUDA 4B7AA 4UTPA 3CO5A 1XTSA 1LRKA 1KGSA 3EXFB 4UVHA 1V3QE 5IT9A 3BDVA 2NSLA 4Z0HO 1M2JA 1YMUA 3HDQA 3WGHA 2WIFA 1A8UA 1H2YA 5KVAA 3JWEA 4LOJA 1K75A 1RWWA 4XCVA 2VTBB 1P2VA 3BIXA 2P4SA 2PXCA 4BBJA 5HUQA 3ZXUB 5DYTA 4P3KA 1JG2A 1GXSB 1Y8RA 3EMBA 1L2TA 1ML4A 3GLHB 2E6KA 1K7SN 2OM2A 2A0WA 3G6WA 3EX7C 1ZL2A 3IVMA 3DOOA 1N5LA 1FMTA 3CPJB 3QLJA 1WMSA 4IMIB 2X3YA 4MYSA 4XIYA 3CLVA 3M3HA 4IDDA 1O94C 1EE1A 3D6UA 3FJOA 4NNOA 4KPFC 4DGSA 4DMFA 2JI6A 1HLDA 2R97A 4FWIB 4MV0A 2I9KA 1ZHHA 1VLHA 2TS1A 1II9A 1NVFA 1NUAA 5JZVA 1W0KA 2QORA 4BO0A 2VXCA 5DGIA 2QQEA 2D1TA 3AF4A 1ZBQA 5BUZA 4P5EA 1UADA 1M66A 2ACKA 4BB0A 2R0QC 3Q1LA 4UHDA 1G63A 1IBRA 3RT9A 1H8ED 2VYVD 1H42A 1ZYUA 4MLDA 1CJKC 3Q98A 1SKAA 2V45A 3KAKA 3AG5A 4JJ4A 1Z6AA 3L4SO 4K6OA 1G4UR 1N2CA 3QWBA 4ZVLA 4HX2A 4ZVOA 3TNJA 2RH4A 4D2IA 3RBVA 3G8AA 3FLEA 3F4BA 3IUEA 3COVA 1T9HA 5HKOA 4DPMA 2BJVA 2O7VA 2GD1O 3ZKWA 1R6AA 2QN3A 5CPFA 3VPFA 4KREA 3MTIA 4FILA 4QUBA 4DCNA 4RQTA 3AEKB 5LLTA 4NE9A 4PXAA 4J0GA 5C31A 4CM4B 2ZBRA 5M5BA 4JV5B 1GNLA 2Y1WA 2ZYAA 1OWOA 3CJQA 5KYUA 2FVXA 4IJWA 5KPJA 3LZ6A 2ZIAA 3NT5A 2YC4C 2B7BA 4RH0A 2L2QA 4XDZA 2YJ5A 3H8SA 1JEQA 3EEBA 4FYIA 4ZAGA 5FYQA 3ZKWB 3EODA 4N49A 5TX7A 1XQXA 4X0EA 4DR5B 5DB4A 1Q5PA 4IVPA 3THXA 3CWQA 2E87A 1XZMA 3VFDA 3C8DA 3VNBA 3DVAA 2A94A 5F35A 5BMVA 1DTWA 3P19A 4Y2GA 5C52B 1LB1B 1Z2EA 3K71B 3CIOA 1KOJA 4HFMA 1ZDMA 3MAJA 4YV2A 2F1OA 1U8YA 3DAGA 2P69A 3DMNA 4TS9A 5A5GA 2O23A 4GVXA 1M0WA 4IDGA 2XOKA 4BX3A 5ICEA 3IPLA 3PSHA 3RUIA 3HPQA 3L4BA 1U4OA 2QM8A 4MIOA 3EBOA 4DIUA 2XRYA 1TJ5A 4D9MA 5JANA 3HA2A 3AFOA 3UWDA 1YOVA 3THXB 1L5ZA 4JLPA 2VG8A 4N3BA 4EFKA 3CGGA 3KLPX 4PYIA 5JZOA 4O2AA 2PA3A 5AVWA 3AXSA 3NM4A 1PJAA 3LPAA 2RHDA 3I6BA 4CLXA 4EJFA 3D54D 3RYCA 1XCBA 2X0IA 3KQNA 3IIKA 3AHHA 1QONA 1CVIA 5DBHX 2SKCA 2OO5A 4R1OA 3ZYCA 2X9LA 5TB5A 4F21A 3EDRA 4GRDA 3CLSC 2PQ0A 3G5UA 3JVEA 4DSNA 5E8RA 3C1UA 1CQXA 1YOVB 2D8MA 2WA1A 1L8XA 1OY1A 5DOZA 2Q1WA 1EK0A 1RYMA 4QJBA 4BNLA 4O2AB 2ZIZA 4QDZA 3SQDA 2NZVG 1T4BA 1UC5B 2GZMA 3HEAA 1ZOSA 3I12A 3PICA 1B6RA 4O33A 4DS3A 2GFQA 3K4PA 3BZUA 4JEIA 4X9XA 3SDZA 4GLBA 4E6PA 1OOEA 3PXAA 4KJZA 3SJCA 4NCIA 4X7BA 4AI6A 1ITZA 3RS0A 5ICFA 4YCLA 1VXOA 3TX6A 2ZWMA 3BSYA 2WNHA 4HAYA 4ARUA 3FDFA 1V16A 2Z6QA 1OSNA 5KYNA 1DQNA 4TKVA 4MDFA 4TXHA 3C1TA 3JQ8A 2DCUA 3HCOA 4YRGA 2PMWB 3V4ZA 4J43A 2BHLA 3BE8A 3QK7A 4DQUA 1W0JA 3R0ZA 2CF5A 1J0DA 3PC6A 4PGHA 4UOQA 1IG3A 5IAAA 5DYIA 3LQ2A 5T57A 1J8DA 2Z30A 4JVOA 4L0DA 1RT9A 1K86A 2DQZA 2PVCA 4L75A 1NVVR 4JJ6A 1LW6E 3DFFA 1BE6A 1JIXA 2Z4RA 5LQUA 4ZVKA 2BN4A 2BI8A 3GD5A 3BAFA 1V16B 2QTLA 2Q27A 1UDRA 1KOFA 3JQ8B 2UDPA 2TYSB 2YYAA 1NUUA 3GNLA 4KVAA 5K3FA 4DIBA 2NPIA 5CBPA 2WHXA 1OPRA 3QGMA 5GP1A 1E1QA 3TIVA 4Z1OA 1QV6A 3ZHVA 3W1EA 5KWVA 2C2HA 1TNDA 3CLRD 3NBUA 3BWBA 2YRWA 2BFEA 4O0LA 4PR3A 3WNVA 4N03A 3T0IA 4DG9A 3RD5A 3JALA 2QVGA 1CEQA 2GN4A 4MQEB 2WIAA 3ADCA 3DOIA 1LWNA 2RSLA 1M34E 1ZXXA 4XWYA 1SC1A 1I2DA 1BSVA 1WE2A 4OY3A 3SQOA 4C7MA 5C3MA 4UVIA 2DCMA 2ZR9A 3KB8A 4A4DA 4V3CA 5K3FB 1ORVA 5CBPB 3QPWA 1A98A 4BDTA 3W90A 3WO0A 3I61A 1ZMXA 2V59A 1GLNA 1XA3A 4JUAA 4LHSA 4Q39A 3UXYA 3AL2A 4JT8A 5A5VA 2A9OA 2J0UA 2QZ4A 2AX4A 1QFMA 4J16C 4MULA 4RZHA 4Z9XA 1RKXA 2BFEB 3EQZA 1DWQA 2VUTA 4AY6A 4XVHA 4X63A 4BO2A 2XZTA 5TQVA 2I6XA 2B98A 3EZYA 4R84A 4PZLA 5TS3A 1L5SA 1SVMA 5DGHA 5HQ3A 4P86A 2CYCA 2G9NA 1EBBA 2E6UX 2TSYB 5KIAA 2Q4TA 2VQ6A 3HB0A 2PMDA 4G07A 1H0KA 2DLCX 1ZH0A 4YUYA 4ZC1A 3TIGA 2H65A 3EVFA 1VECA 2C4TA 5A9SB 3L7DA 4CKWA 3G0BA 3TKLA 3EZ6A 1MH1A 1XZGA 5L3SA 3A7DA 3UPTA 4RTRA 2PFKA 1XXHA 2YJNA 2E21A 3WKCA 5EIHA 5KKAA 1N6KA 3D4IA 3ONWA 5GMOA 3NHRA 2DVMA 2XDAA 3INGA 3FROA 4P82A 5KVCA 4H31A 3MHTA 2IGBA 3PEEA 2VHUA 3UBMA 4U4AA 3V9AA 3Q7TA 4W5NA 3ETGA 2CBGA 3ZDEA 4LY6A 2POQX 4D9KA 1Z0SA 5K01A 2B8NA 3MJRA 3NBZC 4FDUA 4K9NA 4XKJA 4DR1B 4DBLE 1DQSA 3AY6A 1K6XA 2E37A 4CKWB 1T5DX 1M5UA 3F9IA 1UMCA 5F3WB 1TJNA 1U1IA 3HCDA 4WKNA 5MGNA 2WG2A 2HK8A 4IYJA 3AIMA 2WPDA 5HUHA 1XXHB 5L3SB 4MS3A 3D2AA 3MA0A 1YTLA 4BPBA 5L9AA 3LK6A 1GPLA 2QMQA 1P9WA 5EMNA 5E1MA 2WHPA 1Y6GA 1N0IA 2ILTA 2C4UA 2J31A 3DUFA 4LBYA 3VNAA 3VPSA 1Q3TA 3WYNA 4BVJA 3L7JA 1QHFA 2DFDA 3UJPA 4OYYA 3SN6A 1UQUA 4RY2A 3C5HA 4XR4A 3UEOA 3PXCX 4M46A 5JLAA 3GNTA 2Q45A 3UAYA 4RADA 1W34A 4GGPA 2WSSD 3T6KA 2JDIA 5ALGA 4LDJA 4MS3B 1OI2A 1O6GA 3F6PA 3BSWA 3IXQA 1H05A 1X94A 3X0DA 3A1DA 3KWJA 1DO2A 3PI6A 3D6NB 4H1UA 2VSYA 2WHPB 1BVYF 3HCBA 4US2R 2GTIA 2WILA 2YXPX 3L0ZA 1TK2A 4IQFA 5AKYA 4LC0A 4MVJP 3K2IA 2FPMA 4ZJUA 1GQRA 1B0PA 1JUDA 2JFBA 3QOFA 2BE9A 3VDXA 5E9QA 2JAXA 5K3SA 4ZWNA 3ERCA 1Q74A 5GAJA 1KPGA 1NMXA 4J75A 4NG4A 3GLGA 1CRZA 1V7CA 2HV8A 4N5NA 4YEDA 5LZ7A 2UYOA 3TQQA 1W76A 4UARA 5ALDA 4AJOA 1MAHA 4PS0A 4HUJA 2NP6A 4FXPA 1JX6A 1PV1A 2VIIA 4NBKA 1D2RA 1ZM7A 3GRFA 3ZWNA 3O9MA 5SYMA 4U9IS 1HRKA 1PFWA 4J2HA 2J4CA 3OI7A 1QFJA 4QNMA 4R69A 3O9VA 2OSBA 1CZUA 1O77A 1TT7A 1THZA 3COPA 4G26A 4HAWA 5LZ9A 4ZOQI 1MDFA 2CVFA 4YCSA 1DAMA 5K99A 3A4YA 1DSSG 4FYWA 2FZ5A 1S8OA 1PZGA 3KM0A 3GLGB 5H8WA 3TNFA 5ES3A 3TLEA 4IDFA 4KQKA 5KQPA 1M2KA 4ZI7A 2BC9A 4PG4A 4RDXA 2BGTA 2VQFB 1CUVA 4O29A 5B5SA 1DWUA 3NM5A 2F9FA 4Y6SA 4DQLA 1QV7A 1YS2X 1CVRA 1P8JA 4OJYA 5K0CA 4GOND 1Q84A 4F5ZA 2H2FA 5ESXA 4G0OA 2WLSA 4HPJB 1N2GA 2PSHA 1UFOA 3G2JA 3ZWWA 4EMBA 3O7WA 6LDHA 3I2YX 1XD9A 3IPAA 5EJGA 3UWMA 1J9GA 4HMOA 2WM9B 3AEXA 3MZ0A 4XVUA 3B6MA 1RHJA 3OZDA 3DP7A 3TXXA 1B76A 3ZXIA 2Z3ZA 3W5UA 1NP7A 2EP5A 4A6DA 3LUDA 1BDMA 4HEHA 2GVNA 2H1WA 3EGVA 2WUEA 4G09A 3QEKA 3VISA 3OQ1A 2HIGA 3RBAA 3QMWA 4LZWA 3LGSA 3KDSE 3WL6A 3UFXA 1SKYE 4KQ9A 2Y0CA 2JBAA 1KDYA 4NMHA 1HT3A 1I4EB 1ECFA 2ET6A 3OPYI 1LA2A 3O4GA 3R7FA 3GLTA 1HNNA 2XTJA 4YI5A 1L9KA 1T8WA 4FFBB 5EIAA 3BOSA 4BRSA 1IWOA 1Z8FA 1OBVA 2B5VA 4OQNA 3WY9A 4BGIA 2NACA 3G68A 1D2NA 4JT4A 4E08A 2BEUA 5JEDA 1ZAKA 2HC9A 2PR2A 3L8HA 4UM5A 3TQIA 4BQSA 2OL4A 2QMOA 4P4TA 4AS1A 1Z38A 2JBAB 2R65A 4A8TA 3IQIX 3OM0A 4G8CA 4KV9A 4MQ5A 4WJLA 3HJGA 4S05A 3CEMA 1ZKDA 1Y8ZA 3N74A 3HJRA 2VPXA 4GG1A 1K5HA 3WWOA 1CD5A 4NZPA 2C96A 4NYJR 1E1RA 1KNXA 1Q57A 1P0PA 1U7DA 4RMHA 1IC6A 5G40A 4DR2B 4A2PA 2ZSKA 1SRRA 1QMGA 2GLXA 1IQRA 2QLFA 1P4RA 2IPOA 1GG2A 2JLQA 3CIFA 3G8BA 4KEAA 4BQRA 4UXJA 5AK4A 4DA7A 3KXKA 4OMCA 4Z4HA 1KQOA 2BEUB 3E3MA 5J2TA 1J0AA 1R3DA 1K06A 5HFNA 3ETJA 4DCPA 3T5CA 2FSSA 1SHKA 3TRDA 4BEBA 4DF3A 4PU0A 4F4DA 5KYKA 1CZHA 2I4NA 4XCXA 2O8BB 4OK3A 2X2EA 4FX2A 2P9BA 4U7DA 5K0LA 1SHLA 2GKGA 2VHEA 5FA8A 1IBLB 1AQLA 5P21A 1H3EA 3GFOA 1ATIA 2FUNB 5FA6A 2X1VA 1GGVA 1U8AA 2ID9A 4IRXA 1W1IA 1AB5A 2E4UA 3GF4A 1PIWA 2QAGA 3N07A 4LZOA 4YJKA 3CRMA 2Z43A 3N1UA 3QEOA 1R8XA 5DHQA 2GAJA 4PG5A 3ZQJA 1TZ2A 4O5OA 1ZGZA 4G5SA 3H5WA 2OAGA 2PPVA 2QK4A 1ZWLA 2RGBA 3A4LA 2VK2A 4WN3A 4ZCLA 4W9NA 5H0IA 5GPBA 5B2FA 1D0IA 3PT9A 4XWGA 5A9TA 5GONF 3UAOA 5IDYA 5HJEA 4E7PA 3GT3A 3E48A 1MC5A 4L95C 1YQTA 4NYMR 3UIEA 2V0GA 1AHHA 4RLFA 4F45A 2I3ZA 4JD5A 3ZU3A 1YI1A 2FAXA 4PX3A 3VGPA 1M7BA 4FCCA 2AKAB 2FFQA 4KE9A 4MGEA 5C8VA 3ZVMA 3NRCA 2W6OA 1G64A 4BJ3A 3QOXA 4RABA 3VHRA 4R3UC 4E07A 4E30A 3K2EA 4HLUA 1DJOA 3LZDA 2CL6X 4AZTA 3T61A 3CNQS 1JH8A 4MUXA 5BV7A 5EE3A 4C5AA 3G8DA 3I01A 4MEAA 1SZDA 4QXOA 4ESEA 3W5DA 2WIJA 3NNSA 3QLEA 1ZNXA 4CQNA 1S6YA 4QDKA 1PVOA 1SWWA 4P0TA 3TVYA 5A4FS 1K0UA 3IEXA 3IH5A 2DM6A 1EEHA 1C7FA 3GA0A 4FNAA 5CEJA 2QUAA 1II8A 3IOEA 3EC2A 4GFDA 3DBHA 3QA9A 4GDFA 1W1WA 3IQHX 1Y3FE 2ECOA 3B1FA 3OTGA 4QU5A 5J63A 2QGNA 1GNRA 1T4MA 4MW4A 4DUPA 3BE6A 3K30A 1H8HA 1KS2A 3NAQA 2JJ1D 1E96A 2P6UA 4KH1A 3RYFB 1RLOA 3H11A 5AFSA 3PC4A 1VI2A 1G8JA 1DTEA 3P45A 2WJYA 2IX3A 4X7MA 3EHEA 2XA9A 4NG5A 1KAMA 1R27A 2XYVA 3PE6A 3TM4A 1Z6QA 1II8B 3DBHB 4GVPA 4BTLA 3HXLA 4IJKA 2GWHA 4JLJA 5J1TB 2QW8A 1NXWA 3IUPA 3ZXXA 3H86A 4GSLA 2Q2NA 4X6LA 4DIEA 4F91B 1YR9A 2IY8A 4BLRA 1TIPA 5IRCD 2I3DA 1N0VC 4JYCA 3R0XA 5KWJA 3SLRA 1XK6A 2RHBA 3NM6B 5JAHA 2I03A 2AFIE 3WYEA 3OO1A 3TXAA 3JAMA 1FJXA 1SXIA 2IJGX 4NLLA 5HMLA 3DPUA 2GJAA 3H11B 4C6TA 1ORDA 3BD8A 4FUQA 1O7JA 3A1CA 3U4QA 3JASA 3DAFA 3GZJA 2JFNA 1RFLA 3OUZA 2RHHA 3KVOA 4K88A 2X23A 4ZTUB 4CMCA 4ID3A 3T3GA 3VZRA 1CFJA 3A3OA 3RJMA 1R10A 3RREA 1NRJB 4GX2A 4YAWA 3CEPB 3I9FA 1J07A 2GAOA 1RLUA 1H85A 3HJBA 4CQLA 4GPBA 2WI8A 3N0VA 2AYYA 4IHKA 4TT3A 1GN9A 3ASZA 3GRCA 4DBZA 4MYHA 5TF4A 3L0PA 3CZMA 5CNJA 2LIPA 5CURA 4C6TB 4EUSA 1RXYA 3U4QB 2Q6OA 3JASB 3R23A 1T1EA 2IXBA 3W4JA 1Z6ZA 3HFJA 1CQJA 5AO9A 2NOAA 4DEVA 3K70B 1GG5A 3X1MA 1A88A 4RY8A 1YU6A 2C5GA 1OWMA 1FP4A 2KLHA 2OP0A 4O1MA 1L5RA 4E5UA 5B4UA 1HEUA 4JR0A 4JI1B 4CQLB 1NWHA 2PAFA 4YQFA 3OECA 2FW8A 4RCZA 2EFHB 4LZJA 3QMPA 3OIDA 2OHGA 1JXMA 4MVCA 2RGDA 4UCQA 2LR0A 3E3OA 3CLUD 4D4HA 2B4TO 3CVXA 3VYVA 4TZ6A 2AZDA 3H75A 2B1QA 1QQBA 1T8SA 1TJ4A 2ZRPA 1CQJB 3FKJA 1EFDN 1QZUA 5HYVA 3W9YA 3O91A 3MQ2A 2O06A 1VKOA 4LWQA 5C4MA 1RM0A 1GQOA 1OZGA 1FP4B 3DEKA 5JTTA 5AIBA 2ZIXA 2IKSA 3N05A 4J1QA 2JI9A 1ZGHA 2GRAA 3NXSA 2GPTA 3U31A 4QHYA 1UEXC 4CHTA 3QKWA 4Y2RA 3VPCA 3DA8A 1RVDA 2P9EA 3GVPA 3ZPXA 3RSFA 4PLTA 1B6TA 1DJMA 2IZOA 3MBOA 2F64A 2GNAA 2VHWA 3KK0A 3RO7A 3B7WA 1G7SA 5FL7A 4L8LA 5F64A 3SC3A 3V8VA 2C07A 1YFZA 4A10A 3W9BA 1UAYA 4IEEA 3TGLA 4WZBE 3HCCA 4MUAA 4A0HA 2H7VA 2V97A 4TYWA 2ZIXB 2GBCA 3BRWD 4M22A 4MW7A 1LNZA 2O4UX 1TZMA 4HVTA 2AMYA 4IILA 1XKQA 1GU7A 4HH4A 4Z9YA 2EKQA 5E7MA 1JW9B 4IIGA 4B7UA 4QM6A 3L92A 1VBKA 1LDNA 3ESRA 2VXOA 5AOAA 4TKMA 2AJBA 1CZNA 3HL0A 1SXJA 3PHCA 5E4JA 1ISPA 4A15A 3K0AA 3TLCA 1DIRA 1FVXA 1I4TD 1OLXA 4BLTA 1KJ9A 1L5HA 3NDRA 2AG6A 4G8BA 4S35A 1Q7GA 1XLWA 3PZBA 4G5FA 2ZXUA 1GYQA 4UAUA 2A0YA 4Y3UA 2PZAA 2AOTB 1P2UA 1A9XA 4YJ3A 2J3EA 3AZQA 4CL3A 4BFXA 5BW6B 1KP2A 1IOLA 3VR5H 1IY8A 1Z07A 2DH6A 2HIMA 1BX3A 1U0SY 5CEFA 1VIDA 1Q44A 2CJWA 2QRHA 2M32A 3Q0EA 1G5RA 5FKJA 4FS3A 1P9LA 4L9AA 4P7FA 1SXJB 4ZREA 3IRVA 4N0EA 5FR2A 3K0AB 1Z0FA 3A4NA 2X14A 4KO3S 4TSKA 3REFA 1OLXB 3A32A 5IJAA 1Z12A 2RHMA 2P2YA 5IVDA 3UJCA 4LFAB 1L5HB 3KR2A 3D7MA 4HR7A 3SS8A 1PZHA 1JG6A 3GLVA 5AHKA 1I7SB 3CCFA 3C1AA 5CEEA 1QFZA 2VPQA 1YFKA 4JXJA 4XLLA 1A9XB 1UT8A 4YJ3B 5FBHA 1WUHS 1ZI6A 4AUNA 4ETIA 4F38A 1WMDA 3HNPA 2PRKA 2O54A 2Q5OA 3R5JA 2BFPA 1W0KD 2NTJA 1POWA 4URWR 4RE6A 5LYJF 2CJWB 1RYEA 1YCHA 2YX1A 3PHIA 4RZXA 3OEHA 1G3QA 1PR9A 4ZO4A 2O2IA 621PA 4L4YA 2HSZA 3CTMA 4CIYA 2C0PA 2JCSA 4DLAA 3UV7A 1E89A 3A6KA 2XCSB 2FWPA 2FMIA 4DM4A 2O8CA 5L3RA 1KQGA 1ULSA 1L6IA 3EXHA 3H2BA 3QQPA 2IC5A 3BE5A 1IHUA 3FE2A 3K7EA 4DLSA 1T4GA 4FGSA 1VYHA 1LBIA 1VRWA 3K53A 1OC4A 3BGWA 1Y48E 1PL8A 2HU7A 3DXZA 3PPXA 4I8XA 3GXOA 2UYQA 4NE7A 3SQNA 3VI4B 1UPXA 5ALHA 4TOIA 3R2JA 4F46A 4BNNA 3P1JA 1VSQA 2ZB7A 3MSCA 4OHMA 5EYPB 3CISA 2H2AA 5GM2A 5FPTA 4LW8A 1U0HC 5ELLA 1FFBA 3ENZA 2FRDA 3OETA 4IMJB 4L9SA 2P2CA 5JAMA 4ZVQA 2O8CB 2COKA 3EXHB 2HWUA 3KPYA 2G9VA 3NVMB 1YR3A 2FZKA 3KLBA 2GWRA 1FFAA 4EJSA 3H18A 1WQ4A 1BYIA 1U3VA 4CLHA 1Z6PA 2GM5A 4NOKA 4CFSA 4W5RA 1W2GA 1I4LD 2I6SA 2D2FA 5HR5A 3LSYA 1MX3A 3R0JA 2EATA 3KQUA 4M55A 4YMIA 2PPLA 5DW0A 4HB4A 3RUDA 1MKYA 4BAUA 4IMPA 3SIRA 4MYRA 4EVRA 3PQ2A 3STTA 4YJDA 4OF4A 2AI2A 2GETA 2FMXA 1ZQ1A 2ZJ3A 4YR9A 3CVWA 2JAOA 3PEUA 3UT6A 4M9SA 1JDNA 4MDHA 4Z99A 3UW1A 2HF7A 1IQPA 1DKQA 3VZDA 2WSMA 2PD4A 3UJNA 4PPGA 1OWPA 3D4BA 5AJUA 4IV5A 5B64A 2ZK7A 3B3FA 3FHLA 4ZV7A 2GUGA 2C4VA 3Q41A 5JZSA 1QYDA 4PQEA 1QTNA 3A1TA 2C4MA 2XNJA 4YWJA 4Q24A 5E9AA 1QFXA 3V8EA 4KFTA 1D4ZA 1IEQA 4AP6A 3D0QA 1ORTA 3OD5A 4HO1X 4M1MA 1NQXA 1XLUA 3I8SA 4LBVA 3V4LA 2PZBA 3F1KA 3I64A 1JE0A 4ENQA 4BFZA 5BWNA 3ZVNA 1L4UA 1FNDA 1EU1A 1NDQA 1QVZA 3KYIB 1LBSA 4S24A 4YJHB 4B4DA 2O2CA 4KL8S 3NHLA 3A1EA 4ARAA 2ST1A 2QZSA 1SVOA 3N8KA 5I7UA 3LOQA 4TYMA 5DGCA 2GK7A 4H7FA 3AI3A 1W93A 2QSYA 3QVGA 1CE8B 1X87A 4K5QA 4Y6QA 2VAWA 3TEJA 3C6YA 4X6YA 1UWLA 2ZSUA 5EP1A 2GZ3A 3O3OB 1JAYA 2Q1UA 2Z2IA 4LDQA 4R9NA 1DKOA 2DB3A 3RODA 3U1VA 2KS6A 5JRJA 4DQVA 3A6PC 1F48A 2YCBA 3D7KA 3H2GA 5EHNA 3RIEA 4ZHSA 3O83A 3FNQA 3B60A 2Z1MA 1O6BA 1K6IA 3FSJX 1TLLA 3GWZA 4R6WA 2GA8A 2DECA 1R5JA 2ODBA 1CQIA 5ALKA 3K70C 5JSKA 5DRTA 2JLSA 2XYQA 4MUMA 5K45A 5BN1A 2RI1A 4CM3A 1CU1A 1JDBB 3FF4A 2OD9A 3IMCA 3L7NA 4NHEA 2Z2JA 2FFRA 3W5HA 1OD6A 2DBRA 3CXUA 1J23A 3OTHA 5KPDA 1KVSA 3GAMA 2EYQA 1JHPA 1LF5A 4FDLA 4WPGA 1YRYE 2P75A 2WYVA 4HATA 3GEHA 4I1UA 2QP3A 1G60A 3NBQA 4Y2HA 2IV7A 3OLZA 3KKQA 3CT4A 3BCSA 1IOZA 3HVUA 3OE1A 4MKIA 2XWJI 1E4OA 1YS1X 3R76A 1O6FA 1CQIB 2HBYA 1CDDA 1QM5A 1PVVA 3G17A 3R3HA 2ZXFA 5BYBA 1XNHA 1ZJ4A 2DTDA 2X4DA 3K6RA 3MUOA 4B71A 1BQ3A 2CT8A 1UIMA 5EINA 5TF0A 2FG5A 1EK6A 3R6WA 3LC1O 4CM7A 3DL4A 2IYEA 3JU3A 3QVSA 4C88A 3EQ9A 5HM6A 1FFGA 4XZ3A 4GVLA 4XJSA 4B2IA 4G67A 3F8WA 5FBVB 3QBVA 4AULA 1HKHA 5E2IA 1BMQA 3HVKA 3C3CA 4HLQB 4M9RA 4PF1A 4WKOA 3STWA 1RXIA 1P4HA 1LK7A 1PL0A 3C3PA 4KN5A 1A71A 2WWHA 3FJYA 1BDBA 4PAQA 4PX5A 1U2DA 2EP7A 1U8UA 1RAIA 2J46A 2W2QA 3PFBA 1RQNA 4MITA 1IWPB 2WVJA 5EPEA 3UJ3X 1AXGA 3GGDA 4K6HA 4ARBA 5GJWC 2LBPA 4KLRA 1U63A 2YV3A 4IZOA 3FWPA 5KEIA 2V7TA 1QGAA 5BN3B 3QLVC 1XAIA 2ABWA 4PC6A 3GLIA 2PXAA 4Y2SA 1EI9A 2NYAA 2XCIA 3NKVA 1KAHA 1MR3F 2E1RA 1LBHA 3LD9A 4FCVA 4F11A 2IYWA 2I3GA 1SXHA 2V5AA 3PD1A 4H08A 1GSAA 2DF8A 2P9CA 4MQUA 4YQZA 4B9EA 4DY4A 1UCFA 5K8JB 3BXFA 1QBGA 4Q1DA 5KYVA 3ETDA 4FC6A 3QWFA 4W8OA 1VCNA 1H5QA 2UZIR 4CN8A 3IODA 3R7AA 4F12A 1TB4A 2XUZA 1PQUA 1QANA 1ESNA 2II6A 1C8BA 2MIIA 2QE7A 4CKXA 3AOGA 4D81A 1XZIA 4DDMA 1ZD4A 4JVNA 4O4JF 3GLIB 4F9EA 3ZCTA 1SXJC 4RGBA 3VPBA 3MRXA 3L41A 3BJZA 3SR4A 4F72A 1JHRA 3A28A 2FSIA 3GY0A 4RVNA 1MDBA 5J40A 4EYKA 5JXIA 4IVNA 2H11A 3QVTA 5KX5F 4RTMA 2XB4A 3A2MA 1AGPA 3D8RA 4OHBA 5MN4A 3T3OA 1TQ4A 4PRYA 4G4SO 1JNYA 3MAAC 4MS1A 4C30A 2Z1DA 4XE5A 3TLYA 3ZY2A 1DXQA 2ZIFA 5KSZA 3OY7A 5ER6A 2V5VA 2CNNA 1C29B 3MT8A 1K68A 4JJKA 2XWBF 3EEQA 4MI3A 4Q4JA 4UU7A 4V3BA 3LT1A 2XB2A 2VUHB 5BRJA 1BD4A 3U4IA 1JFFB 3J81A 2GPSA 1YL6A 3S8EA 4RZ2A 4W99A 4WZ6A 3ZIAD 2BL4A 1NMSA 3K16A 2EQAA 3P2MA 2D8AA 3PFIA 4YFYA 4B1FA 4R1MA 4L51A 1K3FA 2FGJA 4MS1B 4BJ6A 5BSKA 2FPIA 2GM4A 1E2BA 3KJGA 5GM1A 5H82A 4AMGA 4IAOA 1W46A 2C8VA 1P5HA 3D3WA 3O0DA 4D7AA 2AG5A 2ZRHA 4DYHA 4Q4JB 4DA4A 2G67A 5CDTA 4D0GA 2BLLA 1E98A 2J7PA 2PWYA 4BX9A 2YOGA 1SOMA 4KR9A 1YNOA 3MGGA 2JFHA 5CGQB 3U7JA 4EGCB 1YVDA 2GCNA 4J0JA 2O50A 3AEUA 4DUYB 5A3QA 1E4VA 1HTTA 3A6DA 2IH2A 2VF4X 3EXHC 4DDKA 2QYSA 1A5TA 4C87A 4S3MA 5HP4A 5BXQC 1U3FA 2BF4A 5A4IS 1ZM4A 4L57A 2FPIB 4D46A 1YJAA 2YMPA 4DQ0A 4NTZA 4RESA 3EULA 1EVIA 3D3WB 3PQ4A 1N6PA 1ODLA 5H5JA 3EEOA 1YR7A 1PFQA 3KL2A 2RKOA 1DAIA 2G1UA 1RKBA 3TSYA 1NLZA 1VJ5A 3F49S 2GPNA 4EWLA 5AESA 3ANYB 3LXXA 1OPXA 2WYHA 3OOWA 4MVJG 3S2FA 1ZZEA 3MFQA 5KYYB 1AGXA 3AEUB 4O5AA 4PPYA 1ZW1A 1SWVA 1M34A 1GN8A 2FRDC 3I9KA 1JAHA 1Y1PA 4RFLA 4PWZA 4HEA1 5JATA 1Z39A 1B1AA 5DM0A 1FXUA 4MQMA 4Z8XA 3SHFA 4ZT6A 4D96A 2XQFA 1F12A 4LSZA 3MTEA 1YK0A 4MV7A 3OF2A 2R3SA 2GERA 2G63A 3PUXA 4RD2A 2O20A 3L8YA 3MTGA 1RM4A 4RJIA 1Q0RA 4F3KA 2HMUA 1QNFA 2R6DA 4EA9A 1DDOA 1YRLA 3M34A 4HG2A 4TYPA 4ZCPA 4X64B 3AJ8A 1RHMA 1YB5A 4UE6A 1NVMB 1U2EA 1XAGA 2PUWA 3B2QA 3BBLA 3BJIC 3G8CA 2HRRA 1KY2A 1TUIA 2GZ1A 2IYAA 4IH9A 4S2UA 3SYLA 3TCXB 3DD5A 4Q7MB 4OQXA 1BFKA 2Q28A 1VL0A 2INGX 1SCAA 4Z5XA 5K8LA 2DSNA 4GZ6A 4N5IX 3TVDA 1MZPA 3M5WA 1NBAA 1JFRA 2BGKA 5CJPA 3ZI0A 4DCJA 1ZLXA 3GRVA 5EKSA 1ZI9A 3QWHA 1JL3A 3WLEA 1MIOA 1G5FA 2HSGA 2G1PA 3KO8A 4XI9A 5F2EA 3ZDYB 2XE7A 4CMKA 4H6PA 5KCZA 2DQ4A 3OX2A 4J7CA 1NPYA 4WIAA 3UYLA 4YRJA 3PDUA 2BEJA 2XT9A 2ZU6A 1QLHA 1QIGA 2DBQA 4CF4A 1L4KA 3HJFA 1UKAA 5LMZA 1UC4B 1X1BA 3FDXA 3D3EA 1IN6A 4G1UC 4Q4DA 2UAGA 1JIUA 1YRHA 1E2EA 4TTPA 3NP9A 2I2BA 5L45A 1Q15A 3WOHA 4U63A 5DJ5A 2EKDA 2XUFA 2ZTSA 4YT5A 3UYKA 1K0FA 4EI9A 1NM5A 5IANA 5ESRA 3OP1A 2I2WA 3WQRA 3IL2A 1MIOB 4FYHA 2WF6A 3Q7QA 1JDBC 1RJFA 1WV0A 3O2QB 4CG3A 2CL0X 1GVNB 1N8NA 5CW2A 1Y37A 3PRYA 5CLIA 5UKDA 5AICA 3ZHUA 3OCXA 4ZZIA 3QEJA 2F59A 2NZXA 5ITZA 1NVXQ 3A36A 3GFTA 2XLBA 2DH5A 4BL5A 3HDJA 1V4NA 3T0FA 2BTQB 5I7WA 1BHJA 5IAKA 2B0CA 5FT9A 3ZV6A 5JAOA 5FOSA 2ATVA 3MB8A 3PUYA 3BZWA 3NAMA 4QLOA 3EFOA 4MV4A 4XM1A 1LI7A 2IEDA 3NUGA 1I7LA 4EUEA 3PL5A 3EAQA 1QKJA 2RIRA 3ZHOA 4EMUA 4GBMA 2DQSA 2B4YA 1D6SA 2IUYA 3D4PA 4FHZA 4KVGA 3G0IA 2JGLA 1E0JA 1TM2A 3DDZX 1N2SA 1E1RD 1U3TA 3FUCA 4J0QA 2PKQP 5JS2A 3FX2A 1J8QA 3ZK8A 5JYCA 3EF3A 1U0RA 1GTZA 1WPRA 2ZQZA 5B6IA 5ITZB 4KBGA 1GFZA 3V1YA 1UT5A 2MSCB 3I34X 2EFJA 2KPOA 3R5HA 4JN6B 2A9KA 5LQNA 1E6KA 3IQEA 4O2AF 1XZ8A 1AKRA 2I6TA 2GJ8A 4NI5A 3SYTA 4E2WA 1UWKA 5AI6A 4HXGA 2E55A 1NF9A 2O3UA 1XMIA 5FNVB 2N3ZA 1ULUA 4P93A 4QOSA 4B73A 3RTDA 5I7EA 4QREA 3EPJA 4DLKA 1BDIA 1JHUA 3TW4A 3NTLA 4MQFA 4F5DA 3UAXA 3SSNA 3I05A 1LDEA 2PSJA 1RIFA 2AV6A 1L8AA 2MDTA 2X0KA 4IV0A 4J1TA 4TLCA 5HGXA 2FDRA 3L6CA 4B5KA 5JWRA 2SCUB 4UPVA 5A9RA 5F1OA 1I1HA 4A0RA 5DT9A 1FW6A 1F2TA 2K5UA 3RUCA 3IDSA 1ZCBA 2W4MA 2OPBA 3TZKA 5IKPA 4M38A 3H1GA 5EJ6A 1GZ6A 2K6GA 4ND7A 1N1DA 3LYHA 2X13A 2VAXA 3NCTA 2IHUA 2H4ZA 1Z2AA 4S12A 5LUBA 4BMXA 3BKXA 4D9JA 4EUKA 3ED1A 2QP4A 4BBPA 2IDZA 1DC8A 3MCUA 3QHAA 5FORA 5DLDA 1XALA 4MQFB 3JRNA 2AJLI 2BGJA 3BJMA 1U2DC 3CQ9A 4FLFA 2J0VA 1M2NA 1UBNA 1CQZA 2CV1A 4Q15A 2R2GA 1GUFA 3E9MA 3EA5A 3AIKA 1DVRA 3KT8A 1UBHS 3PNYA 4GXRA 4KO1S 2YHSA 4M98A 4JL5A 2E2WA 2IZ1A 3KAQA 3OU6A 5EZ5A 3VX3A 3INRA 1F2TB 5LXTA 4RA6A 5JD6A 3VHXB 1U7TA 1RIIA 4ZXFA 4LGMA 1PW7A 1UDBA 2VJQA 4WINA 4DV5B 2CMHA 3AB8A 4C08A 3EH2A 2FK7A 1SMKA 3HCRA 1IBMB 1QV9A 4IDQA 1R8JA 1BMTA 3EQ8A 1MRZA 1JKJA 2OBYA 2O4CA 3WGLA 1BN6A 1QCZA 3BSFA 3G1WA 1NIPA 2BT4A 4DA8A 5TY0A 3GO4A 2H4YA 1Z4PX 4QXMA 1AB6A 4OL0A 1VI6A 1HA3A 1N7GA 3IP9A 1L5LA 4ALJA 1AKMA 1N2HA 1ND6A 2ZPAA 4QX6A 4RA6B 4FB4A 3WR5A 5LXTB 3T4UA 5J4YA 2UYGA 1PR4A 4ACBA 3KFVA 5K6TA 1T4CA 1SBYA 3Q7SA 1FUIA 1F38A 2REQB 2V4UA 2GPAA 2WE7A 1A7KA 3ECSA 3M33A 4N82A 2P2ZA 3F7OA 5BW4A 5JALA 4BATA 4QDOA 1EDDA 1FSGA 1FU8A 1UEJA 1ZIDA 1SUSA 2WWRA 2QE6A 3FZGA 3IMKA 3KELA 1II0A 1FS6A 2BHSA 2WIBA 4OJQA 4TROA 4Y7DA 3MTQA 5CA0A 3IEUA 4KQFA 3UA4A 1Y9EA 3PWKA 4QHTA 2BZGA 1R4NA 5EIWA 1XDZA 4L8GA 5EPUA 4Z0NA 1OFTA 4LG1A 3R5TA 1X70A 2J67A 2PH3A 2PX0A 3KWMA 3MEQA 3MQ4A 4GE3A 4I1SA 4X65B 4QXRA 1YJ5A 3DW3X 2HX1A 2FLKA 2YOFA 2YZ7A 1O0SA 5FOTA 2RGEA 3H3XA 3PQ6A 3H16A 1K9VF 1DTSA 1T4CB 2J07A 3NIBA 3OEEA 3JZDA 4JFAA 1J1ZA 3BMXA 1GGEA 1GKKA 2ODNA 2XF2A 3W5BA 1S2OA 2VRCD 2WJAA 3B89A 3DFKA 2VQ3A 4RHUA 5CA0B 3Q6MA 3I9V6 4HYYA 3GW8A 5ESWA 4OB7A 4XEUA 4NCAA 1XA4A 1R4NB 3ETLA 3P0EA 3S2UA 5HRAA 1QH0A 1XRQA 3L0SA 4TWRA 1GZDA 5F7XA 5DLYA 1PJLA 3GGCA 4FZJA 4OD0A 2PD3A 4L0CA 1VLMA 2Z5GA 2VYQA 1OYOA 3D6HA 3AVPA 4QGAA 3QG1A 3IAHA 1IDOA 1CETA 3KTFA 3M4NA 1XU4A 5CCDA 5JJCA 4JLAA 4TT3D 1AQNA 5J2UA 5HIAA 5BT9A 2HGZA 4BNDA 4EP1A 1ZK2A 4Q9NA 1D1PA 2PT5A 3IR7A 5LLDA 1HL7A 4QQFA 1HEIA 1NX6A 3KKZA 2O3QA 4HEJA 2XYRA 1C8LA 1PYGA 3DW1X 5EWJB 5CCEA 3CA8A 1FJ2A 1WCXA 1WDWB 1TKAA 4PNZA 3E0QA 2HMVA 3LLVA 4LY3A 5JH7B 3DTNA 4PZYA 4RPLA 3EPKA 1A2QA 2HPZA 4S1TA 1YS7A 4ZOCA 3KT6A 1X8KA 2FW7A 4YAJA 2OHXA 5TR9A 4O25A 1FQJA 1XZDA 3LX8A 3QW4B 2FP4A 3WTCA 1EGVB 2O5VA 3LVQE 3OF5A 1H4QA 4J4HA 3WWEA 4BNDB 2PUAA 4N4AA 1L7EA 2WD7A 1MFZA 4QULA 5JFOA 2BMAA 3KXIA 3V34A 3WDLA 4OSEA 7AT1A 5EKXA 2ZYUX 2QGFA 1C0KA 1TVEA 2XMSA 3BWVA 3GAFA 3IV9A 4OJNA 4R68A 1B2LA 4CNBA 3QIAA 4FR5A 5DNAA 5JHHB 5LKAA 3UUFA 3TUIC 4Y2QA 1NYTA 3ZBQA 4DWOA 5KINB 3JZIA 1Y5IA 4G9EA 3E9ZA 3MN1A 5AWFC 9LDTA 2JGFA 4AYWA 4FT2A 4ARSA 4KR6A 3F8TA 1WW8A 2FP4B 2WZDA 3TEMA 2V03A 1KP9A 4GYYA 2QN1A 4M21A 1HYEA 3T4XA 3BIOA 3LCUA 3W79A 4DLPA 2WD7B 2FF5A 4DTIA 4G0UA 1D5WA 4WEOA 2EF1A 3OBIA 4BIMA 1PLLA 1TZCA 3F4LA 4NYIQ 1Z0JA 4A0FA 2VNIA 3TIFA 2VHXA 4YI3A 5T5QA 2GN6A 2CVOA 5CH5A 3QUCA 4PLVA 4FI3C 2A86A 2NU8A 4A6PA 3SICE 1K4KA 2EIXA 1FPQA 2NUPA 3MWDA 3OEYA 5JSZB 2FN7A 3TB4A 3OZGA 4A0QA 3A4TA 4PGAA 4QVIA 1XF1A 2XMGA 1V25A 3LQYA 3RFFA 2X0JA 2YYZA 5DM2A 5HILA 1KPIA 3ZD8A 5TS2A 1B8UA 2VJBA 1UBRS 4C4PA 1V1MA 3F96A 3DOFA 3SGLA 4ZDKA 1NM5C 2HCJB 1SXJD 2DZDA 3EOZA 3AM1A 4L6CA 1WNFA 3PXDA 5G4KA 2X7HA 2QF7A 3LLCA 3JPWA 3RUFA 4BNVA 4BO5A 1YQDA 4ZI7F 4C2TA 1T91A 2NUPB 3A14A 4ZI2A 3W9UA 3VU9A 4EPRA 4KE6A 3T3EA 5CYGA 4HNAA 4NOJA 4ZP1A 2AFIA 3GFVA 1NATA 1CV2A 2E5WA 3NNDA 4FBMA 5GZ1A 3NTXA 3DLHA 1EX1A 2NIPA 2FPKA 3DKVA 4MVYA 1V1MB 1A5AB 1BD3A 1SIUA 2QGZA 4JT2A 3LHFA 1GVHA 4RAQA 5D3KA 5HMMA 3WJ7A 5IKXA 3BHNA 4QAJA 4DB2A 1JVBA 3FWKA 1TEXA 1XQ6A 3HADA 5HQJA 2C7OA 3GOQA 4QUAA 4ML3A 5G4KB 3SLGA 4V02A 3GH3A 3HVRA 1Z0ZA 2IZ7A 4MICA 1QIJA 3C3KA 1GPBA 4TTQA 3V3KA 1NHWA 2QMEA 3FOZA 4CNQA 5B58C 3GJ7A 4HNAB 1PX2A 4P31A 3K8YA 3FYDA 1PX0A 2FN3A 1FLAA 2GPYA 2QD3A 2ZT8A 3C85A 4P38A 3BCUA 5JYDA 1FDTA 1TGYA 2IHYA 2DP4E 3AG6A 3EY9A 1S3FA 2BM1A 4P0PB 2A58A 3KL4A 1DKRA 2G76A 3V97A 2PKEA 3FTNA 3TPZA 3CMMA 3E15A 4BRWA 4RUKA 5FRDA 1MO3A 2C1XA 2HDWA 3BB4A 1F9AA 3OQ6A 1QTIA 3JYOA 1CKEA 1J9EA 4C4XA 4URXR 1UBKS 5J58A 2NU9A 4J1TC 4XPZA 4TVOA 1RQGA 1MENA 2ZWPA 1F17A 3DC7A 4RK0A 3VKFA 3LLMA 3KE8A 4BNFA 1J5PA 2QTMA 1KZHA 3FZQA 3AFIA 4LQ4A 4BYGA 4BQFA 4ZEVA 3RI3A 3PF9A 2AXQA 3PGKA 5A04A 3OQPA 4XVQA 4BNHA 2VSXA 3HN7A 3ZWAA 4H18A 4ZVVA 9ABPA 4N41A 1L4FA 1RQPA 3CNOA 1U9IA 4LQLA 4QUDA 3VZCA 3MNFA 4AYXA 1Y7PA 2P5SA 3CSDA 4HLNA 4E31A 5A5EA 2GRUA 4LHYA 3VPDA 4LSMA 3OKFA 5JSYA 2EW1A 3NOXA 4FIDA 4P4GA 1OX4A 3BAZA 5AI8A 1OIXA 5EKUA 1RXWA 2QBYB 1CNMA 4RZQA 3T52A 1U94A 4KZPA 1U7OA 4YP6A 4KCGA 3IC5A 4Z4CA 4EUFA 4MYUA 3B1ZA 1TAQA 1H6CA 3OBBA 5ETJA 4EY7A 1JJAA 2ECKA 4ISCA 3JAKA 2RDMA 4MVWA 4ZI5A 2ATIA 2SICE 4IIUA 4B33A 2DHRA 2XTMA 3BWXA 2VP5A 4OFBA 4PHCA 4WZBA 2VSQA 2ZRNA 3NHBA 2ZBEA 1BU8A 4BZXA 2VWGA 3EZXA 4TZ0A 3EWNA 1RLJA 5HJ2A 3GJQA 4REMA 1HYQA 2LUOA 4TWZA 1DL5A 1OX4B 3LI2A 4QT0A 3IHKA 2A30A 4Q16A 1HDZA 5JNUA 2XUIA 1OMOA 3HO8A 3T3NA 2OBFA 1ZD1A 1PNTA 2F55A 2XUGA 3E61A 3ZLVA 1WKBA 4MO2A 1KMHA 1TRKA 3EW9A 1E92A 3JAKB 2IY9A 4O4IA 4WLNA 4AZSA 3H83A 2WDZA 4BMDA 2ZDGA 2LNDA 2NUBA 1M6VA 2A59A 1RHUA 4DCTA 4OEHA 1D0SA 2W2TA 2XVYA 4UU0A 1OZ0A 5JJ5A 3D02A 2VDLB 1T26A 1U6JA 4IG4A 5HWSA 1JT2A 1NKTA 3P4XA 4L8FA 3R7SA 1US8A 3DLPX 2X5JO 3WB2A 5K0FA 4WUTA 4B80A 1JEYA 3SXUA 1ZD5A 1XV5A 4U9UA 1I4DD 1NULA 5ESDA 4CMGA 5H4GA 4R31A 5EJMA 4ND5A 2CXRA 1KMHB 1RCFA 3CW2A 2CNOA 1D9XA 4Q18A 1E9VA 4EB0A 1M6VB 4C21A 4MZXA 2BI7A 4N0PA 4BAZA 8ATCA 1UKYA 2ZRJA 4NQZA 3QKUA 2CCKA 3F5DA 4XB1A 4TLBA 3H1EA 3OJEA 4AJPA 1MAUA 2CB9A 3JQAD 4KRYA 2ZQYA 3JYLA 2PTGA 4DSZA 4M9XA 4Q1VA 1JEYB 1B93A 4TLDA 4RL4A 3GFRA 3SXUB 3ME5A 1OBOA 1RZRD 3TR5A 2R7LA 2JLVA 2R1VA 2QP9X 3IDZA 4FE4A 5HEKA 2EP8A 4UNRA 2QQ5A 1B74A 2XUJA 3DBIA 4MP6A 5DMXA 2I8CA 3GIDA 3T7IA 3NTVA 2DULA 4KK4A 3L7AA 4HDQB 4J6EA 4UHBA 4EHJA 4UHHA 2AJCA 4CGYA 4KRGA 1UFRA 1XMVA 3NETA 3VUEA 5ADWA 3ITNA 1QQ5A 3MCVA 3PNBA 5C8ZA 1Q14A 1S9HA 1VJRA 4UZSA 1VMKA 1AMOA 1AO0A 1YS6A 2R85A 1P91A 1ZCAA 1OXXK 1EM8A 4AG5A 2J3QA 3KVYA 5CYPA 1XYGA 3ROKA 2ZSEA 3WZMA 1NMZA 1FOEB 2GN0A 3QU9A 3T7DA 1AKVA 1QPZA 2CXOA 2YZNA 2AOUA 2V9ZA 5AKHA 4E15A 5ICGA 1E2FA 1KZ9A 2RHWA 2I2CA 1QYVA 2XB6A 4PZ0A 4XIIA 2XQIA 3H7AA 3W34A 3WWCA 4H1WA 2LXNA 1MPTA 3DP9A 1J21A 1O97C 4OP1A 5D3ZA 2FNAA 5E95A 5EE9A 4DRYA 1FPMA 1WULS 5AH0A 1VB5A 2YS7A 4ZA2A 5B4VA 5BV1A 3RAEC 1F5SA 1W30A 2A1TS 2YCLA 5BO5A 1AO3A 1DAFA 2AMJA 2XQJA 1ZFNA 5A7FA 3AHFA 1TO2E 2C0QA 2QL5A 1PG2A 3OCWA 2CZQA 1I3MA 2BF7A 4Q9AA 3QYJA 1KDZA 3GBPA 1Y3BE 2HRBA 4MKRA 2VZEA 2E4VA 3N53A 5B2ZA 3N8HA 3TLXA 5HFJA 3AC0A 3TZCA 2VK8A 4F9TA 2POCA 3VSBA 1ZD2P 1QXSA 4DJTA 6REQA 3OOYA 2HRCA 4TTJA 1K5DA 2F3UA 1Y5NA 2JJMA 2ZE8A 1QP8A 3CV3A 3DNMA 2CBZA 2QTCA 2VP6A 2FMTA 1T8PA 3IE0A 3WLFA 1F14A 2CK3A 3R3XA 3UMJA 5KTSA 5EA2A 4UUQA 2DGDA 3MD9A 3QVJA 1W96A 2JEOA 2IL1A 4CIDA 1X7YB 2IS6A 3P0RA 1W581 4NFSA 3TUZC 3BBPA 3KEFA 2R2AA 1CX9B 4B6RA 5COQA 5ADHA 1NW3A 1ZGGA 2I6FA 1QE5A 4Q66C 3Q9NA 3HQ4O 4PHFA 2XODA 3IDOA 2PFSA 1VLVA 6REQB 3ZE6A 1VSUA 1U0FA 4MUNA 4UHJA 1Q0TA 1TA4A 1QVVA 2JLAA 1NJ5A 3PUIA 1QWSA 1H5UA 1E6EA 1NBME 1NUHA 1ZUWA 2C03A 3DE2X 1HSOA 3R8FA 1GPUA 1UWCA 3NC4A 1IE3A 4RYDA 1AN9A 2BGNA 4LXTA 2P0AA 5JQGA 5JHGB 1NNI1 2JCGA 1UQTA 1GTMA 2HJSA 3KOOA 4IV8A 4AUEA 5YASA 3HR8A 3PGMA 2X0EA 4EQ6A 821PA 2WB4A 2JIPA 3H2HA 1GPNA 5DHTA 1WHTA 3GYGA 2XNSA 1INLA 3QOWA 4Q6WA 3TS1A 5KNDH 5K0JA 4ZQEA 2YXBA 4MMZB 1H1DA 3UJ8A 3VNVA 3RS2A 3ZWBA 4YFVA 2YV5A 5HJ7A 1LTKA 1AHPA 3JQ6A 1Z6XA 1L3BA 1S7CA 4MUEA 3EXG1 3QLUA 1JMYA 1H0HA 4L6IA 1IY2A 1SD1A 2CYAA 3F3KA 4QFMA 3BF8A 1N75A 3SSOA 2PGLA 2IOFK 4JH0A 4MWGA 3RT1A 1L1EA 1NJFA 1FU7A 1TAHA 1VGRA 4YRQA 2JFOA 4BO8A 2SHKA 2AJTA 3SNKA 4PYMA 2GR9A 3OLVA 3TD9A 1I30A 1QX3A 1NVBA 3ZDFA 1ZU5A 5E7QA 4GX5A 1LW7A 4EGJA 3A9VA 1XRNA 2JLZA 3DZCA 4H1VA 4ZYVA 3H99A 1VSVA 2B5WA 3KB2A 3ADOA 4NQRA 4A9AA 4II2A 1Z4LA 1KO8A 3AEZA 4E70A 4BRZA 4U7WA 3CVJA 4YHBA 2QHXA 3E4CA 3TTUA 4NECA 1T5IA 1M76A 3LQ1A 1JI3A 3RNOA 1FP7A 2GARA 3MQFA 3WGIA 3AI2A 1WB9A 2QQFA 1B0UA 2O7RA 2PTHA 3LHKA 3HYNA 2EJTA 5J4VA 5LN1A 3P5BA 2OC9A 2WHRA 3Q2OA 4BV9A 5L7TA 4J90A 1ISFA 2ZE6A 3FIUA 2JFYA 1JXQA 2WJWA 1ND5A 3L0YA 1XHEA 4U2CA 4FDTA 4R98A 1FDSA 3OJOA 2FKAA 2J3DA 3EZNA 1OHHA 2D0OB 4YJ3F 1RKVA 1GV0A 3BFVA 3P2YA 3VC2A 5CJ2A 1GZVA 4LJ9A 3RSCA 4RKWA 2FR0A 1YRWA 4DNFA 1Z35A 1FVHA 1X13A 2AZTA 2ID8A 1ZHFA 4MWBA 3PGLA 1E79D 2R6AA 3UHOA 4D4MA 5H3LA 4N5LA 4J91A 4HYTA 3D1VA 3ZG6A 1JHDA 2ATCA 1TKCA 4YT4A 3GMTA 3LY5A 3LX4A 1X1TA 1RYZA 3VC1A 2DLDA 1NF3A 2BD0A 2A7QA 5KU1A 1IXRC 3DXXA 1XRJA 3EFHA 3WO1A 1CUCA 1U0NA 1M33A 5C35A 1PNVA 1BDJA 1M6YA 2QSUA 4QC2A 3LT5A 4B17A 4F4UA 1OFVA 2PNJA 2H2IA 1H23A 3GGOA 3S68A 3AINA 2BH9A 4HN4B 3ACCA 3V8QA 5AJHA 5IT5A 2X7JA 4MCHA 3SMVA 3AVOA 1UEIA 2VSOA 1WVIA 4ZOEA 5TJ9A 3IEMA 1CULC 1LTHR 3KJZA 2OHVA 2QRNA 3ONNA 2VFAA 4HNTA 1OH5A 3A0UA 1RR6A 3HJCA 5G41A 4MLPA 2XKKA 3U0VA 5JDIA 5JNWA 4Q4AB 4FJ1A 5FFMA 1U2TA 1RXSA 1DZIA 2HA4A 1L5OA 3AHDA 3BWCA 1KY4A 4KQHA 3WLLA 1SOUA 1XTRA 2GYUA 3ABOB 1G8YA 3VNSA 3WLOA 3CY6A 4O4HA 2V4MA 4JBXA 4YDHB 1UXIA 5BQ3A 1USIA 2EW8A 4ZODA 4XYMA 1QTRA 4FLMA 1XELA 1UJ6A 2GEDA 2UZ3A 3ICPA 1H2XA 2JIQA 1ZJ5A 2P5TB 3NC0C 1NI5A 3V48A 1CZKA 2J9XB 3C3AA 2IYSA 3DLAA 4OGKA 1NF2A 2Y3IA 1YHZA 1FLNA 2Z2ZA 5ITSA 1IHDA 1EXNA 4L3WA 4XB6B 5DTRA 4KDEA 3TIIA 4H0CA 2H0RA 2G8NA 2GAAA 2Q0SA 1NRXA 1TCVA 3UV3A 2FDXA 4I4NA 3NI2A 8AT1A 5ULLA 2BOVA 1NW9B 3D0OA 3E7DA 3RDPA 3F5SA 4E5DA 1POXA 4DC1A 4RTQA 1U8XX 1N7IA 2X42A 1H9BA 3FYUA 3I1JA 3TG8A 1TF7A 4YO8A 3OZAA 5CNKA 3PUKA 4M86A 2UUCB 2QQ0A 3FWZA 2KW5A 3MLBA 3Q5DA 5JCZA 1QGED 1Q7BA 2JJ8A 1VPDA 2ZUSA 2GB4A 2C5AA 3K9CA 1AN0A 3QG5A 1FTWA 2BRUA 2A0UA 2YBEA 4DE5A 2P9ZA 5EVJA 2PV0A 4EL0A 2L17A 3P9ZA 3TW8A 4TS1A 4PAOA 2OGSA 2AZXA 1CUBA 4TX1A 5AKGA 1WL8A 4ZRNA 5AR1A 1KO5A 2ZPUA 3K8ZA 2XOXA 3FYUB 3BSSA 5EUMA 4I9UA 1F8YA 1PGJA 2GEUA 5SY9A 3U56A 1CR6A 1CDZA 4ITRC 3DEJA 4F3CA 4C7BA 1QRUA 1NJ6A 1FYVA 3IUQA 3RK0A 4V0KA 3PYXA 3W5CA 1RACA 2PUVA 2Q50A 1JECA 3DZFA 3LHSA 1HMYA 1WLYA 3L6DA 2PUBA 1VA4A 2P79A 4ZQGA 1DIAA 2Q9AA 3CM0A 3L7MA 4FWBA 5J5VA 4B4WA 5LM3A 3SJBA 1XZQA 4OP3A 2PWAA 4MQ4A 1M10A 1A8HA 5M2QA 4KR3A 2GBPA 3AV0B 3ER6A 4DVJA 2HHCA 1QIKA 2G88A 4FVTA 4HFJA 3E81A 3V1NA 3TW0A 5DHAA 4XW2A 3B6JA 3N2KA 5HDQA 4LKRA 2RC6A 1ISMA 4RMGA 4AWBA 3DTYA 1NLUA 2AMFA 2VUUA 4PZCA 1J5EB 2BZ0A 421PA 3U61B 4EG5A 4OXXA 4BN4A 4AKHA 4AXBA 4HVLA 3K94A 1ZW6A 3KFLA 3BXZA 3FOBA 4PHTA 4TM7A 1VIVA 4WXRA 5DO9A 3RFUA 4LE0A 1P72A 1LSOA 3CRQA 1SBZA 1HI9A 3B70A 3HLYA 1G7TA 4HAUA 4M7WA 3PNSA 1YOBA 4RAOA 3HDHA 3KUCA 1UANA 2C54A 1XB2A 2BY4A 4FTWA 4YJFA 2UUPA 1CTQA 4UU8A 1FZTA 3F6EX 4YAKA 1P5FA 1GFWA 1GZHB 1FQWA 3ROPA 2OCGA 2WJIA 3K4QA 4WD3A 2JK0A 1L4LA 4B8WA 3LUAA 1LNQA 1L1RA 1XDWA 3S1AA 5B30A 1GY8A 1GNPA 4OQYA 5C7IO 4JBWA 1PGPA 4C5BA 4MUIA 5DK4A 1JZTA 4OQZA 3O1HB 5JSUA 5JS8A 5LMNB 3ZEAA 3AHEA 3PVSA 2OHJA 1YUNA 3DVSX 5GZ6A 1L1QA 2IYOA 3IVXA 4DSAA 1TZBA 5I5EA 4S0ZA 2IWHA 1LPAB 4RCVA 1E58A 3T7RA 4H3HB 5KOIA 4FUTA 3N39C 2CFOA 2Q1XA 2HSDA 3LTEA 2DPLA 3FMOB 2OZEA 1QRRA 2WKWA 3A7EA 3KAPA 3DHWC 1NWCA 3K0CC 3MS4A 4QOJA 4Y6LA 3ITEA 4BMVA 2PVSA 1Z5OA 3EHDA 4XWAA 4GBJA 3GLKA 3WB9A 4EPTA 5K0ZA 3P0FA 1NKSA 5DX0A 5IF9A 4O02B 4UEQA 5EP3A 2YH2A 2YDYA 3C4QA 3ER8A 5HKKA 4RULA 3GA5A 4PX9A 3H2KA 4N8EA 4ETMA 1NY5A 3I4LA 4WA7A 5MFZA 2CN1A 4C78A 4YMVA 2R11A 2WJJA 5AQ1A 1YJXA 3LPCA 3P94A 5DEIA 1W8DA 3M6VA 3HL4A 4ZGBA 1T6YA 2CDBA 1QYIA 4P22A 2OAQ1 2Y67A 2YHAA 1T5HX 3MJHA 2OC4A 3OWHA 2AVNA 2DQKA 3QU2A 4P84A 4LV6A 5LZ5A 3EIOA 2I6GA 3LVFO 5G0TA 5A0VA 3JYNA 4GQIA 4TLMB 1MJ5A 1YT5A 2EWVA 5HK8A 4ZEMA 1GAXA 3LP8A 5BQPA 3W6NA 3ZOKA 3AX6A 3F5MA 2ASVA 2YWDA 4JLUA 5LIRA 5JRDS 1G66A 1TPZA 2PZEA 3O8NA 1XDUA 3JRXA 1JMKC 1G4HA 1PQPA 3Q3IA 4B0PA 2NX2A 2OBMA 4DCMA 1IBSA 2HXYA 3RRFA 4KQIA 1V26A 4R71A 5I9IA 1P3DA 1WVGA 4V1CA 3V4PB 1DFHA 1EP1B 3D43A 5E3HA 3VAAA 2P1ZA 2IXFA 5LP6A 2QY6A 1X1EA 1SO8A 3HCWA 1DG1G 3I8OA 5A05A 1WM1A 5JS7A 3OY2A 4FFVA 2O6LA 5GGXA 3VR6H 5F5NA 4F0JA 1U1FA 3T5TA 3WQHA 1JR6A 4LRWA 4WLEA 3AY7A 5THKA 2JD0A 2XNKA 2QZPA 2NUTA 1ZM9A 2DJ5A 4AC9A 4RIEA 3STUA 1X1QA 1RPNA 3P52A 4HH0A 1Z0DA 5KHOC 2R86A 3JD4A 3LA6A 4LNAA 2HLPA 3G9XA 1RABA 1ACMA 1ZQ9A 5JPIA 2X0DA 1J49A 3CLTC 4KRXA 1DU4A 3LC2O 4J07A 4PGMA 4ALMA 3FCAA 4CF7A 4FEYA 3D6JA 1Y34E 2G1KA 3B5IA 2QX4A 1CEEA 1EXMA 1SELA 1DFIA 3V1UA 4YP1A 1ORRA 4EKEA 5DHSA 4RM3A 5F78A 5EFOA 4ZZ3A 1G6HA 3MLAA 4TV9A 2NUTB 2B2NA 4FEGA 2P40A 1G3UA 2YN2A 4LHEA 3I04M 1O0BA 2W43A 1GRRA 4X00A 2GM3A 5K0EA 5JSFA 5IKOA 3LUHA 1LBQA 3TBFA 1U99A 2GD2A 1GP2A 5DF1A 3OQIA 1PCXA 4WH0A 3JVIA 3Q5EA 4RHYA 3WJAA 4RK7A 1Y8CA 3SFVA 3A10A 4X3PA 5JDIC 1LVGA 2B36A 3CZQA 4ND4A 2OLKA 3MWEA 4WE3A 1EJ0A 1TEVA 3OIWA 3KOUA 2A14A 4U00A 3FFWA 1AKYA 1T8RA 2YZ2A 3KZVA 3MINB 4TV9B 1ZH6A 2ZP1A 4UHEA 4QDJA 2QSZA 3WQQA 4BWFB 1C9EA 5KU7A 5LU8A 4JI2B 1JHYA 5JPDA 3OJFA 4D9BA 2GHTA 3O4RA 1A4IA 3V6LA 1JT9A 2OWDA 4NMWA 4XYBA 4AN1A 2OFPA 4KYUA 2W6QA 1S0UA 2PIDA 3OQIB 1EWYA 1NI3A 4W5WA 3HXTA 5JH7A 2H9YA 4J7AA 2JJYA 1M0SA 3RJZA 4PLFA 3WSVA 3LRPA 2NXJA 4NCBA 1ZEJA 3MWEB 4RTOA 5FULA 4AKSA 4E5PA 4LIPD 4I6JA 2NWQA 3TLJA 1WPGA 3EK2A 4JQOA 1QE0A 1X9IA 5I9NA 4L4SA 2GI4A 1QG6A 1XNJA 3FOAA 3MT9A 2PKYX 3CZ5A 3I6ZA 2IYLD 2Q5LA 1NXXA 1ULTA 1Z17A 2O1EA 2QT1A 1PYOA 2YFYA 3F0TA 3FYUC 3PHHA 4PW0A 4UFNA 2J8ZA 1H1TA 4BB6A 4F8JA 3RQIA 4YRFA 4ZYWA 3GCDA 3EZFA 1KIFA 1YR8A 1V1RA 4UBIA 3WLNA 4JODA 5EIBC 4MPJA 5E7IA 2IXEA 2YY5A 4LJ8A 1SIOA 2BRUC 1HXHA 2G9UA 1AGYA 1NV9A 4KWCA 1BMFA 2QLTA 3B7GA 5B3JA 4BP1A 2P4QA 1U8EA 1V39A 2AI1A 5BSVA 3IJEB 3CN7A 4FI3F 2PCLA 4HKTA 3QE3A 2G9RA 3FD8A 2JS7A 4MWSA 2O57A 3FNGA 4ZT5A 4HH1A 3AUSA 3SHTA 4XXHA 1DT5A 1Q22A 4EEZA 2WT9A 1UXKA 4HX5A 1PQ4A 4GWLA 3VJLA 4ZIRB 1QPGA 5I4BA 2YVLA 3A1SA 3UT0A 4YRLA 3GT4A 4AP5A 1V1RB 4QZVA 5GY7A 3MBKA 2DBVO 3HCEA 1XJ5A 2BTOA 4P2GA 4RZ3A 5F23A 2DEUA 5DFAA 3KEQA 1EMDA 1W5AA 1TD1A 2JFXA 3DHNA 1ZPDA 2ZUFA 1BVRA 4RLQA 3UG7A 1UK9A 1GSIA 2NUAA 3WG9A 5CIYA 4IUCS 3ZWKA 2CLMB 2XTZA 1QK3A 3O1LA 4XDHA 1K8XB 3DMTC 3G0CA 5CIQA 4EAAA 3DDOA 3F5FA 2BI4A 3D5EA 1IBCA 1V7ZA 1OT5A 1Z56C 1ZC4A 2P9JA 2X86A 3C45A 3DCYA 3QHPA 4RV9A 3ZHTA 4YAGA 1PJZA 1ZMOA 2F17A 2FZVA 3T95A 4LGCA 3D0KA 1E3WA 5FNVF 2XUPA 1ORIA 3BS4A 1W9HA 2H3HA 1ODIA 5CGZA 1S2NA 4C0JA 5FPYA 4ZMSA 2WIGA 3KSRA 2V7WA 1QPBA 4QXPA 4QL3A 4UBMA 4LC1A 2EHDA 4X8HA 3FOCA 5ANRB 3OJWA 2NUAB 4BQIA 1GA4A 1X1SA 4R2IA 1LQUA 2WUDA 4GI7A 4IHAA 2QKYA 1HMPA 3EGIA 1FFCA 4IDAA 4QU0A 4BU0A 3EG5A 1NU8A 1ADYA 1PD1A 2W98A 5HF8A 5F1KA 3CE6A 3O5AA 2ZWAA 2FSUA 1IUNA 1E3WB 3SP1A 3DFMA 1SB8A 2EQBA 3A05A 1P81A 3FYHA 3MSXA 4UUNA 2FN4A 2QRQA 4EH1A 4D97A 1XTPA 4JHLA 4XARA 1DRVA 2OFFA 4C0AC 1M1XB 3E6AA 5LQJA 4ARCA 1QZZA 5F12A 2ZYGA 3HYLA 4EFMA 1OQAA 4PZPA 3DXYA 1OGJA 1XHLA 4XGRA 4HAIA 4ZEWA 3GBSA 2WK1A 4M6WA 3IHWA 1TM4E 3LY9A 5ALRA 3T3DA 4F86A 2Y99A 4EFLA 2JKYA 2ONCA 2PUJA 4RS4A 4EAQA 3MUNA 5EMLA 3N7AA 2BFCA 3IXMA 1W4CA 1UJMA 4ID9A 4AF7A 2OXCA 5CM9C 1N34B 4K2AA 3P9IA 4V2IA 3U7HB 1XPOA 4F85A 2VWHA 4NJEA 3S2YA 1HBJA 3PR3A 1JLHA 1JKFA 3NBAA 4ZANA 3W2IA 2IYZA 1E5TA 1XLTC 1HSZA 4AG6A 3TO5A 3NHFA 3TTXA 1WMEA 3QVVA 5LXTF 5JS6A 4BKPA 2B94A 4M6WB 3E9CA 2PZKA 1RXCA 1P80A 1UOOA 2IGTA 4HPXB 4MCAA 1ISGA 4OSOA 1PDVA 4BZPA 4CMIB 3ZY6A 3ONDA 1CUSA 4P3XA 1DPFA 2W58A 4RPCA 5ALWA 4ZGWA 1RKQA 1PS8A 2WUGA 3MYYA 3A27A 3ZK9A 1IJBA 4NJEB 3DOCA 5IK2A 3UK7A 4ZYZA 1X92A 4XUCA 1Y3AA 2WWTA 4RXTA 1DQPA 4AJKA 1PR6A 4EPXA 2NTYC 5TT1A 1W36B 4XVRA 1L0BA 2MINB 1AU9A 3NNNA 1I51A 2Q3JA 1CUYA 4G2TA 3WL4A 2KYRA 3OEWA 4H27A 1MTOA 1XL0A 1ISHA 1DMSA 2G40A 3AUUA 3FOFC 4W1RA 1SIBE 3TCNA 3O7MA 4MLCA 4ESVA 2Z8XA 2MMCA 2DRIA 3UJDA 4UTOA 1P61B 4BLOA 2A0KA 4FYKA 5K05A 2VJNA 3DMDA 4HQFA 1XU7A 5CA0F 3T94A 5J3JA 1X6VA 5G4LA 1ODSA 1PJ4A 1MRNA 1U8CB 4PC1A 1UOEA 4Q3BA 1O5OA 2WVHA 3OT5A 1XCPA 3JR7A 3DR5A 3KKNA 2OCDA 4IOMA 1LPNA 1P0MA 2O14A 2Q3MA 2VPWA 5DU2A 4A8PA 2DR2A 1OTHA 4U5XA 4JI7B 5JC8A 5E1OA 1N9GA 3EISA 3QXGA 5GOZA 3EXEA 4V24A 1CZOA 3FGOA 1OA0A 2Y77A 4Y18A 4BNIA 4BFUA 1RBQA 3N59A 4X60A 1NOJA 1UPCA 5DMHA 3MPUA 2EL9A 1M0EA 1SK8A 2AJ8A 1R6XA 5C53B 1KYTA 2Q4DA 1TW2A 1Z29A 2UVPB 3CNBA 4TN5A 3WISA 4C0LA 4YRMA 3AXTA 4DWVA 4GOXA 2BDEA 4ETWA 4U2KA 3P0HA 4W7SA 1EFKA 2C2GA 2J45A 2VDPB 1ONPA 2JH9A 1R64A 1IM2A 1WXFA 3EXEB 1JILA 3LCMA 4O63O 5BYKA 4HQNA 1LF0A 1SAYA 2G0TA 1T6XA 5ECGC 1MW8X 3BQNB 5JWHA 4Z2YA 3S81A 3TCKA 4UDNA 4UD2A 5FUWA 3VTFA 4YRCA 3FFXA 1IY0A 2Q5HA 2CK3D 4NF2A 3IE1A 1FEZA 2AG8A 2L18A 4O4LA 5K0BA 3EGCA 3E9QA 2RGWA 3NRBA 3A6GA 3NGLA 4Z9BA 3VDMA 2DFNA 3FGPA 4DV2B 4H77A 3UQZA 4LK2A 2D59A 3H42B 1Z3IX 4NV1A 3EY4A 3QUQA 4HZGA 2YXLA 4Q4CA 2HDNB 1KWGA 5JISA 2M6SA 2XCTB 1M1YA 2ON6A 1N6HA 4LX8A 2V96A 1GWNA 3WHKA 5K09A 4WERA 3THWA 1AT1A 1T0HB 4NK4A 3RK1A 1EFAA 3B1WA 4JYMA 5SZHB 4NXMB 4I8DA 4IHQA 3NHJA 3E7XA 2YMLA 2OUIA 2XX3A 2SECE 3JTMA 4O4LB 2UU9B 2BUCA 3QFTA 2HN9A 3ZGZA 2G9QA 5LU9A 4H7DA 3RJTA 2GNOA 2RH9B 2CZCA 4WFKA 4YDRA 3V4FA 3AWIA 2UVQA 3BJRA 3GNQA 2YR0A 3KU1A 3L05A 3TRHA 1LRJA 2BKVA 1J56A 1UZMA 2G4VA 2IYYA 2QTRA 3IP3A 3AY3A 3LIPA 2OECA 1NUQA 4Z49A 1EFCA 3OU7A 3GP3A 5FUXA 5FI5A 5LP1A 1M1YB 4UCWA 3ILSA 4K86A 1CUAA 4LZZA 4LTMA 5FAXA 4ERNA 5ILOA 3THWB 3K1ZA 3KHUA 2J9GA 2W6PA 1SQGA 3DL7A 4HGYA 1JBKA 3GNSA 3A9UA 4P58A 4YRAA 2LWIA 2EYUA 2R84A 1A0OA 5L4LA 1XT6A 3F78A 4I6GA 2XNCA 3USCS 5B3JC 1K7XB 2P9GA 3FVQA 4IVQA 4MHTA 1ZIOA 3EVEA 1PFGA 2G09A 2ZTLA 4BFLA 5ER9A 3SQWA 3WAKA 1GGNA 2AN3A 1T1JA 3C3JA 4Q00A 1XZCA 3ANLA 4DMKA 4E1AA 2BM8A 1JHMA 4L27A 4Q9HA 1TLTA 5E6SA 3UZUA 1V8PA 2IBTA 3VBCA 3GBVA 3FTDA 3BGOS 3VMFA 5A2QA 3GEEA 4H15A 1K66A 1KJWA 3B1XA 5AW2A 1FQKA 3SK0A 2C7VA 2X4LA 3NHUA 4BS9A 2NTNA 1ZISA 5LBTA 1SQSA 2IODA 2RJ3A 4JROA 4DFDA 4FHFA 4TVSA 5MN6A 1UQRA 2BP7A 2IP2A 3CKMA 4CJXA 2QJOA 3VVBA 5DM60 4KFCA 3FPBA 3FF1A 3LT0A 4P98A 1JQKA 2UUOA 1RMYA 1E9FA 2X9QA 5AP9A 4GL4A 5P8WA 3CF0A 3DE6X 1AKEA 4CUKA 3I5XA 1ZVVA 1Q20A 1Q17A 4WFQA 3UAZA 5H68A 1H0RA 2PZFA 3UWOA 2H6EA 5AK0A 4QXQA 2RK6A 1OHHD 3K0FA 3O2SB 1XZEA 3OA2A 4RH3A 5AJWA 4K46A 4KTTE 5E6SB 1NIJA 3RM3A 4KK3A 2EARA 4HEQA 2GN2A 2OCLA 4OQPA 3ACBA 1HE1C 4UAGA 5F73A 3PX7A 2ZJ7A 4ZVPA 1AQYA 1UBLS 3SJUA 2O05A 4YRTA 4QATA 4CT0A 2CXPA 2WE8A 2BP7B 2ZUBA 2OBXA 4O2BB 3ANXA 3INNA 3AL0C 3N28A 1F0YA 1QH8B 3DAYA 3TAHA 3CBGA 3CLTD 3LWBA 4PO8A 4R0MA 5JR3A 3NDBB 1NZFA 1R74A 4HUQA 4FMPA 4BO1A 2ZWIA 2H57A 5JW6A 4QDXA 3AFMA 5DK6A 3DM5A 4J0HA 3UJ9A 2PUCA