2V8BA

Sad structure solution of proteinase k grown in selenate solution
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Selenate Substitution: Application in Protein Crystallography
rcsb
molecule tags Hydrolase
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2v8bA00
2B6NA 1BH6A 1IAVA 4Z2AA 4C3VA 1GT91 2G4VA 1GNVA 2W2PA 1Y3DE 4OMDA 2DUJA 2PMWB 5K7SA 1V6CA 1SIBE 1VSBA 3DW1X 3WIVA 2V8BA 3DW3X 2P4EA 1GCIA 1SBIA 4NE7A 2WUVA 4GI3A 5ARDA 2DQKA 4LVOA 2PYZA 4FONA 2Z57A 1Y33E 1TO2E 1SUCA 1AF4A 4OMCA 1GTG1 3DE1X 3WQBA 3LPDA 3DE4X 1R64A 4OV6B 1T1GA 4BWGA 1SH7A 2Z2ZA 5B1EA 1JEAA 1AV7A 1PJ8A 3AJ8A 1NDUA 4I0WB 1OYVA 1R0RE 3GT4A 3LPCA 3L1KA 3F49S 4ZOQI 1PFGA 1SUAA 3EIFA 4DZTA 4H6VA 1IC6A 1SPBS 3GCWA 1BE8A 4WOBA 5B1DA 1DUIA 3F7MA 4HVLA 1T1IA 1TM1E 2XRMA 4H6WA 3DDZX 3GT3A 1SUBA 3VV3A 3WHIA 1KDVA 4B5LA 5JXGA 1ZVJA 1WMFA 4HX2A 1EA7A 2ZWPA 1S01A 1SCNE 2X8JA 3ZXYA 3AJ9A 1KE2A 3CNQS 1UBNA 4YN3A 2WWTA 3VYVA 2HPZA 1HT3A 1S2NA 1P8JA 1C9MA 3SQOA 3WIUA 5FAXA 5JMOA 1TK2A 3DE3X 1SCJA 1SELA 2W2MA 3DYBA 1BFUA 1WSDA 3D43A 3I2YX 2ID4A 2SBTA 1SBNE 1SCBA 3D9QX 1SIUA 3TI7A 3QTLA 1C3LA 2WUWE 4MZDA 1TM3E 3LXUX 1LW6E 1TMGE 1MPTA 1YJBA 2SICE 3I37X 3HJRA 2QTWB 1SUPA 1TM5E 1R6VA 3DE6X 1GA1A 3Q5GA 1C9NA 1OT5A 1CNMA 1A2QA 2Z2XA 1NLUA 4WOCA 3DE5X 3I34X 1Y4AE 1GA6A 1Q5PA 1S02A 5AMXA 2IXTA 1TO1E 3SICE 3BX1A 1Y3CE 1OYOA 4KPGA 1SBCA 1NDQA 3H42B 2Z58A 2Z56A 4DJ5X 4M1ZA 2ZRQA 4KG7A 3TECE 1SUDA 3F7OA 1SCDA 3DVRX 2ID8A 1YU6A 4H6XA 5ARCA 3A3NA 3VTAA 1GTJ1 3ZXXA 2ZWOA 4RYDA 1SCAA 3QMPA 3DE0X 2PRKA 1WVMA 5JXJA 3BGOS 5AVKA 1SVNA 3VHQA 3I30X 2W2NA 3PTLA 2PKCA 1BFKA 1GTL1 1CSEE 1V5IA 3A3PA 1ST3A 5I9SA 2W2QA 1ZVKA 2PWBA 1YJAA 4K8RB 1MEEA 5AVJA 2WV7A 3DVQX 1Y9ZA 5CW1A 4AKSA 4C3UA 1WMEA 2W2OA 1TM4E 1Y34E 1BJRE 4LVNA 2X8JB 1PTKA 4NE9A 1AU9A 4AKTA 1ST2A 4ZARA 1AK9A 3DE7X 1KE1A 1KDZA 3CO0S 1AQNA 1Y48E 1GA4A 5ARBA 1EGQA 1AH2A 3EE6A 1AVTA 1DBIA 4DWWA 1KDYA 5SICE 1SIOA 1P7VA 2GKOA 3QFHA 5FFNA 1PEKE 1Y3BE 4CG0A 3A3OA 1Y4DE 2Z30A 3P5BA 1THMA 2E1PA 4KB5A 2Z2YA 3BPSA 2XTJA 3TI9A 1P7WA 2HD4A 1TM7E 2ST1A 1C9JA 3VSBA 4CFZA 3DE2X 2SECE 4J94A 1BE6A 1Y1KE 1Y3FE 5JXIA 2PQ2A 5AQEA 1SN7A 3PRKE 3EDYA 3DVSX 1SBTA 3DWEX 2DP4E 3UNXA 1SUEA 4JP8A 1XF1A 3OSZA 1GNSA 3VV2A 4CFYA 3Q40A 2PWAA 1YJCA 2TECE 1SBHA 3T41A 5JXHA 2SNIE 1WMDA 3GCXA 3AFGA 1TECE 2IY9A 1T1EA 3LPAA 4NMXB 5FBZA
chains in the Genus database with same CATH superfamily
5AP9A 3VHLB 3LKDA 4C78A 5DNYB 2W6PA 2EQBA 1FPQA 5K45A 2YWBA 1D4AA 3Q7PA 4JS0A 2PUBA 2AN4A 4C3VA 1I0LA 5HEKA 1P1CA 1CFZA 3OQHA 2LCIA 2Q5QA 2XH8A 5J4LA 1NRWA 2YVUA 3GNSA 5JV5A 4R83A 3AJDA 4GUDA 4S1VA 5T4HA 6LDHA 3Q8KA 4B4DA 3HA3A 2CHGA 2QRVA 1ITZA 1JALA 1J2EA 1DE0A 2AHRA 2DTXA 2FPGA 2HJHA 3CG0A 3QGMA 2FPPB 5C0OE 4CKYA 5K0CA 1C14A 1KP9A 3DFKA 3QYJA 3GFRA 1B26A 1P4AA 3H19A 3IHTA 3AXSA 5F64A 1KY2A 3L06A 4F1WA 4PFKA 4PZLA 3QEOA 3DW1X 5BSVA 2FOXA 3HXOA 5DZSA 4EUKA 5EWLA 1VRVA 1PRYA 1G55A 2GAJA 2JH9A 3HDQA 1GCIA 4PYIA 5G4KA 5IK2D 3EGOA 5JW6A 4P98A 1T43A 3KEMA 3TIGA 1LI4A 4DW8A 3JAMA 4PHGA 4CUJA 4F5WA 2Q46A 4I5DA 2O8DA 4BNMA 1WS6A 2IOYA 4HQFA 2CJWB 2WTNA 2OMEA 3AMVA 3L0CA 4HJRA 4M60A 4PHCA 4Q93A 4UEOA 3V4VB 4F7DA 4KYTA 1IM2A 1MRSA 4V03A 4P4UA 4UVHA 3TB4A 1C0IA 2PX3A 3B82A 5CVJA 5DTRA 4LF5B 1JE0A 1FMLA 4FFLA 4GPBA 5EP3A 2R66A 3HEAA 4COOA 3PC8A 2HUPA 3AR7A 2W6MA 1U80A 4EFLA 2O6HA 4X6XA 3VPGA 5G0SA 1ZEMA 1KYTA 3GXOA 2I4RA 4WKOA 3S68A 4A1OA 2Q27A 3TINA 2CNDA 3NOQA 1FMJA 1L4NA 4KEAA 3ORQA 4EPXA 3R6LA 3WGIA 1Q21A 2HHAA 4K9NA 4ZO7A 4HI0E 3D4BA 3NBZC 1BXRA 3M33A 3PD7A 3U4HA 1SH7A 4E2XA 5HF8A 2VF7A 5FNVF 2A9VA 3AW9A 4DCSA 5IUKC 2GJ4A 1BWQA 2H1FA 1WVGA 1CF9A 1Y5IA 4LDQA 1BD4A 1VYVA 4Q00A 2XE8A 2PKQP 4QDTA 4X9XA 4XRRA 5DYWA 4D9BA 4RX1A 3KZCA 3BSWA 4LE2A 4EY5A 1O2DA 4MRRA 5AVTA 2Z9BA 3ZCUA 1H9BA 4D3DA 2JFWA 2O8CB 4CKZA 3PL5A 3B2EA 3OP1A 1WD5A 2BFWA 2FWIA 4XSVA 1M3SA 2GOYA 3FWPA 3KU1A 4MWDA 4O0MA 3WAGA 5D00A 1E63A 4KO1S 1VYTA 2GESA 1ETHA 2BGJA 3PX7A 2IZ0A 3AHIA 1Z5OA 2HA5A 2XDAA 3A14A 4IL5A 5KBYA 3GEHA 4BQOA 1T35A 4R0VA 4C7KA 5A5EA 1JLMA 1G21B 1KHTA 2XF8A 1EGMB 3MRVA 3WRWA 4C07A 3G8CA 3O3CA 3EIFA 2HW8A 2WAYA 4JC0A 3U4GA 3UHFA 1XVUA 4F04A 3PGXA 1L2TA 5ALKA 5ECGC 1TU4A 3JZMA 2Q28A 5T6MA 2V5VA 3VC2A 5EXSA 1X0XA 3SIPA 3UMYA 4CGZA 2G6BA 2XRYA 3UJHA 4GR5A 1E2HA 1KZ6A 3Q98A 4EPYA 1FPMA 3GBPA 5FTNA 2J0UA 5JYCA 3CRNA 1JYEA 2CXQA 3WFIA 2HU8A 2WAAA 5ERGB 4C7BA 5AJXA 1JG6A 1ISGA 2P9EA 2V45A 1ZOIA 2YV1A 5EMJA 4AY2A 2QZSA 3LUJA 4OP2A 2CXXA 1USIA 2UZ0A 4MP6A 5K8CA 4Q3CA 4D9NA 3ETGA 3GT3A 1QQBA 3EVZA 2P9TA 2V6IA 4NP6A 4YRRA 3WHIA 4JX8A 1GRNA 5TIIA 1DFHA 1JEQA 3M6UA 3O8QA 1E5XA 4KJXA 4UBMA 2X4GA 3CHYA 5IX8A 5AXAA 3L7YA 4C88A 4DCPA 4CG2A 3C5VA 1Q7CA 4LHZA 3KUKA 1P9LA 2UVQA 1UEJA 3OSUA 1I6LA 5EWMA 5FA8A 4Z5XA 1KEEA 4Y2HA 2NG1A 1OX4A 4AS3A 3NP7A 3R9WA 2OVBA 2PH1A 3AU8A 1GKIA 1P2UA 1I36A 4W9RA 3G1TA 4KQ1A 1JIUA 2ZVQX 1A77A 3SZGA 1QIJA 2Q1WA 4MITA 4DXHA 3D3KA 3PC2A 1WHSA 4IIDA 4OMUA 4CFSA 3QPVA 4D4IA 5HRCA 1PW7A 3HDTA 5ED4A 3HE3A 1M6NA 3KEFA 4ROTA 3EXHC 3FPAA 2EJWA 2QB5A 1UOEA 3PQEA 4EM6A 3K4PA 2MJLA 2MHCA 4PSVA 4KO3S 1SBYA 3IP6A 5KJ1A 2FR0A 2GHQA 1DKLA 4NEHB 4OQDA 4PWYA 4X91A 5F5LA 4OXYA 2OM6A 4CIAA 3BQMB 2X1LA 5DTMA 5JQWA 5EP4A 3AHCA 4QXOA 4JXJA 2HEIA 4P3XA 3F8WA 3DR5A 4LBVA 2QVYX 3A10A 3UV3A 4Z1MD 5LN1A 4JOQA 3QENA 1V6AA 3QBTA 4EKEA 2PJRA 2F1HA 1XSEA 4UASA 5A5FA 2WJHA 1QHIA 2V65A 2TMDA 3S2SA 1Z7EA 3UT5B 4K0KB 2GLUA 4DDTA 1N2IA 5C1OA 1SZJG 4RCYA 2VXCA 3AG6A 4EFDA 5DRTA 1Q0HA 1T0JB 1ORHA 1XMIA 1L7DA 1VJGA 3F71A 3IUJA 2QUIA 1O95C 1K6MA 1PGOA 2ZYIA 1D1PA 1OTHA 1MO2A 1SC6A 2DPYA 3HL0A 3B13B 3KEOA 4OGWA 2XE6A 1CV2A 5AW2A 1QFSA 3LTEA 1BU8A 3GVHA 4L9SA 3SQDA 3LXUX 2YJ5A 1EFKA 1V8OA 3LQFA 3EVGA 2GCGA 4BMPB 1ORVA 1YZFA 2SICE 3AF5A 3HDJA 2OCKA 3KD2A 2H52A 2ZEJA 4WKPA 2ZM6B 1W93A 1GZDA 1MB3A 4URZR 1KNQA 1FC0A 4B47A 3MGCA 4QBFA 3MT9A 4QTZA 1LSUA 5C2JB 2AH5A 1HZJA 2M32A 4NJOA 2JARA 1E59A 2XCQA 3DE6X 1HA3A 3U4AA 2ZAMA 2I3BA 4BLUA 3RK0A 3VYUB 5EIHA 1G21A 3IUNA 1XNQB 2Y71A 1MQSA 3N2IA 4CF4A 1XDDA 4IVPA 3CSDA 3VZBA 1RWKA 1VSTA 3EQ2A 1PK9A 3V3KA 1K5DA 5F7ZA 3UWDA 3LE8A 2VJYA 3GEEA 4RA6A 2PMDA 2W2VA 3ET4A 4E12A 3AOEC 3K9HA 2AG6A 4Q1DA 2EZTA 4K9LA 1ABBA 5HKKD 3M8KA 3GP8A 5HIIA 4M0FA 3MQFA 3FDZB 3TRFA 3IEPA 1U5AA 4XUCA 4Y2PA 1HTBA 2VF8A 2W6ZA 3B38A 1MA0A 1U4OA 1KBZA 3CLUC 4AJ4A 1DFIA 2JLBA 2LW7A 1AKYA 1R5OA 4Z3KA 4OHCA 3GGCA 3L84A 2C2WA 3KLNA 4ZI7F 1FJ2A 3ZD8A 5AOVA 4ALJA 3RVPA 4PQEA 4W99A 2HRQA 1R66A 1WKBA 3NOVA 5DHFA 4KTTE 2GM9A 1RSZA 3WK7A 5L40A 4DYVA 2D06A 1S2IA 3CGWA 4DBVO 1JDBC 1MT0A 5JVDA 1Q1AA 5AOCA 3WKEA 3ZGYA 1N78A 1E2LA 3PYXA 1IN8A 3DC2A 3SYNA 4ZRDA 1YQUA 4QLBA 4YRCA 3HR8A 3CGGA 1OGYA 4PYNA 3RIEA 5FPQA 1P2SA 3H4TA 2PGLA 4BN0A 1SIWA 1UFVA 4EJSA 1DRWA 2H92A 4ZZ3A 4H1TA 1RPAA 3TJRA 1GVHA 2D2FA 4F4UA 5HM8A 4IMJB 3S6JA 1F2VA 2X40A 3PDWA 3IVMA 1WXFA 3VUEA 1ADYA 1J0DA 2NO5A 4L7VA 1I13A 1TJ4A 2CFSA 3G2OA 2QUKA 3L1UA 4WAUA 3S81A 3E8XA 821PA 4DLWA 2GWHA 1CZRA 4YB8A 4HPXB 3KIPA 5IJZA 4FR2A 1VJRA 3RSQA 5H82A 2JI4A 5LR6A 1QB8A 3IHKA 4NEGA 4FFSA 2A0KA 2DFDA 1BX1A 4O5OA 2VWHA 4Q7KA 4BFTA 3GG9A 3SC6A 4D3FA 4ZYZA 1CRPA 1YK1A 4IFTA 3UMBA 1QO9A 1BKDR 4H0CA 1G7CA 1G3UA 1N6KA 4JFRA 1R12A 3JVIA 3ORYA 3IT1A 4LFAB 1RACA 3FDXA 2AK2A 3V4PB 2HWWA 3LF1A 3KQWA 5ADHA 5ILGA 3NC0C 3O4FA 5CGZA 1RRCA 3DMHA 3R44A 1JNXX 3CUSA 4DV1B 4C4TA 3W9UA 1ADBA 2ZRPA 3L8EA 3WFZA 4BQQA 4C0QC 4WXHA 5FEMA 4BC0A 2RGNA 5TX7A 3K6JA 3ETEA 4A0HA 3VGPA 2CVOA 3I6MA 2M6LA 1LS1A 5AVRA 3BJMA 1P62B 5CIWA 2ZG6A 4FHFA 4KQMA 2GVDC 1YBMA 1DAOA 2FDXA 2X8AA 3A1TA 1GPBA 3ILYA 3OM1A 3AETB 3P9SA 3X1KA 4P5DA 3BMOB 2JFVA 3K96A 3NIWA 4ZI2A 5A1TA 2MYUA 2LDXA 3E7DA 4BDSA 2PBLA 1HZZA 5AVJA 1RIIA 3CPHA 3IBCA 3JV7A 3DVQX 3U7JA 1GQ2A 1PP4A 3H5RA 4P3KA 4D8WA 1ZUNA 1U0EA 2ZCJA 1OH7A 2X5JO 4IP0A 4K81B 4NSNA 3K05A 3RIXA 3CX7A 4E14A 2W2OA 2PXAA 3FOCA 5FI5A 1IWBB 4KFTA 2Y1OA 1KR2A 4FQ7A 3NWOA 2QQ0A 2VRBA 4IVNA 3V5NA 4DA9A 3B9BA 1GL6A 3FFAA 3SD7A 4D97A 2LWIA 4O2AA 2AYXA 2XDQA 3FCXA 1NV9A 2MT9A 4JBGA 3RSOA 3WGNA 2XZLA 3BFVA 3W2FA 1A4UA 4OJNA 5DHUA 3WL4A 3V7NA 5FA5A 1G8SA 4QJ3A 4ZOAA 2NPFA 1EU1A 5K8UA 4YJ2B 1TU3A 3QTTA 4MB6A 3W6PA 4IIVA 5AOBA 1SQFA 3FI0A 4XR9A 2QLBA 3B1ZA 3HY6A 2Y27A 4U7HA 3E53A 3SYKA 4BWFB 5IT0A 1TJ3A 3A26A 3V7UA 2VTVA 4JOCA 3K1JA 1TAGA 3MOIA 4N65A 2C92A 1S3GA 4LNHA 4EW1A 5K5EA 1P0CA 1QTIA 4HNQA 4JP1A 4XVQA 4UBIA 5DH9A 5CDFE 3GHHA 2XNHA 1KJIA 2H8KA 3BICA 3ZHZA 5SICE 4JGBA 1GN8A 4DQVA 3IAAA 4CQJA 2O0JA 4UTZA 5TEVA 3E9YA 1QTNA 5F12A 3N07A 3TQOA 4HNAB 2PL3A 5DSZA 3WI7A 2YIJA 4CG0A 2O4CA 2OCIA 1F4LA 1A8IA 3B2NA 1RPTA 3TOXA 5J43A 1EM8B 2PH7A 3EG9B 5AKEA 4PY2A 2K2WA 2QG4A 5A4JA 3BHNA 4EENA 3AFIA 1K86A 1F2TB 1NLFA 2E6UX 3WRYC 4MV0A 5G1PA 3NBYC 4BNZA 4LAFA 4UAUA 3AIMA 5LKRA 2MYPA 1F1BA 3GGJA 4G1UC 3U7QB 1UADA 1WUIS 4PHHA 1VPTA 2IPOA 3AWIA 3BPSA 1FDUA 3K32A 1L5MA 3LO8A 1L4UA 1VP9A 1G8HA 1XV5A 2H07A 2JL1A 2ISQA 2QQ5A 3CX6A 3ZPXA 4BVKA 4D8TA 5F7OA 3UG7A 3F97A 1T2UA 3PNMA 4GLJA 1O6CA 1ZPDA 1B6TA 2VEDA 3DAGA 1C9JA 1FBNA 3VSBA 4AN1A 4CFZA 1VB5A 1J5EB 1IN7A 3QMVA 1DXQA 3GRVA 2BKUA 4JUAA 3UYKA 5IKPA 5TQ2B 1PQ4A 4OFBA 5FPHA 3COJA 3OY7A 1A1VA 3CVOA 4F3CA 5HZGA 2AJ8A 3G1UA 4YUYA 4H7JA 2FWJA 4PSAA 4PN7A 2ZJ5A 3JZFA 1KI3A 3HY4A 5I7HA 1UMBA 2BRUA 2DBZA 4PNPA 1FTNA 3F5MA 4JYZA 4HBGA 2QMEA 3SFTA 2NTVA 4MVJD 4BVBA 2NO4A 4W5TA 1B23P 2B1RA 4EPTA 5AQEA 2RHCA 4RTOA 1GCGA 5B3AA 4KR2A 4B6JA 6Q21A 4QDKA 3FKQA 3LDUA 3OPMA 3RWBA 3DMTA 3NO4A 1XPRA 2BZGA 4QOJA 1INLA 1TJYA 4G24A 4IDDA 1NOKA 3OJLA 4BMCA 1A88A 1GKLA 3HNPA 1N2JA 1U0GA 2WTBA 2YN4A 1YKGA 4MAMA 1M2WA 4MPTA 4J0HA 4CV0A 3TZBA 3EEFA 1CIJA 1ENPA 3BGVA 1LFAA 2VRNA 1NAIA 1XZJA 4U7PB 4X64B 1D2AA 1ODTC 5AHRA 2IF2A 3VOAA 3QZUA 4KK4A 2RB4A 2GQ0A 4LHWA 5EJ9A 5LJIA 4RGQA 5EUBA 1A69A 3ESBA 5D3MB 1XN1A 3K6SB 3EPJA 1ISFA 2PS3A 5JSYA 1H3NA 4BJHB 1DEHA 2XT6A 4C3ZA 3RB8A 1DV1A 3GLSA 4MQFB 3FE2A 5DBGA 2WJ3A 2OHVA 2VHJA 1YJQA 3A1SA 3NEJA 1IK4A 3QV2A 2J5XA 5IMSA 1J39A 2YZMA 2ZCVA 4LYDA 4OHBA 1P9WA 1LRKA 3NUQA 4ARZB 4DV0B 1JR2A 4M7RA 3SKXA 4EGJA 5C53B 3PWSA 3GN1A 2FLKA 2GX6A 3LCCA 5CJJA 3V34A 5AW3A 2JA2A 1IAVA 1JQDA 2B25A 3JD4A 5H9WA 2ENUA 3ED1A 1VP3A 4QG7A 1QYXA 4B3BA 5B3LA 1K2WA 2GB4A 1QGUA 4JBYA 3TZKA 2HJWA 2IUTA 3AH8A 3L4EA 2H57A 4C06A 3HO1A 2HCFA 4RXUA 1N2XA 2CE2X 1Z0JA 4FMCF 5C8ZA 1IB0A 1FYDA 2VDKB 3E5HA 3FSGA 3EBLA 5AM4A 1SC3A 4A5OA 2WT4A 1E2QA 2FFRA 1DIAA 1ABEA 1H2FA 2L82A 4DRYA 3IRVA 3R3ZA 1J8YF 5AJHA 3DB1A 5DM2A 2GCOA 5HQTA 1PV4A 4G5OA 4C05A 3DTYA 2VC2B 3HUFA 3NV9A 4LIPD 4Q9IA 4Z8XA 4CMCA 5KYUB 3QKUA 3KJGA 4FVTA 4Q1BA 1K6EA 1CUZA 1JFRA 4LVOA 5JD5A 1TAHA 4EDFA 5BVGB 5KQMA 4CR8A 3PDUA 4FCWA 3DZHA 4YRPA 3AGQA 1RPNA 1X9HA 3IUMA 3A4MA 4IHKA 1ZO8A 5BNIA 1NUAA 2X0KA 1G8KA 1XIVA 2J5RA 3DNFA 3K1AA 4GYKA 4MVJP 3REQA 1E2UA 3A9CA 1VIMA 3AEYA 3QVGA 5THQA 1ZG3A 2ZROA 1IHDA 4WFKA 4IF4A 2B3DA 4JL6A 4OUDA 3RJ9A 4EO9A 1QP4A 3HO6A 3I12A 4MR9B 2HF7A 1BD3A 4IXDA 3E2MA 2YNMC 3NJ8A 4B8ZA 1C9EA 1GJRA 1OGJA 3HU2A 3PPVA 1WULS 1I3MA 2Z9DA 1N9GB 2C96A 2I8LA 4ANFA 2E55A 1CUUA 2CD9A 3CMMA 3LYUA 5JS8A 5EIBD 3VPCA 4RY2A 1C7RA 1O3YA 2ZUUA 3EEBA 3OTGA 4M7OA 4ESOA 5BNTA 3UYLA 5EUQB 3EXHB 2XBLA 3DOEA 4PVDA 1FSFA 2VAMA 3NOOA 1WUJS 3W78A 1Q77A 2LRHA 4Q9JA 1A27A 2DHQA 2FQYA 3NT4A 1XHFA 4IGFA 3RIYA 2AZ4A 1BX0A 1YHYA 1O08A 2FF7A 3K2EA 5JSZB 3EIEA 4AWAA 4WBNF 4TN5A 4P08A 4BVFA 1L5FA 2B8JA 3GRUA 3BDVA 2ODNA 2ZDHA 2A5LA 4PAQA 3GGOA 1H0RA 2OO3A 3AF3A 3AINA 3ZKWB 1FX0B 4E5NA 1TVKA 3CV3A 3NEAA 2GR9A 3MGBA 3OZUA 2P9BA 1U31A 3NYQA 4L4YA 1U4SA 2X0DA 5AKYA 1COWD 2YY5A 3GD7A 4BGIA 1AA6A 1M2OB 1GSIA 3T94A 4RESA 1W1WA 3KKZA 4DZZA 3ELUA 3BS4A 1OFUX 2R1VA 521PA 5BY2A 2DWPA 1IJEA 4B0OA 4JJ4A 1YQTA 2D2VA 1VM6A 4YP0A 4XCXA 3TD6A 2QM8A 3F6RA 5M5BA 3E9EA 1H3EA 5U4XA 1I5RA 5CEFA 3BXGA 4TS4A 5BUQA 2C0PA 3V2GA 4YMWA 2FPIA 5A4MS 1PN3A 1OI7A 1KDVA 4F11A 1CKEA 1O54A 4KQXA 3ZI7A 3SJCA 3AVXA 1RP1A 1PSDA 3ZD6A 3OCUA 3C3DA 1EUQA 2W0SA 1XI2A 2YOHA 4A1FA 4B4KA 5DMXA 2ECPA 2DOKA 4BKOA 1NJGA 1JIJA 4PLHA 4JI2B 3PG5A 4M0LA 4HX2A 1RZRD 3L46A 4A36A 4FN5A 4HG2A 4J3JA 3WMGA 1OFTA 3T1HB 1RAAA 1VFNA 2A0WA 3FPSA 3ZYCA 2ZXEA 4E5MA 2H1OA 4I5FA 1BIFA 1LTKA 4HXEB 4O2BB 3V1LA 1E9VA 2GM4A 3ZXYA 2BD0A 1OBFO 4UCXA 4HXGA 2H4JA 1E2EA 4CLOA 3P8ZA 4ENVA 2GHRA 4YWHA 1RWPA 3JQDA 1DBWA 2JIDA 3BMQA 3O47A 3FPJA 4H3SA 2W6NA 4NH4A 1UXIA 1WNFA 1K8XB 1XMPA 3TBHA 4ZYTA 2PSJA 4C0JA 3NBFA 3PP8A 4RK0A 4UATA 3G3EA 3OJXA 2CXHA 2HDOA 1U7TA 2GF9A 1QX4A 2YVAA 1QQ7A 5JDIA 5DLQC 4YJGB 2LP4Y 1M34A 5FI0B 4E46A 2EYUA 4Z99A 5BYAA 1DKQA 2O2YA 1GG2A 2O2ZA 1LBSA 3JSAA 1NHWA 1BVRA 2JCXA 4ML3A 2C5LA 3RG8A 4C21A 2I0FA 1DAFA 4CLHA 4RH3A 3HMKA 4BKUA 1D2MA 2Q9CA 4K6OA 1JP7A 3PC4A 5A7FA 1GL7A 1SELA 1Z88A 1DQZA 1X3SA 4ZVOA 1Y8CA 1JDBB 1X7WB 1C4XA 3ZDQA 2H7XA 1R10A 2DPLA 3ZU2A 1II8A 1G16A 3QUQA 2GSDA 1BJKA 1P2TA 4PSUA 4UNQA 4AM8A 3QEJA 2PZLA 3HCNA 2F4NA 2R5NA 4HZUB 1F4PA 3HXTA 4O4IB 1BSVA 4OL0A 3ZHRA 2ANBA 4K7JA 4NBUA 1IY9A 5JNRA 2BZ0A 2QN3A 2VVTA 3KJNA 2REXB 3M5CA 3OMXA 1UINA 1EUDB 1GEGA 1I24A 1NULA 1SOMA 121PA 1JHOA 1O96B 1OSNA 2B5OA 4MIKA 4X93A 3I04M 5L51A 4YRMA 3EPRA 3E9CA 3WHPA 4ZDJA 1B1CA 6ABPA 1YR8A 4Z4IA 5DHSA 4K86A 1HH4A 1TM5E 3MPOA 2IY8A 3FMPB 3FWKA 5KQRA 2V7VA 2OFPA 1PR0A 1L9KA 1KJJA 1E9BA 3BRCA 3UA4A 5HTOA 5A6VA 5MN5A 4XM0A 3KQPA 2WD9A 2Z2XA 3FGPA 4IS2A 5CYOA 3SF8B 1O1YA 1TLTA 2PZKA 3GLFE 4AF8A 1JB9A 4MW2A 1LJUA 2O5RA 1QR6A 3AYXB 3OCZA 4N5MA 2BFPA 4QPPA 3WLMA 4F5EA 4QPZA 5HW0A 5TJ9A 1W4RA 1HRDA 1P1JA 1VKNA 2H48A 1E2IA 4R8VA 3ZVLA 1Y9EA 2PT7A 4ZOLA 2AOXA 2BI4A 1NBME 1CDEA 1S02A 1X8JA 2XD4A 3LG2A 2Y1XA 5AMXA 4CCWA 1JILA 1Z5WA 2J3IA 4N5DA 3GFTA 3ZDFA 1SHZA 2P2DA 5DBIA 3CKKA 1KDRA 1NQUA 4M46A 1JEOA 4QOSA 1YJXA 4R68A 1EP3B 4BZXA 1H4SA 2A92A 5K0GA 1EAYA 1WZUA 4MJLA 1FMFA 3OZDA 1OYOA 1CY6A 2QZJA 4PQRA 3LA6A 5TGDA 1YTUA 4UBKA 1JBEA 2FEAA 2ZJ7A 3VSEA 1TEZA 2V6JA 2BMWA 1OOEA 4I08A 2QVBA 3GA0A 4OI2A 1N2CA 3MGGA 3OJ0A 3UJCA 1TZBA 1NY5A 3DMDA 3PXXA 1PX0A 1QLWA 2O2EA 1M8PA 2AMYA 3QQPA 2OOKA 4OQPA 2XB9A 4OIMA 4E32A 3VSAA 4EHLA 4MARA 3AHEA 3G6KA 4G86A 4INZA 1WUYA 2QX4A 4TPKA 3LVRE 3P0HA 1B15A 4KV7A 5D3KA 3WGZA 4C4YA 4BQEA 3H84A 5DBFA 3LFTA 1J49A 3VHXB 4ECEA 4DRXA 5CBPB 1MV8A 2H1CA 1SUWA 2CL6X 3W06A 4NFYA 3JQ8A 1AK1A 3UMRA 3AOEA 4ZU3A 2BFDA 1RQNA 4KR0A 2Y1DA 2GEFA 3F2VA 1GTRA 2XJ4A 4XFJA 3H1GA 3JQFC 5FOWA 4MMXB 4CL0A 1DIHA 4QUAA 2J33A 4FT4A 1ODSA 4J9UE 4OHXA 2IP4A 2JCYA 1BYUA 4UARA 4A0GA 4FWBA 4E5KA 1SOAA 2QU8A 2QWXA 2GCEA 3BXEA 3VR5A 5H1YA 1Y7LA 1I4DD 3NC4A 2AOUB 1GY8A 2BGNA 4PCAA 4D9GA 4M0CA 1QS0A 1T9DA 4ZAZA 2EGHA 2R6GA 1FFXA 9ATCA 5FFFA 4KMSA 1KZ1A 2V6GA 3HPQA 2F8MA 1XZLA 2GN6A 1XXHA 4HYEA 4NU0A 1FXWF 5G3ZA 5BOSB 1NN1A 1SG0A 3UQYS 1KI4A 4A6DA 3TX6A 4PINA 1ZDMA 3H1PA 4HDMB 5IBRA 3O8DA 5LBIA 4CMIB 1NSFA 2F55A 2SHKA 3NYRA 5E6SB 1BVYF 1OHHA 3DZBA 2EBWA 4JLDA 4BEWA 2JIPA 1DP4A 2R6DA 2WU0A 3ETNA 1DEOA 1RR6A 3OCXA 4KQCA 1HOXA 4U2CA 4UW9A 4HEJA 1EQ2A 1U3UA 2FH5B 2ET6A 5GONF 3QWFA 4YRFA 3T1VA 5C8XA 2TMGA 4A3SA 4ITRC 1JPJA 1IIRA 1E18A 2C3OA 2NSJA 3P2IA 4GL4A 1G64A 4B6EA 4EUFA 4EY6A 2QSJA 5BNWA 4AKGA 3NX4A 3A3PA 5B1IA 4CUZA 3E0QA 5EZYF 4RKYA 5EIWA 3WLQA 3INRA 4WFIA 2YBDA 3HJAA 2F17A 3MCWA 1GRVA 1OBHA 1YJAA 3O2NA 4L2IB 4RLFA 3VH3A 3AWDA 2RHLA 3BL6A 1NZDA 2CHQA 1SKYE 3AI2A 3K7EA 5BYBA 3L7MA 5AVZA 2CVZA 4BV8A 1AKWA 3N2KB 1PT5A 4L57A 4MRAA 4B84A 1DTWA 2UYQA 3CT4A 4UQOA 1RQRA 2VAXA 3EPLA 3SAJA 4FE3A 2F1OA 1TM4E 4RGYA 5KOHB 2WPDA 2WLSA 2FN7A 1TJPB 3IJEB 3TOCA 5MFZA 5I9NA 1N5DA 2YZ2A 3P4UA 5EOVA 4DADA 2CZGA 2RHGB 1E1LA 2OL4A 4UNRA 2WPNA 1Z4JA 1T0PA 4PC3A 3C5CA 1PR9A 3QA9A 4EMBA 1T1SA 4DDUA 1N3LA 2GEKA 1AKNA 2C29D 1K6JA 1U2SA 2C57A 1KDZA 3I28A 3PT9A 5LP6A 5EWJB 3TQFA 4ARIA 4JNCA 1NRJB 3TDKA 3A6LA 1UZUA 4D02A 2UVPB 1WQ3A 3IXLA 1XLWA 3CUUA 4YALA 2QN6A 4MWTA 3O8LA 2IHJA 3B6EA 2IBMA 1I1HA 1SK9A 3USZA 4F9FA 2KWIA 1KEVA 3I9OA 2WTAA 5C81A 4R69A 1BS1A 1USWA 1E3DA 1FF9A 4OHYA 1X1CA 2HPHA 2PFSA 2W8BB 5LQNA 3KWFA 3R3VA 4AW9A 1Q20A 2VNHA 2VNJA 1SZDA 3D2LA 3LWZA 4ZYLA 4Q4DA 3VKGA 1N8SA 5E1BA 5DI3A 1KJNA 2NO6A 1NBAA 1PEKE 3P0EA 4C04A 5A9SA 3OQIB 4OF4A 5IDQA 4P4TA 3P5BA 1USKA 5KAMA 2IIBA 3OEYA 3NHPA 3ZUGA 4TZ6A 3CKLA 4KI7A 2ZBEA 4PR3A 1FDVA 1OASA 2ZYAA 4BX0A 4N9WA 4HEHA 1NL3A 2BFBA 3C5WP 4BB0A 3AVWA 3PX2A 5JI3E 1CR6A 1DRJA 2ZYDA 3ND9A 3ZX4A 5H4GA 1JHDA 1T3ZA 2ETVA 3AY7A 3ERCA 3PU6A 5EVJA 4BVLA 2KYRA 1YDGA 3GDWA 4II2A 4H18A 4ITUA 3NHBA 1ZC3A 2DPMA 1ECFA 2XEDA 4R7TA 1A5SB 1FA9A 3PDHA 4OAPA 3WWCA 1E79A 2IITA 1L5KA 3GGPA 2NP7A 1FFGA 4EPRA 3I92A 1NUPA 2IQIA 5A71A 1GGHA 2NAFA 3O4RA 4INOA 5KEIA 3IRUA 4I4CA 1SG9A 1BS9A 1XTTA 3IUQA 2GA8A 3IIMA 3QOXA 2HRRA 3GQBA 4QRDA 3PHJA 3FMVA 4L4UA 4DPMA 1TM2A 2ZBGA 1D6NA 1XQWA 1WIWA 2F2TA 3BBPA 3N75A 4NZZA 4CMIA 1ZSYA 2CK3A 3GEMA 3NAMA 1UBHS 1YKFA 3B1FA 3RVMA 1XWIA 3G0DA 4GAEA 3EISA 1WCWA 1B8NA 3FR8A 4BTVA 1KH2A 3FUUA 3GA5A 1JHQA 3LDFA 2JLZA 2COUA 1NVVQ 4QYMA 1T8TA 4GP7A 5GM1A 2QK4A 4J8PA 4XB1A 1AY0A 3PWTA 2HCRA 2P1DA 3QG1A 1XNJA 1VLQA 1MFZA 1II9A 4OHRA 2OVFA 2RGEA 1FFEA 4TL9A 4QWMA 2GJKA 3PFWO 3FPCA 1KMIY 4ETIA 1G3IA 6NULA 3AFHA 2QJRA 3UCEA 3G23A 3A27A 2PGIA 4IJ6A 3MAAC 5EJ2A 3EEOA 1Z4IA 4MWGA 4ZC8A 3P20A 4U5QA 3TXXA 4HDRB 3GLIE 3FTFA 2IXBA 3WYCA 4BLWA 1BCRB 3OF5A 1NP6A 3PQ5A 3PNOA 4DJAA 4JOBA 1AUXA 5FPYA 5IAEA 3AERA 1SGWA 4E2YA 2NV2B 3CJRA 3C1AA 5JBIA 3G5TA 1L7QA 3ZCTA 3B60A 1L4LA 2FRDA 4YT4A 2OXFA 2PYIA 4CTKA 3KAPA 3TCXB 5JXHA 3DV0B 1JJAA 3VU1A 3D4PA 3KJEA 3VR6A 2E21A 3DDSA 2I78A 3AFGA 4UD2A 4URWR 5JS1A 4WCVA 5IM4A 1PNOA 3U4IA 4NMXB 3UVEA 3PWKA 4R8MA 4EA6A 1XO1A 5J3JA 1SCIA 4K6CA 3WNBA 1RMQA 1B3BA 1Z6TA 2Y0CA 1E32A 1ISPA 3DTVB 4LOKA 4MRPA 4QBGB 2R4QA 1DTEA 4L22A 4POAA 4QJ5A 3A1DA 2OLKA 3DFZA 4M1MA 4C7OA 5HS4A 4PG8A 3ZVKA 3AL0C 5CK4A 3QXGA 4C7JA 4FW8A 5U9CA 4PIMA 3OESA 4FSXA 3WL6A 1QKJA 3E3MA 1KZ9A 3CEAA 3FHLA 3C3PA 3OHMA 2WM8A 4AZVA 1XAIA 4ZQHA 1RYBA 4FQ8A 3LHDA 4D80A 1JFFB 1RXEA 2DUJA 4Y1RA 2C07A 5FO1A 4TUYF 2QKYA 2PMWB 1WDMA 3D1LA 4KV9A 4XD7D 1JTEA 3SLGA 4HNVA 2EKQA 3ESRA 1C0EA 2F8TA 4Z4EA 2IKQA 1M5TA 1Z3CA 3ELWA 3I0ZA 3AY3A 5BR4A 3OQ1A 4LJLA 3WIVA 3FNFA 1US8A 4EA7A 2WE7A 5DX1A 3VVMA 1IDN1 4MNTA 5HS6A 1K97A 1QF9A 3MPUA 4M89A 3RT9A 4DG8A 1K88A 1YHNA 2WU1A 4RADA 3M9WA 1NG1A 3L18A 4PLPA 5BSGA 1I30A 3I9JA 3DWGA 3PQ2A 4O02B 4NU5A 3KOMA 1Z82A 3COSA 3PRJA 4UVGA 3T5TA 3THSA 3O4IA 4JBHA 3MLEA 3G2IA 3DDWA 1F17A 4I8IA 1XQXA 5C8YA 4AJ9A 1DJLA 2Q4DA 3L6UA 4CF3A 4R5MA 4YRKA 4WL0A 1FSZA 3CRQA 3FFTA 2Y93A 5F7XA 3A05A 3DEHA 1OY1A 3V1KA 4FUTA 5KDDA 2BH2A 4NICA 3F2IA 4OQEA 3FHOA 2HJSA 3M6XA 4XD2A 3VJKA 4R0MA 1SXGA 4O4LA 5AVQA 3OO0A 3PICA 3QVLA 1PE0A 5IM5A 3RPEA 4XIYA 5KX5B 3KO8A 1UMCB 2BE9A 1C7FA 2QR5A 3FJ1A 3ZW9A 3A6DA 1L5VA 4OM8A 3UHAA 2WYIA 3UCXA 2BEKA 2VCEA 2Y2UA 4JLBA 4BWGA 1E3MA 3VISA 1YQEA 3GUVA 4FCCA 3L1VA 1TF7A 4XVRA 2BFCA 3ZWNA 4X45A 3H2BA 5IARA 3P26A 1OI2A 1U2QA 3JASA 3ZNNA 2P9CA 2FP4A 1E77A 1WSBA 5B1EA 3THXB 4EX6A 1Q1QA 1VG0B 2IE0A 3IS3A 3OT1B 4PZEA 2XOXA 3ZU3A 1ILEA 5GGYA 3L7KA 4UUQA 3IE0A 4DYDA 2XUAA 3EIOA 5HMMA 4MV4A 3UKDA 7ABPA 2JFZA 3NGLA 4PEVA 1OYVA 1YVRA 3GT4A 1Y1PA 1YACA 4ZQFA 1I51A 2QZZA 2EF1A 3AVUA 2WD7B 4BNIA 3QPBA 4RVFA 4Y2VA 1TZCA 3QWIA 3L79A 1ZH4A 4MRMA 1GPH1 1AE1A 1Q7TA 1RLJA 1NIPA 5GV8A 2G71A 1AZTA 4FKMA 1L7OA 2HADA 4JC8A 3UJ8A 1VKHA 4CR7A 1VBFA 3OCWA 4DC0A 2R8RA 1Y8AA 2X6TA 2WSSD 5L4SA 1P60A 4RE5A 6REQB 1J24A 1DAGA 2YZNA 3NHFA 4ODIA 4R9NA 3VH1A 2V3CC 4WPGA 1ML3A 1QC5A 2BMJA 4PSCA 1SRRA 5C3UA 3UV6A 3IESA 5K0FA 3RBAA 2EHJA 2F9LA 3GFQA 1YDMA 3DBIA 1JRLA 1LSOA 4I5EA 4XGRA 2VIIA 5AESA 5DX0A 3MTAA 2Y4NA 5F3DA 2XRMA 4DAOA 1YR1A 4EFMA 2A9QA 2I65A 2O54A 4PQFA 1C9DB 1VQ1A 3WDKA 2C20A 3LIIA 1H5QA 3W6ZA 1RAFA 4X54A 1HUQA 1YBHA 2O0KA 2QYHA 4DUGA 4U7JA 1QVRA 4GX0A 5MGNA 2W42A 1RPZA 3PT5A 4DQUA 1E4EB 2C03A 1XEWX 4Q4HA 5BQXA 1W0JD 2WVJA 2A9FA 5FBWB 1ZVJA 1PJQA 4IDGA 1GZUA 3RSGA 5KOJB 3OZVA 4U63A 2V1UA 5CDUA 3UJNA 4DR4B 1DXOA 3IDOA 3RS5A 2GBLC 1UPBA 2P5UA 3W79A 3L8ZA 2QYOA 2OORA 4RHUA 5JROA 2L19A 4JGIA 4JITA 3RREA 3ZHYA 4RSGA 4OMFG 2OD9A 3B3FA 2Q41A 3F6EX 4IAOA 5C1BA 4BRUA 1JI0A 3ABIA 1IVSA 1LV7A 5FWAA 3VAAA 4JR1A 3CWZA 3MTDA 2UZAA 3SQLA 3WGVA 3CY6A 5KVSA 4CM3A 1NG9A 2GMWA 3SJAA 1NYRA 2PTGA 2R3SA 1MDFA 4UDNA 3T5DA 4IINA 1EVYA 3GA7A 1OJ7A 1OMOA 5BR7A 2NUBA 3IULA 3QX8A 3AG5A 4DOMA 5LZ2A 4GBED 2VJKA 4DGSA 3TR6A 1MVLA 4YRDA 4QUHA 1IUOA 3RS7A 3ASZA 1JWAB 2GYWA 2Q2OA 3BE6A 4B2IA 1ZJ6A 3R23A 3J7TA 3THYA 4TTSA 4CVNA 1UMDB 3ZDBA 2JI8A 2AJDA 4FKZA 2G9VA 1VHJA 1NQAO 4IF6A 5L3RA 5L3VA 1RYMA 4HH3C 1E1RA 1NNLA 4S2UA 4P7BA 3ZJVA 4ZCLA 4WJZA 1M6VA 5ICCA 3EGDA 1TK2A 2RHMA 4Z7QB 2I7TA 3QVKA 1VE1A 3P19A 2C7OA 3SFZA 2QIPA 3IXMA 3C0KA 1MZVA 1CYEA 3PLAE 2FSUA 3B5IA 1WPGA 1B0UA 3TX2A 3VZCA 3GYBA 4IG4A 5AT1A 4MCHA 1SBNE 1XXLA 1IOLA 1BHSA 4D7AA 1TTHA 3ZQJA 4H7DA 2Z0MA 3OQNA 1SFRA 5G0WA 1W6UA 3NIBA 1C3LA 4CL2A 4LHXA 1FUYB 1J00A 1OD6A 3AL3A 5KSYA 1XKXA 2XT0A 3MC1A 4TV9A 1J97A 4MA4A 2O1EA 1M1NB 1G60A 4RZSA 5AKJA 5H0IA 1E9SA 4YQEA 4LNUB 1GADO 3LK7A 4NATA 4LW8A 4UDXX 5BMVF 4QFCA 3TW8B 2W43A 5HCNA 4EEKA 3IBGA 2ZJ3A 4R41A 3U26A 4F21A 5CLFA 4QL3A 3EODA 4AYWA 2DQ4A 2IZOA 4MV5A 5JH7B 1E1QA 1XQ6A 3MJDA 2JAQA 4AO7A 1BKYA 2B36A 4N3GA 4UXJA 4MV1A 4CM5A 3KJIA 4GPEA 1F0YA 3MS4A 4LMBA 4CMJA 1AQIA 2RH8A 3RTAA 5F98A 2O1WA 4J03A 4KOAA 4LTNA 3GFBA 1P9OA 4QOIA 4BDTA 3GDGA 3LHKA 5DGIA 1FFBA 5FCDA 3VAYA 1RQ7A 3D8RA 2E0IA 3CFYA 2MSWA 4MVJG 4IRMA 1H69A 5COQA 5C7YA 4LOLA 4R1NA 3QF4B 4CQNA 3LY9A 1UM9A 2XMPA 1TO1E 4NX2A 3BT7A 1R3DA 4AC9A 4XX0A 2O5EA 2AG5A 3W5HA 2H7YA 2Z95A 2E5LB 3DYVA 3JQGB 4YXWA 2IWRA 2JGLA 2XKJE 1NSTA 3EXAA 4KPGA 3EC2A 2BGKA 2CB0A 1UBKS 2NLOA 1TJNA 4TTTS 1DINA 2NYAA 2VDQB 1GZ3A 3FNRA 2R0QC 3EVCA 5EXPA 1NFFA 1GL3A 1XJ0A 3FKSD 5DXFA 1OQAA 3QPCA 2OHHA 1CLEA 1Z4OA 3DXZA 5LLDA 2OHXA 2F3UA 2YYZA 3ESDA 2VTBA 2Y1LA 3WLOA 5KKNB 3LNCA 2I5PO 1Z74A 2FN3A 3EHDA 4IHQA 4H4EA 3K0AB 4RHXA 5JO0A 4AWBA 4CEHA 3A9VA 4I50F 4DLSA 2EFHB 1SHLA 4FZ3A 1GNPA 1RHKA 2NM0A 3VPXA 4GVLA 3IQEA 1Z29A 5KINB 4AYXA 4JOSA 4NI5A 1GZHB 3AZOA 4P80A 4F2DA 4S3MA 1JEYB 3WDSA 1V2HE 3QLVA 4H16A 4NDNE 2WG2A 1Y1LA 1UK8A 4P3YA 2IYTA 1E6MA 2KE5A 2XYQA 2XSZD 3EUFA 4MYHA 3V1MA 2EWWA 3BSYA 4QATA 4DC9A 5CEEA 4W6ZA 2IYEA 3JARB 1V8ZA 1CERA 3V32A 4YRGA 2HY7A 3TEFA 3TN7A 4RYDA 5A3RA 3RYHB 2AVNA 1KS2A 4HH0A 2G09A 1QGZA 4XUDA 4HVTA 3THWB 3DE0X 2BFEB 3T0GA 2ACEA 2J3DA 3HV0A 3TPCA 4TXHA 2XAUA 1M1XB 4R1LA 4JROA 4S05A 1UXOA 2NU9B 3BGOS 2Y66A 3DDOA 3RYCB 2H4WA 1KWKA 3UH1A 1I2DA 1F14A 3LKBA 4EYEA 1FXUA 5LDHA 1UM8A 3IA2A 1NVUQ 5D5HA 3BAFA 3U4DA 5CB4B 1OR8A 1JB1A 1IEVA 2DPXA 3P9XA 1H8HA 3F4BA 4FX5A 2XW6A 3LQ2A 3KTAB 1MAAA 1RQXA 1THGA 1I8TA 3P96A 5TT1A 3WK5A 5CDHA 1GTVA 2HMWA 2OHFA 1BFKA 1SVMA 1YRQA 4B44A 1CUEA 1Y8ZA 3N1UA 3BJEA 4MGEA 4CKEA 1NI3A 1AKTA 4KIJA 4HWRA 1N5RA 1ZOPA 4J0CA 3RC7A 2VG8A 1ODCA 2HCJB 3D81A 2O0LA 1W25A 4IWNA 4UTPA 1XK6A 3TW8A 4OKIA 1KK2A 2Q3LA 3GLQA 1CXZA 2C4UA 5E3HA 1XAGA 3ND5A 3ZQ6A 3WYGA 4U2GA 4EVIA 2Z6UA 1WVIA 2CDRA 3FYUC 4RA9B 4XUGB 1PF7E 4U00A 3PCTA 4R3UC 5LB4A 2ZIEA 1KI7A 2O8BB 5H3LA 1U6KA 2DWQA 1XELA 1RU3A 3DEZA 2YRXA 3B36A 3M4NA 3OETA 4IJQA 2F62A 1LLCA 2OZKA 4AJOA 1P3Y1 4N7BA 3UFXB 3W2EA 4AUNA 1KMQA 3KQUA 1PVOA 1T5SA 4ZEVA 3DH0A 2QI9F 4RVHA 1BJRE 5ALDA 1L3IA 1JHRA 1R9MA 3BWVA 3W3AA 4BZZA 4ER0A 3U3ZA 1WEKA 4E31A 4MWSA 2X58A 2BHTA 2OLEA 3NTOA 4HAVA 2X3FA 3LVBA 3V9AA 4ZCTA 1DC6A 2R65A 3ABZA 4WI1A 2Q5JA 4PF1A 1RYYA 3NKFA 4BNGA 4JLMA 4GSKA 1CZLA 5AO9A 3PVCA 1QPZA 4GQBA 3UMMA 4REQB 1KOLA 3JQ9A 4ZCPA 4BRZA 2BEUA 4EG6A 3AYZB 3IODA 2QT0A 5JVDF 4YJ3A 4ND8A 4PTZA 4D98A 1PD0A 3AEQB 1RJ9B 2AOWA 1CVIA 3AJAA 4J7UA 1IY1A 4L5YA 5F2NA 2W6OA 4KREA 1N3YA 4TYYA 1LLUA 3MCVA 4XWOA 4LJYA 3OE5A 1B1AA 3CEMA 4RLHA 4NOLA 3FBTA 2B7CA 2G0AA 4GNKA 2IP2A 1JR3D 2WICA 2YUIA 3QY9A 4JCOA 4A6PA 1E2PA 4DMGA 5HNKA 2JFUA 2Q99A 2Z30A 3V7FA 4L5AA 1UBTS 1P0IA 1WXQA 4QQ8A 4AG6A 3C74A 3CLSC 1EFRD 3EBOA 1RM5A 3K20A 2DR2A 4KQKA 2WHXA 3BL5A 3T5CA 3L0IB 3ZXIA 3T0IA 1N7IA 1IM5A 1JQ3A 4QU8A 3ZBTA 4CM1A 3AKCA 2ZBUA 3GDHA 3PE6A 3QHQA 3V33A 1MRZA 2IFTA 4BNXA 4FEAA 4M86A 1JYSA 2PYDA 3R7NA 2I4OA 1GAJA 5ITSA 4D6XA 1EG7A 4RSRA 5ILOA 2XWQA 1T0UA 1L4KA 1U2DA 2YJNA 2PLWA 3OF3A 3EYWA 1JVBA 2BKXA 2ZIXB 4YDSA 5EERA 4P0QB 4D6PA 1V11B 3STTA 2KM1A 4O1HA 1M5RA 4X97A 4K1LA 4P5EA 2IBTA 3U1VA 4U0JA 4JP3A 3ICEA 4F8JA 4LJ8A 4FMDF 2R00C 5EGSA 3HK2A 4B8YA 1XT6A 3WK8A 3RBVA 2HXGA 2WJIA 1N1DA 4EMTA 2PQ2A 2MYNA 5HQ3A 3ED5A 3HSKA 1U8TA 4Z54A 2BFFB 3D3WA 4NNPA 1QHHB 4R9VA 4CMGA 1L7PA 2I03A 4JVNA 4W9NA 2QXTA 5DPMA 1Q3KA 1JQBA 3AUKA 1DZ3A 2JFPA 1ODIA 4MI1A 2QPLA 4NHOA 2VJQA 2QE6A 1EXVA 2I91A 1M1YE 4LF7B 1GDDA 1QONA 1NQTA 2A35A 1FFYA 1LPNA 5EYPA 4LPSA 5KNDH 1XOIA 3HB5X 5FD8A 4TN1A 4HGPA 5FAKA 3MAJA 2IYLD 3C7CB 3JS5A 1X3LA 3GRRA 1JR6A 1A9TA 1CZKA 3IEUA 3N0RA 5CA1A 5KTKA 1PCXA 1TQ2A 3A1WA 3RVRA 1WQ1R 4TLDA 4ZJZA 4CT4B 2OAP1 1Y6QA 2RHDA 1KKLA 3E22B 3NR2A 5JCOA 3W8EA 3V6MA 4CXMA 5HYVA 1IB6A 1P6UA 2CE7A 4OQFA 1RRKA 1LRLA 2XI4A 3HU1A 1E3JA 1A82A 2I6UA 4MUGA 3FRJA 3RFVA 2OQVA 1LGYA 3II6X 2ONJA 4AMYA 4JLUA 3DLIA 2Y9PB 3L4BC 2EW8A 3RRXA 2XCTB 1M0EA 2IDJA 4A26A 3SKYA 1W85A 2Q5CA 4QQKA 4CR6A 3TVYA 4JDPA 1G4AE 3RKUA 3STWA 4CCSA 5IJWA 5I3CA 2B4TO 4QGSA 1L4GA 5KQLA 2BJHA 3GX1A 4BO0A 1G8FA 4C6RA 2XBMA 1T8YA 4RDXA 3U9LA 1YUNA 1SU8A 2I7DA 2I7CA 1ZOOA 3E03A 4MS1A 5FOSA 3Q11A 1HE8B 2BN4A 3K6KA 4MWZA 1SXJC 4X24A 2OTCA 2GZRA 2ZBRA 4JYCA 4HAOA 1JWBB 2WJVA 4DANA 1YU9A 4AO6A 4JQOA 4Q4AB 3GZNA 4UVDA 4BMZA 3GJ6A 1CUDA 5C9ZA 3PR3A 5LOVA 2I6FA 1C2TA 3ZK8A 3I64A 2BFOA 2OFOA 3K5IA 1PQYA 3KSRA 2C5HA 5C51B 2VATA 5KHOC 4YHHB 4E5DA 3ABOB 1NBWB 3OWOA 4NYIQ 2G17A 3FSJX 4TMXA 3S40A 2E4UA 3TZQA 3LQ1A 1G6KA 4XM1A 2H2GA 1T8WA 1H2XA 4IM7A 4HUTA 2FJPA 5AI6A 4ER3A 4WXPA 4IIGA 2G88A 4NDZA 4W5WA 1BWSA 1FE8A 3RJMA 2RGDA 5CK5A 1Q14A 4XWWA 2FXVA 3E1KA 1QH8A 2X5KO 3E9RA 2BGRA 3GAFA 4URFA 5AKLA 3WHLA 1TLLA 5LQAA 4G0VA 4G65A 1UBUS 2NVOA 5DMHA 1O94A 3LCVB 1QR2A 2ZVDA 2FSFA 3D6TB 3FAZA 1NUTA 1YL5A 1Z2DA 1UJCA 2DVMA 2P4SA 4DLNA 5KC9A 2XGMA 1S8NA 4MLCA 3GLFB 3I53A 4YXFA 1H65A 3QHPA 2JLXA 3QUCA 4HYTA 2ZYUX 4IUCS 4MSUA 1BMQA 3M5DA 1R64A 1JE1A 1L7VC 5IC5A 4ZYWA 4KLNA 3IURA 4JBXA 1LBIA 4BXOB 3PIIA 2PIDA 4G1CA 2P6RA 3D4NA 3NAQA 3T3DA 3DMRA 1ORRA 4IX9A 4F0JA 1JHAA 1PR1A 1WBJB 2AXNA 2PV0A 2ZSDA 3HZZA 3GUHA 3ILSA 1ZJ5A 5ES4B 2FW6A 2AA3A 2XUPA 3DP9A 4OHMA 2BFFA 4AT1A 4EWLA 1C8KA 4DY6A 2VSXA 2WI8A 3LUKA 3U7IA 4DLXA 1RLUA 1BWPA 1ZGBA 1K7CA 1B0ZA 1UWVA 4K46A 4IIFA 3VU9B 3OICA 3DXFA 1A71A 4XLZA 1QF6A 4MVCA 2OQ2A 3DBHB 3GAMA 4DUYB 5LXTB 4L9AA 4YNBA 3U60B 4R31A 2BELA 3MN1A 5J63A 1PG2A 1V96A 4BRSA 5BQFA 2HU2A 4IV8A 1VKOA 1ESEA 3CW9A 3D6HA 5K0EA 4BO4A 1WF3A 2MTBA 1TIKA 3SHOA 4GPD1 2A57A 3ASUA 3NHSA 4ZT5A 1ZJWA 3FSGD 1Z2PX 1AMUA 3BCHA 4MS4A 4DIDA 1DRKA 1PG5A 3H9EO 1UBEA 1ZUD1 1M6EX 3GB9A 2AFRA 3LUFA 3S7TA 2BFNA 3IVCA 4JZYA 1ATIA 1UFQA 1P3JA 5KWJA 2L18A 5LQUA 1A8HA 4M1QA 4OGLA 4CZ2A 1PWZA 4D79A 5B36A 2HPAA 4NENB 1NUHA 2XPCA 1BXGB 3AP1A 1T2EA 1XEXA 1X38A 4RL6A 2ONZA 2WV9A 5DHPA 1N1EA 4HTFA 1R3UA 4IDEA 4ZCIA 4AJEA 1DKRA 1Y7HA 1RM3A 2EJCA 4QD3A 2QM3A 4QYWA 3MERA 1EVJA 1SUSA 4UNPA 3VZSA 3DZJA 5I4KA 1CUXA 4BUCA 1ORWA 3BMXA 3I4FA 3TLEA 2JIMA 3AT1A 2QUAA 1U65A 4OFXA 1H9CA 2NSLA 2V0NA 4KXFB 2WA2A 5AYVA 4BKRA 2QJFA 2LKCA 1J8VA 1VPVA 2XJ9A 3NBMA 3IFSA 1XHEA 5IXSA 5ELXA 3I6QA 1ULTA 4KSCA 1PV2A 4EKNB 4JXZA 1FYXA 2CV0A 4LWPA 4WGFA 3H17A 1UZAA 2CNNA 4G85A 4X1YB 4J2OA 1C80A 2AZDA 3OQBA 1TT5A 2NSDA 3CR8A 3MCUA 3ROEA 5KMGB 2YKGA 1K5PA 2QL7A 2XVXA 1LDEA 1TU0A 3L6CA 4OVKA 4XEUA 1WSWA 1Z8DA 2ODPA 2XDYA 3HBJA 4K03A 4PLTA 3AHJA 4X66B 3GLHB 2YIVX 4WDRA 3B3JA 2V03A 5DNAA 2C8JA 4PX5A 1EP9A 3WQHA 2B1IA 1UBNA 2ECFA 1Z5VA 4KXUA 2J4CA 3PUZA 4P54A 4RETA 4RH1A 3OAAD 3MOSA 2Z08A 2Z5GA 4MTLA 3IKVA 4Z7JA 1KO7A 1SUFA 2C7BA 3QKRA 1SKYB 1ESZA 1SHJA 4MV8A 1GXSB 3HGMA 2O3RA 4GF5A 1V43A 1Q0PA 3PFGA 4N6OA 2XLBA 1BNCA 2ADOA 4KLRA 1I32A 1A8QA 5T41A 3VU3A 4Q3DA 3Q6MA 2E4XA 3CUKA 4EFNA 1O4WA 4TSFD 3TRKA 4EUHA 1AQJA 3A31A 1NXPA 5EE5B 3FNBA 1TK3A 1ADJA 4NC9A 4XASA 1P1IA 2BI7A 3WA6A 1UJNA 4YJDA 2NX2A 5IT4A 4OSPA 2PU7A 1DV2A 2JK1A 4C6SA 2V58A 2J0VA 4BHTA 2R1TB 1OWLA 1FU4A 5IDVA 1YOVB 2R62A 4NAUA 5BW5A 1V16B 4RNDB 2IXGA 3ST7A 5E3IA 1QGAA 1EVZA 1SQ5A 2HRDA 1L5GB 3O5AA 3QMWA 4HATA 3JTMA 3G49A 1U63A 1LUAA 4GWKA 1ENYA 1FY2A 4IDFA 2FR8A 2DM6A 4JASB 4TWRA 2WUWE 1VCHA 3EEIA 4YMGA 1XCPA 3CZQA 1XDSA 2E9SA 1N5OX 4FGJA 3RAJA 3PNYA 1DXHA 2FP3A 3EB9A 2ZJBA 1CR2A 3BJRA 3I5AA 4R16A 4Y7CA 3RC9A 4IIJA 1VMDA 1OH8A 3HA2A 3PDIB 1QHFA 1N7GA 1Q0SA 2PGOA 1RZ3A 3KP1A 3JQAA 1P73A 2Y67A 4FI3F 4K6FA 4JCCA 2H5LA 4NG5A 4MICA 4PFQA 3CVUA 5EKSA 4XQEA 4IJKA 4DNXA 2IW1A 4D0GA 3KPVA 1OT5A 3NM4A 1YI1A 2DLDA 4G3XA 5A5VA 3TQRA 1SOWA 1R5BA 2D2XA 4NCXA 5IVKA 2XXBA 3OZ7A 1RYDA 2V7WA 1M0WA 2B4YA 2X0EA 2II6A 3H1FA 2HO5A 1EDDA 1TKBA 1GAQA 3FZQA 3IPLA 1F0NA 1ACJA 4FC6A 4FR5A 4K1XA 4L0DA 4LDRA 3VHRA 1A7KA 3R0VA 3HEBA 2VJCA 3WC4A 1SC9A 1TOAA 2J6IA 4BRWA 4YR7A 4ZYYA 3BH7A 3HA5A 4FDAA 5C4MA 4LKRA 3BSSA 2NWQA 1DO8A 1I4EB 5DGHA 3HZOA 2AUTA 1OZFA 5TXGA 4CIXA 1XCBA 4BQIA 1HX7A 4LC0A 4ND5A 3FCYA 2I9KA 4M1YA 1UFRA 1RPJA 2D3WA 2X0FA 3DB2A 3CX8A 4G36A 1KDOA 1V8PA 2C58A 1CULC 1GZ7A 4MR7A 4X62B 2OYCA 3V2IA 2IPMA 3X2SA 3Q2OA 5MGBA 2JBAA 1XMJA 3G2QA 2VRCA 1E5QA 1WHTB 4KFSA 3A2NA 3QLJA 3RWOA 4YCSA 2PLAA 3FTQA 1HLPA 3NYIA 3Q6IA 2JIQA 1D4OA 1OAOC 3B1KA 3NASA 4N3NA 2D7JA 5DLDA 2PIAA 3FYUB 4F5ZA 4ZK6A 3K71B 4UUMA 1KSJA 3EEQA 4KAFA 4HB3A 5AI8A 1T4DA 3T7KA 4KXVA 1HDEA 1VDZA 4F6RA 1RBQA 3FCOA 4Q16A 4B4VA 3FZNA 5L8VA 3CRRA 1RKVA 1XVTA 4L15A 5C8DA 1JDSA 3B6IA 3UWOA 3MCTA 4WZBE 4YHBA 3MD0A 3DBLA 4WLNA 5ABPA 4XDGA 3QW4B 1SVWA 2Z8YA 4R2WA 4LHEA 1CJTC 1ISJA 1PSZA 1Z6PA 2PSSA 1Q7EA 1KSFX 3UANA 3GLIB 3AB7A 4MVJF 4D9JA 3H9UA 1KVRA 3ITKA 4TQGA 4YJKA 4L4ZA 3EIQA 1I33A 3Q9UA 3KVVA 3I5MA 1MAVA 1DX9A 3ZNOA 5KYWB 1FMCA 1J7KA 5SYAA 3ZCSA 2P6UA 2NU7A 4HR7A 1IXZA 1IUKA 1G8MA 2KSQA 2RBGA 2ZKIA 4QULA 4X8MA 4V0KA 3UJ9A 4A16A 2YXPX 4D8UA 4X92A 5ED0A 5AVKA 1B93A 3KLBA 4IW3B 1SVNA 3T7TA 2R7KA 1YRWA 1CFJA 2B92A 5MHTA 4XIGS 4EBFA 1SUIA 2Q0XA 1Z0IA 4U9HS 4DILA 1ZY2A 4N18A 2GZHA 4ASUD 3B3QA 1P2BA 3CINA 3HG7A 3I0NA 1H2AS 5EIAA 4RLSA 2ZJAA 3MXOA 1O95D 2V74B 2XCSB 2H1RA 1Y81A 2QM0A 1MTOA 2Q1YA 3B6ZA 2ZBPA 4G09A 3RSCA 1H2EA 1Q50A 1DEXA 2J3JA 1J0EA 4G5HA 2QNRA 1QG6A 3KZVA 3N8IA 3OTOB 3SHQA 3C6QA 4TLBA 1TUGA 4G1FA 5ALPA 3N05A 1XZAA 2O3TA 4P2BA 1KDTA 2IPXA 1ZM4A 1ZC4A 3R8XA 3WGJA 1NVXQ 1XEAA 4HX9A 4H17A 2FWMX 1OXXK 2JLUA 1QCDA 2CF5A 1EDBA 3THRA 3QXXA 4BBJA 4Z0HO 1VJ5A 3FNHA 3P27A 2JFYA 4LRWA 5HGJA 4DQKA 1K68A 4E22A 2VT7A 3KK0A 1MJNA 5I48A 4TKZA 3NH9A 1G0OA 1RHRA 3KPJA 1QPBA 3V4LA 2YQZA 3SF0A 3BSFA 4QJ4A 2O2XA 1TUBA 2XXAB 4ND7A 3SIRA 2CXNA 3PFCA 4HQRA 4I1IA 3JZIA 1E92A 4D0NA 4TRMA 1PG0A 2A14A 5E1MA 5KQGA 1Q12A 4QVKA 4RANA 3NLLA 1VG1A 1X7ZA 2EATA 3N7TA 1AK9A 2PFKA 2AI2A 4GEKA 4NCNA 3GGDA 3QYFA 3L43A 1T2FA 2OG2A 5EJFA 1FLDA 2IOFK 1Y48E 4NJEA 1GA4A 3CLUD 1YB4A 3AR8A 3OOWA 5ENDA 4KQGA 3LTNC 1YB7A 1M7HA 3HFRA 1HDCA 4WACA 1V1MA 5LMNB 1DBIA 2ASVA 1ONOA 3GLGE 2B8NA 3ZQUA 4XEHA 4DIFA 1XKLA 5B30A 2WB2A 1ZA2A 4E5YA 2QL6A 3MTGA 4RY8A 3H18A 4ID9A 3STUA 1WB5A 3EVBA 1HE2A 3PFIA 5L6LB 4TLMB 1Z28A 2CXSA 4MUNA 1Y4DE 3O21A 3LUGA 1YQDA 4GGMX 3FTEA 4PGHA 4FKBA 3U61B 2H7VA 4LYAA 1VGQA 3BAZA 2BF7A 2G40A 3GH1A 1IHYA 3BREA 4HFRA 4J4BA 2O57A 2R85A 3VMFA 5JWOA 2JC3A 3PE3A 1PZEA 4HLUA 4QHYA 5E7QA 4D1YA 3ESXA 3R9XB 1IG0A 2IHNA 1DHRA 4I6EA 2FI1A 3QJ5A 2C2OA 4N0QA 5HPYB 2CSUA 5LSAA 4PG7A 3UAYA 1L1EA 1TFRA 2NP6A 1LFDB 3AHDA 2NUPA 1FTGA 2D4HA 4FNOA 1ZZEA 1ZIXA 4N7JA 3NBXX 1S96A 2JJYA 3ZY3A 2BHLA 2LPMA 2W2TA 4LYJA 3SYTA 3GJ8A 3TYXA 4ACBA 4EGSA 3AUUA 3W7BA 3HUDA 3I32A 4GPAA 4P81A 4LF6B 1W5TA 1VJTA 2CMGA 1Y6JA 2IYYA 2P2YA 4MCIA 4BO6A 2PL9A 3GR6A 3ECCA 3LCJA 4HADA 4BNTA 4IFEA 3S44A 2ONKA 3L40A 2YXDA 2Z83A 1Y3FE 2JAUA 4I4TB 3P94A 3OTHA 4FE4A 4KLCA 4EG5A 4EL0A 5KUTA 4Q9HA 4BO7A 5JXIA 5C5CA 2RKWA 2DECA 1Q16A 3AY0A 4GRIA 5L3ZA 2E87A 4LWQA 1H23A 1UKVY 1PO7A 1U2GA 3IKMB 4UTXA 5DGTA 1YVPA 1PEYA 2E3JA 4WJLA 3QSGA 5FP0A 4CKBB 1D6SA 3DZCA 3JVEA 1V7QA 3MTQA 1DBVO 1GR0A 1MG0A 3CF2A 4G5QA 2NSHA 5E7MA 1GPYA 1SA0A 1NW7A 5HIJA 1HFEL 3OKCA 4QU9A 4YC7A 1XKQA 1P5HA 4LY0A 2I55A 2OZPA 1I3LA 3B2QA 1YB6A 1CLUA 5AVVA 4TV8A 5JAIA 1R6UA 3KSDO 2WZDA 4IDHA 4KC0A 1E3IA 2BLNA 5CRIA 3FETA 3OC6A 2QRMA 3MINB 4GOKA 2QTTA 4F9EA 1D1QA 1T13A 1YJCA 4HAZA 1C9YA 1R6BX 2RIPA 5CA0B 3C15C 2NUTB 1SBHA 2DKNA 4LXXA 1UIMA 3VR0A 4DS3A 1FQKA 3EFOB 4HTAA 4FFNA 3RHTA 4AZSA 2P1RA 2ZK7A 3BQ9A 3LWDA 1Z8NA 3VXKA 5JYEA 4JJFA 1DARA 1POXA 2FETA 1DVRA 3G8BA 2RARA 3X44A 4HUQB 1EPUA 2J7PD 4RHTA 1ULUA 4OAQA 1EX6A 3PV0A 4EHBA 4KRGA 4NXMB 2W6QA 1ZYUA 2NAPA 4PYKA 3R7WB 4H0FA 1ZWKA 3WMXA 4ZCMA 3D7MA 4P7GA 3FA2A 3RTCA 1ZHOA 1PL6A 1S2LA 3ZN2A 4EKYA 1A9QA 4M4SA 4WN9A 2HZBA 1YFLA 5IJAA 4LISA 5JAMA 2YIDA 4P82A 4WVFA 2JD2A 4OLBA 4XFDA 3SEAA 5IYZF 3VJMA 4LXYA 3IMCA 2B20A 3EY4A 3BUSA 1H0SA 3LAWA 2VH1A 4Y6QA 3MWLA 4G5FA 2VQDA 3BMCA 4LOHA 3U3RA 4RD0A 4RZHA 1ISSA 1C8LA 5JZOA 5K7SA 3DCJA 4DIBA 2PX4A 1UC9A 5BNFA 1GQQA 2CFTA 3FVVA 3V55A 4XGQA 4KR6A 4ABYA 2EFYA 3LYLA 1U0JA 3OA2A 2VAVA 4UPDA 4RM2A 3O8NA 3HLKA 4YAJA 3GLKA 4YV1A 2VCHA 3FGOA 2RFLA 3IOEA 3A06A 3EIXA 4CKCA 4L5BA 4BNJA 1HXHA 2KX7A 1MW8X 4B1FA 5JD4A 3S8EA 1IEWA 1VRCA 2GHIA 2EX1A 3NNSA 4XOIA 1NQVA 5EZSA 3V1UA 3BF8A 3L8HA 3O3NB 3UAWA 1CRZA 3WHKA 1PKEA 1I94B 3ZBUA 4LSZA 5JZBA 2OXIA 4DE5A 3M6FA 2QHXA 3EIUA 1U99A 1CUIA 4OAOA 1QO0A 1XG5A 4QDOA 1SXHA 3TLBA 2C97A 2ZUFA 4QBTA 2E48A 1JG2A 1Z0SA 2BKEA 4J76A 5AVWA 2AR0A 4BIIA 2V96A 2ZRFA 3H2YA 5ITZA 3LPDA 2J87A 4YUZA 1SXJA 5LQSA 3T7JA 1BRMA 4LDAA 4GYJA 1V1RA 3K09A 2HYIC 1DQNA 4I66A 4DWJA 2KPOA 4FPXA 4HXYA 5EUMA 5L3QA 1FJXA 1SO8A 4X3OA 2PT9A 4OGKA 5IU6A 1Z25A 4DLLA 4MWCA 5C1DA 3KR1A 3PUXA 2AT1A 2Z1DA 1TK9A 5E4YA 1GWNA 1GOTA 2BCGY 2IPLA 3NRCA 2W58A 1C3VA 1IVNA 4GNRA 1CDZA 3M34A 1F2UB 3PNVA 5U4QA 4D3YA 4F8EA 4N0MA 3PDCA 1ARZA 1QIDA 2GN0A 1K7YA 3UZUA 3W7VA 3DV2A 1YDHA 1U04A 1WU7A 4NU8X 2J3HA 3DLHA 1NURA 5F73A 4DA4A 3CCFA 2V7QD 4Q1EA 3X1XA 2XZPA 2P67A 4ZV9A 1P3DA 3T9BA 4YROA 1ZK1A 4D25A 5FLKA 1ZVMA 2KLHA 4GMDA 4QXRA 3VAZA 5G0UA 1TZKA 4LJ5A 5HF6A 3TRJA 3UOAB 4EX7A 4F1KA 5KZMB 1KARA 4DBLE 1DC8A 1VL5A 3A3KA 3OZIA 5CDSA 4CLRA 4F4IA 3D5QA 2WHPA 3REFA 3QVWA 1NJ8A 1TT7A 2BEVB 3PDJA 1PJAA 3KB8A 3SXUB 1XVAA 2P77A 4ZVTA 1VIAA 1REQA 2EP8A 3KBOA 1TD9A 3F7MA 3QLTA 4LS3A 2ZYSA 3WTCA 4KK3A 3OFKA 1DSSG 3VR4H 3T6KA 3MUEA 4MIEA 1EFLA 1T4MA 1V2GA 4A6EA 1YZYA 4HT3B 1FFHA 2D5IA 4KLAA 4BNLA 1U0BB 5KNDD 1B42A 2AE1A 2HHJA 4Q05A 3CLTD 1L8OA 2IYQA 2NVUA 4ZANA 2RGWA 4LC1A 4CBVA 1TLFA 3JYHA 1OBOA 1VA5A 4YMTA 1L8XA 4FYVA 4QQFA 2QBYB 4EZBA 3TMYA 2PU5A 1BHO1 4FYHA 4LRSB 2J5BA 1TYAE 4PXAA 3SX0A 3IUBA 2UVDA 4V0ME 1YZLA 2RONA 3DOIA 3RBZA 1EA7A 4L3WA 2OMKA 2OV6A 1JXQA 4NMWA 3WGHA 5LWHA 2FRVA 2IC5A 3JQ7A 4OU4A 2QJOA 3W5SA 3TZEA 5HZKA 2WF5A 1MVNA 3QQ5A 4IXNA 4XDYA 1L4FA 2GA9A 3F8SA 2EC5A 5CP8A 1XZDA 1QOQB 2Q6OA 3PUYA 3NBKA 1DO2A 3NT5A 1U3GA 1U8CB 4PGAA 3D6AA 5CPBA 3BWBA 5FIUA 4EYGA 4PLVA 1BCSB 1ZGZA 3KFXA 1FNCA 2VTKA 1T26A 2OV1A 5D1NA 1FLNA 5HG0A 3V8MA 1S2MA 5KS2A 2IYXA 3CBQA 5GTDA 2QD4A 5EHNA 1BN7A 1E3WB 2BGIA 4L28A 2HZ7A 4JLKA 2QLJA 3P9ZA 2OAEA 3QTBA 3W1WA 5FLXA 4X1IA 2QYTA 4PZAA 4U39A 1ACLA 4PU0A 2W98A 5CT5A 4YRQA 1Z5PA 5ES3A 5GZ1A 3IQXA 4YECA 4EF4A 1T2NA 5KVVA 2PGXA 4AP6A 1XGKA 4GMFA 3HVUA 5T4EA 3D8BA 4RELA 2ZE5A 4F1JA 4LV6A 5AUQA 3AUSA 1SQGA 3H1TA 1QYVA 2P2CA 4JA2A 3M0EA 2DHCA 3HWX1 1USVA 4FDVA 3HQ4O 1JA1A 2YNMD 1QGDA 1SD2A 2AW3A 4PAWA 4BL5A 2NZXA 3IAXA 4QGBA 3LX8A 4QEZA 4TYPA 4KMOA 5J2TB 4NYMQ 4KWTA 1DPFA 3NG1A 4TKMA 2RKBA 3SC3A 1KTIA 4GW3A 2H59A 1RHUA 3D9QX 1YI8A 3EAFA 4IHAA 3E27A 3HVJA 2X3UA 4GXNA 4JT8A 3DEIA 4PHTA 2YWHA 3O93A 3KE9A 3PJRA 2IU6A 3JALA 1BW9A 2IPAB 1LI5A 1TM3E 1DG3A 1JLSA 1VBMA 3DTVD 3LGAA 4I9NA 3A1EA 3EVDA 1SCUA 2B35A 1P91A 3BA1A 3OFVA 2J0QA 4BVJA 3WBJA 3QJGA 3ZJ5A 3NHUA 1A9YA 3H5NA 3GFSA 4AICA 3OZBA 5FL7A 5KJCA 3OOJA 4P4LA 1EXWA 4J7CA 4WLFA 1TL7C 4BFYA 2JJ8A 3MRXA 4XAQA 3SZOA 3WNDA 3EZLA 4JU9A 1AK2A 1XD2B 3IJRA 3P9CA 4KH1A 4ALLA 4Y6PA 3SLKA 2BEWB 2MDTA 1C41A 2EBUA 5H16A 2OBMA 1NLUA 1K75A 3DE5X 2XKKA 1BDJA 3ME5A 2AFVA 1UDXA 1T3SA 6CHYA 3FYSA 3PKIA 5IS2A 1QU3A 4A2PA 3R8CA 1SOUA 4O4JF 1FFDA 3R20A 1TTPB 2PMKA 3KU4A 5HJ2A 3A2LA 2NTEA 1YE8A 2B1JA 4LE0A 3T0FA 4I5GA 5CFOA 2WYHA 1RT9A 4BGUA 1OZHA 3T15A 2ODTX 4PLGA 4E0BA 2OCGA 1R6AA 2V55B 4ZU1X 4EHIA 1J07A 1JQEA 3H0CA 4WECA 2QAGC 3MBIA 4TVBA 3DUFA 1GRCA 4JC4A 1TQ8A 2GZ3A 3AFNA 3KPWA 5EHQA 4DLBA 2ADFA 4Y9SA 4I1VA 1BGWA 5BRNA 3RFXA 2BYTA 2FSIA 2H4FA 4FEYA 4Q18A 1ADFA 1NXVA 3HYSA 3CRMA 4YPVA 2LE0A 2Q6IA 5J5AA 1TD1A 1ISRA 3VBCA 2CXRA 2HGSA 5FXMA 3T12A 4UVIA 4TMYA 4XLLA 4Y8VA 4P22A 3C6BA 4UJ5A 2ZU6A 4W8GA 5HIKA 4P4GA 4FYWA 1K7EB 1O4VA 2EL7A 2FWAA 2FZEA 3K8YA 3T4XA 4D46A 4EB6A 5LL6P 4RM3A 1LKZA 1U9IA 4DQLA 4RVGA 3N7UA 4PPGA 5TE9A 4D6YA 4UTNA 2R6CA 1MC5A 2XMRA 4V3CA 4KSBA 5FADA 3ANMA 5IF3A 4F93B 2Z8YM 1LF5A 2VHVA 1ZH8A 3OUTA 4PIVA 1HYEA 4Z4QA 1M1YB 4KG7A 2OO5C 4MIYA 1RXUA 4XQGA 5TQ0A 4Q21A 3VX4A 1DQSA 3TECE 1M66A 2AD5A 2XE7A 3OPQA 1KK1A 2A5FA 4X1KA 1FS6A 4Z9XA 5I9LA 4PWZA 4PG6A 4QTUB 1NVMB 1P44A 3BD7A 3OQJA 4G1BA 1WY5A 1XE3A 2J41A 1ND5A 2R60A 1TNDA 3S5JA 1H05A 2H63A 4JEUA 1PJSA 4TLCA 2H5EA 1NXSA 5FNVA 1KFCB 2GBIA 2AFHA 3FLAA 2AN3A 4US0R 3EGCA 1Z0DA 3WLAA 3TRHA 4CQMB 1X39A 3OX3A 4C0XA 4EG3A 3MG9A 2HIHA 3ZE0B 1YMUA 2VJNA 3CPEA 4MYDA 3PC3A 3BGIA 1WETA 4V1CB 4ZGWA 4B5KA 5EXDA 5HKOA 1HT0A 4OPMA 4RZQA 5F7JA 4BX2A 3NAZA 4ES6A 1X70A 2E89A 4Y2QA 2D1FA 4Z49A 3N86A 5JXJA 3K92A 2WIDA 1WXEA 1OAOA 5C80A 4UHHA 3AP2A 2WFLA 2BM9A 2OG1A 3AEUB 3LU1A 2HLPA 3CS3A 3N74A 1WUTA 4IHJF 1QF7A 2VUIB 2R751 3K9WA 2BONA 4TYWA 2QN8A 4A0RA 1FUUA 1GTZA 1KYIA 1JZTA 1PZHA 4RF5A 4TV9F 3GPBA 1B74A 1XL0A 3DLAA 4PPQA 4WSOA 3CCCA 3LQQA 5AJWA 2CNWD 2DT8A 3B1WA 3FSEA 3SNKA 5BPHA 1U0TA 4A0SA 1Z9BA 1MB0A 3V4RA 3Q4GA 3KLPX 2P8SA 4D41A 5CYPA 2JK0A 2JAHA 4X85A 3CM0A 2ZVPX 1KH1A 2X77A 2OFWA 2R6FA 3AEZA 3NTXA 4OXKA 4W1RA 2VAWA 2Y76A 3MJEA 4BCCA 3I4CA 1M2NA 4L6IA 2JGDA 1LU9A 3WZLA 1OFHA 4PLFA 4ZHQA 1AKEA 3H11A 4L4RA 4WH0A 2ZI4A 5IXYA 1TZMA 4IV5A 2IPNA 2XMGA 3TWOA 4CGYA 4EJ0A 1K7SN 3O9ZA 1SCKA 3AUTA 3ORSA 3IAS1 4CHTA 3KSBC 4FGWA 1UWKA 4ARCA 3LUDA 3VO1A 2NZUG 3FMFA 2C99A 3W8RA 2WSIA 4PR0A 5JLJA 3PKZA 1JNYA 1UBLS 1Y34E 4XGKA 2HNKA 5FA6A 3S8MA 3OZRA 5EINA 4F4HA 5I3ZA 5EE1A 2CNKA 4M1TA 4KL8S 3GV0A 2ILTA 2G9ZA 1CB7A 5EA2A 1K2VN 2I33A 3MJCA 2FVYA 3B70A 2PH3A 4ENTA 2X8JB 1O5OA 2ZR7A 3M6MD 2A67A 4FDLA 4ZARA 1J6UA 1GZ6A 4OQXA 3L49A 2X14A 4XJSA 2FPMA 2VJDA 5E6UB 2UYGA 5FPSA 1CUAA 3V1NA 3UJPA 3I6YA 4D3XA 1KVSA 4IG9A 4EMUA 2XEXA 2W2XA 1GILA 1X7HA 1MBZA 1W6RA 2G9UA 2PGJA 1T36A 4PQYA 4JBIA 2POQX 2IT1A 2XMZA 4MOWA 1N32B 3EXG1 3OWXA 4MVXA 3PHHA 3N2EA 4PC7A 3CRVA 1KL7A 4A4DA 4MUIA 1TF2A 5L3SB 3FD8A 2HHLA 1PNTA 4NYJQ 4E94A 1GTSA 4L8WB 4YUWA 2YV2A 5LA6F 3WV5A 3G02A 2QA5A 1K8RA 1JGTA 1THMA 2ZAYA 2P11A 3LZDA 1UEIA 4A8HA 3UB3A 3ZHCA 5B3JC 3JYOA 4OOEA 4N76A 1J22A 5F77A 1CQXA 2VZ8A 2BMVA 4EG4A 1XU7A 1R7RA 2UYOA 2Q1UA 3B85A 1JEDA 1GTMA 1UIRA 2XTJA 3FUXA 5ICEA 4DVGA 2AZXA 2C4HA 1UOQA 4N4AA 2ST1A 3C3WA 5BV2P 4H27A 4R8SA 4ZXPA 3JATA 3GPCA 1XN4A 4EABA 5JC1A 1U1GA 3OHPA 3R6TA 4IIBA 3PSHA 4R1UA 4ZMRA 1G3QA 3H4IA 2D1YA 3DHVA 1AUOA 3ABQB 3PFKA 3BXHA 3QNWA 4FFVA 3S8YA 4EYSA 2AJBA 5KAPA 1HM5A 2A1UB 3NP9A 2YDXA 4DLUA 1PHRA 5ETJA 1ZMBA 4G0NA 4JLNA 4NCHA 3STVA 2IEIA 2ZSAA 5AM0A 5MF6A 4FFPA 3ILHA 4QFMA 5K3AA 3U3DA 3A25A 2W11A 4X3CA 1ZVQA 1FVFA 2YC4C 4UM5A 3L4JA 2ZB7A 3M81A 4KPUA 2QLMA 2ZAGA 3HTXA 1IZ0A 1CUYA 3PJEA 3U44A 1NI5A 3LQKA 1BOOA 2XUGA 2WWFA 3I8SA 5LUAA 2VWPA 3BOSA 4HKTA 1ZM3A 3U13A 1ZCBA 2IU4A 2H4XA 1GFWA 5HDQA 3ZDCA 2CT8A 1XZ8A 1P1FA 5KSZA 1CJCA 1KBOA 1JKIA 3Q7SA 2GAIA 5CTAA 4ZXFA 3VVCA 3EGEA 5DIZA 1GFZA 1PWXA 5G0VA 1ZGCA 3FH0A 1GNSA 2DULA 5JQGF 3G0BA 1KDPA 3K35A 1RE0A 4GDMA 3EGXB 4ZI7A 3RIGA 4Z86A 1W2HA 3ODGA 4Y9TA 2XTZA 4BO8A 4DT1B 1U28C 1RHQA 2AF3C 2BP7B 2J48A 4OBEA 1U2ZA 3KJFA 3QYAA 3K4QA 4AZWA 2PLNA 2EGUA 3OE7A 3N6VA 3GCXA 2X4DA 4U1RA 3T3OA 2WOJA 4Q03A 1MP0A 2A5YB 4ZODA 4BB9A 3VA7A 4DKJA 1R5NA 3FF1A 3V7YA 3X43A 1L4HA 3F5FA 4E4RA 4E2FA 2CWDA 4GECA 4O59O 2OCLA 2XBUA 3PI6A 3R7SA 1IK6A 3IUPA 3IR6A 2CKMA 2AEFA 1M6WA 4NBNA 1DJPA 2QVXX 5CJPA 1HG0A 4C5BA 3GFVA 2FWNA 4DBLC 2RH4A 4LF9B 3BGDA 2FTKE 2GLTA 1TF5A 4EHJA 2WSMA 1W4CA 4EW3A 1ZQ1A 1KYQA 4LJ6A 2V7BA 5LWQA 1PL7A 3GJ0A 3PFNA 5IZ4A 3MOGA 5CH3A 5GJBA 3FY4A 3E9MA 4OMDA 2FQXA 5B4UA 2FLWA 3FTDA 1A4RA 2PAFA 3LSTA 1R0YA 2PD3A 3A4NA 4P7KA 2ZTVA 5FLYA 2IV3A 3RKSA 4CHGA 1FP4B 1IEXA 1FXSA 2QROA 3G0CA 4AS1A 1HE3A 4Z3DA 5C1IA 1WWKA 3EPKA 1QYDA 4IICA 4LYFA 10MHA 5CDTA 2HTFA 2IRWA 4C22A 2JFOA 4RJLA 3PNPA 5LIRA 1FX1A 2EP7A 4BKQA 3MCZA 3ZGVA 4S24A 3OWHA 4OK6A 1NRXA 4MVYA 2LCQA 1MEOA 2P78A