2V8CA

Mouse profilin iia in complex with the proline-rich domain of vasp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN-2
publication title High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2v8cA00
3LEQA 3T12B 3T1RA 1CF0A 3CHWP 1VEUA 3MS6A 4X1LA 3MSHA 3L9KA 1CJFA 5FEFA 3NECA 4D60A 2VK3A 1D1JA 2ZL1B 4ESPA 3UB5P 1VETB 1Y4OA 3T1QB 1SKOA 3CPTA 3KYEA 3DAVA 4QWOA 2JKGA 1FIKA 1Z09A 5FDSA 2V8FA 2JKFA 1PNEA 1YPRA 3LGOA 5FEGA 1PFLA 2PRFA 2E8JA 3T1XA 3NULA 2ACGA 5EVEA 3U4LP 1VEUB 3D9YA 1G5UA 2BTFP 4X1MA 4X25A 1SZVA 2ZL1A 1FILA 1VETA 1F2KA 1J3WA 3CPTB 5EM1A 1K0KA 2HZ5A 3T1SA 2PAVP 1A0KA 1PRQA 3L7HA 2B95A 5EV0A 2V8CA 1HLUP 1CQAA 4FTXA 4FUWA 5EM0A 1AWIA 2PBDP 1SKOB 1ACFA
chains in the Genus database with same CATH superfamily
3T1RA 1JTDA 5TR7A 2O0YA 1SDNA 3FV7A 1S0WA 3NECA 2EX9A 2VGKA 2HP6A 3HLGA 3B42A 3E2LA 1K4FA 2ZM0A 4HP4A 1SHVA 3TRCA 1XPBA 2Z6DA 1KVMA 4PAUA 5DF7A 3ZG9B 1CEGA 3ITBA 4ZAMA 3KYEA 3UE3A 2Y2QA 2XDMA 4U0XA 1EW0A 1ZHHB 1FIKA 5DTKA 4JGQA 4MNRA 5L10A 2A2LA 4A5RA 1LL8A 3KSIA 5FI6A 4F3LA 1KE3A 1NY0A 3EQUA 4R4RA 4C6YA 2OAQ1 3ZNYA 2PR5A 5EUAA 1ES2A 5HWVA 1ONGA 1TF1A 5E2FA 4LENA 4I5SA 4NXEA 3BEBA 1GHPA 3LR4A 3UMEA 5IHVA 4HBUA 4B4ZA 4GHIA 5GHXA 4NXGA 2XFTA 5D3OA 1K55C 4EWFA 4WL9A 5CHJA 3ZNTA 4QD4A 4FD8A 2WAFA 3PAEA 2QPNA 3UDFA 3SZTA 3SOIA 4PM8A 1FR6A 3T1SA 3BWLA 4II7A 3RH8B 5DF9A 3WS1A 3Q1FA 2B95A 4KZ9A 4DJ2A 5HD5A 3N8LA 2VX8A 3MXRA 2M7VA 2W1TA 1BT5A 2KX6A 4CLCB 1JWVA 1OTAA 1N9BA 3MSHA 3LY4A 1O07A 1GA0A 4N9LA 2ZL1B 3F1OB 5HARA 4S2MA 5HSQA 4LV1A 3IHBA 3DAVA 5GLCA 3NIAA 5HL6A 3NOPC 4EU0A 3IX4A 3PYPA 3EOIA 4IBXA 1PNEA 3LIFA 4EQIA 2HDSA 1VHMA 5GHZA 4R4SA 1L0FA 2WZZA 4PPRA 3UY6A 3LGOA 2KDKA 3MXSA 3T1XA 2R9XA 2ACGA 3UN7A 3V50A 1P0ZA 4RVAA 5C5KA 1DRMA 3V5MA 3DBAA 2H10A 3BQ8A 1J3WA 1RP5A 3OPHA 4CLCE 4Y17A 4GD6A 4CLCD 5HPIA 2K7SA 4U0TA 3RFBA 2HF6A 4MN6A 4HH2A 1H8YA 3Q82A 4IJGA 2Y2JA 3T4TA 1STZA 4BD1A 3O5YA 3B47A 4S2NC 5HWTA 4F3LB 3CG5A 2VEAA 2V9AA 5FAQA 3QP1A 1W8QA 4HESA 1NRFA 3T4JA 3FZCA 4G3KA 2O9CA 3CHWP 1PZPA 3VP3A 3UB9A 1VQQA 5IU1A 4GW9A 3CITA 5CGXA 1X0OA 1D1JA 1MBLA 3PAGA 4EEUA 3BY9A 5HAPA 1FSYA 1LHYA 3O86A 5FI2A 4UQIS 1NZOA 2QMIA 3LCEA 2JKGA 4H6JA 4N92A 4CJNA 1W8YA 3ULFA 5TBMB 4PHTA 4L0LA 2LB5A 3IHAA 1IYSA 3RXXA 3NDEA 4D2OA 2W1TB 2OSUA 3VP2A 4KZ3A 4ZDXA 2A49A 1XA7A 1L0GA 1KVLA 1MWSA 4R23A 4M3KA 4K0WA 1HD8A 3OPLA 3MQ0A 3WS0A 4HBTA 2BTFP 5DF8A 3MJQA 1XJ4A 3IXHA 4XT2A 3VV4A 3FG8A 1FOFA 4OQGA 1U60A 3R7WA 3N8RA 2OWHA 3PBRA 2H0TA 2AVXA 3I7JA 2XSSA 1F5MA 4QY5A 2G2UA 2ZOIA 5FASA 1T19A 3FWLA 3L7HA 4P87A 1TS8A 3OCLA 2P7JA 3PHYA 3IF5A 2X02A 1WA9A 4DKIA 2ZC3B 4KQDA 3NOUC 3ZG8B 4R38A 2ZLYA 3T4OA 4Q0IA 3HUNA 1SKOB 2ZQCA 5AQ7A 2NUTC 1KDSA 1GHMA 4GNUA 2EWWA 4ZJ1A 2JKRI 4R3BA 3FKVA 5K5BA 4L9GA 5GL9A 1YMSA 3GDIA 1OTEA 4KG6A 5AJGA 5CHUA 3V3SA 4B9OA 3LEZA 3E4OA 5HZHA 4RA7A 2CC1A 4MLLA 4UAAA 4H8RA 4MEZA 2EFXA 4CPKA 1XXMA 4IVIA 5AQAA 1P9RA 2WAEA 2JKRM 3O3VA 2PU2A 4QU3A 2O99A 5KIZA 1S4RA 3IBJA 2ZMVA 3K2NA 2PDRA 4OP5A 1ZG6A 4WZ5A 1G28A 4XUXA 3UB6A 3GQZA 4ZJ2A 3NOTC 3QHYA 2ZBBA 4KUKA 3C4PA 3U4LP 3A3IA 3WS5A 1PIOA 1NLZA 3ZDJA 2Y2IA 4OONA 4FSFA 3PBQA 2J8YA 3GECA 2EX2A 4UQIM 2KOIA 1BULA 4OOYA 1FILA 2HV1A 3LUQA 4O7DA 4Z9QA 3BFGA 3CWFA 3MQOA 1K0KA 2K2NA 5HL1A 2H5SA 3CZDA 4WEKA 3HUMA 4NEED 4OQ0A 5DFXA 2ZQ9A 4KG5A 1DP8A 4BBUA 3LY3A 3TW8A 4OQIA 1BLSA 2Q0OA 2JE5A 2ZD8A 1WE4A 3IX3A 4LRYC 3VP0A 5J4EA 4XUZA 2PBYA 5EPHA 2Y2GA 5FQJA 4LRXC 3QP5A 3FPVA 2PD8A 4R0QA 4KZ4A 4E6WA 1LI9A 2XRNA 1ZKJA 2WADA 3D4FA 5CTMA 4RYEA 5J7EA 3HLBA 3LIDA 2D01A 4UHUA 3C5AA 3W8KA 1V9YA 5FI7A 3SS3A 1ESUA 4XT2B 4DE2A 2ZQAA 2NUPC 4GD8A 3EEHA 1WYBA 4ETXA 3M6BA 3R7WB 3Q07A 4O0PA 1YLWA 4YINA 4DDSA 4GZBA 3OCNA 3FYZA 1W63Q 3VOYA 3WWXA 1TDLA 1VM1A 1IYQA 3G35A 3SS4A 3UNWA 5DKKA 3G34A 4WN5A 1FSWA 1FCOA 1MPLA 1F9IA 4L9EA 4PM9A 3LIEA 1N4OA 2OOLA 3TOIA 2HGVA 2XQZA 1JWPA 4OPYA 4EERA 3SH8A 2CMNA 3H7WB 4E3OA 3MQQA 2XF3A 3ZGAB 2ZM2A 4LCMA 1DP6A 1JTGA 2J7VA 3VSLA 2Y79A 3NCKA 1G68A 3A0SA 4DN0A 1PRQA 3E4PA 1HLUP 3BY8A 5J8XA 3EWKA 1K6SA 4KQQA 1W79A 4OOLA 4GOGA 1AWIA 2WK0A 4N1HA 4BWIA 1WYCA 3WRZA 1MWUA 2J3TC 5AQBA 1CJFA 4RQ9A 4M4XA 4LPZA 4IUKA 3VP4A 3CAXA 3QP4A 1IELA 2VK3A 4P0MA 3HBRA 5EVIA 2QJ7A 1GCEA 1NRJA 3C38A 1Y4OA 1HZOA 4PM7A 5DKLA 5HPFA 4E3NA 4LGWA 2ZQDA 3E4QA 1ODVA 4O8GA 3IXDA 5FDSA 3GR2A 4OVDA 4EUZA 2WKHA 2JC7A 4WZ5C 2VV8A 4ID4A 4E3IA 1VB6A 4B4XA 2X71A 4FOFA 3HVFA 3N8SA 3G2ZA 3FC7A 3H82A 2IWCA 3O88A 1RGZA 1KE0A 1YSQA 1PI4A 3HL9A 3N7WA 4LV3A 4GLQA 1FR1A 4E04A 4LLOB 4HQAA 2WZXA 3VP1A 1W7FA 1YT4A 5CERA 4EW7A 3G4PA 4C3QA 3LI8A 5KSCA 4K0XA 1YKDA 3MBZA 3NY4A 5HFOA 3MR0A 5FQMA 3MZEA 4HJ6A 1CEFA 3HCYA 4S2KA 5FATA 2C5WB 1TD5A 1GHIA 2Y8HA 3LO7A 3MZDA 3N6IA 2PR6A 1OTIA 1MKIA 3UO9A 4EV4A 4Z1WA 2INWA 3E98A 3EGDC 3UB7A 2ZMFA 3V39A 3Q7ZA 2Z2MB 3NJAA 2ZOHA 4DF6A 4MDZA 1PW1A 3S7OA 5CEBA 1IYPA 4PMAA 3Q7VA 3P01A 1BUEA 3ZFZA 3BM6A 3S4XA 4OOMA 3MFXA 3T4KA 5F1GA 4JPMA 3GMWA 5L8MA 2V8FA 2ZC6B 4F94A 2WKEA 4PM5A 3BJNA 5CGSA 3KSFA 4FH2A 1YPRA 2E8JA 4KZ7A 1XX2A 1N9OA 4PKYA 4S2LA 1K56A 5CTNA 2ZQ7A 2K31A 5EVIB 2V0UA 3G30A 5HAQA 1Z6FA 2QKPA 1YLZA 1F2KA 1M6KA 5CECA 2HZ5A 1I5QA 1EI5A 4WBGA 4MBHA 4OH0A 4Y7PA 3BQAA 4AFIA 2PAVP 5EV0A 2V8CA 4K91A 2M1CA 1YSPA 4HJ4A 2ZMAA 1DY6A 5E2HA 1DP9A 4KG2A 1GSWA 2V1ZA 4HNBA 2HDRA 1H8MA 3H82B 3T12B 5BOHA 4R6LA 1S4SA 3WS4A 4JF6A 5FEFA 4P85A 4BMWA 4DXBA 1ES5A 5EVIC 5M1AA 2V20A 4EEPA 4X6TA 4OPQA 5A91A 4XXRA 2Y2OA 4DDYA 3VOZA 3SH9A 3IXGA 2R9WA 2Y2NA 3V67A 3HJKA 4EBNA 5L2FA 1NYYA 1DJAA 2EX6A 4GJ4A 2XD5A 1XJ2A 4GHIB 4BL3A 1IFQA 1IKGA 3OPRA 2FFYA 3DW0A 2WGWA 1PFLA 1QMFA 5F68A 5HDDA 5CHMA 2VKSA 2DCFA 2J9OA 4R70A 3C30A 3G31A 4GCZA 4WMCA 2L1MA 5HW3A 5I5LA 3FPWA 1RGYA 3BYDA 3C7VA 4HP9A 3Q7VB 2HP9A 2DRWA 1ZC2A 4WYYA 4P6ZS 2GDNA 5DFYA 4E3KA 3SS5A 3IX8A 3T4QA 3IBRA 4NK3A 4KQOA 2IA2A 2O9BA 2EXBA 1UWNX 1KGGA 3CLOA 3P09A 4Y0OA 2H28A 3QP8A 3BFCA 1H8ZA 3ZQ5A 2MJ6A 1VEUA 3DTMA 4BL2A 3EGXC 4MN5A 4EETB 1JNUA 4NXFA 3O87A 2P9VA 1IKIA 3B3XA 4ZTKA 3LR3A 3UE6A 1NLYA 5FL3A 4KZ8A 3C8CA 5A90A 5CX7A 2Y2PA 1ZG4A 3GTCA 4KZ6A 5GLBA 4IVKA 4JKTA 4Y0UA 2OLVA 3BFDA 4HIAA 5FQQA 2XK1A 4ZJ3A 4S2IA 1ES3A 1P9WA 2YKFA 4HJ3A 4DRTA 3P98A 5AVEA 3OC2A 1Q2PA 5E43A 2LB9A 3G32A 4KQRA 2VGLS 1MXOA 4JXVA 4UA7A 3BLMA 3H9WA 3UMDA 3PBOA 2W3DA 3NBLA 2G2WA 4OPZA 1N9LA 1K56D 4R3JA 4BENA 3DWKA 5E2GA 1XA1A 4U3TA 5G4ZA 3S7QA 2XH9A 4CQHA 3CJMA 5GLDA 1L2SA 4UA9A 3VE4A 4QHCA 5DTSA 3UDIA 3RJUA 1BTLA 1P97A 1TEMA 5L07A 1S67L 2WGWB 5FAPA 2H0YA 2V0WA 4RX2A 4EUVA 5EOOA 3HLDA 3BECA 1ZTUA 2L0WA 4IHQA 4H6JB 5CGWA 3MS6A 3VE3A 2Y59A 3MKEA 4D60A 4JBFA 4HI4A 4JGPA 4EXOA 4YWZA 4P6ZM 4ME4A 4IEDA 4BJPA 2FH5A 5F69A 2QJ5A 3DWZA 1ALQA 2PD7A 3KSGA 2W3HA 2XFSA 3HJIA 2GZAA 3C4OA 1LT0A 1MKMA 1YMXA 1LSXA 2HJ9C 5G4YA 1YLPA 5HWWA 1NWZA 2BASA 5CXWA 4P6BA 5GHYA 3VMAA 5EVEA 1VEUB 4JF5A 1GSXA 1PI5A 4YFMA 2JHEA 1G5UA 2P9VB 3C7UA 1XFNA 1LL5A 4X1MA 4WZ4A 3ZVTA 4OQHA 1LI0A 3M2JA 4IUHA 1KE4A 4Q8IA 2EA9A 2PT7A 3B33A 5LBRA 3G2YA 3T50A 4DE0A 2DNSA 2ZM8A 3IS2A 3IWIA 4S2OA 4WMCD 3MKFA 2B18A 1BSGA 2G7UA 2Z2LB 2VZWA 1OT9A 5EM0A 3AGFA 1XKZA 4Q0HA 3ISGA 1T1CA 3PBNA 2VGLM 1PW8A 2VV7A 2E8IA 3KYQA 3A3JA 5JYOA 3ICYA 3M2KA 4Y3IA 1BLCA 4ZBEA 1E25A 5HDSA 1NZUA 4JLFA 1JWZA 4HHDA 4ESPA 2PU4A 1D7EA 4WF0A 4DE3A 4HEFA 4O01A 5DVAA 1EWZA 3EEAA 3T1QB 3PBTA 3F1NA 4QPRA 5A93A 4CLCA 2JCHA 3A0VA 3T4SA 2UWXA 5AQ9A 1IOUA 2HDUA 4JXGA 3RTYA 1MWRA 5DTTA 3F1OA 4OPRA 4MMNA 2HJEA 4QB8A 3NULA 1JVJA 2XLNA 2J3TD 4GS9A 3MFDA 4JXWA 1W63M 2JKTI 3DTIA 3A3EA 4R1GA 4Y2FA 3HLCA 1FCMA 2V1BA 4X25A 2WYXA 2XGNA 1VETA 4X56A 4WLAA 5EM1A 4DXCA 2Y4AA 2JKTM 2D02A 1L3LA 1A0KA 3OLOA 3NDGA 2P08A 1PWGA 3IWQA 1YLJA 3IWOA 4MCWA 1DJCA 3PBSA 3PXPA 2BLSA 3R4KA 3OBFA 1YLYA 2W3FA 3TE8A 3LR5A 2XROA 1SKFA 3KSHA 1XGJA 1CF0A 3SH7A 5FDHA 3DTEA 3BFEA 1H5XA 4G3VA 1LLBA 1CI8A 4EBPA 1E4DA 2BG1A 1BLPA 1ESIA 2VJWA 2ZQ8A 3JYIA 5TFQA 4GDBA 4QWOA 2IWBA 4I39A 1E3UA 5A92A 1K57C 3G6OA 2QZ6A 3IS2B 2A24A 4GKUA 3SW1A 2V1AA 1OMEA 2RL3A 2Y2KA 1UGUA 4OP8A 1ONHA 1K38A 4Y5FA 4LCLA 1XFQA 4BD0A 3NHQA 4S2PA 1PZOA 3JVUA 1H3QA 2PYPA 2EFUA 4DE1A 2WKIA 2OLUA 5HAIA 3D72A 3JVVA 2VV6A 5TBMA 4GN2A 4YOFA 4E6XA 3KO6A 1GSVA 3W4PA 4JGOA 3GVBA 1K25A 1GA9A 1NYMA 3LIAA 2VA0A 3MZFA 1S1ZA 1NXYA 3F1NB 2WGVA 5M18A 1XGIA 4KUOA 2Y2HA 5FQ9A 3RXWA 3CUEA 4KZ5A 1F98A 1OTBA 4QJGA 3UE0A 4LV0A 1TS6A 3TJZC 4HY8A 3IF6A 1N9NA 4I3JA 4K08A 4X69A 5HX9A 5L09A 5A8BA 2UV0E 4GDNA 4GS9B 2QHKA 5CRFA 2EWVA 2Y2MA 4FH4A 3W4QA 3HLEA 3ZG0A 4MBKA 5EOEA 3L9KA 4DMZA 4ZRRA 3LR0A 4E3JA 1LSWA 5DJUA 4MBFA 1LSVA 3FKWA 5FQIA 4ARZA 1VETB 2X01A 1MY8A 2P74A 1SKOA 3CPTA 1CK3A 3P7NA 4CLCC 3UPOA 3OOVA 4R3AA 1Z09A 4KZAA 4PKYG 4UA6A 2J9PA 5CEDA 1OJGA 2Q9NA 4HH3A 2JKFA 3ZYTA 5TGFA 2XA7S 4BLMA 3QNBA 5MC7A 2XD1A 5FEGA 2PRFA 2HP5A 2JBFA 2YKHA 3TG9A 4MN7A 2FFFB 1KGEA 5F83A 2V2FF 3D9YA 3S7NA 1KOUA 5EVID 1MWTA 2Y2LA 2B5RA 4JGRA 4LV2A 3GSGA 5F1FA 1XJ6A 4C75A 2L4RA 1C3BA 2WKPA 4I3AA 2Y55A 3S22A 1Y54A 2A24B 2KLIA 4B88A 4G3WA 5F6AA 1D06A 4Q0JA 3ZG7B 3UPNA 3MMHA 3UE1A 3LEQA 2FZ0A 2Z6CA 2VGJA 2R78A 3AGDA 4N9KA 1EROA 4I3IA 3AGEA 5J3WA 4LRZE 3Q81A 3HUOA 3E2KA 4OKPA 5AVFA 5FQKA 3F1PA 1ERQA 1T1AA 5JYPA 2W1RA 2ZJ9A 5HDCA 5KMWA 4Y15A 4E3MA 4X55A 1OPXA 2QYBA 1MC0A 4OLDA 1T1BA 2GJ3A 2M7UA 2W27A 3A3DA 3IF6B 1L0EA 4RX3A 4IBRA 1E3UD 3KYZA 3HLFA 1H0MA 5EE8A 1XP4A 1SDEA 1FCNA 2JN7A 3VFFA 3ZVWA 2HPBA 2W0NA 5M19A 3BFFA 2C6WB 1K54A 2DMWA 1BYWA 1YAXA 5I94A 4EESA 4WEJA 3UB8A 1NJ4A 1TVFA 3UDXA 3DTKA 4ARZB 2J80A 4NG2A 3OPPA 5IT5A 4NXBA 4EBLA 2Q9MA 3CPTB 2WGIA 3CUEC 2GX5A 3WS2A 1ERMA 5GLAA 2XA7M 3VSKA 3ZHHA 3IQAA 3IF6C 1CQAA 3H7WA 4Y13A 1YQSA 1T18A 4KENB 1M40A 1YLTA 1S6RA 3BLSA 3ZCZA 1BLHA 4YNRA 3W2ZA 2PHYA 3BRMA 1KDWA 2Y91A 2W3EA 3KX0X 1OTDA 4S2JA 2XEPA 3PTEA 1MZUA 1ES4A 2EX8A 1FQGA 2EXAA 3E0YA 3UB5P 5FAOA 5F82A 5KZHA 1Y28A 1CI9A 1HVBA 3QNCA 1S66L 3WRTA 1TS0A 1S1YA 2O9AA 3MXQA 1G6OA 4KZBA 3HLWA 4L9FA 3TSGA 3IH8A 2I72A 4WELA 5FA7A 1SCWA 4BBTA 4PM6A 3K3DA 4DJ3A 3LFVA 3V3RA 4FCFA 2WUQA 5TJJA 4I38A 5EECA 4LFUA 2IWDA 1K57A 2B02A 3UPPA 2OAP1 3F1PB 2WKQA 1SZVA 1PYYA 2ZC5B 2A3UA 4NKPA 1K55A 3M6HA 4B93A 4X68A 3N4IA 1I2SA 1OJ5A 4X53A 2W3GA 1XJ3A 5EFWA 3JPUA 4FTXA 2WKRA 3A0RA 3C2WA 3HREA 1Q2QA 1PWCA 4BBVA 3QP6A 1ACFA 5EVLA 1BZAA 5U47A 3W4OA 5HD3A 4NETA 4X1LA 3LICA 4QY6A 5DJTA 3IT9A 1QMEA 1J9MA 3LI9A 2P04A 3OZHA 1KGFA 3EQVA 3GRJA 3NC8A 5KSHA 5F5YA 2J3WA 1TDGA 4Y0TA 4E3LA 1DJBA 3S7PA 2XR0A 4JF4A 1OT6A 3QP2A 3T4LA 1LL9A 1AXBA 3VFHA 4WM9A 3BW6A 4OLGA 4ETZA 3IXBA 1UWPX 3ZG5A 2RCXA 4HOIA 3MF0A 2PYRA 4JXSA 1K54C 3S1YA 1W5DA 1RCJA 1O7EA 1HTZA 5G18A 5E2EA 3K3CA 4GB7A 1K6RA 2QWSA 4UEYA 3D3OA 2ZL1A 2OV5A 4EQ1A 4WUJA 1TS7A 2GNXA 2HDQA 2ZC7A 5FSRA 1G6AA 1V9ZA 1PWDA 1K4EA 3CMZA 1L0DA 5IS1A 1IYOA 3GV9A 2OWJA 3LYXA 2ZC4B 1IEMA 3A3FA 1I2WA 2VLGA 3NI9A 2I9VA 4FUWA 4S2NA 1YM1A 3IH9A 3PR6A 3LIBA 3U2AA 2PBDP 4N1XA 4BQMA 3ITAA 3VOLA 3CI6A
chains in the Genus database with same CATH topology
3LEQA 3T12B 3T1RA 1CF0A 3CHWP 1VEUA 3MS6A 4X1LA 3MSHA 3L9KA 1CJFA 5FEFA 3NECA 4D60A 2VK3A 1D1JA 2ZL1B 4ESPA 3UB5P 1VETB 1Y4OA 3T1QB 1SKOA 3CPTA 3KYEA 3DAVA 4QWOA 2JKGA 1FIKA 1Z09A 5FDSA 2V8FA 2JKFA 1PNEA 1YPRA 3LGOA 5FEGA 1PFLA 2PRFA 2E8JA 3T1XA 3NULA 2ACGA 5EVEA 3U4LP 1VEUB 3D9YA 1G5UA 2BTFP 4X1MA 4X25A 1SZVA 2ZL1A 1FILA 1VETA 1F2KA 1J3WA 3CPTB 5EM1A 1K0KA 2HZ5A 3T1SA 2PAVP 1A0KA 1PRQA 3L7HA 2B95A 5EV0A 2V8CA 1HLUP 1CQAA 4FTXA 4FUWA 5EM0A 1AWIA 2PBDP 1SKOB 1ACFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEQ A;  3T12 B;  3T1R A;  1CF0 A;  3CHW P;  1VEU A;  3MS6 A;  4X1L A;  3MSH A;  3L9K A;  1CJF A;  5FEF A;  3NEC A;  4D60 A;  2VK3 A;  1D1J A;  2ZL1 B;  4ESP A;  3UB5 P;  1VET B;  1Y4O A;  3T1Q B;  1SKO A;  3CPT A;  3KYE A;  3DAV A;  4QWO A;  2JKG A;  1FIK A;  1Z09 A;  5FDS A;  2V8F A;  2JKF A;  1PNE A;  1YPR A;  3LGO A;  5FEG A;  1PFL A;  2PRF A;  2E8J A;  3T1X A;  3NUL A;  2ACG A;  5EVE A;  3U4L P;  1VEU B;  3D9Y A;  1G5U A;  2BTF P;  4X1M A;  4X25 A;  1SZV A;  2ZL1 A;  1FIL A;  1VET A;  1F2K A;  1J3W A;  3CPT B;  5EM1 A;  1K0K A;  2HZ5 A;  3T1S A;  2PAV P;  1A0K A;  1PRQ A;  3L7H A;  2B95 A;  5EV0 A;  2V8C A;  1HLU P;  1CQA A;  4FTX A;  4FUW A;  5EM0 A;  1AWI A;  2PBD P;  1SKO B;  1ACF A; 
#chains in the Genus database with same CATH topology
 3T1R A;  1JTD A;  5TR7 A;  2O0Y A;  1SDN A;  3FV7 A;  1S0W A;  3NEC A;  2EX9 A;  2VGK A;  2HP6 A;  3HLG A;  3B42 A;  3E2L A;  1K4F A;  2ZM0 A;  4HP4 A;  1SHV A;  3TRC A;  1XPB A;  2Z6D A;  1KVM A;  4PAU A;  5DF7 A;  3ZG9 B;  1CEG A;  3ITB A;  4ZAM A;  3KYE A;  3UE3 A;  2Y2Q A;  2XDM A;  4U0X A;  1EW0 A;  1ZHH B;  1FIK A;  5DTK A;  4JGQ A;  4MNR A;  5L10 A;  2A2L A;  4A5R A;  1LL8 A;  3KSI A;  5FI6 A;  4F3L A;  1KE3 A;  1NY0 A;  3EQU A;  4R4R A;  4C6Y A;  2OAQ 1;  3ZNY A;  2PR5 A;  5EUA A;  1ES2 A;  5HWV A;  1ONG A;  1TF1 A;  5E2F A;  4LEN A;  4I5S A;  4NXE A;  3BEB A;  1GHP A;  3LR4 A;  3UME A;  5IHV A;  4HBU A;  4B4Z A;  4GHI A;  5GHX A;  4NXG A;  2XFT A;  5D3O A;  1K55 C;  4EWF A;  4WL9 A;  5CHJ A;  3ZNT A;  4QD4 A;  4FD8 A;  2WAF A;  3PAE A;  2QPN A;  3UDF A;  3SZT A;  3SOI A;  4PM8 A;  1FR6 A;  3T1S A;  3BWL A;  4II7 A;  3RH8 B;  5DF9 A;  3WS1 A;  3Q1F A;  2B95 A;  4KZ9 A;  4DJ2 A;  5HD5 A;  3N8L A;  2VX8 A;  3MXR A;  2M7V A;  2W1T A;  1BT5 A;  2KX6 A;  4CLC B;  1JWV A;  1OTA A;  1N9B A;  3MSH A;  3LY4 A;  1O07 A;  1GA0 A;  4N9L A;  2ZL1 B;  3F1O B;  5HAR A;  4S2M A;  5HSQ A;  4LV1 A;  3IHB A;  3DAV A;  5GLC A;  3NIA A;  5HL6 A;  3NOP C;  4EU0 A;  3IX4 A;  3PYP A;  3EOI A;  4IBX A;  1PNE A;  3LIF A;  4EQI A;  2HDS A;  1VHM A;  5GHZ A;  4R4S A;  1L0F A;  2WZZ A;  4PPR A;  3UY6 A;  3LGO A;  2KDK A;  3MXS A;  3T1X A;  2R9X A;  2ACG A;  3UN7 A;  3V50 A;  1P0Z A;  4RVA A;  5C5K A;  1DRM A;  3V5M A;  3DBA A;  2H10 A;  3BQ8 A;  1J3W A;  1RP5 A;  3OPH A;  4CLC E;  4Y17 A;  4GD6 A;  4CLC D;  5HPI A;  2K7S A;  4U0T A;  3RFB A;  2HF6 A;  4MN6 A;  4HH2 A;  1H8Y A;  3Q82 A;  4IJG A;  2Y2J A;  3T4T A;  1STZ A;  4BD1 A;  3O5Y A;  3B47 A;  4S2N C;  5HWT A;  4F3L B;  3CG5 A;  2VEA A;  2V9A A;  5FAQ A;  3QP1 A;  1W8Q A;  4HES A;  1NRF A;  3T4J A;  3FZC A;  4G3K A;  2O9C A;  3CHW P;  1PZP A;  3VP3 A;  3UB9 A;  1VQQ A;  5IU1 A;  4GW9 A;  3CIT A;  5CGX A;  1X0O A;  1D1J A;  1MBL A;  3PAG A;  4EEU A;  3BY9 A;  5HAP A;  1FSY A;  1LHY A;  3O86 A;  5FI2 A;  4UQI S;  1NZO A;  2QMI A;  3LCE A;  2JKG A;  4H6J A;  4N92 A;  4CJN A;  1W8Y A;  3ULF A;  5TBM B;  4PHT A;  4L0L A;  2LB5 A;  3IHA A;  1IYS A;  3RXX A;  3NDE A;  4D2O A;  2W1T B;  2OSU A;  3VP2 A;  4KZ3 A;  4ZDX A;  2A49 A;  1XA7 A;  1L0G A;  1KVL A;  1MWS A;  4R23 A;  4M3K A;  4K0W A;  1HD8 A;  3OPL A;  3MQ0 A;  3WS0 A;  4HBT A;  2BTF P;  5DF8 A;  3MJQ A;  1XJ4 A;  3IXH A;  4XT2 A;  3VV4 A;  3FG8 A;  1FOF A;  4OQG A;  1U60 A;  3R7W A;  3N8R A;  2OWH A;  3PBR A;  2H0T A;  2AVX A;  3I7J A;  2XSS A;  1F5M A;  4QY5 A;  2G2U A;  2ZOI A;  5FAS A;  1T19 A;  3FWL A;  3L7H A;  4P87 A;  1TS8 A;  3OCL A;  2P7J A;  3PHY A;  3IF5 A;  2X02 A;  1WA9 A;  4DKI A;  2ZC3 B;  4KQD A;  3NOU C;  3ZG8 B;  4R38 A;  2ZLY A;  3T4O A;  4Q0I A;  3HUN A;  1SKO B;  2ZQC A;  5AQ7 A;  2NUT C;  1KDS A;  1GHM A;  4GNU A;  2EWW A;  4ZJ1 A;  2JKR I;  4R3B A;  3FKV A;  5K5B A;  4L9G A;  5GL9 A;  1YMS A;  3GDI A;  1OTE A;  4KG6 A;  5AJG A;  5CHU A;  3V3S A;  4B9O A;  3LEZ A;  3E4O A;  5HZH A;  4RA7 A;  2CC1 A;  4MLL A;  4UAA A;  4H8R A;  4MEZ A;  2EFX A;  4CPK A;  1XXM A;  4IVI A;  5AQA A;  1P9R A;  2WAE A;  2JKR M;  3O3V A;  2PU2 A;  4QU3 A;  2O99 A;  5KIZ A;  1S4R A;  3IBJ A;  2ZMV A;  3K2N A;  2PDR A;  4OP5 A;  1ZG6 A;  4WZ5 A;  1G28 A;  4XUX A;  3UB6 A;  3GQZ A;  4ZJ2 A;  3NOT C;  3QHY A;  2ZBB A;  4KUK A;  3C4P A;  3U4L P;  3A3I A;  3WS5 A;  1PIO A;  1NLZ A;  3ZDJ A;  2Y2I A;  4OON A;  4FSF A;  3PBQ A;  2J8Y A;  3GEC A;  2EX2 A;  4UQI M;  2KOI A;  1BUL A;  4OOY A;  1FIL A;  2HV1 A;  3LUQ A;  4O7D A;  4Z9Q A;  3BFG A;  3CWF A;  3MQO A;  1K0K A;  2K2N A;  5HL1 A;  2H5S A;  3CZD A;  4WEK A;  3HUM A;  4NEE D;  4OQ0 A;  5DFX A;  2ZQ9 A;  4KG5 A;  1DP8 A;  4BBU A;  3LY3 A;  3TW8 A;  4OQI A;  1BLS A;  2Q0O A;  2JE5 A;  2ZD8 A;  1WE4 A;  3IX3 A;  4LRY C;  3VP0 A;  5J4E A;  4XUZ A;  2PBY A;  5EPH A;  2Y2G A;  5FQJ A;  4LRX C;  3QP5 A;  3FPV A;  2PD8 A;  4R0Q A;  4KZ4 A;  4E6W A;  1LI9 A;  2XRN A;  1ZKJ A;  2WAD A;  3D4F A;  5CTM A;  4RYE A;  5J7E A;  3HLB A;  3LID A;  2D01 A;  4UHU A;  3C5A A;  3W8K A;  1V9Y A;  5FI7 A;  3SS3 A;  1ESU A;  4XT2 B;  4DE2 A;  2ZQA A;  2NUP C;  4GD8 A;  3EEH A;  1WYB A;  4ETX A;  3M6B A;  3R7W B;  3Q07 A;  4O0P A;  1YLW A;  4YIN A;  4DDS A;  4GZB A;  3OCN A;  3FYZ A;  1W63 Q;  3VOY A;  3WWX A;  1TDL A;  1VM1 A;  1IYQ A;  3G35 A;  3SS4 A;  3UNW A;  5DKK A;  3G34 A;  4WN5 A;  1FSW A;  1FCO A;  1MPL A;  1F9I A;  4L9E A;  4PM9 A;  3LIE A;  1N4O A;  2OOL A;  3TOI A;  2HGV A;  2XQZ A;  1JWP A;  4OPY A;  4EER A;  3SH8 A;  2CMN A;  3H7W B;  4E3O A;  3MQQ A;  2XF3 A;  3ZGA B;  2ZM2 A;  4LCM A;  1DP6 A;  1JTG A;  2J7V A;  3VSL A;  2Y79 A;  3NCK A;  1G68 A;  3A0S A;  4DN0 A;  1PRQ A;  3E4P A;  1HLU P;  3BY8 A;  5J8X A;  3EWK A;  1K6S A;  4KQQ A;  1W79 A;  4OOL A;  4GOG A;  1AWI A;  2WK0 A;  4N1H A;  4BWI A;  1WYC A;  3WRZ A;  1MWU A;  2J3T C;  5AQB A;  1CJF A;  4RQ9 A;  4M4X A;  4LPZ A;  4IUK A;  3VP4 A;  3CAX A;  3QP4 A;  1IEL A;  2VK3 A;  4P0M A;  3HBR A;  5EVI A;  2QJ7 A;  1GCE A;  1NRJ A;  3C38 A;  1Y4O A;  1HZO A;  4PM7 A;  5DKL A;  5HPF A;  4E3N A;  4LGW A;  2ZQD A;  3E4Q A;  1ODV A;  4O8G A;  3IXD A;  5FDS A;  3GR2 A;  4OVD A;  4EUZ A;  2WKH A;  2JC7 A;  4WZ5 C;  2VV8 A;  4ID4 A;  4E3I A;  1VB6 A;  4B4X A;  2X71 A;  4FOF A;  3HVF A;  3N8S A;  3G2Z A;  3FC7 A;  3H82 A;  2IWC A;  3O88 A;  1RGZ A;  1KE0 A;  1YSQ A;  1PI4 A;  3HL9 A;  3N7W A;  4LV3 A;  4GLQ A;  1FR1 A;  4E04 A;  4LLO B;  4HQA A;  2WZX A;  3VP1 A;  1W7F A;  1YT4 A;  5CER A;  4EW7 A;  3G4P A;  4C3Q A;  3LI8 A;  5KSC A;  4K0X A;  1YKD A;  3MBZ A;  3NY4 A;  5HFO A;  3MR0 A;  5FQM A;  3MZE A;  4HJ6 A;  1CEF A;  3HCY A;  4S2K A;  5FAT A;  2C5W B;  1TD5 A;  1GHI A;  2Y8H A;  3LO7 A;  3MZD A;  3N6I A;  2PR6 A;  1OTI A;  1MKI A;  3UO9 A;  4EV4 A;  4Z1W A;  2INW A;  3E98 A;  3EGD C;  3UB7 A;  2ZMF A;  3V39 A;  3Q7Z A;  2Z2M B;  3NJA A;  2ZOH A;  4DF6 A;  4MDZ A;  1PW1 A;  3S7O A;  5CEB A;  1IYP A;  4PMA A;  3Q7V A;  3P01 A;  1BUE A;  3ZFZ A;  3BM6 A;  3S4X A;  4OOM A;  3MFX A;  3T4K A;  5F1G A;  4JPM A;  3GMW A;  5L8M A;  2V8F A;  2ZC6 B;  4F94 A;  2WKE A;  4PM5 A;  3BJN A;  5CGS A;  3KSF A;  4FH2 A;  1YPR A;  2E8J A;  4KZ7 A;  1XX2 A;  1N9O A;  4PKY A;  4S2L A;  1K56 A;  5CTN A;  2ZQ7 A;  2K31 A;  5EVI B;  2V0U A;  3G30 A;  5HAQ A;  1Z6F A;  2QKP A;  1YLZ A;  1F2K A;  1M6K A;  5CEC A;  2HZ5 A;  1I5Q A;  1EI5 A;  4WBG A;  4MBH A;  4OH0 A;  4Y7P A;  3BQA A;  4AFI A;  2PAV P;  5EV0 A;  2V8C A;  4K91 A;  2M1C A;  1YSP A;  4HJ4 A;  2ZMA A;  1DY6 A;  5E2H A;  1DP9 A;  4KG2 A;  1GSW A;  2V1Z A;  4HNB A;  2HDR A;  1H8M A;  3H82 B;  3T12 B;  5BOH A;  4R6L A;  1S4S A;  3WS4 A;  4JF6 A;  5FEF A;  4P85 A;  4BMW A;  4DXB A;  1ES5 A;  5EVI C;  5M1A A;  2V20 A;  4EEP A;  4X6T A;  4OPQ A;  5A91 A;  4XXR A;  2Y2O A;  4DDY A;  3VOZ A;  3SH9 A;  3IXG A;  2R9W A;  2Y2N A;  3V67 A;  3HJK A;  4EBN A;  5L2F A;  1NYY A;  1DJA A;  2EX6 A;  4GJ4 A;  2XD5 A;  1XJ2 A;  4GHI B;  4BL3 A;  1IFQ A;  1IKG A;  3OPR A;  2FFY A;  3DW0 A;  2WGW A;  1PFL A;  1QMF A;  5F68 A;  5HDD A;  5CHM A;  2VKS A;  2DCF A;  2J9O A;  4R70 A;  3C30 A;  3G31 A;  4GCZ A;  4WMC A;  2L1M A;  5HW3 A;  5I5L A;  3FPW A;  1RGY A;  3BYD A;  3C7V A;  4HP9 A;  3Q7V B;  2HP9 A;  2DRW A;  1ZC2 A;  4WYY A;  4P6Z S;  2GDN A;  5DFY A;  4E3K A;  3SS5 A;  3IX8 A;  3T4Q A;  3IBR A;  4NK3 A;  4KQO A;  2IA2 A;  2O9B A;  2EXB A;  1UWN X;  1KGG A;  3CLO A;  3P09 A;  4Y0O A;  2H28 A;  3QP8 A;  3BFC A;  1H8Z A;  3ZQ5 A;  2MJ6 A;  1VEU A;  3DTM A;  4BL2 A;  3EGX C;  4MN5 A;  4EET B;  1JNU A;  4NXF A;  3O87 A;  2P9V A;  1IKI A;  3B3X A;  4ZTK A;  3LR3 A;  3UE6 A;  1NLY A;  5FL3 A;  4KZ8 A;  3C8C A;  5A90 A;  5CX7 A;  2Y2P A;  1ZG4 A;  3GTC A;  4KZ6 A;  5GLB A;  4IVK A;  4JKT A;  4Y0U A;  2OLV A;  3BFD A;  4HIA A;  5FQQ A;  2XK1 A;  4ZJ3 A;  4S2I A;  1ES3 A;  1P9W A;  2YKF A;  4HJ3 A;  4DRT A;  3P98 A;  5AVE A;  3OC2 A;  1Q2P A;  5E43 A;  2LB9 A;  3G32 A;  4KQR A;  2VGL S;  1MXO A;  4JXV A;  4UA7 A;  3BLM A;  3H9W A;  3UMD A;  3PBO A;  2W3D A;  3NBL A;  2G2W A;  4OPZ A;  1N9L A;  1K56 D;  4R3J A;  4BEN A;  3DWK A;  5E2G A;  1XA1 A;  4U3T A;  5G4Z A;  3S7Q A;  2XH9 A;  4CQH A;  3CJM A;  5GLD A;  1L2S A;  4UA9 A;  3VE4 A;  4QHC A;  5DTS A;  3UDI A;  3RJU A;  1BTL A;  1P97 A;  1TEM A;  5L07 A;  1S67 L;  2WGW B;  5FAP A;  2H0Y A;  2V0W A;  4RX2 A;  4EUV A;  5EOO A;  3HLD A;  3BEC A;  1ZTU A;  2L0W A;  4IHQ A;  4H6J B;  5CGW A;  3MS6 A;  3VE3 A;  2Y59 A;  3MKE A;  4D60 A;  4JBF A;  4HI4 A;  4JGP A;  4EXO A;  4YWZ A;  4P6Z M;  4ME4 A;  4IED A;  4BJP A;  2FH5 A;  5F69 A;  2QJ5 A;  3DWZ A;  1ALQ A;  2PD7 A;  3KSG A;  2W3H A;  2XFS A;  3HJI A;  2GZA A;  3C4O A;  1LT0 A;  1MKM A;  1YMX A;  1LSX A;  2HJ9 C;  5G4Y A;  1YLP A;  5HWW A;  1NWZ A;  2BAS A;  5CXW A;  4P6B A;  5GHY A;  3VMA A;  5EVE A;  1VEU B;  4JF5 A;  1GSX A;  1PI5 A;  4YFM A;  2JHE A;  1G5U A;  2P9V B;  3C7U A;  1XFN A;  1LL5 A;  4X1M A;  4WZ4 A;  3ZVT A;  4OQH A;  1LI0 A;  3M2J A;  4IUH A;  1KE4 A;  4Q8I A;  2EA9 A;  2PT7 A;  3B33 A;  5LBR A;  3G2Y A;  3T50 A;  4DE0 A;  2DNS A;  2ZM8 A;  3IS2 A;  3IWI A;  4S2O A;  4WMC D;  3MKF A;  2B18 A;  1BSG A;  2G7U A;  2Z2L B;  2VZW A;  1OT9 A;  5EM0 A;  3AGF A;  1XKZ A;  4Q0H A;  3ISG A;  1T1C A;  3PBN A;  2VGL M;  1PW8 A;  2VV7 A;  2E8I A;  3KYQ A;  3A3J A;  5JYO A;  3ICY A;  3M2K A;  4Y3I A;  1BLC A;  4ZBE A;  1E25 A;  5HDS A;  1NZU A;  4JLF A;  1JWZ A;  4HHD A;  4ESP A;  2PU4 A;  1D7E A;  4WF0 A;  4DE3 A;  4HEF A;  4O01 A;  5DVA A;  1EWZ A;  3EEA A;  3T1Q B;  3PBT A;  3F1N A;  4QPR A;  5A93 A;  4CLC A;  2JCH A;  3A0V A;  3T4S A;  2UWX A;  5AQ9 A;  1IOU A;  2HDU A;  4JXG A;  3RTY A;  1MWR A;  5DTT A;  3F1O A;  4OPR A;  4MMN A;  2HJE A;  4QB8 A;  3NUL A;  1JVJ A;  2XLN A;  2J3T D;  4GS9 A;  3MFD A;  4JXW A;  1W63 M;  2JKT I;  3DTI A;  3A3E A;  4R1G A;  4Y2F A;  3HLC A;  1FCM A;  2V1B A;  4X25 A;  2WYX A;  2XGN A;  1VET A;  4X56 A;  4WLA A;  5EM1 A;  4DXC A;  2Y4A A;  2JKT M;  2D02 A;  1L3L A;  1A0K A;  3OLO A;  3NDG A;  2P08 A;  1PWG A;  3IWQ A;  1YLJ A;  3IWO A;  4MCW A;  1DJC A;  3PBS A;  3PXP A;  2BLS A;  3R4K A;  3OBF A;  1YLY A;  2W3F A;  3TE8 A;  3LR5 A;  2XRO A;  1SKF A;  3KSH A;  1XGJ A;  1CF0 A;  3SH7 A;  5FDH A;  3DTE A;  3BFE A;  1H5X A;  4G3V A;  1LLB A;  1CI8 A;  4EBP A;  1E4D A;  2BG1 A;  1BLP A;  1ESI A;  2VJW A;  2ZQ8 A;  3JYI A;  5TFQ A;  4GDB A;  4QWO A;  2IWB A;  4I39 A;  1E3U A;  5A92 A;  1K57 C;  3G6O A;  2QZ6 A;  3IS2 B;  2A24 A;  4GKU A;  3SW1 A;  2V1A A;  1OME A;  2RL3 A;  2Y2K A;  1UGU A;  4OP8 A;  1ONH A;  1K38 A;  4Y5F A;  4LCL A;  1XFQ A;  4BD0 A;  3NHQ A;  4S2P A;  1PZO A;  3JVU A;  1H3Q A;  2PYP A;  2EFU A;  4DE1 A;  2WKI A;  2OLU A;  5HAI A;  3D72 A;  3JVV A;  2VV6 A;  5TBM A;  4GN2 A;  4YOF A;  4E6X A;  3KO6 A;  1GSV A;  3W4P A;  4JGO A;  3GVB A;  1K25 A;  1GA9 A;  1NYM A;  3LIA A;  2VA0 A;  3MZF A;  1S1Z A;  1NXY A;  3F1N B;  2WGV A;  5M18 A;  1XGI A;  4KUO A;  2Y2H A;  5FQ9 A;  3RXW A;  3CUE A;  4KZ5 A;  1F98 A;  1OTB A;  4QJG A;  3UE0 A;  4LV0 A;  1TS6 A;  3TJZ C;  4HY8 A;  3IF6 A;  1N9N A;  4I3J A;  4K08 A;  4X69 A;  5HX9 A;  5L09 A;  5A8B A;  2UV0 E;  4GDN A;  4GS9 B;  2QHK A;  5CRF A;  2EWV A;  2Y2M A;  4FH4 A;  3W4Q A;  3HLE A;  3ZG0 A;  4MBK A;  5EOE A;  3L9K A;  4DMZ A;  4ZRR A;  3LR0 A;  4E3J A;  1LSW A;  5DJU A;  4MBF A;  1LSV A;  3FKW A;  5FQI A;  4ARZ A;  1VET B;  2X01 A;  1MY8 A;  2P74 A;  1SKO A;  3CPT A;  1CK3 A;  3P7N A;  4CLC C;  3UPO A;  3OOV A;  4R3A A;  1Z09 A;  4KZA A;  4PKY G;  4UA6 A;  2J9P A;  5CED A;  1OJG A;  2Q9N A;  4HH3 A;  2JKF A;  3ZYT A;  5TGF A;  2XA7 S;  4BLM A;  3QNB A;  5MC7 A;  2XD1 A;  5FEG A;  2PRF A;  2HP5 A;  2JBF A;  2YKH A;  3TG9 A;  4MN7 A;  2FFF B;  1KGE A;  5F83 A;  2V2F F;  3D9Y A;  3S7N A;  1KOU A;  5EVI D;  1MWT A;  2Y2L A;  2B5R A;  4JGR A;  4LV2 A;  3GSG A;  5F1F A;  1XJ6 A;  4C75 A;  2L4R A;  1C3B A;  2WKP A;  4I3A A;  2Y55 A;  3S22 A;  1Y54 A;  2A24 B;  2KLI A;  4B88 A;  4G3W A;  5F6A A;  1D06 A;  4Q0J A;  3ZG7 B;  3UPN A;  3MMH A;  3UE1 A;  3LEQ A;  2FZ0 A;  2Z6C A;  2VGJ A;  2R78 A;  3AGD A;  4N9K A;  1ERO A;  4I3I A;  3AGE A;  5J3W A;  4LRZ E;  3Q81 A;  3HUO A;  3E2K A;  4OKP A;  5AVF A;  5FQK A;  3F1P A;  1ERQ A;  1T1A A;  5JYP A;  2W1R A;  2ZJ9 A;  5HDC A;  5KMW A;  4Y15 A;  4E3M A;  4X55 A;  1OPX A;  2QYB A;  1MC0 A;  4OLD A;  1T1B A;  2GJ3 A;  2M7U A;  2W27 A;  3A3D A;  3IF6 B;  1L0E A;  4RX3 A;  4IBR A;  1E3U D;  3KYZ A;  3HLF A;  1H0M A;  5EE8 A;  1XP4 A;  1SDE A;  1FCN A;  2JN7 A;  3VFF A;  3ZVW A;  2HPB A;  2W0N A;  5M19 A;  3BFF A;  2C6W B;  1K54 A;  2DMW A;  1BYW A;  1YAX A;  5I94 A;  4EES A;  4WEJ A;  3UB8 A;  1NJ4 A;  1TVF A;  3UDX A;  3DTK A;  4ARZ B;  2J80 A;  4NG2 A;  3OPP A;  5IT5 A;  4NXB A;  4EBL A;  2Q9M A;  3CPT B;  2WGI A;  3CUE C;  2GX5 A;  3WS2 A;  1ERM A;  5GLA A;  2XA7 M;  3VSK A;  3ZHH A;  3IQA A;  3IF6 C;  1CQA A;  3H7W A;  4Y13 A;  1YQS A;  1T18 A;  4KEN B;  1M40 A;  1YLT A;  1S6R A;  3BLS A;  3ZCZ A;  1BLH A;  4YNR A;  3W2Z A;  2PHY A;  3BRM A;  1KDW A;  2Y91 A;  2W3E A;  3KX0 X;  1OTD A;  4S2J A;  2XEP A;  3PTE A;  1MZU A;  1ES4 A;  2EX8 A;  1FQG A;  2EXA A;  3E0Y A;  3UB5 P;  5FAO A;  5F82 A;  5KZH A;  1Y28 A;  1CI9 A;  1HVB A;  3QNC A;  1S66 L;  3WRT A;  1TS0 A;  1S1Y A;  2O9A A;  3MXQ A;  1G6O A;  4KZB A;  3HLW A;  4L9F A;  3TSG A;  3IH8 A;  2I72 A;  4WEL A;  5FA7 A;  1SCW A;  4BBT A;  4PM6 A;  3K3D A;  4DJ3 A;  3LFV A;  3V3R A;  4FCF A;  2WUQ A;  5TJJ A;  4I38 A;  5EEC A;  4LFU A;  2IWD A;  1K57 A;  2B02 A;  3UPP A;  2OAP 1;  3F1P B;  2WKQ A;  1SZV A;  1PYY A;  2ZC5 B;  2A3U A;  4NKP A;  1K55 A;  3M6H A;  4B93 A;  4X68 A;  3N4I A;  1I2S A;  1OJ5 A;  4X53 A;  2W3G A;  1XJ3 A;  5EFW A;  3JPU A;  4FTX A;  2WKR A;  3A0R A;  3C2W A;  3HRE A;  1Q2Q A;  1PWC A;  4BBV A;  3QP6 A;  1ACF A;  5EVL A;  1BZA A;  5U47 A;  3W4O A;  5HD3 A;  4NET A;  4X1L A;  3LIC A;  4QY6 A;  5DJT A;  3IT9 A;  1QME A;  1J9M A;  3LI9 A;  2P04 A;  3OZH A;  1KGF A;  3EQV A;  3GRJ A;  3NC8 A;  5KSH A;  5F5Y A;  2J3W A;  1TDG A;  4Y0T A;  4E3L A;  1DJB A;  3S7P A;  2XR0 A;  4JF4 A;  1OT6 A;  3QP2 A;  3T4L A;  1LL9 A;  1AXB A;  3VFH A;  4WM9 A;  3BW6 A;  4OLG A;  4ETZ A;  3IXB A;  1UWP X;  3ZG5 A;  2RCX A;  4HOI A;  3MF0 A;  2PYR A;  4JXS A;  1K54 C;  3S1Y A;  1W5D A;  1RCJ A;  1O7E A;  1HTZ A;  5G18 A;  5E2E A;  3K3C A;  4GB7 A;  1K6R A;  2QWS A;  4UEY A;  3D3O A;  2ZL1 A;  2OV5 A;  4EQ1 A;  4WUJ A;  1TS7 A;  2GNX A;  2HDQ A;  2ZC7 A;  5FSR A;  1G6A A;  1V9Z A;  1PWD A;  1K4E A;  3CMZ A;  1L0D A;  5IS1 A;  1IYO A;  3GV9 A;  2OWJ A;  3LYX A;  2ZC4 B;  1IEM A;  3A3F A;  1I2W A;  2VLG A;  3NI9 A;  2I9V A;  4FUW A;  4S2N A;  1YM1 A;  3IH9 A;  3PR6 A;  3LIB A;  3U2A A;  2PBD P;  4N1X A;  4BQM A;  3ITA A;  3VOL A;  3CI6 A; 
#chains in the Genus database with same CATH homology
 3LEQ A;  3T12 B;  3T1R A;  1CF0 A;  3CHW P;  1VEU A;  3MS6 A;  4X1L A;  3MSH A;  3L9K A;  1CJF A;  5FEF A;  3NEC A;  4D60 A;  2VK3 A;  1D1J A;  2ZL1 B;  4ESP A;  3UB5 P;  1VET B;  1Y4O A;  3T1Q B;  1SKO A;  3CPT A;  3KYE A;  3DAV A;  4QWO A;  2JKG A;  1FIK A;  1Z09 A;  5FDS A;  2V8F A;  2JKF A;  1PNE A;  1YPR A;  3LGO A;  5FEG A;  1PFL A;  2PRF A;  2E8J A;  3T1X A;  3NUL A;  2ACG A;  5EVE A;  3U4L P;  1VEU B;  3D9Y A;  1G5U A;  2BTF P;  4X1M A;  4X25 A;  1SZV A;  2ZL1 A;  1FIL A;  1VET A;  1F2K A;  1J3W A;  3CPT B;  5EM1 A;  1K0K A;  2HZ5 A;  3T1S A;  2PAV P;  1A0K A;  1PRQ A;  3L7H A;  2B95 A;  5EV0 A;  2V8C A;  1HLU P;  1CQA A;  4FTX A;  4FUW A;  5EM0 A;  1AWI A;  2PBD P;  1SKO B;  1ACF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...