2V8CA

Mouse profilin iia in complex with the proline-rich domain of vasp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords PROFILIN-2
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2v8cA00
2V8CA 1G5UA 1ACFA 3LGOA 3MS6A 1J3WA 3T1QB 3NULA 5EVEA 4D60A 3L9KA 5FEGA 2PAVP 3MSHA 2JKGA 2ACGA 4X1LA 1SKOB 4X1MA 1VETA 1F2KA 1YPRA 3LEQA 2ZL1B 1AWIA 3T1XA 3CPTA 1D1JA 1SZVA 3UB5P 3NECA 3DAVA 1PNEA 2ZL1A 1VETB 2JKFA 4ESPA 3L7HA 1SKOA 1CJFA 1K0KA 1CF0A 5EM1A 3D9YA 4QWOA 1FIKA 1A0KA 1Y4OA 1Z09A 2PRFA 4FTXA 2BTFP 2HZ5A 2PBDP 1VEUB 5FDSA 3T1SA 4X25A 3T1RA 1PRQA 1HLUP 4FUWA 2B95A 5EV0A 3T12B 3U4LP 5FEFA 3KYEA 1CQAA 1FILA 3CPTB 2E8JA 1PFLA 5EM0A 2VK3A 3CHWP 1VEUA 2V8FA
chains in the Genus database with same CATH superfamily
2O9AA 4Y5FA 1N9NA 1LI0A 1FQGA 4KG2A 3SS4A 5FI7A 4B88A 3H82A 1ESIA 1J9MA 2Q0OA 4Q0IA 3R4KA 3LY4A 4B4ZA 2MJ6A 3EEHA 4RX2A 3CITA 2HDQA 3SH8A 3V50A 5FEGA 1YLWA 4BBVA 3UE1A 1EI5A 1YPRA 3OPLA 5DVAA 3KX0X 3O87A 3HLDA 3D9YA 3P98A 3RJUA 3C8CA 3T50A 2W27A 4M3KA 1MY8A 1WYCA 2V2FF 3BM6A 1YQSA 4OOMA 5DFYA 2ZQ7A 2WKIA 2R9WA 5CTMA 2JKRM 1NJ4A 4BL2A 3Q7VA 4GS9A 4JXWA 5HSQA 1FCMA 3E98A 5FQIA 3IHBA 1FCNA 4PKYA 3ZGAB 4NXBA 5DJTA 3PBRA 1E4DA 1VEUB 3BJNA 2WGIA 4Q8IA 2Y2LA 2H0YA 2O99A 2J80A 1NWZA 2WKQA 4F3LA 1LI9A 3KYQA 3ZG0A 2ACGA 4O01A 3GRJA 4WN5A 4LV0A 2ZL1A 3GR2A 4JGOA 4H6JA 3HBRA 4ME4A 3MXRA 1DJBA 2P9VA 3K3DA 3EGDC 3T4QA 1H0MA 4N9KA 2DMWA 4MNRA 5CX7A 1E3UA 2HP6A 4MBHA 3GDIA 3NJAA 2Y2MA 5EFWA 2JCHA 2PD7A 2YKHA 1SDNA 4UAAA 1JWPA 1D06A 3IBJA 4E3JA 4JKTA 5M19A 3FKVA 1PWDA 4ZJ3A 4BLMA 3MQOA 4KZAA 3FV7A 3CI6A 1YMSA 5GHZA 1LL9A 3T4OA 2WAEA 3EGXC 1XJ6A 2I72A 3LIFA 4HEFA 2P08A 2PHYA 4IBRA 4P6ZS 3BEBA 5I5LA 3FPVA 3LCEA 3RTYA 3UB9A 3FG8A 3OCNA 2DNSA 3QHYA 5F1FA 1HVBA 3NOTC 1D1JA 1RGYA 3AGFA 3JVVA 5CEBA 4I3IA 2J3TD 1YAXA 1IKGA 3UMEA 4CLCC 4ETXA 3G4PA 1ES4A 2EXAA 3IH9A 1EROA 2CMNA 4ID4A 4WUJA 5EOEA 5J4EA 1LL8A 3ISGA 5FQJA 3NI9A 4XUXA 4UA6A 3UDXA 2XGNA 4E6XA 1FR1A 2EX8A 5E2EA 4NETA 3LIAA 3BRMA 2L0WA 1FILA 3O88A 3CHWP 4GW9A 4NEED 4E3NA 2OLUA 2V9AA 3MBZA 1IOUA 4BD0A 4GB7A 3MFXA 4EUVA 4WELA 4YFMA 3NY4A 2LB5A 5IHVA 1MZUA 1ES2A 5LBRA 2WGWB 2CC1A 2ZMVA 3O5YA 2Z2MB 3T4KA 5HARA 3IXBA 2HDSA 4Z9QA 5EPHA 4Y7PA 1YT4A 4QU3A 1N9LA 1S66L 3BYDA 2O0YA 5EVIC 1OJ5A 3GECA 4S2PA 4WBGA 1S6RA 3A0VA 3M2JA 4K08A 5HAIA 2XD5A 3CPTA 3T4SA 3GSGA 1BZAA 1VB6A 4JXGA 1ODVA 1V9ZA 1FSWA 2Y2KA 5KMWA 1DJCA 2EX6A 4E3KA 1E3UD 5TFQA 1STZA 1S1YA 2GDNA 4O8GA 4CJNA 2UV0E 3HVFA 2G7UA 2PU2A 2K31A 2HDRA 3E4QA 1MBLA 3ZNTA 1GSVA 2WADA 4PHTA 3NOUC 1FCOA 1YLPA 1MWUA 3E2KA 1JWZA 1T1BA 4KUOA 3C5AA 4NG2A 3MF0A 3MJQA 3PXPA 1P97A 3LO7A 4Y2FA 5G18A 2Y55A 2WYXA 1ZG4A 4EWFA 2Y2QA 1H8YA 3MQQA 3W4QA 4BJPA 1V9YA 2JBFA 2ZLYA 3WS2A 2ZC3B 5IU1A 1ZKJA 1L3LA 4NXEA 1I2SA 3BY9A 4DE0A 2PU4A 1TDLA 3DTMA 4X1MA 4EERA 3OLOA 3LEQA 3NCKA 4BQMA 3D72A 3ZQ5A 5TGFA 2ZD8A 3TJZC 1MKMA 2HJEA 4KZ3A 3HL9A 1OT9A 1K54A 3TW8A 1JVJA 1O7EA 2L4RA 5DTTA 1CEGA 4D60A 4XT2B 1NYYA 4KZ8A 4OQIA 3SH9A 1F98A 2W0NA 3H82B 3GVBA 3OZHA 4S2LA 3D4FA 2HZ5A 4PAUA 4P85A 2VGKA 5EVIB 1EW0A 3UMDA 1AXBA 3EQUA 1C3BA 1UWNX 4I3AA 4FD8A 4R3AA 3N8SA 2QKPA 2PT7A 4ETZA 3I7JA 1KVMA 1NXYA 2O9BA 3B3XA 3LIBA 4F3LB 3BFDA 4Y17A 4G3VA 1LT0A 4L9EA 3UDIA 1VHMA 2PAVP 2B02A 5GHYA 1DP8A 4HNBA 4I38A 5CGSA 3A0SA 3P01A 3HREA 4KQOA 1BYWA 3V39A 4MDZA 3V3RA 4EBPA 5HWVA 5GHXA 2PR6A 1FSYA 4DE3A 4O0PA 3E4PA 4PM8A 3ZVTA 1GHIA 4HJ3A 3FYZA 3V3SA 4NXGA 3NIAA 1K38A 3MZDA 2W3HA 4YWZA 4PKYG 2V0WA 1GA0A 3UB7A 4QWOA 3MMHA 3PR6A 3G2YA 2XR0A 3FPWA 3OPPA 1TS8A 3A3FA 4OQ0A 4UQIM 1IELA 5FI6A 3B42A 5CGXA 3MSHA 4IBXA 5HAPA 4GNUA 1VM1A 4KZBA 4X69A 1PIOA 1OTAA 4JXSA 5FQ9A 4WM9A 1JTGA 3IWIA 3IX3A 2G2UA 1PWGA 1Z6FA 4Y13A 1L0FA 1N9OA 2W3FA 4LV3A 1QMFA 2FH5A 3ZCZA 4L0LA 2ZQDA 3A3JA 2EXBA 2Y4AA 3ULFA 3JPUA 3HLCA 1KDWA 4FTXA 2BTFP 3A3DA 4D2OA 2Y2HA 2AVXA 3H7WA 2ZMFA 1X0OA 1SKFA 4RQ9A 1GCEA 1NYMA 3NDEA 1G5UA 4KZ4A 4QD4A 5HW3A 3HUOA 2Y2GA 3N7WA 3RFBA 2EFUA 5HX9A 1VETB 4BD1A 2A3UA 3NOPC 4WZ5A 3IF6B 1S0WA 2BG1A 2P7JA 1BTLA 2VGLS 3HLFA 2R78A 2ZJ9A 3QP4A 1MC0A 1T18A 4GJ4A 1YLZA 1HZOA 4P87A 2FZ0A 3G2ZA 2WK0A 1JTDA 2QMIA 3UB8A 4B93A 1LSWA 3BFGA 4S2IA 1ZHHB 1S4SA 3T1XA 3CAXA 3G35A 4C75A 3A0RA 1AWIA 2KOIA 5F83A 2EX9A 3HCYA 1PI5A 2H10A 4LENA 1SZVA 4E6WA 4PMAA 3IWQA 3QP8A 4IUKA 3TE8A 4CPKA 3WS5A 1NRJA 5AJGA 3U2AA 3SZTA 1G28A 3F1OA 2XA7S 3M6BA 2EA9A 3N6IA 2P74A 1Y4OA 1GHMA 5FAQA 1W8YA 1O07A 1DP9A 3F1NB 4HJ4A 3FWLA 4CLCE 1K55C 4CQHA 1L0DA 1VEUA 4KENB 2ZOHA 4L9FA 1MKIA 2QWSA 5EUAA 5A93A 5DF9A 3NULA 4C6YA 4DKIA 3OOVA 2PD8A 4X1LA 2ZC4B 3M2KA 3LR4A 2Z6DA 3H7WB 4MBFA 2Y79A 2VGJA 2JKTM 1P9WA 4IHQA 3RH8B 4N1HA 3HLBA 2OOLA 2Y2IA 1UWPX 2D02A 2P9VB 2W3GA 2XFTA 2E8IA 4ZTKA 3ITAA 4BBTA 5L09A 4U0TA 4F94A 2J7VA 4U3TA 3N4IA 4YNRA 4E3MA 2XA7M 1Z09A 1OTBA 4HP4A 5FQMA 3Q7ZA 3ZVWA 3LFVA 1OMEA 1E25A 3OPRA 1BULA 5CGWA 5J7EA 2PDRA 4K91A 4CLCB 4OPQA 5E43A 2W1TB 1PW8A 4OOYA 3CUEC 2I9VA 2QZ6A 1VETA 1F2KA 2V1ZA 3A3IA 1RP5A 5M1AA 3K3CA 3IF6A 4DMZA 5EM1A 3KSFA 3DTKA 1T1CA 4EV4A 4FSFA 4Y0UA 5JYPA 1N9BA 1RCJA 4KQDA 2NUTC 3B33A 3DWZA 5I94A 4QPRA 4HI4A 1IFQA 3E0YA 2HV1A 4HIAA 2EFXA 4LV1A 4ZJ2A 3Q07A 1JWVA 3WRTA 2PRFA 4GLQA 4ZRRA 5HZHA 2Y2JA 3LR0A 3AGDA 1CEFA 5F1GA 5F68A 2IWDA 5U47A 1I2WA 1FOFA 2VLGA 3HJIA 1HTZA 3HLWA 4AFIA 3F1PA 3AGEA 2BASA 3SS5A 3QP6A 1JNUA 4MCWA 1K57C 5KSHA 3F1NA 1T19A 3NHQA 2HJ9C 2PBDP 2X01A 3CLOA 3PBOA 1ONGA 1MWSA 4I5SA 3BY8A 2WZXA 5FATA 3HLEA 2FFYA 5HL1A 1W7FA 1IYOA 2XEPA 3H9WA 1KGEA 2DRWA 1K54C 4OLGA 4ZAMA 2V1AA 4NK3A 2VV6A 5EM0A 1YM1A 1WYBA 5AQ7A 1K25A 1SKOB 4GOGA 2QHKA 5L2FA 3F1PB 4UQIS 3IBRA 2Y2PA 1D7EA 4EESA 3LR5A 3ZG8B 1SHVA 1DY6A 3UO9A 1YSPA 3U4LP 3VE4A 3CUEA 4EW7A 5GL9A 2OSUA 4NXFA 1NRFA 4H8RA 4WYYA 4WF0A 4X55A 2Y59A 4ZBEA 3C30A 2LB9A 1N4OA 2GZAA 5CHJA 4N92A 4MN6A 3JVUA 3IX8A 1K57A 2WGWA 1U60A 4ZJ1A 2JC7A 1TS6A 1XXMA 1XGIA 2V0UA 3IT9A 3ZG7B 1Q2PA 1LHYA 4OQHA 1Y54A 1L2SA 3LY3A 5DKKA 1IYSA 3A3EA 2OWJA 3Q7VB 5C5KA 1PW1A 2XSSA 3WRZA 4DRTA 4LCLA 4DJ2A 1XJ3A 2INWA 2K2NA 1PYYA 4S2OA 1DP6A 4WLAA 4ARZA 3ZG9B 4S2JA 5KZHA 4IEDA 4GN2A 4Y15A 5L07A 4Q0JA 4HOIA 3IXDA 4YOFA 3S7OA 3PAGA 4K0WA 1P9RA 4HBTA 1G6OA 1S1ZA 4RX3A 1GA9A 4P6BA 4R3BA 4BMWA 2V8FA 4Q0HA 3UPPA 5HD3A 4Y3IA 3VOYA 4FOFA 1ONHA 1SCWA 2V1BA 2Y2NA 2XLNA 1EWZA 4NKPA 4LGWA 3OCLA 4GKUA 1W5DA 1ES3A 3W4OA 5F6AA 4WMCA 4EUZA 1HLUP 3G6OA 3CPTB 5FAPA 4OP5A 4OP8A 1KGGA 2Z2LB 5CERA 4EQ1A 4EBLA 4LRZE 4Y0OA 5M18A 2H5SA 4KG6A 2A2LA 4KQRA 2HGVA 5KSCA 3R7WA 4JF5A 2XROA 2J9PA 4IVIA 2Y2OA 4WZ5C 2GNXA 1BLCA 3ZFZA 4KQQA 2K7SA 4X68A 1NLYA 5EVEA 1PWCA 4R4RA 3LIDA 4KUKA 1ES5A 1PNEA 5FQQA 3DTIA 5EECA 4HJ6A 4GZBA 3T1SA 5AVFA 1NY0A 5D3OA 4LV2A 4EETB 3B47A 1DRMA 3MS6A 3NBLA 1TF1A 3VSLA 2VV7A 3IXGA 5GLCA 4DDSA 2RL3A 3S22A 3PBNA 4OQGA 1YKDA 4HH3A 2VJWA 3UDFA 1YMXA 4UEYA 3WS1A 3ZG5A 3HUNA 3DTEA 5FA7A 3IF5A 5IS1A 2QPNA 3VP3A 3D3OA 1K4EA 5FDHA 4DE2A 3WS4A 4LRYC 2OAQ1 3PTEA 2JE5A 3PYPA 4QY5A 3IH8A 1XGJA 3IF6C 2EWWA 2ZOIA 2BLSA 1G68A 1BLHA 3LIEA 3EQVA 2JKGA 1BT5A 2ZM8A 3UB5P 3CZDA 1XKZA 4OONA 3LI9A 3BFEA 2PYRA 4FH2A 1LSXA 2OV5A 5F69A 4KG5A 4R3JA 5FQKA 5EV0A 4I39A 1WA9A 2PYPA 1XFQA 1OTDA 1PZOA 1KGFA 4HBUA 4IVKA 1W63Q 4GD8A 4DXCA 4OOLA 4E3IA 3VOLA 2VX8A 4MBKA 4QJGA 2GX5A 3KSHA 1K56A 4KZ9A 3WWXA 3IQAA 1I5QA 4M4XA 1OT6A 3LEZA 3IS2A 3T1QB 3CMZA 2VA0A 4Z1WA 3N8RA 4E3OA 2W3DA 1L0GA 4WL9A 3G34A 2RCXA 3FZCA 4WZ4A 1XA1A 2D01A 3S7NA 2W3EA 2VGLM 2ZC5B 3V67A 4HHDA 2WKPA 2WUQA 3QP1A 3UPNA 4G3WA 3G31A 1VQQA 2HPBA 2PR5A 3HUMA 5FI2A 5KIZA 1TEMA 5TBMB 5HDDA 3K2NA 1ALQA 4X25A 5HDCA 1KE0A 1YLYA 2M7UA 4GS9B 4R6LA 1F9IA 5AQBA 5CRFA 4EEUA 4ZDXA 4EU0A 2Z6CA 2ZQAA 1BUEA 2X71A 4KZ6A 5CXWA 2Q9NA 2XF3A 3BLSA 3G30A 5K5BA 3CG5A 1MPLA 3PHYA 2E8JA 2ZMAA 5A91A 3C7VA 3UNWA 2Q9MA 1H8ZA 2L1MA 4PPRA 4X56A 4CLCD 4HP9A 4LRXC 4O7DA 4EEPA 3BFFA 3E4OA 4IJGA 3CWFA 2VK3A 4C3QA 4G3KA 2XK1A 3SW1A 3UE3A 4JGPA 5FAOA 5F82A 4I3JA 3SOIA 3OBFA 2WKEA 5DF7A 4R1GA 4UHUA 1BSGA 2Y91A 1MWTA 4DE1A 2M7VA 4MEZA 1GHPA 1BLSA 3BLMA 3N8LA 3C38A 5A8BA 3SS3A 5G4ZA 4HQAA 4OPZA 1M6KA 2J9OA 5DTKA 1BLPA 2O9CA 3MKFA 3DAVA 3BQAA 3VSKA 3DBAA 4EQIA 4GDBA 5DTSA 4X6TA 3NC8A 2IA2A 5FSRA 3QNCA 3DWKA 2R9XA 1PI4A 1IYQA 5E2GA 4S2NC 4OH0A 1K6SA 4BBUA 5CEDA 3M6HA 4P6ZM 1NZOA 3Q81A 4IUHA 3Q1FA 2XD1A 5AQ9A 1YSQA 1M40A 3S1YA 1IYPA 2ZQ9A 5CHMA 1XJ4A 2WAFA 3BFCA 1CF0A 3HLGA 2OWHA 3T1RA 1LLBA 3E2LA 2QJ7A 3W8KA 2A24B 3C7UA 3WS0A 4MMNA 2J3WA 1S67L 3VFHA 1ZTUA 4XXRA 3L7HA 1FIKA 2ZC7A 3T12B 4GCZA 3EOIA 3TG9A 2JN7A 3IWOA 3RXXA 1K55A 2ZQ8A 3R7WB 2XQZA 1XP4A 2QYBA 2HP9A 2QJ5A 3UE6A 4A5RA 5MC7A 2JKRI 5DKLA 1XPBA 3TOIA 2ZM0A 4CLCA 4JLFA 4B4XA 3VP0A 5G4YA 1TDGA 3S7PA 3BW6A 4K0XA 4WEJA 5A90A 3C2WA 4UA9A 1W8QA 2IWBA 5DF8A 3T4TA 1RGZA 4QB8A 5HL6A 4KZ5A 4RA7A 3UE0A 4N1XA 2EX2A 2KX6A 1IEMA 4R23A 4UA7A 2GJ3A 3LICA 3RXWA 5HFOA 1MXOA 1XA7A 5HPFA 5J3WA 4PM5A 4BL3A 2ZM2A 1KOUA 1H8MA 3OC2A 2HF6A 2X02A 2UWXA 4HESA 1S4RA 2HDUA 4QY6A 3UPOA 3QP5A 5GLAA 1OTEA 2W1RA 4DXBA 1TVFA 5AVEA 4FCFA 4PM7A 5GLDA 5FL3A 4OVDA 4R70A 4OPRA 3EEAA 3EWKA 2C5WB 4GHIB 1NZUA 4JXVA 1P0ZA 3T4LA 3VOZA 2J8YA 3NECA 4S2MA 4S2NA 2YKFA 4LCMA 2J3TC 3F1OB 3IXHA 1L0EA 4MN5A 4B9OA 3LYXA 1PRQA 2KDKA 5E2HA 5EVLA 5DFXA 3P7NA 5F5YA 1K4FA 2WKRA 3GTCA 5AQAA 4OPYA 1IKIA 3CJMA 3MZFA 3G32A 1NLZA 1CI8A 3W2ZA 2JKFA 4LLOB 1W63M 1SKOA 3PBTA 5FDSA 4OKPA 1K6RA 2B5RA 3IS2B 5HWWA 3BWLA 3GV9A 4KZ7A 1PFLA 1GSWA 5EE8A 2V8CA 3TRCA 3LGOA 2FFFB 1ESUA 1F5MA 1OJGA 5HAQA 2VKSA 3SH7A 4OLDA 2ZL1B 2ZC6B 4JGRA 4WMCD 1CJFA 2H28A 5FASA 5TBMA 3O86A 3T4JA 2OLVA 4FUWA 3LR3A 3UY6A 1Q2QA 3GQZA 1DJAA 3ZHHA 3PBSA 4YINA 5EVIA 4WEKA 5HDSA 5E2FA 2C6WB 4LFUA 2W1TA 1HD8A 1WE4A 4GD6A 4ARZB 5L10A 3HJKA 3KSGA 4N9LA 2JKTI 3V5MA 4GHIA 5BOHA 3MR0A 4II7A 3P09A 4P0MA 1TS7A 5TR7A 4MLLA 1ZG6A 1UGUA 1A0KA 5DJUA 2A49A 3LI8A 4Y0TA 1CK3A 3W4PA 4EXOA 4HH2A 3C4PA 4DJ3A 2JHEA 1J3WA 1K56D 4XT2A 3PBQA 1XX2A 2OAP1 1Y28A 2IWCA 3MKEA 2Y8HA 3ZYTA 1K0KA 2NUPC 5HPIA 3KO6A 2VV8A 4RYEA 1ERMA 2WGVA 3MXQA 2M1CA 1OPXA 4BENA 4HY8A 4QHCA 3IX4A 2XFSA 3VP4A 4BWIA 3KSIA 4GDNA 2A24A 5IT5A 3JYIA 2DCFA 2VEAA 2H0TA 3NDGA 1ZC2A 5EVID 4JPMA 3MQ0A 3S7QA 2WZZA 4R4SA 2KLIA 1MWRA 4S2KA 1SDEA 3QP2A 1TS0A 3C4OA 3IHAA 3S4XA 1KVLA 2P04A 4FH4A 4U0XA 1T1AA 4XUZA 1ACFA 2ZBBA 5CTNA 5HD5A 3ITBA 3MXSA 4DN0A 4X53A 3OPHA 1KE3A 1LL5A 1H5XA 1QMEA 3BECA 5JYOA 4PM9A 1KE4A 1W79A 3FC7A 4JBFA 4H6JB 1PZPA 4JF4A 4E04A 1GSXA 3KYEA 3VP2A 3VMAA 5HWTA 1YLJA 4DF6A 2VZWA 2XRNA 3ICYA 3L9KA 3LUQA 4LPZA 1LSVA 1TD5A 2B18A 4E3LA 3PAEA 3QNBA 3VE3A 3MFDA 4EBNA 5L8MA 4ESPA 2WKHA 4RVAA 5EOOA 2XH9A 4JF6A 5J8XA 1OTIA 3VFFA 5TJJA 5A92A 5CHUA 1KDSA 3O3VA 3Q82A 5FEFA 5GLBA 4DDYA 2PBYA 1YLTA 1XJ2A 3VV4A 3GMWA 2XDMA 3UN7A 1XFNA 1ERQA 2EWVA 1G6AA 1CI9A 3BQ8A 3VP1A 2HP5A 4L9GA 2V20A 3ZNYA 2ZQCA 5CECA 3MZEA 1FR6A 4JGQA 3TSGA 1H3QA 3UB6A 3KYZA 2G2WA 3FKWA 4MN7A 4R0QA 3DW0A 2B95A 3ZDJA 4R38A 1CQAA 4PM6A
chains in the Genus database with same CATH topology
2V8CA 1G5UA 1ACFA 3LGOA 3MS6A 1J3WA 3T1QB 3NULA 5EVEA 4D60A 3L9KA 5FEGA 2PAVP 3MSHA 2JKGA 2ACGA 4X1LA 1SKOB 4X1MA 1VETA 1F2KA 1YPRA 3LEQA 2ZL1B 1AWIA 3T1XA 3CPTA 1D1JA 1SZVA 3UB5P 3NECA 3DAVA 1PNEA 2ZL1A 1VETB 2JKFA 4ESPA 3L7HA 1SKOA 1CJFA 1K0KA 1CF0A 5EM1A 3D9YA 4QWOA 1FIKA 1A0KA 1Y4OA 1Z09A 2PRFA 4FTXA 2BTFP 2HZ5A 2PBDP 1VEUB 5FDSA 3T1SA 4X25A 3T1RA 1PRQA 1HLUP 4FUWA 2B95A 5EV0A 3T12B 3U4LP 5FEFA 3KYEA 1CQAA 1FILA 3CPTB 2E8JA 1PFLA 5EM0A 2VK3A 3CHWP 1VEUA 2V8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8C A;  1G5U A;  1ACF A;  3LGO A;  3MS6 A;  1J3W A;  3T1Q B;  3NUL A;  5EVE A;  4D60 A;  3L9K A;  5FEG A;  2PAV P;  3MSH A;  2JKG A;  2ACG A;  4X1L A;  1SKO B;  4X1M A;  1VET A;  1F2K A;  1YPR A;  3LEQ A;  2ZL1 B;  1AWI A;  3T1X A;  3CPT A;  1D1J A;  1SZV A;  3UB5 P;  3NEC A;  3DAV A;  1PNE A;  2ZL1 A;  1VET B;  2JKF A;  4ESP A;  3L7H A;  1SKO A;  1CJF A;  1K0K A;  1CF0 A;  5EM1 A;  3D9Y A;  4QWO A;  1FIK A;  1A0K A;  1Y4O A;  1Z09 A;  2PRF A;  4FTX A;  2BTF P;  2HZ5 A;  2PBD P;  1VEU B;  5FDS A;  3T1S A;  4X25 A;  3T1R A;  1PRQ A;  1HLU P;  4FUW A;  2B95 A;  5EV0 A;  3T12 B;  3U4L P;  5FEF A;  3KYE A;  1CQA A;  1FIL A;  3CPT B;  2E8J A;  1PFL A;  5EM0 A;  2VK3 A;  3CHW P;  1VEU A;  2V8F A; 
#chains in the Genus database with same CATH topology
 2O9A A;  4Y5F A;  1N9N A;  1LI0 A;  1FQG A;  4KG2 A;  3SS4 A;  5FI7 A;  4B88 A;  3H82 A;  1ESI A;  1J9M A;  2Q0O A;  4Q0I A;  3R4K A;  3LY4 A;  4B4Z A;  2MJ6 A;  3EEH A;  4RX2 A;  3CIT A;  2HDQ A;  3SH8 A;  3V50 A;  5FEG A;  1YLW A;  4BBV A;  3UE1 A;  1EI5 A;  1YPR A;  3OPL A;  5DVA A;  3KX0 X;  3O87 A;  3HLD A;  3D9Y A;  3P98 A;  3RJU A;  3C8C A;  3T50 A;  2W27 A;  4M3K A;  1MY8 A;  1WYC A;  2V2F F;  3BM6 A;  1YQS A;  4OOM A;  5DFY A;  2ZQ7 A;  2WKI A;  2R9W A;  5CTM A;  2JKR M;  1NJ4 A;  4BL2 A;  3Q7V A;  4GS9 A;  4JXW A;  5HSQ A;  1FCM A;  3E98 A;  5FQI A;  3IHB A;  1FCN A;  4PKY A;  3ZGA B;  4NXB A;  5DJT A;  3PBR A;  1E4D A;  1VEU B;  3BJN A;  2WGI A;  4Q8I A;  2Y2L A;  2H0Y A;  2O99 A;  2J80 A;  1NWZ A;  2WKQ A;  4F3L A;  1LI9 A;  3KYQ A;  3ZG0 A;  2ACG A;  4O01 A;  3GRJ A;  4WN5 A;  4LV0 A;  2ZL1 A;  3GR2 A;  4JGO A;  4H6J A;  3HBR A;  4ME4 A;  3MXR A;  1DJB A;  2P9V A;  3K3D A;  3EGD C;  3T4Q A;  1H0M A;  4N9K A;  2DMW A;  4MNR A;  5CX7 A;  1E3U A;  2HP6 A;  4MBH A;  3GDI A;  3NJA A;  2Y2M A;  5EFW A;  2JCH A;  2PD7 A;  2YKH A;  1SDN A;  4UAA A;  1JWP A;  1D06 A;  3IBJ A;  4E3J A;  4JKT A;  5M19 A;  3FKV A;  1PWD A;  4ZJ3 A;  4BLM A;  3MQO A;  4KZA A;  3FV7 A;  3CI6 A;  1YMS A;  5GHZ A;  1LL9 A;  3T4O A;  2WAE A;  3EGX C;  1XJ6 A;  2I72 A;  3LIF A;  4HEF A;  2P08 A;  2PHY A;  4IBR A;  4P6Z S;  3BEB A;  5I5L A;  3FPV A;  3LCE A;  3RTY A;  3UB9 A;  3FG8 A;  3OCN A;  2DNS A;  3QHY A;  5F1F A;  1HVB A;  3NOT C;  1D1J A;  1RGY A;  3AGF A;  3JVV A;  5CEB A;  4I3I A;  2J3T D;  1YAX A;  1IKG A;  3UME A;  4CLC C;  4ETX A;  3G4P A;  1ES4 A;  2EXA A;  3IH9 A;  1ERO A;  2CMN A;  4ID4 A;  4WUJ A;  5EOE A;  5J4E A;  1LL8 A;  3ISG A;  5FQJ A;  3NI9 A;  4XUX A;  4UA6 A;  3UDX A;  2XGN A;  4E6X A;  1FR1 A;  2EX8 A;  5E2E A;  4NET A;  3LIA A;  3BRM A;  2L0W A;  1FIL A;  3O88 A;  3CHW P;  4GW9 A;  4NEE D;  4E3N A;  2OLU A;  2V9A A;  3MBZ A;  1IOU A;  4BD0 A;  4GB7 A;  3MFX A;  4EUV A;  4WEL A;  4YFM A;  3NY4 A;  2LB5 A;  5IHV A;  1MZU A;  1ES2 A;  5LBR A;  2WGW B;  2CC1 A;  2ZMV A;  3O5Y A;  2Z2M B;  3T4K A;  5HAR A;  3IXB A;  2HDS A;  4Z9Q A;  5EPH A;  4Y7P A;  1YT4 A;  4QU3 A;  1N9L A;  1S66 L;  3BYD A;  2O0Y A;  5EVI C;  1OJ5 A;  3GEC A;  4S2P A;  4WBG A;  1S6R A;  3A0V A;  3M2J A;  4K08 A;  5HAI A;  2XD5 A;  3CPT A;  3T4S A;  3GSG A;  1BZA A;  1VB6 A;  4JXG A;  1ODV A;  1V9Z A;  1FSW A;  2Y2K A;  5KMW A;  1DJC A;  2EX6 A;  4E3K A;  1E3U D;  5TFQ A;  1STZ A;  1S1Y A;  2GDN A;  4O8G A;  4CJN A;  2UV0 E;  3HVF A;  2G7U A;  2PU2 A;  2K31 A;  2HDR A;  3E4Q A;  1MBL A;  3ZNT A;  1GSV A;  2WAD A;  4PHT A;  3NOU C;  1FCO A;  1YLP A;  1MWU A;  3E2K A;  1JWZ A;  1T1B A;  4KUO A;  3C5A A;  4NG2 A;  3MF0 A;  3MJQ A;  3PXP A;  1P97 A;  3LO7 A;  4Y2F A;  5G18 A;  2Y55 A;  2WYX A;  1ZG4 A;  4EWF A;  2Y2Q A;  1H8Y A;  3MQQ A;  3W4Q A;  4BJP A;  1V9Y A;  2JBF A;  2ZLY A;  3WS2 A;  2ZC3 B;  5IU1 A;  1ZKJ A;  1L3L A;  4NXE A;  1I2S A;  3BY9 A;  4DE0 A;  2PU4 A;  1TDL A;  3DTM A;  4X1M A;  4EER A;  3OLO A;  3LEQ A;  3NCK A;  4BQM A;  3D72 A;  3ZQ5 A;  5TGF A;  2ZD8 A;  3TJZ C;  1MKM A;  2HJE A;  4KZ3 A;  3HL9 A;  1OT9 A;  1K54 A;  3TW8 A;  1JVJ A;  1O7E A;  2L4R A;  5DTT A;  1CEG A;  4D60 A;  4XT2 B;  1NYY A;  4KZ8 A;  4OQI A;  3SH9 A;  1F98 A;  2W0N A;  3H82 B;  3GVB A;  3OZH A;  4S2L A;  3D4F A;  2HZ5 A;  4PAU A;  4P85 A;  2VGK A;  5EVI B;  1EW0 A;  3UMD A;  1AXB A;  3EQU A;  1C3B A;  1UWN X;  4I3A A;  4FD8 A;  4R3A A;  3N8S A;  2QKP A;  2PT7 A;  4ETZ A;  3I7J A;  1KVM A;  1NXY A;  2O9B A;  3B3X A;  3LIB A;  4F3L B;  3BFD A;  4Y17 A;  4G3V A;  1LT0 A;  4L9E A;  3UDI A;  1VHM A;  2PAV P;  2B02 A;  5GHY A;  1DP8 A;  4HNB A;  4I38 A;  5CGS A;  3A0S A;  3P01 A;  3HRE A;  4KQO A;  1BYW A;  3V39 A;  4MDZ A;  3V3R A;  4EBP A;  5HWV A;  5GHX A;  2PR6 A;  1FSY A;  4DE3 A;  4O0P A;  3E4P A;  4PM8 A;  3ZVT A;  1GHI A;  4HJ3 A;  3FYZ A;  3V3S A;  4NXG A;  3NIA A;  1K38 A;  3MZD A;  2W3H A;  4YWZ A;  4PKY G;  2V0W A;  1GA0 A;  3UB7 A;  4QWO A;  3MMH A;  3PR6 A;  3G2Y A;  2XR0 A;  3FPW A;  3OPP A;  1TS8 A;  3A3F A;  4OQ0 A;  4UQI M;  1IEL A;  5FI6 A;  3B42 A;  5CGX A;  3MSH A;  4IBX A;  5HAP A;  4GNU A;  1VM1 A;  4KZB A;  4X69 A;  1PIO A;  1OTA A;  4JXS A;  5FQ9 A;  4WM9 A;  1JTG A;  3IWI A;  3IX3 A;  2G2U A;  1PWG A;  1Z6F A;  4Y13 A;  1L0F A;  1N9O A;  2W3F A;  4LV3 A;  1QMF A;  2FH5 A;  3ZCZ A;  4L0L A;  2ZQD A;  3A3J A;  2EXB A;  2Y4A A;  3ULF A;  3JPU A;  3HLC A;  1KDW A;  4FTX A;  2BTF P;  3A3D A;  4D2O A;  2Y2H A;  2AVX A;  3H7W A;  2ZMF A;  1X0O A;  1SKF A;  4RQ9 A;  1GCE A;  1NYM A;  3NDE A;  1G5U A;  4KZ4 A;  4QD4 A;  5HW3 A;  3HUO A;  2Y2G A;  3N7W A;  3RFB A;  2EFU A;  5HX9 A;  1VET B;  4BD1 A;  2A3U A;  3NOP C;  4WZ5 A;  3IF6 B;  1S0W A;  2BG1 A;  2P7J A;  1BTL A;  2VGL S;  3HLF A;  2R78 A;  2ZJ9 A;  3QP4 A;  1MC0 A;  1T18 A;  4GJ4 A;  1YLZ A;  1HZO A;  4P87 A;  2FZ0 A;  3G2Z A;  2WK0 A;  1JTD A;  2QMI A;  3UB8 A;  4B93 A;  1LSW A;  3BFG A;  4S2I A;  1ZHH B;  1S4S A;  3T1X A;  3CAX A;  3G35 A;  4C75 A;  3A0R A;  1AWI A;  2KOI A;  5F83 A;  2EX9 A;  3HCY A;  1PI5 A;  2H10 A;  4LEN A;  1SZV A;  4E6W A;  4PMA A;  3IWQ A;  3QP8 A;  4IUK A;  3TE8 A;  4CPK A;  3WS5 A;  1NRJ A;  5AJG A;  3U2A A;  3SZT A;  1G28 A;  3F1O A;  2XA7 S;  3M6B A;  2EA9 A;  3N6I A;  2P74 A;  1Y4O A;  1GHM A;  5FAQ A;  1W8Y A;  1O07 A;  1DP9 A;  3F1N B;  4HJ4 A;  3FWL A;  4CLC E;  1K55 C;  4CQH A;  1L0D A;  1VEU A;  4KEN B;  2ZOH A;  4L9F A;  1MKI A;  2QWS A;  5EUA A;  5A93 A;  5DF9 A;  3NUL A;  4C6Y A;  4DKI A;  3OOV A;  2PD8 A;  4X1L A;  2ZC4 B;  3M2K A;  3LR4 A;  2Z6D A;  3H7W B;  4MBF A;  2Y79 A;  2VGJ A;  2JKT M;  1P9W A;  4IHQ A;  3RH8 B;  4N1H A;  3HLB A;  2OOL A;  2Y2I A;  1UWP X;  2D02 A;  2P9V B;  2W3G A;  2XFT A;  2E8I A;  4ZTK A;  3ITA A;  4BBT A;  5L09 A;  4U0T A;  4F94 A;  2J7V A;  4U3T A;  3N4I A;  4YNR A;  4E3M A;  2XA7 M;  1Z09 A;  1OTB A;  4HP4 A;  5FQM A;  3Q7Z A;  3ZVW A;  3LFV A;  1OME A;  1E25 A;  3OPR A;  1BUL A;  5CGW A;  5J7E A;  2PDR A;  4K91 A;  4CLC B;  4OPQ A;  5E43 A;  2W1T B;  1PW8 A;  4OOY A;  3CUE C;  2I9V A;  2QZ6 A;  1VET A;  1F2K A;  2V1Z A;  3A3I A;  1RP5 A;  5M1A A;  3K3C A;  3IF6 A;  4DMZ A;  5EM1 A;  3KSF A;  3DTK A;  1T1C A;  4EV4 A;  4FSF A;  4Y0U A;  5JYP A;  1N9B A;  1RCJ A;  4KQD A;  2NUT C;  3B33 A;  3DWZ A;  5I94 A;  4QPR A;  4HI4 A;  1IFQ A;  3E0Y A;  2HV1 A;  4HIA A;  2EFX A;  4LV1 A;  4ZJ2 A;  3Q07 A;  1JWV A;  3WRT A;  2PRF A;  4GLQ A;  4ZRR A;  5HZH A;  2Y2J A;  3LR0 A;  3AGD A;  1CEF A;  5F1G A;  5F68 A;  2IWD A;  5U47 A;  1I2W A;  1FOF A;  2VLG A;  3HJI A;  1HTZ A;  3HLW A;  4AFI A;  3F1P A;  3AGE A;  2BAS A;  3SS5 A;  3QP6 A;  1JNU A;  4MCW A;  1K57 C;  5KSH A;  3F1N A;  1T19 A;  3NHQ A;  2HJ9 C;  2PBD P;  2X01 A;  3CLO A;  3PBO A;  1ONG A;  1MWS A;  4I5S A;  3BY8 A;  2WZX A;  5FAT A;  3HLE A;  2FFY A;  5HL1 A;  1W7F A;  1IYO A;  2XEP A;  3H9W A;  1KGE A;  2DRW A;  1K54 C;  4OLG A;  4ZAM A;  2V1A A;  4NK3 A;  2VV6 A;  5EM0 A;  1YM1 A;  1WYB A;  5AQ7 A;  1K25 A;  1SKO B;  4GOG A;  2QHK A;  5L2F A;  3F1P B;  4UQI S;  3IBR A;  2Y2P A;  1D7E A;  4EES A;  3LR5 A;  3ZG8 B;  1SHV A;  1DY6 A;  3UO9 A;  1YSP A;  3U4L P;  3VE4 A;  3CUE A;  4EW7 A;  5GL9 A;  2OSU A;  4NXF A;  1NRF A;  4H8R A;  4WYY A;  4WF0 A;  4X55 A;  2Y59 A;  4ZBE A;  3C30 A;  2LB9 A;  1N4O A;  2GZA A;  5CHJ A;  4N92 A;  4MN6 A;  3JVU A;  3IX8 A;  1K57 A;  2WGW A;  1U60 A;  4ZJ1 A;  2JC7 A;  1TS6 A;  1XXM A;  1XGI A;  2V0U A;  3IT9 A;  3ZG7 B;  1Q2P A;  1LHY A;  4OQH A;  1Y54 A;  1L2S A;  3LY3 A;  5DKK A;  1IYS A;  3A3E A;  2OWJ A;  3Q7V B;  5C5K A;  1PW1 A;  2XSS A;  3WRZ A;  4DRT A;  4LCL A;  4DJ2 A;  1XJ3 A;  2INW A;  2K2N A;  1PYY A;  4S2O A;  1DP6 A;  4WLA A;  4ARZ A;  3ZG9 B;  4S2J A;  5KZH A;  4IED A;  4GN2 A;  4Y15 A;  5L07 A;  4Q0J A;  4HOI A;  3IXD A;  4YOF A;  3S7O A;  3PAG A;  4K0W A;  1P9R A;  4HBT A;  1G6O A;  1S1Z A;  4RX3 A;  1GA9 A;  4P6B A;  4R3B A;  4BMW A;  2V8F A;  4Q0H A;  3UPP A;  5HD3 A;  4Y3I A;  3VOY A;  4FOF A;  1ONH A;  1SCW A;  2V1B A;  2Y2N A;  2XLN A;  1EWZ A;  4NKP A;  4LGW A;  3OCL A;  4GKU A;  1W5D A;  1ES3 A;  3W4O A;  5F6A A;  4WMC A;  4EUZ A;  1HLU P;  3G6O A;  3CPT B;  5FAP A;  4OP5 A;  4OP8 A;  1KGG A;  2Z2L B;  5CER A;  4EQ1 A;  4EBL A;  4LRZ E;  4Y0O A;  5M18 A;  2H5S A;  4KG6 A;  2A2L A;  4KQR A;  2HGV A;  5KSC A;  3R7W A;  4JF5 A;  2XRO A;  2J9P A;  4IVI A;  2Y2O A;  4WZ5 C;  2GNX A;  1BLC A;  3ZFZ A;  4KQQ A;  2K7S A;  4X68 A;  1NLY A;  5EVE A;  1PWC A;  4R4R A;  3LID A;  4KUK A;  1ES5 A;  1PNE A;  5FQQ A;  3DTI A;  5EEC A;  4HJ6 A;  4GZB A;  3T1S A;  5AVF A;  1NY0 A;  5D3O A;  4LV2 A;  4EET B;  3B47 A;  1DRM A;  3MS6 A;  3NBL A;  1TF1 A;  3VSL A;  2VV7 A;  3IXG A;  5GLC A;  4DDS A;  2RL3 A;  3S22 A;  3PBN A;  4OQG A;  1YKD A;  4HH3 A;  2VJW A;  3UDF A;  1YMX A;  4UEY A;  3WS1 A;  3ZG5 A;  3HUN A;  3DTE A;  5FA7 A;  3IF5 A;  5IS1 A;  2QPN A;  3VP3 A;  3D3O A;  1K4E A;  5FDH A;  4DE2 A;  3WS4 A;  4LRY C;  2OAQ 1;  3PTE A;  2JE5 A;  3PYP A;  4QY5 A;  3IH8 A;  1XGJ A;  3IF6 C;  2EWW A;  2ZOI A;  2BLS A;  1G68 A;  1BLH A;  3LIE A;  3EQV A;  2JKG A;  1BT5 A;  2ZM8 A;  3UB5 P;  3CZD A;  1XKZ A;  4OON A;  3LI9 A;  3BFE A;  2PYR A;  4FH2 A;  1LSX A;  2OV5 A;  5F69 A;  4KG5 A;  4R3J A;  5FQK A;  5EV0 A;  4I39 A;  1WA9 A;  2PYP A;  1XFQ A;  1OTD A;  1PZO A;  1KGF A;  4HBU A;  4IVK A;  1W63 Q;  4GD8 A;  4DXC A;  4OOL A;  4E3I A;  3VOL A;  2VX8 A;  4MBK A;  4QJG A;  2GX5 A;  3KSH A;  1K56 A;  4KZ9 A;  3WWX A;  3IQA A;  1I5Q A;  4M4X A;  1OT6 A;  3LEZ A;  3IS2 A;  3T1Q B;  3CMZ A;  2VA0 A;  4Z1W A;  3N8R A;  4E3O A;  2W3D A;  1L0G A;  4WL9 A;  3G34 A;  2RCX A;  3FZC A;  4WZ4 A;  1XA1 A;  2D01 A;  3S7N A;  2W3E A;  2VGL M;  2ZC5 B;  3V67 A;  4HHD A;  2WKP A;  2WUQ A;  3QP1 A;  3UPN A;  4G3W A;  3G31 A;  1VQQ A;  2HPB A;  2PR5 A;  3HUM A;  5FI2 A;  5KIZ A;  1TEM A;  5TBM B;  5HDD A;  3K2N A;  1ALQ A;  4X25 A;  5HDC A;  1KE0 A;  1YLY A;  2M7U A;  4GS9 B;  4R6L A;  1F9I A;  5AQB A;  5CRF A;  4EEU A;  4ZDX A;  4EU0 A;  2Z6C A;  2ZQA A;  1BUE A;  2X71 A;  4KZ6 A;  5CXW A;  2Q9N A;  2XF3 A;  3BLS A;  3G30 A;  5K5B A;  3CG5 A;  1MPL A;  3PHY A;  2E8J A;  2ZMA A;  5A91 A;  3C7V A;  3UNW A;  2Q9M A;  1H8Z A;  2L1M A;  4PPR A;  4X56 A;  4CLC D;  4HP9 A;  4LRX C;  4O7D A;  4EEP A;  3BFF A;  3E4O A;  4IJG A;  3CWF A;  2VK3 A;  4C3Q A;  4G3K A;  2XK1 A;  3SW1 A;  3UE3 A;  4JGP A;  5FAO A;  5F82 A;  4I3J A;  3SOI A;  3OBF A;  2WKE A;  5DF7 A;  4R1G A;  4UHU A;  1BSG A;  2Y91 A;  1MWT A;  4DE1 A;  2M7V A;  4MEZ A;  1GHP A;  1BLS A;  3BLM A;  3N8L A;  3C38 A;  5A8B A;  3SS3 A;  5G4Z A;  4HQA A;  4OPZ A;  1M6K A;  2J9O A;  5DTK A;  1BLP A;  2O9C A;  3MKF A;  3DAV A;  3BQA A;  3VSK A;  3DBA A;  4EQI A;  4GDB A;  5DTS A;  4X6T A;  3NC8 A;  2IA2 A;  5FSR A;  3QNC A;  3DWK A;  2R9X A;  1PI4 A;  1IYQ A;  5E2G A;  4S2N C;  4OH0 A;  1K6S A;  4BBU A;  5CED A;  3M6H A;  4P6Z M;  1NZO A;  3Q81 A;  4IUH A;  3Q1F A;  2XD1 A;  5AQ9 A;  1YSQ A;  1M40 A;  3S1Y A;  1IYP A;  2ZQ9 A;  5CHM A;  1XJ4 A;  2WAF A;  3BFC A;  1CF0 A;  3HLG A;  2OWH A;  3T1R A;  1LLB A;  3E2L A;  2QJ7 A;  3W8K A;  2A24 B;  3C7U A;  3WS0 A;  4MMN A;  2J3W A;  1S67 L;  3VFH A;  1ZTU A;  4XXR A;  3L7H A;  1FIK A;  2ZC7 A;  3T12 B;  4GCZ A;  3EOI A;  3TG9 A;  2JN7 A;  3IWO A;  3RXX A;  1K55 A;  2ZQ8 A;  3R7W B;  2XQZ A;  1XP4 A;  2QYB A;  2HP9 A;  2QJ5 A;  3UE6 A;  4A5R A;  5MC7 A;  2JKR I;  5DKL A;  1XPB A;  3TOI A;  2ZM0 A;  4CLC A;  4JLF A;  4B4X A;  3VP0 A;  5G4Y A;  1TDG A;  3S7P A;  3BW6 A;  4K0X A;  4WEJ A;  5A90 A;  3C2W A;  4UA9 A;  1W8Q A;  2IWB A;  5DF8 A;  3T4T A;  1RGZ A;  4QB8 A;  5HL6 A;  4KZ5 A;  4RA7 A;  3UE0 A;  4N1X A;  2EX2 A;  2KX6 A;  1IEM A;  4R23 A;  4UA7 A;  2GJ3 A;  3LIC A;  3RXW A;  5HFO A;  1MXO A;  1XA7 A;  5HPF A;  5J3W A;  4PM5 A;  4BL3 A;  2ZM2 A;  1KOU A;  1H8M A;  3OC2 A;  2HF6 A;  2X02 A;  2UWX A;  4HES A;  1S4R A;  2HDU A;  4QY6 A;  3UPO A;  3QP5 A;  5GLA A;  1OTE A;  2W1R A;  4DXB A;  1TVF A;  5AVE A;  4FCF A;  4PM7 A;  5GLD A;  5FL3 A;  4OVD A;  4R70 A;  4OPR A;  3EEA A;  3EWK A;  2C5W B;  4GHI B;  1NZU A;  4JXV A;  1P0Z A;  3T4L A;  3VOZ A;  2J8Y A;  3NEC A;  4S2M A;  4S2N A;  2YKF A;  4LCM A;  2J3T C;  3F1O B;  3IXH A;  1L0E A;  4MN5 A;  4B9O A;  3LYX A;  1PRQ A;  2KDK A;  5E2H A;  5EVL A;  5DFX A;  3P7N A;  5F5Y A;  1K4F A;  2WKR A;  3GTC A;  5AQA A;  4OPY A;  1IKI A;  3CJM A;  3MZF A;  3G32 A;  1NLZ A;  1CI8 A;  3W2Z A;  2JKF A;  4LLO B;  1W63 M;  1SKO A;  3PBT A;  5FDS A;  4OKP A;  1K6R A;  2B5R A;  3IS2 B;  5HWW A;  3BWL A;  3GV9 A;  4KZ7 A;  1PFL A;  1GSW A;  5EE8 A;  2V8C A;  3TRC A;  3LGO A;  2FFF B;  1ESU A;  1F5M A;  1OJG A;  5HAQ A;  2VKS A;  3SH7 A;  4OLD A;  2ZL1 B;  2ZC6 B;  4JGR A;  4WMC D;  1CJF A;  2H28 A;  5FAS A;  5TBM A;  3O86 A;  3T4J A;  2OLV A;  4FUW A;  3LR3 A;  3UY6 A;  1Q2Q A;  3GQZ A;  1DJA A;  3ZHH A;  3PBS A;  4YIN A;  5EVI A;  4WEK A;  5HDS A;  5E2F A;  2C6W B;  4LFU A;  2W1T A;  1HD8 A;  1WE4 A;  4GD6 A;  4ARZ B;  5L10 A;  3HJK A;  3KSG A;  4N9L A;  2JKT I;  3V5M A;  4GHI A;  5BOH A;  3MR0 A;  4II7 A;  3P09 A;  4P0M A;  1TS7 A;  5TR7 A;  4MLL A;  1ZG6 A;  1UGU A;  1A0K A;  5DJU A;  2A49 A;  3LI8 A;  4Y0T A;  1CK3 A;  3W4P A;  4EXO A;  4HH2 A;  3C4P A;  4DJ3 A;  2JHE A;  1J3W A;  1K56 D;  4XT2 A;  3PBQ A;  1XX2 A;  2OAP 1;  1Y28 A;  2IWC A;  3MKE A;  2Y8H A;  3ZYT A;  1K0K A;  2NUP C;  5HPI A;  3KO6 A;  2VV8 A;  4RYE A;  1ERM A;  2WGV A;  3MXQ A;  2M1C A;  1OPX A;  4BEN A;  4HY8 A;  4QHC A;  3IX4 A;  2XFS A;  3VP4 A;  4BWI A;  3KSI A;  4GDN A;  2A24 A;  5IT5 A;  3JYI A;  2DCF A;  2VEA A;  2H0T A;  3NDG A;  1ZC2 A;  5EVI D;  4JPM A;  3MQ0 A;  3S7Q A;  2WZZ A;  4R4S A;  2KLI A;  1MWR A;  4S2K A;  1SDE A;  3QP2 A;  1TS0 A;  3C4O A;  3IHA A;  3S4X A;  1KVL A;  2P04 A;  4FH4 A;  4U0X A;  1T1A A;  4XUZ A;  1ACF A;  2ZBB A;  5CTN A;  5HD5 A;  3ITB A;  3MXS A;  4DN0 A;  4X53 A;  3OPH A;  1KE3 A;  1LL5 A;  1H5X A;  1QME A;  3BEC A;  5JYO A;  4PM9 A;  1KE4 A;  1W79 A;  3FC7 A;  4JBF A;  4H6J B;  1PZP A;  4JF4 A;  4E04 A;  1GSX A;  3KYE A;  3VP2 A;  3VMA A;  5HWT A;  1YLJ A;  4DF6 A;  2VZW A;  2XRN A;  3ICY A;  3L9K A;  3LUQ A;  4LPZ A;  1LSV A;  1TD5 A;  2B18 A;  4E3L A;  3PAE A;  3QNB A;  3VE3 A;  3MFD A;  4EBN A;  5L8M A;  4ESP A;  2WKH A;  4RVA A;  5EOO A;  2XH9 A;  4JF6 A;  5J8X A;  1OTI A;  3VFF A;  5TJJ A;  5A92 A;  5CHU A;  1KDS A;  3O3V A;  3Q82 A;  5FEF A;  5GLB A;  4DDY A;  2PBY A;  1YLT A;  1XJ2 A;  3VV4 A;  3GMW A;  2XDM A;  3UN7 A;  1XFN A;  1ERQ A;  2EWV A;  1G6A A;  1CI9 A;  3BQ8 A;  3VP1 A;  2HP5 A;  4L9G A;  2V20 A;  3ZNY A;  2ZQC A;  5CEC A;  3MZE A;  1FR6 A;  4JGQ A;  3TSG A;  1H3Q A;  3UB6 A;  3KYZ A;  2G2W A;  3FKW A;  4MN7 A;  4R0Q A;  3DW0 A;  2B95 A;  3ZDJ A;  4R38 A;  1CQA A;  4PM6 A; 
#chains in the Genus database with same CATH homology
 2V8C A;  1G5U A;  1ACF A;  3LGO A;  3MS6 A;  1J3W A;  3T1Q B;  3NUL A;  5EVE A;  4D60 A;  3L9K A;  5FEG A;  2PAV P;  3MSH A;  2JKG A;  2ACG A;  4X1L A;  1SKO B;  4X1M A;  1VET A;  1F2K A;  1YPR A;  3LEQ A;  2ZL1 B;  1AWI A;  3T1X A;  3CPT A;  1D1J A;  1SZV A;  3UB5 P;  3NEC A;  3DAV A;  1PNE A;  2ZL1 A;  1VET B;  2JKF A;  4ESP A;  3L7H A;  1SKO A;  1CJF A;  1K0K A;  1CF0 A;  5EM1 A;  3D9Y A;  4QWO A;  1FIK A;  1A0K A;  1Y4O A;  1Z09 A;  2PRF A;  4FTX A;  2BTF P;  2HZ5 A;  2PBD P;  1VEU B;  5FDS A;  3T1S A;  4X25 A;  3T1R A;  1PRQ A;  1HLU P;  4FUW A;  2B95 A;  5EV0 A;  3T12 B;  3U4L P;  5FEF A;  3KYE A;  1CQA A;  1FIL A;  3CPT B;  2E8J A;  1PFL A;  5EM0 A;  2VK3 A;  3CHW P;  1VEU A;  2V8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...