2V8CA

Mouse profilin iia in complex with the proline-rich domain of vasp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN-2
publication title High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2v8cA00
3D9YA 1HLUP 5FEGA 3T1SA 1ACFA 1SKOA 3MSHA 4ESPA 1PRQA 1J3WA 1D1JA 1CF0A 1VETA 5FEFA 2V8CA 1A0KA 2JKFA 4D60A 3L7HA 1FILA 1VEUB 2B95A 4X1LA 2PBDP 5EVEA 3NULA 3NECA 3DAVA 1SKOB 4FUWA 2ZL1A 3LGOA 2ZL1B 3CPTA 3LEQA 1VETB 2VK3A 1G5UA 3T1XA 2E8JA 3T1QB 3CHWP 2PAVP 1F2KA 3T1RA 1PNEA 3UB5P 3T12B 1CQAA 4FTXA 3MS6A 3CPTB 2ACGA 5FDSA 3L9KA 1YPRA 1Y4OA 2BTFP 5EM1A 4X1MA 1FIKA 5EV0A 2PRFA 4X25A 2HZ5A 1PFLA 5EM0A 4QWOA 1K0KA 1AWIA 1Z09A 3U4LP 3KYEA 2JKGA 1SZVA 1VEUA 1CJFA 2V8FA
chains in the Genus database with same CATH superfamily
1FQGA 1NWZA 4EXOA 3DTEA 4ZAMA 5HPIA 2EA9A 2O9CA 2H0YA 3A3JA 3UMEA 4UAAA 2EX2A 1E3UD 3LIAA 3DWZA 1FSWA 2EXBA 5L09A 3KO6A 3CITA 1NJ4A 1SDEA 4PM9A 3D4FA 1VEUB 2ZOIA 3WS5A 3LY4A 5HWVA 3EGXC 1PYYA 3DAVA 2Z6DA 4HJ3A 3KSIA 1JWZA 3VFFA 3GR2A 1H0MA 1DRMA 3S7NA 4MBKA 3VP0A 4O0PA 5FSRA 5M19A 3UY6A 4WZ4A 4GD6A 3JPUA 2JKTM 1W63M 4UHUA 1ZTUA 3B3XA 2WYXA 2C6WB 5CGWA 3V5MA 1ZC2A 4E6WA 1YLJA 1OT9A 2GJ3A 4R70A 4S2OA 2V2FF 4ETXA 2Q9NA 3QP5A 3Q1FA 4GHIA 2ZMFA 3P7NA 4O7DA 1FIKA 1W63Q 4LRZE 2NUPC 4OVDA 1K0KA 1Q2QA 2W3GA 5I94A 3VSKA 4KG2A 1V9YA 5BOHA 5DTKA 3MQ0A 3O5YA 4PPRA 3FPVA 3E2LA 1T1AA 4EEUA 4DE2A 1LSXA 1IKGA 4S2KA 4NXGA 3M6HA 1EI5A 4R38A 3IBRA 4DRTA 4BD0A 3LIDA 1BUEA 3F1PA 5EECA 2Z2MB 3PR6A 3VP3A 2ZQ9A 3T4QA 2P9VB 1BT5A 1LSWA 2B95A 1O07A 3RXWA 3DW0A 5GHZA 2W3DA 5DF8A 1XP4A 3VOZA 1MZUA 3A0VA 2GNXA 3LEQA 1XXMA 2FFFB 3LICA 4EBNA 5HW3A 1JWPA 2JC7A 4IJGA 4LRXC 4NKPA 3LIEA 3K3DA 1NXYA 3T1XA 3Q7VB 4OLGA 3MF0A 4U3TA 2XFSA 4OQHA 2OAQ1 2WK0A 2OV5A 1JNUA 5GLBA 4BJPA 2ZQCA 1S1ZA 2XD5A 4E3JA 4HBUA 1YPRA 5HPFA 3H7WB 3H82B 3BEBA 4Y0TA 2WKHA 1P9WA 5F69A 3NDEA 1DP9A 3GRJA 5GLDA 3OBFA 3EEHA 1ES4A 2HJ9C 3LUQA 1K55A 4OOMA 4YOFA 4Q8IA 2V9AA 5JYOA 4U0TA 1XGJA 3RJUA 4HH2A 4IBRA 3ZG5A 3F1NA 1QMFA 4WN5A 1PI4A 2IA2A 2XH9A 3MXSA 1ACFA 4DN0A 4JXGA 4QY6A 5GL9A 1UGUA 4FCFA 5EVLA 2PR6A 5DTTA 2EFXA 1IEMA 2PDRA 3UB9A 1GHIA 3V50A 4S2MA 1IELA 4NK3A 4H6JA 4HI4A 1XKZA 3ZCZA 5FAOA 2D02A 2EFUA 1HTZA 3IXBA 1F5MA 4HQAA 3UB6A 3NECA 1K4EA 3IS2A 2J3TC 3LGOA 2I72A 3CZDA 3BQ8A 4I39A 5IU1A 5CXWA 1DJAA 3TOIA 1GSXA 1G68A 1SHVA 4GD8A 1NLYA 4QJGA 2VV7A 3DTIA 4NETA 3VP4A 1GSVA 2XRNA 5FQ9A 1ESUA 1MWTA 3ZYTA 5F82A 3QHYA 2OLVA 2ZQ8A 1BZAA 2ZQDA 4PM5A 5GHXA 3PBSA 3IXDA 4N9LA 5CX7A 4P6ZM 3G35A 4JGOA 1YLYA 5EPHA 3M2JA 3C4PA 2ZOHA 1KDSA 3AGFA 3W4QA 4S2NC 5CHJA 2VKSA 3IH9A 4BL2A 3EQUA 4U0XA 1PWGA 1S0WA 3P09A 4JF5A 3VOLA 3IXHA 4E3MA 3HLCA 3CMZA 3F1OB 4R23A 5G4ZA 1W7FA 3QNBA 4EBPA 4WZ5C 4LLOB 3NJAA 3QP2A 4ETZA 4XUXA 4LPZA 2XD1A 1W5DA 3G32A 4K08A 3NBLA 5EVIB 3IT9A 2HPBA 4L9EA 5FQIA 5F1FA 2J9OA 3TG9A 4K0XA 1S6RA 3GVBA 3L7HA 5DKKA 4E3IA 2UV0E 1J9MA 3EGDC 3AGDA 4NXFA 3O3VA 2RCXA 4O01A 3MJQA 1TS8A 5EVEA 5CHMA 3GMWA 3V3SA 4EUZA 5C5KA 2ZLYA 3QP8A 1KE0A 1CI8A 4KZBA 5AQ7A 3HVFA 4ZJ2A 3IWIA 4G3WA 4LFUA 1YSQA 2XLNA 4ME4A 3WS0A 2ZMVA 4S2NA 1YKDA 3BJNA 5AQ9A 1JWVA 2JE5A 2A2LA 3CHWP 1XJ3A 4FTXA 4UA7A 2Z2LB 3OPRA 1FR6A 1TS7A 2H5SA 2VA0A 2VV6A 1P0ZA 4WZ5A 3RXXA 1GA0A 4B9OA 5FDSA 1NRJA 1ZHHB 1KOUA 3H82A 4HESA 3MFXA 3G6OA 2K7SA 2L1MA 5CHUA 4GW9A 4Y5FA 5EV0A 3IWOA 2V0UA 3BFGA 1XX2A 3UB7A 5HWWA 5M18A 1JTGA 3ZG0A 4MNRA 3RH8B 2PR5A 2EWWA 3DTMA 1KDWA 3N8RA 1GHPA 1SZVA 3E2KA 1HVBA 2V8FA 2HJEA 4N1HA 4HOIA 4GHIB 4HH3A 4PAUA 1AXBA 1C3BA 1J3WA 2X71A 3SH7A 2V20A 1TD5A 2I9VA 3SH9A 1PWDA 3IF6B 4YWZA 3FPWA 5TBMA 5HL6A 4OP8A 4MEZA 2PBDP 3HLWA 4BWIA 4N92A 3R7WA 3N6IA 4KG6A 2Y2MA 3I7JA 2DCFA 3PXPA 1KGGA 3F1PB 2VLGA 3BFFA 3BQAA 4AFIA 3LI8A 3NOPC 4P87A 5L10A 2EX9A 1L0EA 3BECA 1KVMA 5FDHA 4E04A 3FWLA 3C7UA 4WF0A 1TEMA 2ZC6B 2A3UA 3LY3A 1KGFA 1OJGA 3MS6A 2OWJA 1T1CA 3R4KA 3T4LA 1EW0A 4YNRA 4FOFA 1D7EA 5LBRA 4WM9A 4OONA 1CEGA 3QP6A 4S2PA 3IBJA 2XGNA 2HDSA 3A3IA 2WGVA 3EQVA 2V0WA 3BY8A 1LT0A 4UQIM 4LV3A 1Z09A 1WYCA 2AVXA 4RQ9A 2JKGA 2PT7A 1LL8A 4KZ8A 4Z1WA 4PMAA 3CAXA 3D9YA 3UE0A 4QU3A 4R4SA 3S7OA 1XJ6A 4KZ5A 4NXBA 1TS6A 2QHKA 4DKIA 2HP6A 2W27A 3B33A 4ZDXA 4C3QA 4KENB 2R78A 5F1GA 3A3FA 4D60A 4DE0A 4II7A 5DJTA 2M1CA 3PAGA 5TFQA 2XA7S 5EVID 3F1NB 4GN2A 3TRCA 1PI5A 3GDIA 2V1BA 5FATA 3LR4A 4Y7PA 1E3UA 4OP5A 2Y59A 1NZUA 4H6JB 3VE3A 2PU2A 3SS4A 3IF6C 3MXQA 2O9AA 4FSFA 4E3NA 3PTEA 4JXVA 3OC2A 3IS2B 1MC0A 3NC8A 4JBFA 3NI9A 2P7JA 4BBUA 1G6OA 3G34A 2Y2KA 4B4ZA 4GDBA 2UWXA 1DP6A 2VGLS 1V9ZA 3W4PA 2PRFA 5HWTA 1OPXA 1Y28A 2PU4A 1YLPA 2M7UA 4JF4A 3VMAA 1MPLA 1S4RA 4IUHA 1SDNA 5IS1A 3VSLA 2Y2GA 2XFTA 1CJFA 4S2IA 3WRZA 4C75A 3IX4A 3MKFA 3LCEA 2WKEA 3E4PA 3EEAA 4HHDA 3LI9A 1HD8A 2V8CA 5FEFA 5MC7A 2ZQAA 4JXWA 1YLWA 4HIAA 3IF6A 1VQQA 1YAXA 1IYSA 1VHMA 2D01A 3Q81A 3PBOA 2V1ZA 1WE4A 2P04A 1L0DA 4XXRA 3DTKA 3SS5A 1L2SA 2ZL1B 3H9WA 1ALQA 3MZFA 3HL9A 1K55C 5M1AA 3VV4A 2O0YA 1T1BA 2Y55A 1YSPA 3LR0A 1Q2PA 4HJ4A 4JLFA 2B5RA 1PNEA 1LI9A 3UPNA 5HFOA 4JGRA 1S66L 3OZHA 5AQBA 2HP9A 2H10A 5EE8A 1BULA 5I5LA 4N9KA 2ZC3B 4I38A 4BQMA 5F68A 2XSSA 2DRWA 2KDKA 1I2WA 5F83A 3UE1A 5DJUA 2XEPA 5AVEA 1FOFA 1PZPA 5FA7A 3ITBA 2ZM0A 3SOIA 4EW7A 2H0TA 5EFWA 3ZVWA 2HDRA 4CLCB 1GSWA 4I3IA 3OLOA 1H5XA 3OCNA 5G18A 4LV0A 4DDYA 3V3RA 3MSHA 3OOVA 5CTNA 2XR0A 3M6BA 4IHQA 2VZWA 3HREA 4WYYA 2CMNA 3Q82A 2Y4AA 5FQMA 5CEDA 2PD7A 5FL3A 4KQRA 2X02A 4HY8A 1FCOA 2V1AA 2WZZA 2ZQ7A 3T4OA 2W3FA 4IVIA 2WUQA 1M6KA 4E3OA 3CWFA 2OAP1 4YFMA 4ZTKA 4Y0OA 1G5UA 2KOIA 3MR0A 5D3OA 5TBMB 3ZGAB 2VJWA 1RGYA 2WGWA 2PAVP 2INWA 4KZ4A 4UQIS 4DXCA 1K54C 3R7WB 3EWKA 1OJ5A 1H3QA 3ICYA 4MBHA 3DWKA 5KMWA 3CI6A 3D72A 4E3KA 3MQOA 1FCNA 2VGJA 2ZM2A 4EU0A 4P6BA 2A49A 2G2UA 1PZOA 3ZDJA 1XA1A 1IYQA 1XGIA 4EEPA 1DJBA 5A93A 3HUMA 3BRMA 1UWNX 2BLSA 5KIZA 1L3LA 3P98A 4RVAA 5GHYA 2JCHA 1K4FA 4IBXA 3VP2A 2JKRI 4RYEA 2Y2OA 1XPBA 5HDDA 4Y3IA 4F94A 1K6SA 1PRQA 3UPPA 4KG5A 1BYWA 2HDUA 1D1JA 4ARZB 4OQ0A 4BBVA 3GQZA 1PIOA 3QNCA 2Y91A 2JBFA 1K56A 1OTDA 1MKMA 4CLCC 1DJCA 1DY6A 4X53A 4EESA 1K54A 5HX9A 5KSHA 3NULA 4L9FA 2ZL1A 3QP1A 3CPTA 3UDXA 3WRTA 5HAIA 4MLLA 3KYZA 3G2YA 3N7WA 4CPKA 5CGXA 4L0LA 2BG1A 4OOLA 4WL9A 4OPQA 5FQQA 3IXGA 2J3TD 4LV1A 1X0OA 1LL9A 1G6AA 4DF6A 3M2KA 3UB5P 4UA6A 4Q0IA 4K0WA 3LEZA 4I5SA 1I2SA 5DF7A 1CEFA 2HF6A 4GS9A 3UB8A 2HGVA 4RX2A 5HARA 2VV8A 2Y2IA 4WUJA 5E2HA 1RP5A 3TJZC 5F5YA 4MDZA 1YLZA 3VOYA 2DMWA 5G4YA 1BTLA 4WBGA 3U2AA 3U4LP 3E4OA 3KYEA 2W1RA 2K31A 2QKPA 4L9GA 4CLCA 1T19A 3C7VA 1U60A 2O9BA 3BLSA 1OT6A 5TR7A 4KQOA 3NDGA 4JPMA 2ZC4B 4BBTA 3S22A 3IX8A 2JHEA 2QJ5A 2G7UA 3MQQA 3GECA 5TJJA 4LCMA 4R4RA 3RTYA 2W1TA 1ZG4A 2Y79A 1FR1A 4LGWA 1MWRA 3C30A 2EXAA 3FKWA 4G3KA 4X1LA 2J80A 1MXOA 3G2ZA 4FUWA 3VE4A 2L0WA 3ITAA 5HAPA 2WKPA 3G4PA 3PYPA 3BW6A 3PAEA 3E4QA 4FD8A 3P01A 3G30A 3C2WA 4YINA 4KZ6A 3CLOA 2QJ7A 2QPNA 3BFCA 3FKVA 4OKPA 1WA9A 3A3DA 3ZG9B 4P0MA 1N9OA 3SZTA 4QB8A 5J7EA 1ERMA 3EOIA 4OOYA 2XROA 1P97A 1ES3A 3A0SA 1L0GA 4D2OA 3WS1A 1PW8A 1OMEA 1YMXA 2P74A 3PBTA 4QPRA 4X55A 1E4DA 4BLMA 5L07A 3LIFA 4ZJ1A 4GNUA 5AJGA 1QMEA 1LLBA 1CK3A 3KYQA 1AWIA 3ZNTA 4HEFA 2GDNA 1ERQA 2W3EA 3VFHA 2O99A 3UE6A 4OLDA 3RFBA 1IFQA 3ZG8B 4BL3A 1YQSA 3WS4A 1MBLA 3O87A 4ARZA 1VETA 4EWFA 3Q07A 4R1GA 5FAQA 4NG2A 2HV1A 4GDNA 5FI6A 1FILA 2ZBBA 4MCWA 3PBNA 2RL3A 3O88A 4WMCA 4CQHA 4MN5A 5HSQA 1N9NA 4LRYC 3CJMA 5KZHA 2JKTI 4NXEA 3FC7A 3UDFA 4QD4A 1Y54A 5JYPA 4WLAA 2QZ6A 2IWDA 3W4OA 5FI7A 2E8JA 3NCKA 3T4JA 1FSYA 4GOGA 5U47A 3BFDA 4JXSA 3LR3A 4E6XA 3BFEA 4PM7A 5CGSA 5L2FA 4ZRRA 2LB9A 4P6ZS 3FV7A 4BENA 1H8ZA 3LIBA 3V39A 3WWXA 3L9KA 1NY0A 5FAPA 4KQDA 2H28A 3N8SA 2PYRA 2NUTC 4DDSA 1GA9A 2WGWB 5CECA 1XJ4A 5K5BA 2WKQA 4DE3A 4F3LA 4IEDA 4EERA 4G3VA 5CEBA 1O7EA 4MN7A 3ZHHA 3HLDA 1TVFA 2Y2HA 5DF9A 4JF6A 1ODVA 1RCJA 2FZ0A 3ZVTA 3T1SA 4EQ1A 1ONGA 5DKLA 2A24A 3B42A 1H8MA 5A92A 1H8YA 2JKFA 4OPZA 1W8YA 4DMZA 5A91A 3UMDA 3SS3A 2HDQA 1RGZA 4Y0UA 5EOEA 3HLEA 3CUEC 3TW8A 3KX0X 3JVUA 2VK3A 3HLBA 1GCEA 3PBQA 1YT4A 3N4IA 1K25A 4IVKA 3HLFA 1P9RA 5TGFA 4OH0A 1EROA 2VX8A 4HBTA 1F2KA 4B4XA 3T12B 4EBLA 1S67L 4PHTA 3OPHA 1GHMA 3CPTB 1NYMA 3GSGA 1F98A 2G2WA 4Y2FA 1F9IA 1TDGA 4HP4A 1Y4OA 4PM8A 1YLTA 3O86A 3A0RA 1PWCA 4Y13A 3HBRA 3PBRA 4X68A 3BWLA 4A5RA 3ZG7B 3ZQ5A 5GLCA 5EM0A 2XK1A 3QP4A 4OQGA 4KZAA 5HD5A 2R9WA 1IOUA 5J3WA 4P85A 1ES5A 4FH2A 2J7VA 4GS9B 4LCLA 3NIAA 2OLUA 4JKTA 4S2JA 2XDMA 4KUKA 4LV2A 3TE8A 3UDIA 4PKYA 1SKOA 3CUEA 4HP9A 3IX3A 1MWUA 1I5QA 2BASA 1FCMA 4KUOA 4XT2A 1A0KA 3IHAA 3E98A 1KE3A 2EWVA 5J4EA 3S7QA 3TSGA 1IYOA 1JVJA 1S1YA 1ZKJA 4K91A 3S4XA 3N8LA 4MN6A 5FQKA 4I3AA 3OPLA 1LSVA 1T18A 1N9BA 2W1TB 1VB6A 5E2GA 3B47A 3UPOA 3PHYA 4EV4A 3KSHA 3ULFA 2J9PA 1CI9A 2Y2PA 3LR5A 4BD1A 4X69A 2J3WA 3BY9A 4R3BA 1ESIA 2IWBA 4M4XA 3OCLA 3NY4A 2QYBA 1KGEA 4CLCE 4RA7A 2YKFA 3IQAA 1BLSA 2VGKA 2Q0OA 1SKFA 4HJ6A 2Z6CA 3KSFA 2JN7A 4KZ3A 3MBZA 4R3JA 1N4OA 2KX6A 2HZ5A 1BLPA 1OTEA 4QWOA 4GJ4A 1KVLA 3S1YA 1OTIA 5CTMA 3K2NA 4GB7A 1BLCA 1VEUA 1HZOA 3JVVA 1K57C 3T4KA 3MZDA 5J8XA 2ZC7A 2ZD8A 3IH8A 1K38A 3LFVA 4ESPA 5FASA 3HLGA 4R3AA 1CF0A 3ZFZA 2P08A 4WEJA 3NHQA 5HDCA 5KSCA 2PHYA 3DBAA 3GV9A 3FYZA 2K2NA 5DTSA 2FH5A 2XA7M 3A3EA 3SH8A 5DVAA 4Z9QA 2WAFA 5HAQA 3BM6A 3HJIA 3UN7A 3V67A 3E0YA 4S2LA 5IHVA 1IKIA 4DXBA 1VETB 5E2FA 4C6YA 1MKIA 2Q9MA 5AVFA 4QHCA 1XFNA 4H8RA 4KZ7A 3IHBA 1SCWA 5GLAA 4MBFA 3BLMA 3T1QB 3MZEA 3KSGA 1W8QA 3LO7A 4WELA 1CQAA 4Y15A 3GTCA 1K56D 1ES2A 1XJ2A 5FI2A 1K57A 3UNWA 2XF3A 2BTFP 5EM1A 2GX5A 3UE3A 4IUKA 3MFDA 2ZMAA 4Y17A 4X1MA 3CG5A 4M3KA 4X6TA 1WYBA 2VGLM 4X25A 4CJNA 4RX3A 1Z6FA 5EUAA 3HUOA 5E2EA 5A90A 4JGQA 2W3HA 1BSGA 4PKYG 2OWHA 1N9LA 1YM1A 2MJ6A 5EOOA 2P9VA 1NLZA 2ZJ9A 4ZBEA 4E3LA 4HNBA 5FEGA 2HP5A 2QMIA 2J8YA 3Q7ZA 2PBYA 4OPYA 3C5AA 2YKHA 2JKRM 2ZM8A 4F3LB 1NYYA 3UO9A 5IT5A 1LI0A 2EX8A 1M40A 2Y2LA 3D3OA 1W79A 2R9XA 1E25A 4B88A 3Q7VA 5DFXA 1ONHA 3FZCA 3T4SA 2A24B 3IF5A 4NEED 4X56A 4DJ3A 1L0FA 3VP1A 5FQJA 4CLCD 3MMHA 4N1XA 2X01A 2C5WB 2L4RA 3H7WA 2WGIA 3C8CA 4MMNA 3ZNYA 2PD8A 4B93A 4JGPA 2EX6A 1OTAA 1S4SA 2XQZA 3HJKA 2DNSA 2Y8HA 4I3JA 1NZOA 1NRFA 1UWPX 1LHYA 4UA9A 3S7PA 2OOLA 4GZBA 2QWSA 4OPRA 4KZ9A 2KLIA 2ACGA 1IYPA 3MKEA 5E43A 5CERA 5HL1A 1STZA 2E8IA 4OQIA 3SW1A 1PFLA 4XUZA 4EUVA 3BYDA 1OTBA 3IWQA 4FH4A 2ZC5B 2WAEA 1KE4A 4GLQA 1MY8A 4ZJ3A 2B18A 1YMSA 3NOTC 1HLUP 3W8KA 4GKUA 2Y2QA 4ID4A 4R0QA 3K3CA 3FG8A 2OSUA 4LENA 1ZG6A 3ISGA 4DJ2A 5EVIC 5HD3A 3JYIA 3NOUC 4EQIA 4QY5A 2M7VA 1JTDA 1BLHA 4KQQA 1LL5A 3LYXA 1SKOB 1DP8A 3OPPA 3C38A 4Q0JA 1PW1A 1TS0A 4R6LA 3T4TA 2WZXA 4XT2B 5CRFA 4O8GA 5A8BA 2FFYA 3MXRA 3AGEA 2PYPA 1VM1A 3G31A 3WS2A 3T1RA 3F1OA 2WKRA 4WEKA 5HDSA 3C4OA 4PM6A 1EWZA 4DE1A 5DFYA 3HUNA 2LB5A 1TF1A 4WMCD 5L8MA 5F6AA 1TDLA 1D06A 2WADA 4UEYA 5AQAA 2WKIA 2GZAA 3W2ZA 4BMWA 2Y2JA 4Q0HA 1MWSA 2CC1A 1K6RA 1XFQA 3T50A 5EVIA 3HCYA 4EETB 2Y2NA 2B02A 4GCZA 2IWCA 2W0NA 2VEAA 1XA7A 5HZHA 1G28A
chains in the Genus database with same CATH topology
3D9YA 1HLUP 5FEGA 3T1SA 1ACFA 1SKOA 3MSHA 4ESPA 1PRQA 1J3WA 1D1JA 1CF0A 1VETA 5FEFA 2V8CA 1A0KA 2JKFA 4D60A 3L7HA 1FILA 1VEUB 2B95A 4X1LA 2PBDP 5EVEA 3NULA 3NECA 3DAVA 1SKOB 4FUWA 2ZL1A 3LGOA 2ZL1B 3CPTA 3LEQA 1VETB 2VK3A 1G5UA 3T1XA 2E8JA 3T1QB 3CHWP 2PAVP 1F2KA 3T1RA 1PNEA 3UB5P 3T12B 1CQAA 4FTXA 3MS6A 3CPTB 2ACGA 5FDSA 3L9KA 1YPRA 1Y4OA 2BTFP 5EM1A 4X1MA 1FIKA 5EV0A 2PRFA 4X25A 2HZ5A 1PFLA 5EM0A 4QWOA 1K0KA 1AWIA 1Z09A 3U4LP 3KYEA 2JKGA 1SZVA 1VEUA 1CJFA 2V8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9Y A;  1HLU P;  5FEG A;  3T1S A;  1ACF A;  1SKO A;  3MSH A;  4ESP A;  1PRQ A;  1J3W A;  1D1J A;  1CF0 A;  1VET A;  5FEF A;  2V8C A;  1A0K A;  2JKF A;  4D60 A;  3L7H A;  1FIL A;  1VEU B;  2B95 A;  4X1L A;  2PBD P;  5EVE A;  3NUL A;  3NEC A;  3DAV A;  1SKO B;  4FUW A;  2ZL1 A;  3LGO A;  2ZL1 B;  3CPT A;  3LEQ A;  1VET B;  2VK3 A;  1G5U A;  3T1X A;  2E8J A;  3T1Q B;  3CHW P;  2PAV P;  1F2K A;  3T1R A;  1PNE A;  3UB5 P;  3T12 B;  1CQA A;  4FTX A;  3MS6 A;  3CPT B;  2ACG A;  5FDS A;  3L9K A;  1YPR A;  1Y4O A;  2BTF P;  5EM1 A;  4X1M A;  1FIK A;  5EV0 A;  2PRF A;  4X25 A;  2HZ5 A;  1PFL A;  5EM0 A;  4QWO A;  1K0K A;  1AWI A;  1Z09 A;  3U4L P;  3KYE A;  2JKG A;  1SZV A;  1VEU A;  1CJF A;  2V8F A; 
#chains in the Genus database with same CATH topology
 1FQG A;  1NWZ A;  4EXO A;  3DTE A;  4ZAM A;  5HPI A;  2EA9 A;  2O9C A;  2H0Y A;  3A3J A;  3UME A;  4UAA A;  2EX2 A;  1E3U D;  3LIA A;  3DWZ A;  1FSW A;  2EXB A;  5L09 A;  3KO6 A;  3CIT A;  1NJ4 A;  1SDE A;  4PM9 A;  3D4F A;  1VEU B;  2ZOI A;  3WS5 A;  3LY4 A;  5HWV A;  3EGX C;  1PYY A;  3DAV A;  2Z6D A;  4HJ3 A;  3KSI A;  1JWZ A;  3VFF A;  3GR2 A;  1H0M A;  1DRM A;  3S7N A;  4MBK A;  3VP0 A;  4O0P A;  5FSR A;  5M19 A;  3UY6 A;  4WZ4 A;  4GD6 A;  3JPU A;  2JKT M;  1W63 M;  4UHU A;  1ZTU A;  3B3X A;  2WYX A;  2C6W B;  5CGW A;  3V5M A;  1ZC2 A;  4E6W A;  1YLJ A;  1OT9 A;  2GJ3 A;  4R70 A;  4S2O A;  2V2F F;  4ETX A;  2Q9N A;  3QP5 A;  3Q1F A;  4GHI A;  2ZMF A;  3P7N A;  4O7D A;  1FIK A;  1W63 Q;  4LRZ E;  2NUP C;  4OVD A;  1K0K A;  1Q2Q A;  2W3G A;  5I94 A;  3VSK A;  4KG2 A;  1V9Y A;  5BOH A;  5DTK A;  3MQ0 A;  3O5Y A;  4PPR A;  3FPV A;  3E2L A;  1T1A A;  4EEU A;  4DE2 A;  1LSX A;  1IKG A;  4S2K A;  4NXG A;  3M6H A;  1EI5 A;  4R38 A;  3IBR A;  4DRT A;  4BD0 A;  3LID A;  1BUE A;  3F1P A;  5EEC A;  2Z2M B;  3PR6 A;  3VP3 A;  2ZQ9 A;  3T4Q A;  2P9V B;  1BT5 A;  1LSW A;  2B95 A;  1O07 A;  3RXW A;  3DW0 A;  5GHZ A;  2W3D A;  5DF8 A;  1XP4 A;  3VOZ A;  1MZU A;  3A0V A;  2GNX A;  3LEQ A;  1XXM A;  2FFF B;  3LIC A;  4EBN A;  5HW3 A;  1JWP A;  2JC7 A;  4IJG A;  4LRX C;  4NKP A;  3LIE A;  3K3D A;  1NXY A;  3T1X A;  3Q7V B;  4OLG A;  3MF0 A;  4U3T A;  2XFS A;  4OQH A;  2OAQ 1;  2WK0 A;  2OV5 A;  1JNU A;  5GLB A;  4BJP A;  2ZQC A;  1S1Z A;  2XD5 A;  4E3J A;  4HBU A;  1YPR A;  5HPF A;  3H7W B;  3H82 B;  3BEB A;  4Y0T A;  2WKH A;  1P9W A;  5F69 A;  3NDE A;  1DP9 A;  3GRJ A;  5GLD A;  3OBF A;  3EEH A;  1ES4 A;  2HJ9 C;  3LUQ A;  1K55 A;  4OOM A;  4YOF A;  4Q8I A;  2V9A A;  5JYO A;  4U0T A;  1XGJ A;  3RJU A;  4HH2 A;  4IBR A;  3ZG5 A;  3F1N A;  1QMF A;  4WN5 A;  1PI4 A;  2IA2 A;  2XH9 A;  3MXS A;  1ACF A;  4DN0 A;  4JXG A;  4QY6 A;  5GL9 A;  1UGU A;  4FCF A;  5EVL A;  2PR6 A;  5DTT A;  2EFX A;  1IEM A;  2PDR A;  3UB9 A;  1GHI A;  3V50 A;  4S2M A;  1IEL A;  4NK3 A;  4H6J A;  4HI4 A;  1XKZ A;  3ZCZ A;  5FAO A;  2D02 A;  2EFU A;  1HTZ A;  3IXB A;  1F5M A;  4HQA A;  3UB6 A;  3NEC A;  1K4E A;  3IS2 A;  2J3T C;  3LGO A;  2I72 A;  3CZD A;  3BQ8 A;  4I39 A;  5IU1 A;  5CXW A;  1DJA A;  3TOI A;  1GSX A;  1G68 A;  1SHV A;  4GD8 A;  1NLY A;  4QJG A;  2VV7 A;  3DTI A;  4NET A;  3VP4 A;  1GSV A;  2XRN A;  5FQ9 A;  1ESU A;  1MWT A;  3ZYT A;  5F82 A;  3QHY A;  2OLV A;  2ZQ8 A;  1BZA A;  2ZQD A;  4PM5 A;  5GHX A;  3PBS A;  3IXD A;  4N9L A;  5CX7 A;  4P6Z M;  3G35 A;  4JGO A;  1YLY A;  5EPH A;  3M2J A;  3C4P A;  2ZOH A;  1KDS A;  3AGF A;  3W4Q A;  4S2N C;  5CHJ A;  2VKS A;  3IH9 A;  4BL2 A;  3EQU A;  4U0X A;  1PWG A;  1S0W A;  3P09 A;  4JF5 A;  3VOL A;  3IXH A;  4E3M A;  3HLC A;  3CMZ A;  3F1O B;  4R23 A;  5G4Z A;  1W7F A;  3QNB A;  4EBP A;  4WZ5 C;  4LLO B;  3NJA A;  3QP2 A;  4ETZ A;  4XUX A;  4LPZ A;  2XD1 A;  1W5D A;  3G32 A;  4K08 A;  3NBL A;  5EVI B;  3IT9 A;  2HPB A;  4L9E A;  5FQI A;  5F1F A;  2J9O A;  3TG9 A;  4K0X A;  1S6R A;  3GVB A;  3L7H A;  5DKK A;  4E3I A;  2UV0 E;  1J9M A;  3EGD C;  3AGD A;  4NXF A;  3O3V A;  2RCX A;  4O01 A;  3MJQ A;  1TS8 A;  5EVE A;  5CHM A;  3GMW A;  3V3S A;  4EUZ A;  5C5K A;  2ZLY A;  3QP8 A;  1KE0 A;  1CI8 A;  4KZB A;  5AQ7 A;  3HVF A;  4ZJ2 A;  3IWI A;  4G3W A;  4LFU A;  1YSQ A;  2XLN A;  4ME4 A;  3WS0 A;  2ZMV A;  4S2N A;  1YKD A;  3BJN A;  5AQ9 A;  1JWV A;  2JE5 A;  2A2L A;  3CHW P;  1XJ3 A;  4FTX A;  4UA7 A;  2Z2L B;  3OPR A;  1FR6 A;  1TS7 A;  2H5S A;  2VA0 A;  2VV6 A;  1P0Z A;  4WZ5 A;  3RXX A;  1GA0 A;  4B9O A;  5FDS A;  1NRJ A;  1ZHH B;  1KOU A;  3H82 A;  4HES A;  3MFX A;  3G6O A;  2K7S A;  2L1M A;  5CHU A;  4GW9 A;  4Y5F A;  5EV0 A;  3IWO A;  2V0U A;  3BFG A;  1XX2 A;  3UB7 A;  5HWW A;  5M18 A;  1JTG A;  3ZG0 A;  4MNR A;  3RH8 B;  2PR5 A;  2EWW A;  3DTM A;  1KDW A;  3N8R A;  1GHP A;  1SZV A;  3E2K A;  1HVB A;  2V8F A;  2HJE A;  4N1H A;  4HOI A;  4GHI B;  4HH3 A;  4PAU A;  1AXB A;  1C3B A;  1J3W A;  2X71 A;  3SH7 A;  2V20 A;  1TD5 A;  2I9V A;  3SH9 A;  1PWD A;  3IF6 B;  4YWZ A;  3FPW A;  5TBM A;  5HL6 A;  4OP8 A;  4MEZ A;  2PBD P;  3HLW A;  4BWI A;  4N92 A;  3R7W A;  3N6I A;  4KG6 A;  2Y2M A;  3I7J A;  2DCF A;  3PXP A;  1KGG A;  3F1P B;  2VLG A;  3BFF A;  3BQA A;  4AFI A;  3LI8 A;  3NOP C;  4P87 A;  5L10 A;  2EX9 A;  1L0E A;  3BEC A;  1KVM A;  5FDH A;  4E04 A;  3FWL A;  3C7U A;  4WF0 A;  1TEM A;  2ZC6 B;  2A3U A;  3LY3 A;  1KGF A;  1OJG A;  3MS6 A;  2OWJ A;  1T1C A;  3R4K A;  3T4L A;  1EW0 A;  4YNR A;  4FOF A;  1D7E A;  5LBR A;  4WM9 A;  4OON A;  1CEG A;  3QP6 A;  4S2P A;  3IBJ A;  2XGN A;  2HDS A;  3A3I A;  2WGV A;  3EQV A;  2V0W A;  3BY8 A;  1LT0 A;  4UQI M;  4LV3 A;  1Z09 A;  1WYC A;  2AVX A;  4RQ9 A;  2JKG A;  2PT7 A;  1LL8 A;  4KZ8 A;  4Z1W A;  4PMA A;  3CAX A;  3D9Y A;  3UE0 A;  4QU3 A;  4R4S A;  3S7O A;  1XJ6 A;  4KZ5 A;  4NXB A;  1TS6 A;  2QHK A;  4DKI A;  2HP6 A;  2W27 A;  3B33 A;  4ZDX A;  4C3Q A;  4KEN B;  2R78 A;  5F1G A;  3A3F A;  4D60 A;  4DE0 A;  4II7 A;  5DJT A;  2M1C A;  3PAG A;  5TFQ A;  2XA7 S;  5EVI D;  3F1N B;  4GN2 A;  3TRC A;  1PI5 A;  3GDI A;  2V1B A;  5FAT A;  3LR4 A;  4Y7P A;  1E3U A;  4OP5 A;  2Y59 A;  1NZU A;  4H6J B;  3VE3 A;  2PU2 A;  3SS4 A;  3IF6 C;  3MXQ A;  2O9A A;  4FSF A;  4E3N A;  3PTE A;  4JXV A;  3OC2 A;  3IS2 B;  1MC0 A;  3NC8 A;  4JBF A;  3NI9 A;  2P7J A;  4BBU A;  1G6O A;  3G34 A;  2Y2K A;  4B4Z A;  4GDB A;  2UWX A;  1DP6 A;  2VGL S;  1V9Z A;  3W4P A;  2PRF A;  5HWT A;  1OPX A;  1Y28 A;  2PU4 A;  1YLP A;  2M7U A;  4JF4 A;  3VMA A;  1MPL A;  1S4R A;  4IUH A;  1SDN A;  5IS1 A;  3VSL A;  2Y2G A;  2XFT A;  1CJF A;  4S2I A;  3WRZ A;  4C75 A;  3IX4 A;  3MKF A;  3LCE A;  2WKE A;  3E4P A;  3EEA A;  4HHD A;  3LI9 A;  1HD8 A;  2V8C A;  5FEF A;  5MC7 A;  2ZQA A;  4JXW A;  1YLW A;  4HIA A;  3IF6 A;  1VQQ A;  1YAX A;  1IYS A;  1VHM A;  2D01 A;  3Q81 A;  3PBO A;  2V1Z A;  1WE4 A;  2P04 A;  1L0D A;  4XXR A;  3DTK A;  3SS5 A;  1L2S A;  2ZL1 B;  3H9W A;  1ALQ A;  3MZF A;  3HL9 A;  1K55 C;  5M1A A;  3VV4 A;  2O0Y A;  1T1B A;  2Y55 A;  1YSP A;  3LR0 A;  1Q2P A;  4HJ4 A;  4JLF A;  2B5R A;  1PNE A;  1LI9 A;  3UPN A;  5HFO A;  4JGR A;  1S66 L;  3OZH A;  5AQB A;  2HP9 A;  2H10 A;  5EE8 A;  1BUL A;  5I5L A;  4N9K A;  2ZC3 B;  4I38 A;  4BQM A;  5F68 A;  2XSS A;  2DRW A;  2KDK A;  1I2W A;  5F83 A;  3UE1 A;  5DJU A;  2XEP A;  5AVE A;  1FOF A;  1PZP A;  5FA7 A;  3ITB A;  2ZM0 A;  3SOI A;  4EW7 A;  2H0T A;  5EFW A;  3ZVW A;  2HDR A;  4CLC B;  1GSW A;  4I3I A;  3OLO A;  1H5X A;  3OCN A;  5G18 A;  4LV0 A;  4DDY A;  3V3R A;  3MSH A;  3OOV A;  5CTN A;  2XR0 A;  3M6B A;  4IHQ A;  2VZW A;  3HRE A;  4WYY A;  2CMN A;  3Q82 A;  2Y4A A;  5FQM A;  5CED A;  2PD7 A;  5FL3 A;  4KQR A;  2X02 A;  4HY8 A;  1FCO A;  2V1A A;  2WZZ A;  2ZQ7 A;  3T4O A;  2W3F A;  4IVI A;  2WUQ A;  1M6K A;  4E3O A;  3CWF A;  2OAP 1;  4YFM A;  4ZTK A;  4Y0O A;  1G5U A;  2KOI A;  3MR0 A;  5D3O A;  5TBM B;  3ZGA B;  2VJW A;  1RGY A;  2WGW A;  2PAV P;  2INW A;  4KZ4 A;  4UQI S;  4DXC A;  1K54 C;  3R7W B;  3EWK A;  1OJ5 A;  1H3Q A;  3ICY A;  4MBH A;  3DWK A;  5KMW A;  3CI6 A;  3D72 A;  4E3K A;  3MQO A;  1FCN A;  2VGJ A;  2ZM2 A;  4EU0 A;  4P6B A;  2A49 A;  2G2U A;  1PZO A;  3ZDJ A;  1XA1 A;  1IYQ A;  1XGI A;  4EEP A;  1DJB A;  5A93 A;  3HUM A;  3BRM A;  1UWN X;  2BLS A;  5KIZ A;  1L3L A;  3P98 A;  4RVA A;  5GHY A;  2JCH A;  1K4F A;  4IBX A;  3VP2 A;  2JKR I;  4RYE A;  2Y2O A;  1XPB A;  5HDD A;  4Y3I A;  4F94 A;  1K6S A;  1PRQ A;  3UPP A;  4KG5 A;  1BYW A;  2HDU A;  1D1J A;  4ARZ B;  4OQ0 A;  4BBV A;  3GQZ A;  1PIO A;  3QNC A;  2Y91 A;  2JBF A;  1K56 A;  1OTD A;  1MKM A;  4CLC C;  1DJC A;  1DY6 A;  4X53 A;  4EES A;  1K54 A;  5HX9 A;  5KSH A;  3NUL A;  4L9F A;  2ZL1 A;  3QP1 A;  3CPT A;  3UDX A;  3WRT A;  5HAI A;  4MLL A;  3KYZ A;  3G2Y A;  3N7W A;  4CPK A;  5CGX A;  4L0L A;  2BG1 A;  4OOL A;  4WL9 A;  4OPQ A;  5FQQ A;  3IXG A;  2J3T D;  4LV1 A;  1X0O A;  1LL9 A;  1G6A A;  4DF6 A;  3M2K A;  3UB5 P;  4UA6 A;  4Q0I A;  4K0W A;  3LEZ A;  4I5S A;  1I2S A;  5DF7 A;  1CEF A;  2HF6 A;  4GS9 A;  3UB8 A;  2HGV A;  4RX2 A;  5HAR A;  2VV8 A;  2Y2I A;  4WUJ A;  5E2H A;  1RP5 A;  3TJZ C;  5F5Y A;  4MDZ A;  1YLZ A;  3VOY A;  2DMW A;  5G4Y A;  1BTL A;  4WBG A;  3U2A A;  3U4L P;  3E4O A;  3KYE A;  2W1R A;  2K31 A;  2QKP A;  4L9G A;  4CLC A;  1T19 A;  3C7V A;  1U60 A;  2O9B A;  3BLS A;  1OT6 A;  5TR7 A;  4KQO A;  3NDG A;  4JPM A;  2ZC4 B;  4BBT A;  3S22 A;  3IX8 A;  2JHE A;  2QJ5 A;  2G7U A;  3MQQ A;  3GEC A;  5TJJ A;  4LCM A;  4R4R A;  3RTY A;  2W1T A;  1ZG4 A;  2Y79 A;  1FR1 A;  4LGW A;  1MWR A;  3C30 A;  2EXA A;  3FKW A;  4G3K A;  4X1L A;  2J80 A;  1MXO A;  3G2Z A;  4FUW A;  3VE4 A;  2L0W A;  3ITA A;  5HAP A;  2WKP A;  3G4P A;  3PYP A;  3BW6 A;  3PAE A;  3E4Q A;  4FD8 A;  3P01 A;  3G30 A;  3C2W A;  4YIN A;  4KZ6 A;  3CLO A;  2QJ7 A;  2QPN A;  3BFC A;  3FKV A;  4OKP A;  1WA9 A;  3A3D A;  3ZG9 B;  4P0M A;  1N9O A;  3SZT A;  4QB8 A;  5J7E A;  1ERM A;  3EOI A;  4OOY A;  2XRO A;  1P97 A;  1ES3 A;  3A0S A;  1L0G A;  4D2O A;  3WS1 A;  1PW8 A;  1OME A;  1YMX A;  2P74 A;  3PBT A;  4QPR A;  4X55 A;  1E4D A;  4BLM A;  5L07 A;  3LIF A;  4ZJ1 A;  4GNU A;  5AJG A;  1QME A;  1LLB A;  1CK3 A;  3KYQ A;  1AWI A;  3ZNT A;  4HEF A;  2GDN A;  1ERQ A;  2W3E A;  3VFH A;  2O99 A;  3UE6 A;  4OLD A;  3RFB A;  1IFQ A;  3ZG8 B;  4BL3 A;  1YQS A;  3WS4 A;  1MBL A;  3O87 A;  4ARZ A;  1VET A;  4EWF A;  3Q07 A;  4R1G A;  5FAQ A;  4NG2 A;  2HV1 A;  4GDN A;  5FI6 A;  1FIL A;  2ZBB A;  4MCW A;  3PBN A;  2RL3 A;  3O88 A;  4WMC A;  4CQH A;  4MN5 A;  5HSQ A;  1N9N A;  4LRY C;  3CJM A;  5KZH A;  2JKT I;  4NXE A;  3FC7 A;  3UDF A;  4QD4 A;  1Y54 A;  5JYP A;  4WLA A;  2QZ6 A;  2IWD A;  3W4O A;  5FI7 A;  2E8J A;  3NCK A;  3T4J A;  1FSY A;  4GOG A;  5U47 A;  3BFD A;  4JXS A;  3LR3 A;  4E6X A;  3BFE A;  4PM7 A;  5CGS A;  5L2F A;  4ZRR A;  2LB9 A;  4P6Z S;  3FV7 A;  4BEN A;  1H8Z A;  3LIB A;  3V39 A;  3WWX A;  3L9K A;  1NY0 A;  5FAP A;  4KQD A;  2H28 A;  3N8S A;  2PYR A;  2NUT C;  4DDS A;  1GA9 A;  2WGW B;  5CEC A;  1XJ4 A;  5K5B A;  2WKQ A;  4DE3 A;  4F3L A;  4IED A;  4EER A;  4G3V A;  5CEB A;  1O7E A;  4MN7 A;  3ZHH A;  3HLD A;  1TVF A;  2Y2H A;  5DF9 A;  4JF6 A;  1ODV A;  1RCJ A;  2FZ0 A;  3ZVT A;  3T1S A;  4EQ1 A;  1ONG A;  5DKL A;  2A24 A;  3B42 A;  1H8M A;  5A92 A;  1H8Y A;  2JKF A;  4OPZ A;  1W8Y A;  4DMZ A;  5A91 A;  3UMD A;  3SS3 A;  2HDQ A;  1RGZ A;  4Y0U A;  5EOE A;  3HLE A;  3CUE C;  3TW8 A;  3KX0 X;  3JVU A;  2VK3 A;  3HLB A;  1GCE A;  3PBQ A;  1YT4 A;  3N4I A;  1K25 A;  4IVK A;  3HLF A;  1P9R A;  5TGF A;  4OH0 A;  1ERO A;  2VX8 A;  4HBT A;  1F2K A;  4B4X A;  3T12 B;  4EBL A;  1S67 L;  4PHT A;  3OPH A;  1GHM A;  3CPT B;  1NYM A;  3GSG A;  1F98 A;  2G2W A;  4Y2F A;  1F9I A;  1TDG A;  4HP4 A;  1Y4O A;  4PM8 A;  1YLT A;  3O86 A;  3A0R A;  1PWC A;  4Y13 A;  3HBR A;  3PBR A;  4X68 A;  3BWL A;  4A5R A;  3ZG7 B;  3ZQ5 A;  5GLC A;  5EM0 A;  2XK1 A;  3QP4 A;  4OQG A;  4KZA A;  5HD5 A;  2R9W A;  1IOU A;  5J3W A;  4P85 A;  1ES5 A;  4FH2 A;  2J7V A;  4GS9 B;  4LCL A;  3NIA A;  2OLU A;  4JKT A;  4S2J A;  2XDM A;  4KUK A;  4LV2 A;  3TE8 A;  3UDI A;  4PKY A;  1SKO A;  3CUE A;  4HP9 A;  3IX3 A;  1MWU A;  1I5Q A;  2BAS A;  1FCM A;  4KUO A;  4XT2 A;  1A0K A;  3IHA A;  3E98 A;  1KE3 A;  2EWV A;  5J4E A;  3S7Q A;  3TSG A;  1IYO A;  1JVJ A;  1S1Y A;  1ZKJ A;  4K91 A;  3S4X A;  3N8L A;  4MN6 A;  5FQK A;  4I3A A;  3OPL A;  1LSV A;  1T18 A;  1N9B A;  2W1T B;  1VB6 A;  5E2G A;  3B47 A;  3UPO A;  3PHY A;  4EV4 A;  3KSH A;  3ULF A;  2J9P A;  1CI9 A;  2Y2P A;  3LR5 A;  4BD1 A;  4X69 A;  2J3W A;  3BY9 A;  4R3B A;  1ESI A;  2IWB A;  4M4X A;  3OCL A;  3NY4 A;  2QYB A;  1KGE A;  4CLC E;  4RA7 A;  2YKF A;  3IQA A;  1BLS A;  2VGK A;  2Q0O A;  1SKF A;  4HJ6 A;  2Z6C A;  3KSF A;  2JN7 A;  4KZ3 A;  3MBZ A;  4R3J A;  1N4O A;  2KX6 A;  2HZ5 A;  1BLP A;  1OTE A;  4QWO A;  4GJ4 A;  1KVL A;  3S1Y A;  1OTI A;  5CTM A;  3K2N A;  4GB7 A;  1BLC A;  1VEU A;  1HZO A;  3JVV A;  1K57 C;  3T4K A;  3MZD A;  5J8X A;  2ZC7 A;  2ZD8 A;  3IH8 A;  1K38 A;  3LFV A;  4ESP A;  5FAS A;  3HLG A;  4R3A A;  1CF0 A;  3ZFZ A;  2P08 A;  4WEJ A;  3NHQ A;  5HDC A;  5KSC A;  2PHY A;  3DBA A;  3GV9 A;  3FYZ A;  2K2N A;  5DTS A;  2FH5 A;  2XA7 M;  3A3E A;  3SH8 A;  5DVA A;  4Z9Q A;  2WAF A;  5HAQ A;  3BM6 A;  3HJI A;  3UN7 A;  3V67 A;  3E0Y A;  4S2L A;  5IHV A;  1IKI A;  4DXB A;  1VET B;  5E2F A;  4C6Y A;  1MKI A;  2Q9M A;  5AVF A;  4QHC A;  1XFN A;  4H8R A;  4KZ7 A;  3IHB A;  1SCW A;  5GLA A;  4MBF A;  3BLM A;  3T1Q B;  3MZE A;  3KSG A;  1W8Q A;  3LO7 A;  4WEL A;  1CQA A;  4Y15 A;  3GTC A;  1K56 D;  1ES2 A;  1XJ2 A;  5FI2 A;  1K57 A;  3UNW A;  2XF3 A;  2BTF P;  5EM1 A;  2GX5 A;  3UE3 A;  4IUK A;  3MFD A;  2ZMA A;  4Y17 A;  4X1M A;  3CG5 A;  4M3K A;  4X6T A;  1WYB A;  2VGL M;  4X25 A;  4CJN A;  4RX3 A;  1Z6F A;  5EUA A;  3HUO A;  5E2E A;  5A90 A;  4JGQ A;  2W3H A;  1BSG A;  4PKY G;  2OWH A;  1N9L A;  1YM1 A;  2MJ6 A;  5EOO A;  2P9V A;  1NLZ A;  2ZJ9 A;  4ZBE A;  4E3L A;  4HNB A;  5FEG A;  2HP5 A;  2QMI A;  2J8Y A;  3Q7Z A;  2PBY A;  4OPY A;  3C5A A;  2YKH A;  2JKR M;  2ZM8 A;  4F3L B;  1NYY A;  3UO9 A;  5IT5 A;  1LI0 A;  2EX8 A;  1M40 A;  2Y2L A;  3D3O A;  1W79 A;  2R9X A;  1E25 A;  4B88 A;  3Q7V A;  5DFX A;  1ONH A;  3FZC A;  3T4S A;  2A24 B;  3IF5 A;  4NEE D;  4X56 A;  4DJ3 A;  1L0F A;  3VP1 A;  5FQJ A;  4CLC D;  3MMH A;  4N1X A;  2X01 A;  2C5W B;  2L4R A;  3H7W A;  2WGI A;  3C8C A;  4MMN A;  3ZNY A;  2PD8 A;  4B93 A;  4JGP A;  2EX6 A;  1OTA A;  1S4S A;  2XQZ A;  3HJK A;  2DNS A;  2Y8H A;  4I3J A;  1NZO A;  1NRF A;  1UWP X;  1LHY A;  4UA9 A;  3S7P A;  2OOL A;  4GZB A;  2QWS A;  4OPR A;  4KZ9 A;  2KLI A;  2ACG A;  1IYP A;  3MKE A;  5E43 A;  5CER A;  5HL1 A;  1STZ A;  2E8I A;  4OQI A;  3SW1 A;  1PFL A;  4XUZ A;  4EUV A;  3BYD A;  1OTB A;  3IWQ A;  4FH4 A;  2ZC5 B;  2WAE A;  1KE4 A;  4GLQ A;  1MY8 A;  4ZJ3 A;  2B18 A;  1YMS A;  3NOT C;  1HLU P;  3W8K A;  4GKU A;  2Y2Q A;  4ID4 A;  4R0Q A;  3K3C A;  3FG8 A;  2OSU A;  4LEN A;  1ZG6 A;  3ISG A;  4DJ2 A;  5EVI C;  5HD3 A;  3JYI A;  3NOU C;  4EQI A;  4QY5 A;  2M7V A;  1JTD A;  1BLH A;  4KQQ A;  1LL5 A;  3LYX A;  1SKO B;  1DP8 A;  3OPP A;  3C38 A;  4Q0J A;  1PW1 A;  1TS0 A;  4R6L A;  3T4T A;  2WZX A;  4XT2 B;  5CRF A;  4O8G A;  5A8B A;  2FFY A;  3MXR A;  3AGE A;  2PYP A;  1VM1 A;  3G31 A;  3WS2 A;  3T1R A;  3F1O A;  2WKR A;  4WEK A;  5HDS A;  3C4O A;  4PM6 A;  1EWZ A;  4DE1 A;  5DFY A;  3HUN A;  2LB5 A;  1TF1 A;  4WMC D;  5L8M A;  5F6A A;  1TDL A;  1D06 A;  2WAD A;  4UEY A;  5AQA A;  2WKI A;  2GZA A;  3W2Z A;  4BMW A;  2Y2J A;  4Q0H A;  1MWS A;  2CC1 A;  1K6R A;  1XFQ A;  3T50 A;  5EVI A;  3HCY A;  4EET B;  2Y2N A;  2B02 A;  4GCZ A;  2IWC A;  2W0N A;  2VEA A;  1XA7 A;  5HZH A;  1G28 A; 
#chains in the Genus database with same CATH homology
 3D9Y A;  1HLU P;  5FEG A;  3T1S A;  1ACF A;  1SKO A;  3MSH A;  4ESP A;  1PRQ A;  1J3W A;  1D1J A;  1CF0 A;  1VET A;  5FEF A;  2V8C A;  1A0K A;  2JKF A;  4D60 A;  3L7H A;  1FIL A;  1VEU B;  2B95 A;  4X1L A;  2PBD P;  5EVE A;  3NUL A;  3NEC A;  3DAV A;  1SKO B;  4FUW A;  2ZL1 A;  3LGO A;  2ZL1 B;  3CPT A;  3LEQ A;  1VET B;  2VK3 A;  1G5U A;  3T1X A;  2E8J A;  3T1Q B;  3CHW P;  2PAV P;  1F2K A;  3T1R A;  1PNE A;  3UB5 P;  3T12 B;  1CQA A;  4FTX A;  3MS6 A;  3CPT B;  2ACG A;  5FDS A;  3L9K A;  1YPR A;  1Y4O A;  2BTF P;  5EM1 A;  4X1M A;  1FIK A;  5EV0 A;  2PRF A;  4X25 A;  2HZ5 A;  1PFL A;  5EM0 A;  4QWO A;  1K0K A;  1AWI A;  1Z09 A;  3U4L P;  3KYE A;  2JKG A;  1SZV A;  1VEU A;  1CJF A;  2V8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...