2V8SE

Vti1b habc domain - epsinr enth domain complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
137
structure length
137
Chain Sequence
SEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN INTERACTOR 1
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v8sE00
3D9JA 1HG2A 3G2TA 4GZDA 5CMWA 3D9IA 3G2SA 5LOZA 2KM4A 3G2WA 3D9PA 1JUQA 4FU3A 1SZ9A 1DVPA 1ELKA 3D9MA 1INZA 1XGWA 1EYHA 3D9LA 1X5BA 2DCPA 5CMYA 1PY1A 2QY7A 3LDZA 4JXTA 1LF8A 1VDYA 2V8SE 2BF0X 1H0AA 1MHQA 1JWGA 3CLJA 3ZYQA 3ZYLA 1JWFA 1HF8A 3G2UA 1UJKA 1SZAA 4FLBA 2L0IA 3ZYMA 5J08A 1JPLA 4NACA 3D9OA 3ZYKA 4GZCA 1UJJA 4Q94A 1EDUA 1HG5A 1HX8A 3D9KA 3ONLA 4HFGA 3RRUA 4AVXA 3D9NA 4Q96A 2MOWA 3ONKA 3G2VA 2L0TB 5LP0A 2DIWA 1HFAA 2LO6A
chains in the Genus database with same CATH superfamily
1BPOA 4CDMA 2PQNA 3I3NA 2KZTA 4RLYA 2KZTB 5ENSD 4U8YD 3ZHEA 4J8SA 4K0RA 3EHNA 3E4BA 1Y6IA 3L82A 3SFYA 1QNFA 3G2TA 4KYOB 2WPVA 3PZ1A 2KM4A 5LCWJ 4JL0A 4A1GA 4C48B 4JXTA 1LF8A 1YYHA 2ILRA 5BXUA 5HI7A 3CR3A 5CRVA 2CFUA 5BUZA 4AY6A 3B13A 2FF4A 3T8MA 3EHRA 4F7AA 4I1MA 1TN6A 2VSYA 4J0UA 5JJ6A 2GRMA 1AP7A 1XGWA 1X5BA 4F3VA 3N71A 2XPIA 4LSZE 2ETCA 4ILIA 3U66A 1HH8A 3QJZA 2C0MA 4UI9K 2GRQB 4JA7A 2I6HA 3DSSA 1YCSB 3DSWA 1EPUA 1L5JA 3LYAA 5AAOA 4N5QA 5FIOA 2ZU6B 4CYMD 1OCOE 1TNUA 2L9BA 4UI9J 2HR2A 2H6HA 3C98A 3G2UA 3ABME 4LNGA 4ATZD 1HO8A 5G04J 5CECB 2XHEA 5ENOD 5AQ7A 4FLHA 3C3QA 3O4ZA 3LDZA 3C72A 2J07A 2WXJA 2JABA 2XZTG 3FH8A 4K5CA 4N2QA 2L6BA 2ETAA 2OEWA 3UXGA 4L2YA 4HORA 3SD5A 2WXMA 3L54A 1SW6A 3APCA 1W3BA 4JC8A 3MZLB 1KT0A 4BTBA 3GZ2A 5ANRA 3Q5MA 3ZKJA 3Q49B 3MA5A 4YNDA 3TWQA 2DYRE 1N0QA 4F6RD 1BLXB 3JQ0A 1LD7A 3T5XA 3QARA 3PVLA 3UM1A 2QZAA 1NFIE 3S7JA 3LPZA 4Q96A 2HO1A 4L1BA 3APDA 3F6QA 5BV1A 3I4GA 4HRMB 3CQCB 3DEPA 4LNBA 5KJMA 4A3TA 4G25A 4J8YA 4AY5A 4G8KA 4KVOA 1Y8MA 4EBAG 3PE4A 3HXEA 4HS2A 2BKKB 4JEHA 1BD8A 2FO1E 3ZYLA 4I6JA 5FTPA 3IHYA 5FJYA 3RRUA 4FULA 2DIWA 5LOZA 4HRLA 3L17A 3FWVA 5ARFA 4I1AA 3SFZA 1N4QA 4RG6A 3HIZA 4CRWA 2BF0X 2Y69E 1UN8A 3Q7FA 3U3WA 1K1AA 4JVSA 4P29A 1KZPA 3UKUG 4XKCA 2IOLA 3OXGA 2F37A 2QYUA 4L7TA 4M7CA 2CFZA 4XI0A 3B7RL 5KNHD 3UX4A 5IY5E 2PZIA 3LY9A 1UW4B 3SY2A 3G2SA 2WXFA 2ZGDA 4BSZB 1PY1A 4J8FA 5B3SE 3UIOC 3FUKA 3VLDA 2A5EA 3BU8A 2WMOA 3CHOA 2X6HA 3TWVA 2P58C 5EIBE 1TR4A 1ELRA 3E34A 1DVPA 4N39A 2P9IG 2R59A 3TG4A 4GMJA 3RO3A 5BV0A 3FUDA 3L13A 3T9KA 4Y6CA 3UIPC 2P2CP 4ANVA 2RKKA 2PNNA 1OXJA 4A1SA 2FBNA 1D8DA 2PL2A 3CVNA 4MS6A 3KS2A 4URKA 5E75A 5M72A 1DNPA 2GROB 5A7DB 1UOHA 2NYJA 3ISMC 4NRHB 2KCVA 3O48A 4TXPA 2OOEA 1OT8A 1NP7A 3FUHA 4KVMA 5CMWA 2LXMA 4BT8A 2A4ZA 5A6CA 4RG9A 3G2WA 3ZRHA 4FC8A 1OWLA 4B89A 3ZU7B 3DPDA 4MLPA 1KPSB 3Q9UC 2R17C 1DCEA 1LD8A 3FTWA 2OEVA 3AS8A 5A23A 2VQ2A 3PNLB 2EIME 3MV2B 4I1OB 2WXRA 3ZUVB 2QY7A 4MKTA 5EDSA 3CSFA 3VTXA 3J5QB 2QYJA 1ZB1A 1FT2A 2VSOE 4BSXA 4DX1A 2YHEA 3ML9A 3EHMA 3I5PA 3G2VA 5EYPF 3UKRG 3LCAA 4UWLA 1IHBA 4JA9A 3FH5A 5D0OD 3PUJA 4GCOA 4C0EA 4NURA 2VGXA 2VGXB 5KCMA 2ETBA 1A17A 3C3OA 5ENTD 3PZ4A 3D9OA 4GZCA 3HXBA 3PREA 1EDUA 4OYSA 3ZPJA 1HS6A 5AQ9A 3FULA 2JEKA 4CGWA 1N0RA 3KSLA 4BY6A 1TJFA 4KZ0A 3KEAA 4G26A 4F1PA 4EZKA 3RIBA 4F53A 5JJTA 1NA0A 5KBAA 4HFGA 2P9UG 3HHMA 2WXKA 2X3MA 3SBTB 4FU3A 3S7DA 3ZNGA 3BG1B 2FEZA 4MBGA 4H7YA 3ZYQA 2IO3C 3FHEA 3AG4E 3V79K 3TWRA 3HG0D 2KC7A 1TEZA 3D9NA 4U0SA 3PEUB 2XEVA 2RD0A 3JUIA 4O6FA 3CVXA 3RU0A 4L2LA 4GTOA 2R02A 2AWIA 3CHPA 2OVFA 1YA0A 5T8IA 1HG5A 4G24A 4I6EA 2MOWA 4CGVA 3DBSA 4WNEA 4G23A 5CMYA 2PM6A 5CBOA 1DCQA 5CEAA 2FI7A 4FLBA 4EHMA 4TRQA 3D3MA 2P9LG 3FTZA 3TJPA 2VJ8A 4EQFA 3ZW3A 2Y4TA 3CK7A 4EPZA 4W9RA 3LJNA 4GTQA 2EQXA 1TNYA 2ZISA 4CDRA 2EILE 3U9WA 4I2WA 2GGFA 4BERA 2LNIA 1BU9A 1OWPA 5JA4D 2V5QC 1Q2ZA 4LERA 5CHEE 3OTNA 4KBQA 3Q7AA 4DI4A 4G8LA 1TYQG 1JPLA 4IYPA 3ZHEB 2IFUA 4XZ4A 2LSUA 4GTPA 3HXCA 4GTTA 3NOGD 2R5SA 4KXKB 4ME2A 1OCCE 1RZ4A 3Q79A 3VLEA 3Q47B 3QAQA 4XEIG 2WXPA 3QDNA 3S2AA 1Z5SC 2KCLA 3ZYKA 2J08A 2LAHA 2XRYA 1LTXA 1HG2A 2QFCA 4ILGA 4HI9A 1H2UA 3D9PA 3AU5A 1MYOA 4Y6WA 5BPPA 4UUCA 4LG6A 3HXFA 4B93B 4L23A 3NQPA 1SA5A 4YVOA 3BQOA 4APOA 4U63A 5EX0A 3X2QE 1OUVA 3OAWA 5BNWA 3V2XA 2F0YA 3GZSA 3ONLA 1IKND 3JXIA 3P1UA 4AOFA 3CHSA 5T3RA 4BESA 4XX5A 4U8VD 1G3NB 1TNBA 4U8HA 5EKQD 4ZFHA 2KXPC 3ZYMA 3OXFA 4O1PA 1S64A 4DUIA 3EJNA 3ZN3A 3ZXPA 3CK8A 3UT4A 4HVBA 1E7UA 4U96D 2R2LA 4XKBA 3MJWA 3AJIA 3FUMA 2XGSA 3U64A 2IO2C 3AS5A 3SI5A 4CEMA 4UQZA 3B7UX 3GW4A 2EINE 2OV8A 3CEQA 4WWPA 4CT0A 3PZ2A 3FTYA 5AARA 3EU5A 1QBQA 5T4YA 3HDXA 4RVBA 3HRAA 3NZUA 1MQSA 3D9JA 3CVVA 4B0ZA 3DRAA 1E96B 2X38A 3LY7A 4LUNU 4PUCA 3ML8A 2IOSA 2LUHA 3PUKA 5ENRD 2VTBA 1SQMA 2VTBB 4OAVB 2AXZA 2VGYA 4HOSA 5LP0A 3B7SA 3FTXA 3UTMA 2H6FA 4PS7A 5AENA 5JMND 4FJYA 1HU3A 2AVPA 2NC9A 2NXPA 5KNGA 3C5RA 3V2OA 4U0ZA 3DXMG 3VTYA 4NQ0A 5J90A 3ABKE 4GMLA 4N3CA 1HXIA 3UI2A 4GPKA 4D10C 1EYHA 1IHGA 3NZSA 5D2MC 3URZA 1HZ4A 3TWWA 3ESKA 3LXUX 4C0MA 1ZU2A 2J8SD 3LVRE 5AQBA 2F8XK 3JUEA 4K5BA 5LFAA 2P9NG 3NOCD 2WVIA 1P5QA 2L0TB 3QWVA 1H6KA 3FUJA 3DPYA 3CHRA 1N11A 2GRRB 4GU5A 2R05A 3ASNE 3D9HA 1O1RA 3VLFA 3DSXA 1TNOA 3FEYA 5BW8C 2WXIA 2ZXWE 5AYWD 3LVQE 3PS6A 4ANWA 2XRZA 5ITZF 3QWPA 3ULEG 2P9SG 3J5PA 5H7PA 3D9IA 5EN5D 5AIJA 2X6KA 1E8YA 4QFVA 1O1SA 4YDOA 5G05C 1TJCA 4DRXE 4HXIA 5FQ6A 2L0IA 5EILA 4YVQC 4K03A 3CVYA 4J8DA 2V4LA 1HX8A 1E8ZA 5EX3A 4YDYA 3FUNA 1E90A 2PQRA 2XEEA 3MEKA 5FINA 2OVBA 3QK0A 3FUEA 5CCMA 4N5CA 3DSUA 4JW1A 3NAWA 1E7VA 2WXQA 2IY0C 2J09A 3IKOB 3CVUA 3PNTB 4FP7A 3MKQA 3MKQB 1KZOA 4J8EA 3GYZA 5DIZA 3LEWA 3FUIA 2J9QA 5FZSA 3RRMB 1BI7B 2BEDA 3UINC 2LO6A 4EECA 3TAXA 3ZGQA 3DWLG 4AV7A 3AG3E 2RG8A 3ENEA 5JHBA 3RSEG 1RW2A 5DBKA 3AAAC 3FUFA 5AJDA 2VSXE 3B7BA 2X6IA 1SA4A 3V30A 1FCHA 4AVXA 4F1SA 3JXJA 1PAQA 3LJ3A 2MRIA 3E30A 3RKVA 1V54E 4B94A 3EDTB 4JHRA 4DJAA 4WUYA 3JQ1A 1GW6A 4CT4A 1S63A 3RO2A 5BXOA 4U95D 1VDYA 4GAAA 1H19A 4NACA 3UM0A 5G05J 2UY1A 2UY1B 4IN3B 3FTVA 4R7LA 1N9AA 2XZDG 4ILHB 1NA3A 3ASGA 1OWOA 1U3DA 2RFMA 1ZBPA 1FT1A 2X6JA 4DLOA 1QYMA 3IXEA 2I2OA 2LSVA 5ANLA 4HOUA 4I6GA 1H2TC 4BWRA 3HXDA 4U7EB 2E0IA 1ELKA 3UM2A 2B0OE 3IV0A 4DX7D 2NSZA 4AIFA 4ZHBA 3ABLE 5CBNA 3ZFWA 4HNAD 2CHXA 4O60A 4JEUA 3LS8A 3CVWA 4E85A 2XQ0A 3L9TA 4AXHA 3PRZA 3SNXA 4HQDA 1WG0A 3K9IA 5KJLA 4GYWA 2XCCA 4QQIA 3EU9A 2DZNA 3CKBA 1OWMA 1H6PA 3SHFA 4I9CA 1N95A 2OCCE 4J7WA 2IONA 3ZVVA 3AG1E 1JCSA 3ZXSA 2DZOA 1UN9A 2P9KG 1HF8A 2XENA 5D66A 3Q75A 4PS8A 1OCRE 3S7FA 1MX2A 1S70B 3FY4A 5FZQA 3CGHA 3DEOA 1N54A 3CVLA 2WXGA 4HOQA 2RFAA 4LCTA 5FQ7A 4Q94A 4G11A 4ATGA 4EZLA 1OCZE 1IQRA 2KBXA 5CERB 2KATA 1SVXA 2Y3AA 3D9MA 1K1BA 4HLEA 3QNKA 1TN7A 4TV3A 3P2BA 4HBDA 3U4TA 3UT8A 5AJLA 3BG0B 3FDHA 2V0PA 1N52A 3EHQA 4DPRA 2FO7A 3R9AB 4A63B 5KJKA 2DCPA 4I2ZA 2VSNA 2XPYA 3QKYA 2GRLA 3CLJA 3AG2E 3Q9NC 3FU6A 4RSYA 2Y1LE 2GRPB 2XPZA 1A5EA 1UJJA 4X8QA 4HB5A 3FTSA 5HQ8A 5FQ8A 3SGHA 5FQ4A 3ASOE 1BI8B 3UPVA 3ZEFA 3KD7A 4WNFA 4HLLA 2DBAA 4TUUA 4G1TA 3TG5A 1JCQA 2DWZA 2CG3A 1IQUA 2KCKA 2CHZA 5FZRA 2V5FA 1NZNA 4I9EA 3L08A 3MGBA 1N94A 3W9FA 3IBEA 4HRNA 4BT9A 1UJKA 3TWSA 2V4HC 3OXLA 4OVVA 3W9GA 3L16A 2AJAA 1TNZA 2QC9A 4GB9A 1O5MA 2CG2A 3BEEA 3FU5A 4DI3A 1E8XA 3QOUA 1SZ9A 2DVWA 4UWKA 5G55A 1INZA 4M3OA 4PDXA 4IULA 1U3CA 4YDWA 3R9MA 3TWUA 4U04A 4YDEA 3Q4AB 5JJ7A 4UWGA 1FPPA 4DLQA 3E33A 1OY3D 2WM9A 3IEGA 4JPSA 3RK6A 2ZGGA 4J6IA 2WXLA 1MX6A 3CSTA 3WG7E 4BETA 2WQ6A 1H2VC 4UWFA 3SFXA 3B95A 2PM7A 3T5VA 3FP3A 2Q7FA 3EIQC 4I17A 3TL5A 3TXMA 2J4DA 3FU3A 5E76A 3RAUA 1S0PA 4WNGA 3L6AA 4FA6A 4U07A 3GZ1A 1X81A 3CV0A 4GTRA 2Y4UA 4APFA 4ABNA 4PS3A 4GMRA 2YINA 4OVUA 2HYZA 2WMNA 1HE8A 3LKUA 3I4RB 4JB8P 2MHKA 1KLXA 5B1BE 3NF1A 4LNUD 1N4RA 3CKCA 1JWFA 1WDYA 4EBAA 4HOTA 2HM8A 2AW6A 3UT7A 4ANUA 2HE0A 2WB2A 3LY8A 2YHCA 3HVEA 3HVEB 3DSVA 1Z3XA 5KJNA 4CDNA 4DX2A 4BFRA 2A5UA 3Q15A 4AJWA 3R7QA 3PE3A 4C9BB 3V31A 3UM3A 2EIKE 2F8YA 1E8WA 3JCKC 3PDNA 5ARGA 2CHWA 4UQXA 2IF4A 2IEJA 2ONDA 3SBSA 4UQYA 4AP2A 2VYIA 2JLBA 2ZIRA 3ESLA 3C3RA 4V3IA 3Q78A 4NIKA 4CZ2D 1JUQA 4UWHA 2XGOA 3D9LA 4B8CB 4WAFA 3QWWA 5CCLA 1QZ2A 1MJ0A 3FU0A 4N3AA 5J08A 4RQIA 4OAUC 2LXLA 3CQGB 5JHAA 2LAIA 2MYOA 1HFAA 2EIJE 5ENPD 4LRZA 1WY6A 4I43A 2B6CA 1KT1A 1K3ZD 3EUVA 1D8EA 4XI9A 1NI1A 3MV3B 4Z68A 4GPMA 4WWOA 3MX3A 5CEDB 5FT9A 2J4BA 2WXHA 4IRUA 4DX6D 4ACLA 5ENNA 5HKPA 1H6OA 3SO8A 2DYSE 1UG3A 4GA2A 1JWGA 3ZIMA 3APFA 3ULYA 1WAO1 1FVHA 4EZJA 5C2YA 4N3BA 5EYLA 2WQ7A 1ELWA 3D9KA 4BEPA 3ONKA 4TXQA 3IHVA 3RRNB 5HRYA 4WNDA 2AXUA 3JYSA 2YQ8A 4GA1A 3TXNA 3S7BA 1NL4A 4JD2G 3CK9A 3CHMA 2C2LA 2H6GA 3E37A 1IXVA 3MYVA 1B89A 1AWCB 1O1TA 4DX5D 4GZ5A 3TWTA 3UMVA 1WM5A 4LEUA 2IQCA 4GYOA 3FTUA 2J49A 2P9PG 3CIAA 4GZ6A 5CRUA 4FJZA 5KWDA 2VGEA 3E32A 4L9PA 4DK5A 2BKGA 1Z3YA 2IJGX 5EIDA 2L6JA 4N2SA 3MCXA 1MZCA 2UWJG 3DSTA 1IYGA 3KAEA 2XGMA 3TGOA 2BUGA 1EF1C 2E2EA 3EIJA 3ASHA 3HYMB 2XS8A 3AU4A 4GTSA 3FFLA 4AM9A 5BT1A 3ASFA 3R7RA 2I1KA 3BUAA 4XIFA 5D0QD 1MX4A 3UUXA 2XS1A 4G2VA 4AEZC 3NBNB 4MRUA 4A3VA 5LX8A 2R03A 1MHQA 3PH0C 4GA0A 3B7TA 4U0UA 1SZAA 2WQHA 2AXVA 4XE0A 2WXNA 5LCWC 4TUMA 1QQEA 5AQAA 3TWXA 5B1AE 2IU1A 3DXKG 4HI8A 1JCRA 1FVFA 2YNQA 1N4SA 3CVQA 2XEHA 4Q69A 4WWNA 5C1DA 4O1OA 2GRNB 3KSQA 4GTMA 4KT6B 4JZYA 2XCBA 3QC1A 3L22A 3FH7A 3FEXA 4FADA 3AS4A 3ASDA 3KEZA 3NB2A 1TN8A 5ENQD 4FHJA 4FHKA 4KZCA 2GW1A 2V8SE 4JHKA 3ULQA 3T8KA 4GYYA 2H6IA 4TXRA 3SQVA 1V55E 3SF4A 1U2VG 4ACKA 4BX8A 4H7XA 5FWQA 2BTDA 3PEVB 3UQ3A 4GTVA 4UI9C 2I9CA 4E6HA 3CVPA 2X6FA 1PC2A 2FULA 5AN8A 4B8AA 1YMPA 4ANXA 1H0AA 2Y0BG 4JHJA 5G04C 2WXOA 3RJVA 4A55A 2I1JA 3CHQA 4CCAA 4KMOA 1DC2A 4BX9A 4K5AB 3MKRA 1D9SA 4GZDA 2C0LA 1OWNA 3QB2A 4GCNA 2M63A 5G2NA 3SZ7A 4GZ3A 1K8KG 3WXXA 3PZ3A 3PZDA 4BTAA 1XNFA 5HS0A 3Q73A 1N4PA 1Z6TA 4PH4B
chains in the Genus database with same CATH topology
1BPOA 4CDMA 1HS6A 4CGWA 3FULA 2JEKA 3D9IA 5AIJA 2PQNA 2X6KA 4DLQA 4BY6A 1TJFA 3I3NA 1E8YA 4QFVA 3IEGA 2WM9A 4JPSA 4KZ0A 2KZTA 2KZTB 3RK6A 4G26A 4J6IA 5G05C 1TJCA 4HXIA 3ZHEA 4J8SA 2WXLA 2L0IA 5FQ6A 4YVQC 4K0RA 3RIBA 4F53A 4K03A 3CSTA 3CVYA 4J8DA 3EHNA 2V4LA 1NA0A 3E4BA 5JJTA 1HX8A 2WQ6A 1H2VC 4HFGA 1Y6IA 4UWFA 1E8ZA 3HHMA 5EX3A 2PM7A 3T5VA 1QNFA 2WXKA 3FP3A 3G2TA 2Q7FA 4KYOB 3EIQC 2WPVA 4I17A 2X3MA 3SBTB 3FUNA 2KM4A 5LCWJ 4FU3A 3TL5A 4JL0A 3TXMA 3S7DA 2J4DA 4A1GA 3FU3A 5E76A 1S0PA 3BG1B 4WNGA 2FEZA 3L6AA 4JXTA 1LF8A 1E90A 4H7YA 2PQRA 4FA6A 2ILRA 3MEKA 3ZYQA 4U07A 3GZ1A 3FHEA 5HI7A 3CV0A 2OVBA 3CR3A 3QK0A 3FUEA 2CFUA 5BUZA 2Y4UA 4AY6A 3B13A 5CCMA 2KC7A 1TEZA 2FF4A 4N5CA 3T8MA 4APFA 3D9NA 4JW1A 4U0SA 1E7VA 3PEUB 4ABNA 2XEVA 4F7AA 2RD0A 4PS3A 2WXQA 2VSYA 4I1MA 4J0UA 5JJ6A 2YINA 4OVUA 2HYZA 2GRMA 2WMNA 1HE8A 3LKUA 3I4RB 2J09A 3IKOB 3JUIA 1XGWA 2MHKA 1X5BA 4O6FA 4F3VA 1KLXA 3NF1A 3CVUA 3CKCA 3N71A 3PNTB 4FP7A 3CVXA 3RU0A 1JWFA 2XPIA 3MKQA 3MKQB 4ILIA 3U66A 4J8EA 1HH8A 3GYZA 4L2LA 4EBAA 5DIZA 3LEWA 3QJZA 2AWIA 2J9QA 3FUIA 2HM8A 5FZSA 2C0MA 4UI9K 3CHPA 3RRMB 4HOTA 4JA7A 2OVFA 1YA0A 5T8IA 1HG5A 2AW6A 4G24A 2I6HA 4I6EA 2MOWA 3UT7A 4CGVA 2LO6A 4ANUA 1EPUA 4EECA 1L5JA 2WB2A 3DBSA 3LY8A 3TAXA 3LYAA 3ZGQA 2YHCA 4AV7A 2ZU6B 3HVEA 4G23A 3HVEB 2PM6A 4WNEA 5CMYA 2L9BA 2RG8A 4UI9J 3ENEA 1Z3XA 5JHBA 4CDNA 5KJNA 4BFRA 2HR2A 5DBKA 3C98A 3FUFA 5LP0A 5AJDA 2FI7A 2VSXE 3G2UA 4FLBA 2A5UA 3Q15A 2X6IA 4TRQA 1HO8A 4AJWA 1FCHA 3D3MA 3R7QA 5G04J 3FTZA 3PE3A 4C9BB 3TJPA 4AVXA 2VJ8A 4F1SA 4EQFA 2XHEA 3ZW3A 2Y4TA 1PAQA 3CK7A 4FLHA 3LJ3A 3O4ZA 3LDZA 1E8WA 2J07A 2WXJA 3JCKC 3PDNA 3FH8A 5ARGA 4EPZA 2CHWA 4W9RA 4N2QA 2EQXA 4UQXA 2IF4A 2MRIA 2ONDA 4CDRA 3RKVA 3SBSA 4UQYA 4L2YA 4B94A 4HORA 3EDTB 3SD5A 4AP2A 2VYIA 2WXMA 2JLBA 3L54A 4JHRA 3U9WA 4DJAA 4WUYA 3ESLA 4I2WA 2GGFA 3APCA 1W3BA 2LNIA 4JC8A 3JQ1A 4V3IA 3MZLB 1KT0A 1OWPA 4BTBA 3GZ2A 1GW6A 5ANRA 1JUQA 4LERA 3Q5MA 4UWHA 4CT4A 2XGOA 5CHEE 3D9LA 4B8CB 3RO2A 3Q49B 4WAFA 3QWWA 3MA5A 3OTNA 1VDYA 4KBQA 4YNDA 5CCLA 4GAAA 4DI4A 1QZ2A 3JQ0A 3T5XA 1H19A 3FU0A 3QARA 4N3AA 5J08A 1JPLA 3PVLA 4IYPA 2IFUA 4NACA 4XZ4A 3ZHEB 3CQGB 2LSUA 5G05J 5JHAA 2UY1A 2UY1B 4IN3B 3S7JA 2LAIA 3FTVA 3LPZA 4Q96A 2R5SA 4KXKB 4ME2A 2HO1A 4R7LA 1HFAA 4L1BA 3APDA 5BV1A 3I4GA 4LRZA 1WY6A 4I43A 1KT1A 3VLEA 3Q47B 3QAQA 4ILHB 1NA3A 3CQCB 3ASGA 4XI9A 3MV3B 2WXPA 1OWOA 3QDNA 4WWOA 5KJMA 3MX3A 4A3TA 1U3DA 3S2AA 5FT9A 2J4BA 2KCLA 2WXHA 4G25A 4IRUA 1ZBPA 2X6JA 3ZYKA 4ACLA 4DLOA 5ENNA 4AY5A 2J08A 2I2OA 2LSVA 2LAHA 4HOUA 5ANLA 2XRYA 4KVOA 1HG2A 2QFCA 1Y8MA 4I6GA 1H2TC 4EBAG 3PE4A 4ILGA 4BWRA 1H2UA 3D9PA 2E0IA 4HS2A 1ELKA 1UG3A 3AU5A 3IV0A 4GA2A 4JEHA 4Y6WA 5BPPA 2NSZA 4AIFA 1JWGA 3ZIMA 3APFA 4EZKA 1WAO1 3ZYLA 1FVHA 3ZFWA 4EZJA 2CHXA 4I6JA 5C2YA 4JEUA 4N3BA 3LS8A 5FTPA 3CVWA 4L23A 3IHYA 5FJYA 2WQ7A 1ELWA 4E85A 3D9KA 2XQ0A 3NQPA 3RRUA 4AXHA 3ONKA 3PRZA 4FULA 3IHVA 2DIWA 5LOZA 3RRNB 4YVOA 3SNXA 3L17A 3FWVA 4WNDA 5ARFA 2AXUA 3K9IA 4I1AA 3SFZA 5KJLA 4RG6A 3JYSA 2YQ8A 4GA1A 4GYWA 4U63A 3TXNA 4APOA 3S7BA 2XCCA 5EX0A 3HIZA 1OUVA 3OAWA 4CRWA 2BF0X 3CK9A 5BNWA 3CHMA 1UN8A 2C2LA 3CKBA 1OWMA 3SHFA 3U3WA 3GZSA 4JVSA 3ONLA 3MYVA 1B89A 4P29A 3P1UA 4I9CA 4AOFA 3CHSA 4GZ5A 4XKCA 5T3RA 2IOLA 2IONA 3UMVA 3ZVVA 1WM5A 4LEUA 4XX5A 2IQCA 3ZXSA 3OXGA 4GYOA 1UN9A 3FTUA 4L7TA 2J49A 2CFZA 4XI0A 3CIAA 4U8HA 4GZ6A 3B7RL 1HF8A 4FJZA 5EKQD 3UX4A 3ZYMA 3OXFA 4PS8A 4DK5A 2PZIA 3LY9A 1Z3YA 1UW4B 3S7FA 3EJNA 3ZN3A 2IJGX 3FY4A 2L6JA 4N2SA 3MCXA 2UWJG 1IYGA 3KAEA 5FZQA 2XGMA 3CGHA 3CK8A 3UT4A 3G2SA 3TGOA 2BUGA 4HVBA 1EF1C 1N54A 2WXFA 1E7UA 2E2EA 3EIJA 1PY1A 4J8FA 3ASHA 3HYMB 4XKBA 3FUKA 3CVLA 3MJWA 3VLDA 3AU4A 3FFLA 4AM9A 3FUMA 5BT1A 3ASFA 3R7RA 2WMOA 2WXGA 3CHOA 4HOQA 4LCTA 2X6HA 2XGSA 5FQ7A 4Q94A 4G11A 2I1KA 3AS5A 3SI5A 3U64A 4XIFA 4UQZA 5D0QD 4ATGA 3B7UX 4CEMA 4EZLA 3GW4A 1IQRA 3UUXA 2KATA 2P58C 2OV8A 3CEQA 4G2VA 4AEZC 1ELRA 2Y3AA 1DVPA 3D9MA 4WWPA 4CT0A 4HLEA 3QNKA 4N39A 4MRUA 4A3VA 5LX8A 4TV3A 3P2BA 2R59A 3U4TA 3UT8A 3FTYA 3TG4A 5AJLA 4GMJA 3RO3A 5BV0A 1MHQA 3PH0C 3FUDA 4GA0A 3L13A 3B7TA 4U0UA 4Y6CA 5T4YA 1SZAA 2WQHA 3BG0B 2AXVA 3HDXA 4RVBA 4ANVA 4XE0A 3FDHA 2WXNA 5LCWC 2V0PA 4A1SA 1N52A 3NZUA 1MQSA 2FBNA 1QQEA 2PL2A 4DPRA 3D9JA 2IU1A 2FO7A 3CVNA 4MS6A 3KS2A 4URKA 1FVFA 3R9AB 3CVVA 2YNQA 4B0ZA 5KJKA 3CVQA 1E96B 2DCPA 4I2ZA 2X38A 3LY7A 2VSNA 5E75A 4Q69A 4LUNU 4PUCA 2XPYA 5M72A 3QKYA 4WWNA 1DNPA 2GRLA 3CLJA 3ML8A 5A7DB 2IOSA 3PUKA 3FU6A 5C1DA 4NRHB 2VTBA 2KCVA 3O48A 1SQMA 4RSYA 2VTBB 2AXZA 2OOEA 2XPZA 4KT6B 2VGYA 1UJJA 4JZYA 1NP7A 2XCBA 3QC1A 3FUHA 4HOSA 4KVMA 3L22A 5CMWA 3FTSA 5HQ8A 3B7SA 5FQ8A 3SGHA 3FTXA 4BT8A 3FH7A 3FEXA 2A4ZA 5FQ4A 4FADA 5A6CA 3AS4A 3ASDA 3KEZA 4PS7A 4RG9A 3G2WA 3ZRHA 4FC8A 1OWLA 4B89A 5AENA 4FHJA 4FHKA 4FJYA 4KZCA 3DPDA 1HU3A 3UPVA 2GW1A 3ZEFA 4MLPA 2AVPA 3KD7A 4WNFA 2V8SE 4JHKA 3ULQA 2DBAA 2NC9A 2NXPA 4GYYA 4TUUA 4G1TA 3TG5A 3SF4A 2R17C 2CG3A 1IQUA 4ACKA 4U0ZA 4BX8A 2KCKA 4H7XA 5FWQA 2BTDA 2CHZA 5FZRA 3FTWA 4NQ0A 3VTYA 3PEVB 5J90A 2V5FA 4GMLA 4N3CA 3UQ3A 4UI9C 1HXIA 4GPKA 1NZNA 2I9CA 4D10C 4E6HA 3AS8A 4I9EA 2VQ2A 3PNLB 3L08A 3MGBA 5A23A 3CVPA 2X6FA 1EYHA 3MV2B 1IHGA 3NZSA 1PC2A 4I1OB 2WXRA 2FULA 2QY7A 4MKTA 5EDSA 4B8AA 3CSFA 1HZ4A 3URZA 4ANXA 3IBEA 1H0AA 4JHJA 3ESKA 5G04C 3VTXA 2WXOA 3LXUX 4C0MA 3RJVA 1ZU2A 3LVRE 1UJKA 4BT9A 3OXLA 4OVVA 4A55A 3L16A 2I1JA 2VSOE 3CHQA 4CCAA 5LFAA 4KMOA 4BSXA 4GB9A 2CG2A 3BEEA 2WVIA 2YHEA 1P5QA 3EHMA 3ML9A 3FU5A 3I5PA 3G2VA 2L0TB 4DI3A 4BX9A 3MKRA 3LCAA 4GZDA 1E8XA 2C0LA 3QWVA 1H6KA 4UWLA 3QOUA 3FUJA 1SZ9A 4UWKA 5G55A 1OWNA 1INZA 3CHRA 4M3OA 3QB2A 4GCNA 4PDXA 2M63A 4GU5A 4JA9A 3FH5A 5D0OD 3PUJA 5G2NA 3SZ7A 4GZ3A 4GCOA 4C0EA 4NURA 3VLFA 4IULA 3WXXA 1U3CA 2VGXA 3FEYA 3PZDA 2VGXB 2WXIA 5BW8C 4BTAA 5KCMA 1A17A 4U04A 5AYWD 3LVQE 3Q4AB 3D9OA 5JJ7A 1XNFA 3PS6A 4GZCA 3PREA 1EDUA 1Z6TA 4ANWA 4OYSA 4PH4B 2XRZA 4UWGA 3QWPA 3ZPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9J A;  1HG2 A;  3G2T A;  4GZD A;  5CMW A;  3D9I A;  3G2S A;  5LOZ A;  2KM4 A;  3G2W A;  3D9P A;  1JUQ A;  4FU3 A;  1SZ9 A;  1DVP A;  1ELK A;  3D9M A;  1INZ A;  1XGW A;  1EYH A;  3D9L A;  1X5B A;  2DCP A;  5CMY A;  1PY1 A;  2QY7 A;  3LDZ A;  4JXT A;  1LF8 A;  1VDY A;  2V8S E;  2BF0 X;  1H0A A;  1MHQ A;  1JWG A;  3CLJ A;  3ZYQ A;  3ZYL A;  1JWF A;  1HF8 A;  3G2U A;  1UJK A;  1SZA A;  4FLB A;  2L0I A;  3ZYM A;  5J08 A;  1JPL A;  4NAC A;  3D9O A;  3ZYK A;  4GZC A;  1UJJ A;  4Q94 A;  1EDU A;  1HG5 A;  1HX8 A;  3D9K A;  3ONL A;  4HFG A;  3RRU A;  4AVX A;  3D9N A;  4Q96 A;  2MOW A;  3ONK A;  3G2V A;  2L0T B;  5LP0 A;  2DIW A;  1HFA A;  2LO6 A; 
#chains in the Genus database with same CATH topology
 1BPO A;  4CDM A;  2PQN A;  3I3N A;  2KZT A;  4RLY A;  2KZT B;  5ENS D;  4U8Y D;  3ZHE A;  4J8S A;  4K0R A;  3EHN A;  3E4B A;  1Y6I A;  3L82 A;  3SFY A;  1QNF A;  3G2T A;  4KYO B;  2WPV A;  3PZ1 A;  2KM4 A;  5LCW J;  4JL0 A;  4A1G A;  4C48 B;  4JXT A;  1LF8 A;  1YYH A;  2ILR A;  5BXU A;  5HI7 A;  3CR3 A;  5CRV A;  2CFU A;  5BUZ A;  4AY6 A;  3B13 A;  2FF4 A;  3T8M A;  3EHR A;  4F7A A;  4I1M A;  1TN6 A;  2VSY A;  4J0U A;  5JJ6 A;  2GRM A;  1AP7 A;  1XGW A;  1X5B A;  4F3V A;  3N71 A;  2XPI A;  4LSZ E;  2ETC A;  4ILI A;  3U66 A;  1HH8 A;  3QJZ A;  2C0M A;  4UI9 K;  2GRQ B;  4JA7 A;  2I6H A;  3DSS A;  1YCS B;  3DSW A;  1EPU A;  1L5J A;  3LYA A;  5AAO A;  4N5Q A;  5FIO A;  2ZU6 B;  4CYM D;  1OCO E;  1TNU A;  2L9B A;  4UI9 J;  2HR2 A;  2H6H A;  3C98 A;  3G2U A;  3ABM E;  4LNG A;  4ATZ D;  1HO8 A;  5G04 J;  5CEC B;  2XHE A;  5ENO D;  5AQ7 A;  4FLH A;  3C3Q A;  3O4Z A;  3LDZ A;  3C72 A;  2J07 A;  2WXJ A;  2JAB A;  2XZT G;  3FH8 A;  4K5C A;  4N2Q A;  2L6B A;  2ETA A;  2OEW A;  3UXG A;  4L2Y A;  4HOR A;  3SD5 A;  2WXM A;  3L54 A;  1SW6 A;  3APC A;  1W3B A;  4JC8 A;  3MZL B;  1KT0 A;  4BTB A;  3GZ2 A;  5ANR A;  3Q5M A;  3ZKJ A;  3Q49 B;  3MA5 A;  4YND A;  3TWQ A;  2DYR E;  1N0Q A;  4F6R D;  1BLX B;  3JQ0 A;  1LD7 A;  3T5X A;  3QAR A;  3PVL A;  3UM1 A;  2QZA A;  1NFI E;  3S7J A;  3LPZ A;  4Q96 A;  2HO1 A;  4L1B A;  3APD A;  3F6Q A;  5BV1 A;  3I4G A;  4HRM B;  3CQC B;  3DEP A;  4LNB A;  5KJM A;  4A3T A;  4G25 A;  4J8Y A;  4AY5 A;  4G8K A;  4KVO A;  1Y8M A;  4EBA G;  3PE4 A;  3HXE A;  4HS2 A;  2BKK B;  4JEH A;  1BD8 A;  2FO1 E;  3ZYL A;  4I6J A;  5FTP A;  3IHY A;  5FJY A;  3RRU A;  4FUL A;  2DIW A;  5LOZ A;  4HRL A;  3L17 A;  3FWV A;  5ARF A;  4I1A A;  3SFZ A;  1N4Q A;  4RG6 A;  3HIZ A;  4CRW A;  2BF0 X;  2Y69 E;  1UN8 A;  3Q7F A;  3U3W A;  1K1A A;  4JVS A;  4P29 A;  1KZP A;  3UKU G;  4XKC A;  2IOL A;  3OXG A;  2F37 A;  2QYU A;  4L7T A;  4M7C A;  2CFZ A;  4XI0 A;  3B7R L;  5KNH D;  3UX4 A;  5IY5 E;  2PZI A;  3LY9 A;  1UW4 B;  3SY2 A;  3G2S A;  2WXF A;  2ZGD A;  4BSZ B;  1PY1 A;  4J8F A;  5B3S E;  3UIO C;  3FUK A;  3VLD A;  2A5E A;  3BU8 A;  2WMO A;  3CHO A;  2X6H A;  3TWV A;  2P58 C;  5EIB E;  1TR4 A;  1ELR A;  3E34 A;  1DVP A;  4N39 A;  2P9I G;  2R59 A;  3TG4 A;  4GMJ A;  3RO3 A;  5BV0 A;  3FUD A;  3L13 A;  3T9K A;  4Y6C A;  3UIP C;  2P2C P;  4ANV A;  2RKK A;  2PNN A;  1OXJ A;  4A1S A;  2FBN A;  1D8D A;  2PL2 A;  3CVN A;  4MS6 A;  3KS2 A;  4URK A;  5E75 A;  5M72 A;  1DNP A;  2GRO B;  5A7D B;  1UOH A;  2NYJ A;  3ISM C;  4NRH B;  2KCV A;  3O48 A;  4TXP A;  2OOE A;  1OT8 A;  1NP7 A;  3FUH A;  4KVM A;  5CMW A;  2LXM A;  4BT8 A;  2A4Z A;  5A6C A;  4RG9 A;  3G2W A;  3ZRH A;  4FC8 A;  1OWL A;  4B89 A;  3ZU7 B;  3DPD A;  4MLP A;  1KPS B;  3Q9U C;  2R17 C;  1DCE A;  1LD8 A;  3FTW A;  2OEV A;  3AS8 A;  5A23 A;  2VQ2 A;  3PNL B;  2EIM E;  3MV2 B;  4I1O B;  2WXR A;  3ZUV B;  2QY7 A;  4MKT A;  5EDS A;  3CSF A;  3VTX A;  3J5Q B;  2QYJ A;  1ZB1 A;  1FT2 A;  2VSO E;  4BSX A;  4DX1 A;  2YHE A;  3ML9 A;  3EHM A;  3I5P A;  3G2V A;  5EYP F;  3UKR G;  3LCA A;  4UWL A;  1IHB A;  4JA9 A;  3FH5 A;  5D0O D;  3PUJ A;  4GCO A;  4C0E A;  4NUR A;  2VGX A;  2VGX B;  5KCM A;  2ETB A;  1A17 A;  3C3O A;  5ENT D;  3PZ4 A;  3D9O A;  4GZC A;  3HXB A;  3PRE A;  1EDU A;  4OYS A;  3ZPJ A;  1HS6 A;  5AQ9 A;  3FUL A;  2JEK A;  4CGW A;  1N0R A;  3KSL A;  4BY6 A;  1TJF A;  4KZ0 A;  3KEA A;  4G26 A;  4F1P A;  4EZK A;  3RIB A;  4F53 A;  5JJT A;  1NA0 A;  5KBA A;  4HFG A;  2P9U G;  3HHM A;  2WXK A;  2X3M A;  3SBT B;  4FU3 A;  3S7D A;  3ZNG A;  3BG1 B;  2FEZ A;  4MBG A;  4H7Y A;  3ZYQ A;  2IO3 C;  3FHE A;  3AG4 E;  3V79 K;  3TWR A;  3HG0 D;  2KC7 A;  1TEZ A;  3D9N A;  4U0S A;  3PEU B;  2XEV A;  2RD0 A;  3JUI A;  4O6F A;  3CVX A;  3RU0 A;  4L2L A;  4GTO A;  2R02 A;  2AWI A;  3CHP A;  2OVF A;  1YA0 A;  5T8I A;  1HG5 A;  4G24 A;  4I6E A;  2MOW A;  4CGV A;  3DBS A;  4WNE A;  4G23 A;  5CMY A;  2PM6 A;  5CBO A;  1DCQ A;  5CEA A;  2FI7 A;  4FLB A;  4EHM A;  4TRQ A;  3D3M A;  2P9L G;  3FTZ A;  3TJP A;  2VJ8 A;  4EQF A;  3ZW3 A;  2Y4T A;  3CK7 A;  4EPZ A;  4W9R A;  3LJN A;  4GTQ A;  2EQX A;  1TNY A;  2ZIS A;  4CDR A;  2EIL E;  3U9W A;  4I2W A;  2GGF A;  4BER A;  2LNI A;  1BU9 A;  1OWP A;  5JA4 D;  2V5Q C;  1Q2Z A;  4LER A;  5CHE E;  3OTN A;  4KBQ A;  3Q7A A;  4DI4 A;  4G8L A;  1TYQ G;  1JPL A;  4IYP A;  3ZHE B;  2IFU A;  4XZ4 A;  2LSU A;  4GTP A;  3HXC A;  4GTT A;  3NOG D;  2R5S A;  4KXK B;  4ME2 A;  1OCC E;  1RZ4 A;  3Q79 A;  3VLE A;  3Q47 B;  3QAQ A;  4XEI G;  2WXP A;  3QDN A;  3S2A A;  1Z5S C;  2KCL A;  3ZYK A;  2J08 A;  2LAH A;  2XRY A;  1LTX A;  1HG2 A;  2QFC A;  4ILG A;  4HI9 A;  1H2U A;  3D9P A;  3AU5 A;  1MYO A;  4Y6W A;  5BPP A;  4UUC A;  4LG6 A;  3HXF A;  4B93 B;  4L23 A;  3NQP A;  1SA5 A;  4YVO A;  3BQO A;  4APO A;  4U63 A;  5EX0 A;  3X2Q E;  1OUV A;  3OAW A;  5BNW A;  3V2X A;  2F0Y A;  3GZS A;  3ONL A;  1IKN D;  3JXI A;  3P1U A;  4AOF A;  3CHS A;  5T3R A;  4BES A;  4XX5 A;  4U8V D;  1G3N B;  1TNB A;  4U8H A;  5EKQ D;  4ZFH A;  2KXP C;  3ZYM A;  3OXF A;  4O1P A;  1S64 A;  4DUI A;  3EJN A;  3ZN3 A;  3ZXP A;  3CK8 A;  3UT4 A;  4HVB A;  1E7U A;  4U96 D;  2R2L A;  4XKB A;  3MJW A;  3AJI A;  3FUM A;  2XGS A;  3U64 A;  2IO2 C;  3AS5 A;  3SI5 A;  4CEM A;  4UQZ A;  3B7U X;  3GW4 A;  2EIN E;  2OV8 A;  3CEQ A;  4WWP A;  4CT0 A;  3PZ2 A;  3FTY A;  5AAR A;  3EU5 A;  1QBQ A;  5T4Y A;  3HDX A;  4RVB A;  3HRA A;  3NZU A;  1MQS A;  3D9J A;  3CVV A;  4B0Z A;  3DRA A;  1E96 B;  2X38 A;  3LY7 A;  4LUN U;  4PUC A;  3ML8 A;  2IOS A;  2LUH A;  3PUK A;  5ENR D;  2VTB A;  1SQM A;  2VTB B;  4OAV B;  2AXZ A;  2VGY A;  4HOS A;  5LP0 A;  3B7S A;  3FTX A;  3UTM A;  2H6F A;  4PS7 A;  5AEN A;  5JMN D;  4FJY A;  1HU3 A;  2AVP A;  2NC9 A;  2NXP A;  5KNG A;  3C5R A;  3V2O A;  4U0Z A;  3DXM G;  3VTY A;  4NQ0 A;  5J90 A;  3ABK E;  4GML A;  4N3C A;  1HXI A;  3UI2 A;  4GPK A;  4D10 C;  1EYH A;  1IHG A;  3NZS A;  5D2M C;  3URZ A;  1HZ4 A;  3TWW A;  3ESK A;  3LXU X;  4C0M A;  1ZU2 A;  2J8S D;  3LVR E;  5AQB A;  2F8X K;  3JUE A;  4K5B A;  5LFA A;  2P9N G;  3NOC D;  2WVI A;  1P5Q A;  2L0T B;  3QWV A;  1H6K A;  3FUJ A;  3DPY A;  3CHR A;  1N11 A;  2GRR B;  4GU5 A;  2R05 A;  3ASN E;  3D9H A;  1O1R A;  3VLF A;  3DSX A;  1TNO A;  3FEY A;  5BW8 C;  2WXI A;  2ZXW E;  5AYW D;  3LVQ E;  3PS6 A;  4ANW A;  2XRZ A;  5ITZ F;  3QWP A;  3ULE G;  2P9S G;  3J5P A;  5H7P A;  3D9I A;  5EN5 D;  5AIJ A;  2X6K A;  1E8Y A;  4QFV A;  1O1S A;  4YDO A;  5G05 C;  1TJC A;  4DRX E;  4HXI A;  5FQ6 A;  2L0I A;  5EIL A;  4YVQ C;  4K03 A;  3CVY A;  4J8D A;  2V4L A;  1HX8 A;  1E8Z A;  5EX3 A;  4YDY A;  3FUN A;  1E90 A;  2PQR A;  2XEE A;  3MEK A;  5FIN A;  2OVB A;  3QK0 A;  3FUE A;  5CCM A;  4N5C A;  3DSU A;  4JW1 A;  3NAW A;  1E7V A;  2WXQ A;  2IY0 C;  2J09 A;  3IKO B;  3CVU A;  3PNT B;  4FP7 A;  3MKQ A;  3MKQ B;  1KZO A;  4J8E A;  3GYZ A;  5DIZ A;  3LEW A;  3FUI A;  2J9Q A;  5FZS A;  3RRM B;  1BI7 B;  2BED A;  3UIN C;  2LO6 A;  4EEC A;  3TAX A;  3ZGQ A;  3DWL G;  4AV7 A;  3AG3 E;  2RG8 A;  3ENE A;  5JHB A;  3RSE G;  1RW2 A;  5DBK A;  3AAA C;  3FUF A;  5AJD A;  2VSX E;  3B7B A;  2X6I A;  1SA4 A;  3V30 A;  1FCH A;  4AVX A;  4F1S A;  3JXJ A;  1PAQ A;  3LJ3 A;  2MRI A;  3E30 A;  3RKV A;  1V54 E;  4B94 A;  3EDT B;  4JHR A;  4DJA A;  4WUY A;  3JQ1 A;  1GW6 A;  4CT4 A;  1S63 A;  3RO2 A;  5BXO A;  4U95 D;  1VDY A;  4GAA A;  1H19 A;  4NAC A;  3UM0 A;  5G05 J;  2UY1 A;  2UY1 B;  4IN3 B;  3FTV A;  4R7L A;  1N9A A;  2XZD G;  4ILH B;  1NA3 A;  3ASG A;  1OWO A;  1U3D A;  2RFM A;  1ZBP A;  1FT1 A;  2X6J A;  4DLO A;  1QYM A;  3IXE A;  2I2O A;  2LSV A;  5ANL A;  4HOU A;  4I6G A;  1H2T C;  4BWR A;  3HXD A;  4U7E B;  2E0I A;  1ELK A;  3UM2 A;  2B0O E;  3IV0 A;  4DX7 D;  2NSZ A;  4AIF A;  4ZHB A;  3ABL E;  5CBN A;  3ZFW A;  4HNA D;  2CHX A;  4O60 A;  4JEU A;  3LS8 A;  3CVW A;  4E85 A;  2XQ0 A;  3L9T A;  4AXH A;  3PRZ A;  3SNX A;  4HQD A;  1WG0 A;  3K9I A;  5KJL A;  4GYW A;  2XCC A;  4QQI A;  3EU9 A;  2DZN A;  3CKB A;  1OWM A;  1H6P A;  3SHF A;  4I9C A;  1N95 A;  2OCC E;  4J7W A;  2ION A;  3ZVV A;  3AG1 E;  1JCS A;  3ZXS A;  2DZO A;  1UN9 A;  2P9K G;  1HF8 A;  2XEN A;  5D66 A;  3Q75 A;  4PS8 A;  1OCR E;  3S7F A;  1MX2 A;  1S70 B;  3FY4 A;  5FZQ A;  3CGH A;  3DEO A;  1N54 A;  3CVL A;  2WXG A;  4HOQ A;  2RFA A;  4LCT A;  5FQ7 A;  4Q94 A;  4G11 A;  4ATG A;  4EZL A;  1OCZ E;  1IQR A;  2KBX A;  5CER B;  2KAT A;  1SVX A;  2Y3A A;  3D9M A;  1K1B A;  4HLE A;  3QNK A;  1TN7 A;  4TV3 A;  3P2B A;  4HBD A;  3U4T A;  3UT8 A;  5AJL A;  3BG0 B;  3FDH A;  2V0P A;  1N52 A;  3EHQ A;  4DPR A;  2FO7 A;  3R9A B;  4A63 B;  5KJK A;  2DCP A;  4I2Z A;  2VSN A;  2XPY A;  3QKY A;  2GRL A;  3CLJ A;  3AG2 E;  3Q9N C;  3FU6 A;  4RSY A;  2Y1L E;  2GRP B;  2XPZ A;  1A5E A;  1UJJ A;  4X8Q A;  4HB5 A;  3FTS A;  5HQ8 A;  5FQ8 A;  3SGH A;  5FQ4 A;  3ASO E;  1BI8 B;  3UPV A;  3ZEF A;  3KD7 A;  4WNF A;  4HLL A;  2DBA A;  4TUU A;  4G1T A;  3TG5 A;  1JCQ A;  2DWZ A;  2CG3 A;  1IQU A;  2KCK A;  2CHZ A;  5FZR A;  2V5F A;  1NZN A;  4I9E A;  3L08 A;  3MGB A;  1N94 A;  3W9F A;  3IBE A;  4HRN A;  4BT9 A;  1UJK A;  3TWS A;  2V4H C;  3OXL A;  4OVV A;  3W9G A;  3L16 A;  2AJA A;  1TNZ A;  2QC9 A;  4GB9 A;  1O5M A;  2CG2 A;  3BEE A;  3FU5 A;  4DI3 A;  1E8X A;  3QOU A;  1SZ9 A;  2DVW A;  4UWK A;  5G55 A;  1INZ A;  4M3O A;  4PDX A;  4IUL A;  1U3C A;  4YDW A;  3R9M A;  3TWU A;  4U04 A;  4YDE A;  3Q4A B;  5JJ7 A;  4UWG A;  1FPP A;  4DLQ A;  3E33 A;  1OY3 D;  2WM9 A;  3IEG A;  4JPS A;  3RK6 A;  2ZGG A;  4J6I A;  2WXL A;  1MX6 A;  3CST A;  3WG7 E;  4BET A;  2WQ6 A;  1H2V C;  4UWF A;  3SFX A;  3B95 A;  2PM7 A;  3T5V A;  3FP3 A;  2Q7F A;  3EIQ C;  4I17 A;  3TL5 A;  3TXM A;  2J4D A;  3FU3 A;  5E76 A;  3RAU A;  1S0P A;  4WNG A;  3L6A A;  4FA6 A;  4U07 A;  3GZ1 A;  1X81 A;  3CV0 A;  4GTR A;  2Y4U A;  4APF A;  4ABN A;  4PS3 A;  4GMR A;  2YIN A;  4OVU A;  2HYZ A;  2WMN A;  1HE8 A;  3LKU A;  3I4R B;  4JB8 P;  2MHK A;  1KLX A;  5B1B E;  3NF1 A;  4LNU D;  1N4R A;  3CKC A;  1JWF A;  1WDY A;  4EBA A;  4HOT A;  2HM8 A;  2AW6 A;  3UT7 A;  4ANU A;  2HE0 A;  2WB2 A;  3LY8 A;  2YHC A;  3HVE A;  3HVE B;  3DSV A;  1Z3X A;  5KJN A;  4CDN A;  4DX2 A;  4BFR A;  2A5U A;  3Q15 A;  4AJW A;  3R7Q A;  3PE3 A;  4C9B B;  3V31 A;  3UM3 A;  2EIK E;  2F8Y A;  1E8W A;  3JCK C;  3PDN A;  5ARG A;  2CHW A;  4UQX A;  2IF4 A;  2IEJ A;  2OND A;  3SBS A;  4UQY A;  4AP2 A;  2VYI A;  2JLB A;  2ZIR A;  3ESL A;  3C3R A;  4V3I A;  3Q78 A;  4NIK A;  4CZ2 D;  1JUQ A;  4UWH A;  2XGO A;  3D9L A;  4B8C B;  4WAF A;  3QWW A;  5CCL A;  1QZ2 A;  1MJ0 A;  3FU0 A;  4N3A A;  5J08 A;  4RQI A;  4OAU C;  2LXL A;  3CQG B;  5JHA A;  2LAI A;  2MYO A;  1HFA A;  2EIJ E;  5ENP D;  4LRZ A;  1WY6 A;  4I43 A;  2B6C A;  1KT1 A;  1K3Z D;  3EUV A;  1D8E A;  4XI9 A;  1NI1 A;  3MV3 B;  4Z68 A;  4GPM A;  4WWO A;  3MX3 A;  5CED B;  5FT9 A;  2J4B A;  2WXH A;  4IRU A;  4DX6 D;  4ACL A;  5ENN A;  5HKP A;  1H6O A;  3SO8 A;  2DYS E;  1UG3 A;  4GA2 A;  1JWG A;  3ZIM A;  3APF A;  3ULY A;  1WAO 1;  1FVH A;  4EZJ A;  5C2Y A;  4N3B A;  5EYL A;  2WQ7 A;  1ELW A;  3D9K A;  4BEP A;  3ONK A;  4TXQ A;  3IHV A;  3RRN B;  5HRY A;  4WND A;  2AXU A;  3JYS A;  2YQ8 A;  4GA1 A;  3TXN A;  3S7B A;  1NL4 A;  4JD2 G;  3CK9 A;  3CHM A;  2C2L A;  2H6G A;  3E37 A;  1IXV A;  3MYV A;  1B89 A;  1AWC B;  1O1T A;  4DX5 D;  4GZ5 A;  3TWT A;  3UMV A;  1WM5 A;  4LEU A;  2IQC A;  4GYO A;  3FTU A;  2J49 A;  2P9P G;  3CIA A;  4GZ6 A;  5CRU A;  4FJZ A;  5KWD A;  2VGE A;  3E32 A;  4L9P A;  4DK5 A;  2BKG A;  1Z3Y A;  2IJG X;  5EID A;  2L6J A;  4N2S A;  3MCX A;  1MZC A;  2UWJ G;  3DST A;  1IYG A;  3KAE A;  2XGM A;  3TGO A;  2BUG A;  1EF1 C;  2E2E A;  3EIJ A;  3ASH A;  3HYM B;  2XS8 A;  3AU4 A;  4GTS A;  3FFL A;  4AM9 A;  5BT1 A;  3ASF A;  3R7R A;  2I1K A;  3BUA A;  4XIF A;  5D0Q D;  1MX4 A;  3UUX A;  2XS1 A;  4G2V A;  4AEZ C;  3NBN B;  4MRU A;  4A3V A;  5LX8 A;  2R03 A;  1MHQ A;  3PH0 C;  4GA0 A;  3B7T A;  4U0U A;  1SZA A;  2WQH A;  2AXV A;  4XE0 A;  2WXN A;  5LCW C;  4TUM A;  1QQE A;  5AQA A;  3TWX A;  5B1A E;  2IU1 A;  3DXK G;  4HI8 A;  1JCR A;  1FVF A;  2YNQ A;  1N4S A;  3CVQ A;  2XEH A;  4Q69 A;  4WWN A;  5C1D A;  4O1O A;  2GRN B;  3KSQ A;  4GTM A;  4KT6 B;  4JZY A;  2XCB A;  3QC1 A;  3L22 A;  3FH7 A;  3FEX A;  4FAD A;  3AS4 A;  3ASD A;  3KEZ A;  3NB2 A;  1TN8 A;  5ENQ D;  4FHJ A;  4FHK A;  4KZC A;  2GW1 A;  2V8S E;  4JHK A;  3ULQ A;  3T8K A;  4GYY A;  2H6I A;  4TXR A;  3SQV A;  1V55 E;  3SF4 A;  1U2V G;  4ACK A;  4BX8 A;  4H7X A;  5FWQ A;  2BTD A;  3PEV B;  3UQ3 A;  4GTV A;  4UI9 C;  2I9C A;  4E6H A;  3CVP A;  2X6F A;  1PC2 A;  2FUL A;  5AN8 A;  4B8A A;  1YMP A;  4ANX A;  1H0A A;  2Y0B G;  4JHJ A;  5G04 C;  2WXO A;  3RJV A;  4A55 A;  2I1J A;  3CHQ A;  4CCA A;  4KMO A;  1DC2 A;  4BX9 A;  4K5A B;  3MKR A;  1D9S A;  4GZD A;  2C0L A;  1OWN A;  3QB2 A;  4GCN A;  2M63 A;  5G2N A;  3SZ7 A;  4GZ3 A;  1K8K G;  3WXX A;  3PZ3 A;  3PZD A;  4BTA A;  1XNF A;  5HS0 A;  3Q73 A;  1N4P A;  1Z6T A;  4PH4 B; 
#chains in the Genus database with same CATH homology
 1BPO A;  4CDM A;  1HS6 A;  4CGW A;  3FUL A;  2JEK A;  3D9I A;  5AIJ A;  2PQN A;  2X6K A;  4DLQ A;  4BY6 A;  1TJF A;  3I3N A;  1E8Y A;  4QFV A;  3IEG A;  2WM9 A;  4JPS A;  4KZ0 A;  2KZT A;  2KZT B;  3RK6 A;  4G26 A;  4J6I A;  5G05 C;  1TJC A;  4HXI A;  3ZHE A;  4J8S A;  2WXL A;  2L0I A;  5FQ6 A;  4YVQ C;  4K0R A;  3RIB A;  4F53 A;  4K03 A;  3CST A;  3CVY A;  4J8D A;  3EHN A;  2V4L A;  1NA0 A;  3E4B A;  5JJT A;  1HX8 A;  2WQ6 A;  1H2V C;  4HFG A;  1Y6I A;  4UWF A;  1E8Z A;  3HHM A;  5EX3 A;  2PM7 A;  3T5V A;  1QNF A;  2WXK A;  3FP3 A;  3G2T A;  2Q7F A;  4KYO B;  3EIQ C;  2WPV A;  4I17 A;  2X3M A;  3SBT B;  3FUN A;  2KM4 A;  5LCW J;  4FU3 A;  3TL5 A;  4JL0 A;  3TXM A;  3S7D A;  2J4D A;  4A1G A;  3FU3 A;  5E76 A;  1S0P A;  3BG1 B;  4WNG A;  2FEZ A;  3L6A A;  4JXT A;  1LF8 A;  1E90 A;  4H7Y A;  2PQR A;  4FA6 A;  2ILR A;  3MEK A;  3ZYQ A;  4U07 A;  3GZ1 A;  3FHE A;  5HI7 A;  3CV0 A;  2OVB A;  3CR3 A;  3QK0 A;  3FUE A;  2CFU A;  5BUZ A;  2Y4U A;  4AY6 A;  3B13 A;  5CCM A;  2KC7 A;  1TEZ A;  2FF4 A;  4N5C A;  3T8M A;  4APF A;  3D9N A;  4JW1 A;  4U0S A;  1E7V A;  3PEU B;  4ABN A;  2XEV A;  4F7A A;  2RD0 A;  4PS3 A;  2WXQ A;  2VSY A;  4I1M A;  4J0U A;  5JJ6 A;  2YIN A;  4OVU A;  2HYZ A;  2GRM A;  2WMN A;  1HE8 A;  3LKU A;  3I4R B;  2J09 A;  3IKO B;  3JUI A;  1XGW A;  2MHK A;  1X5B A;  4O6F A;  4F3V A;  1KLX A;  3NF1 A;  3CVU A;  3CKC A;  3N71 A;  3PNT B;  4FP7 A;  3CVX A;  3RU0 A;  1JWF A;  2XPI A;  3MKQ A;  3MKQ B;  4ILI A;  3U66 A;  4J8E A;  1HH8 A;  3GYZ A;  4L2L A;  4EBA A;  5DIZ A;  3LEW A;  3QJZ A;  2AWI A;  2J9Q A;  3FUI A;  2HM8 A;  5FZS A;  2C0M A;  4UI9 K;  3CHP A;  3RRM B;  4HOT A;  4JA7 A;  2OVF A;  1YA0 A;  5T8I A;  1HG5 A;  2AW6 A;  4G24 A;  2I6H A;  4I6E A;  2MOW A;  3UT7 A;  4CGV A;  2LO6 A;  4ANU A;  1EPU A;  4EEC A;  1L5J A;  2WB2 A;  3DBS A;  3LY8 A;  3TAX A;  3LYA A;  3ZGQ A;  2YHC A;  4AV7 A;  2ZU6 B;  3HVE A;  4G23 A;  3HVE B;  2PM6 A;  4WNE A;  5CMY A;  2L9B A;  2RG8 A;  4UI9 J;  3ENE A;  1Z3X A;  5JHB A;  4CDN A;  5KJN A;  4BFR A;  2HR2 A;  5DBK A;  3C98 A;  3FUF A;  5LP0 A;  5AJD A;  2FI7 A;  2VSX E;  3G2U A;  4FLB A;  2A5U A;  3Q15 A;  2X6I A;  4TRQ A;  1HO8 A;  4AJW A;  1FCH A;  3D3M A;  3R7Q A;  5G04 J;  3FTZ A;  3PE3 A;  4C9B B;  3TJP A;  4AVX A;  2VJ8 A;  4F1S A;  4EQF A;  2XHE A;  3ZW3 A;  2Y4T A;  1PAQ A;  3CK7 A;  4FLH A;  3LJ3 A;  3O4Z A;  3LDZ A;  1E8W A;  2J07 A;  2WXJ A;  3JCK C;  3PDN A;  3FH8 A;  5ARG A;  4EPZ A;  2CHW A;  4W9R A;  4N2Q A;  2EQX A;  4UQX A;  2IF4 A;  2MRI A;  2OND A;  4CDR A;  3RKV A;  3SBS A;  4UQY A;  4L2Y A;  4B94 A;  4HOR A;  3EDT B;  3SD5 A;  4AP2 A;  2VYI A;  2WXM A;  2JLB A;  3L54 A;  4JHR A;  3U9W A;  4DJA A;  4WUY A;  3ESL A;  4I2W A;  2GGF A;  3APC A;  1W3B A;  2LNI A;  4JC8 A;  3JQ1 A;  4V3I A;  3MZL B;  1KT0 A;  1OWP A;  4BTB A;  3GZ2 A;  1GW6 A;  5ANR A;  1JUQ A;  4LER A;  3Q5M A;  4UWH A;  4CT4 A;  2XGO A;  5CHE E;  3D9L A;  4B8C B;  3RO2 A;  3Q49 B;  4WAF A;  3QWW A;  3MA5 A;  3OTN A;  1VDY A;  4KBQ A;  4YND A;  5CCL A;  4GAA A;  4DI4 A;  1QZ2 A;  3JQ0 A;  3T5X A;  1H19 A;  3FU0 A;  3QAR A;  4N3A A;  5J08 A;  1JPL A;  3PVL A;  4IYP A;  2IFU A;  4NAC A;  4XZ4 A;  3ZHE B;  3CQG B;  2LSU A;  5G05 J;  5JHA A;  2UY1 A;  2UY1 B;  4IN3 B;  3S7J A;  2LAI A;  3FTV A;  3LPZ A;  4Q96 A;  2R5S A;  4KXK B;  4ME2 A;  2HO1 A;  4R7L A;  1HFA A;  4L1B A;  3APD A;  5BV1 A;  3I4G A;  4LRZ A;  1WY6 A;  4I43 A;  1KT1 A;  3VLE A;  3Q47 B;  3QAQ A;  4ILH B;  1NA3 A;  3CQC B;  3ASG A;  4XI9 A;  3MV3 B;  2WXP A;  1OWO A;  3QDN A;  4WWO A;  5KJM A;  3MX3 A;  4A3T A;  1U3D A;  3S2A A;  5FT9 A;  2J4B A;  2KCL A;  2WXH A;  4G25 A;  4IRU A;  1ZBP A;  2X6J A;  3ZYK A;  4ACL A;  4DLO A;  5ENN A;  4AY5 A;  2J08 A;  2I2O A;  2LSV A;  2LAH A;  4HOU A;  5ANL A;  2XRY A;  4KVO A;  1HG2 A;  2QFC A;  1Y8M A;  4I6G A;  1H2T C;  4EBA G;  3PE4 A;  4ILG A;  4BWR A;  1H2U A;  3D9P A;  2E0I A;  4HS2 A;  1ELK A;  1UG3 A;  3AU5 A;  3IV0 A;  4GA2 A;  4JEH A;  4Y6W A;  5BPP A;  2NSZ A;  4AIF A;  1JWG A;  3ZIM A;  3APF A;  4EZK A;  1WAO 1;  3ZYL A;  1FVH A;  3ZFW A;  4EZJ A;  2CHX A;  4I6J A;  5C2Y A;  4JEU A;  4N3B A;  3LS8 A;  5FTP A;  3CVW A;  4L23 A;  3IHY A;  5FJY A;  2WQ7 A;  1ELW A;  4E85 A;  3D9K A;  2XQ0 A;  3NQP A;  3RRU A;  4AXH A;  3ONK A;  3PRZ A;  4FUL A;  3IHV A;  2DIW A;  5LOZ A;  3RRN B;  4YVO A;  3SNX A;  3L17 A;  3FWV A;  4WND A;  5ARF A;  2AXU A;  3K9I A;  4I1A A;  3SFZ A;  5KJL A;  4RG6 A;  3JYS A;  2YQ8 A;  4GA1 A;  4GYW A;  4U63 A;  3TXN A;  4APO A;  3S7B A;  2XCC A;  5EX0 A;  3HIZ A;  1OUV A;  3OAW A;  4CRW A;  2BF0 X;  3CK9 A;  5BNW A;  3CHM A;  1UN8 A;  2C2L A;  3CKB A;  1OWM A;  3SHF A;  3U3W A;  3GZS A;  4JVS A;  3ONL A;  3MYV A;  1B89 A;  4P29 A;  3P1U A;  4I9C A;  4AOF A;  3CHS A;  4GZ5 A;  4XKC A;  5T3R A;  2IOL A;  2ION A;  3UMV A;  3ZVV A;  1WM5 A;  4LEU A;  4XX5 A;  2IQC A;  3ZXS A;  3OXG A;  4GYO A;  1UN9 A;  3FTU A;  4L7T A;  2J49 A;  2CFZ A;  4XI0 A;  3CIA A;  4U8H A;  4GZ6 A;  3B7R L;  1HF8 A;  4FJZ A;  5EKQ D;  3UX4 A;  3ZYM A;  3OXF A;  4PS8 A;  4DK5 A;  2PZI A;  3LY9 A;  1Z3Y A;  1UW4 B;  3S7F A;  3EJN A;  3ZN3 A;  2IJG X;  3FY4 A;  2L6J A;  4N2S A;  3MCX A;  2UWJ G;  1IYG A;  3KAE A;  5FZQ A;  2XGM A;  3CGH A;  3CK8 A;  3UT4 A;  3G2S A;  3TGO A;  2BUG A;  4HVB A;  1EF1 C;  1N54 A;  2WXF A;  1E7U A;  2E2E A;  3EIJ A;  1PY1 A;  4J8F A;  3ASH A;  3HYM B;  4XKB A;  3FUK A;  3CVL A;  3MJW A;  3VLD A;  3AU4 A;  3FFL A;  4AM9 A;  3FUM A;  5BT1 A;  3ASF A;  3R7R A;  2WMO A;  2WXG A;  3CHO A;  4HOQ A;  4LCT A;  2X6H A;  2XGS A;  5FQ7 A;  4Q94 A;  4G11 A;  2I1K A;  3AS5 A;  3SI5 A;  3U64 A;  4XIF A;  4UQZ A;  5D0Q D;  4ATG A;  3B7U X;  4CEM A;  4EZL A;  3GW4 A;  1IQR A;  3UUX A;  2KAT A;  2P58 C;  2OV8 A;  3CEQ A;  4G2V A;  4AEZ C;  1ELR A;  2Y3A A;  1DVP A;  3D9M A;  4WWP A;  4CT0 A;  4HLE A;  3QNK A;  4N39 A;  4MRU A;  4A3V A;  5LX8 A;  4TV3 A;  3P2B A;  2R59 A;  3U4T A;  3UT8 A;  3FTY A;  3TG4 A;  5AJL A;  4GMJ A;  3RO3 A;  5BV0 A;  1MHQ A;  3PH0 C;  3FUD A;  4GA0 A;  3L13 A;  3B7T A;  4U0U A;  4Y6C A;  5T4Y A;  1SZA A;  2WQH A;  3BG0 B;  2AXV A;  3HDX A;  4RVB A;  4ANV A;  4XE0 A;  3FDH A;  2WXN A;  5LCW C;  2V0P A;  4A1S A;  1N52 A;  3NZU A;  1MQS A;  2FBN A;  1QQE A;  2PL2 A;  4DPR A;  3D9J A;  2IU1 A;  2FO7 A;  3CVN A;  4MS6 A;  3KS2 A;  4URK A;  1FVF A;  3R9A B;  3CVV A;  2YNQ A;  4B0Z A;  5KJK A;  3CVQ A;  1E96 B;  2DCP A;  4I2Z A;  2X38 A;  3LY7 A;  2VSN A;  5E75 A;  4Q69 A;  4LUN U;  4PUC A;  2XPY A;  5M72 A;  3QKY A;  4WWN A;  1DNP A;  2GRL A;  3CLJ A;  3ML8 A;  5A7D B;  2IOS A;  3PUK A;  3FU6 A;  5C1D A;  4NRH B;  2VTB A;  2KCV A;  3O48 A;  1SQM A;  4RSY A;  2VTB B;  2AXZ A;  2OOE A;  2XPZ A;  4KT6 B;  2VGY A;  1UJJ A;  4JZY A;  1NP7 A;  2XCB A;  3QC1 A;  3FUH A;  4HOS A;  4KVM A;  3L22 A;  5CMW A;  3FTS A;  5HQ8 A;  3B7S A;  5FQ8 A;  3SGH A;  3FTX A;  4BT8 A;  3FH7 A;  3FEX A;  2A4Z A;  5FQ4 A;  4FAD A;  5A6C A;  3AS4 A;  3ASD A;  3KEZ A;  4PS7 A;  4RG9 A;  3G2W A;  3ZRH A;  4FC8 A;  1OWL A;  4B89 A;  5AEN A;  4FHJ A;  4FHK A;  4FJY A;  4KZC A;  3DPD A;  1HU3 A;  3UPV A;  2GW1 A;  3ZEF A;  4MLP A;  2AVP A;  3KD7 A;  4WNF A;  2V8S E;  4JHK A;  3ULQ A;  2DBA A;  2NC9 A;  2NXP A;  4GYY A;  4TUU A;  4G1T A;  3TG5 A;  3SF4 A;  2R17 C;  2CG3 A;  1IQU A;  4ACK A;  4U0Z A;  4BX8 A;  2KCK A;  4H7X A;  5FWQ A;  2BTD A;  2CHZ A;  5FZR A;  3FTW A;  4NQ0 A;  3VTY A;  3PEV B;  5J90 A;  2V5F A;  4GML A;  4N3C A;  3UQ3 A;  4UI9 C;  1HXI A;  4GPK A;  1NZN A;  2I9C A;  4D10 C;  4E6H A;  3AS8 A;  4I9E A;  2VQ2 A;  3PNL B;  3L08 A;  3MGB A;  5A23 A;  3CVP A;  2X6F A;  1EYH A;  3MV2 B;  1IHG A;  3NZS A;  1PC2 A;  4I1O B;  2WXR A;  2FUL A;  2QY7 A;  4MKT A;  5EDS A;  4B8A A;  3CSF A;  1HZ4 A;  3URZ A;  4ANX A;  3IBE A;  1H0A A;  4JHJ A;  3ESK A;  5G04 C;  3VTX A;  2WXO A;  3LXU X;  4C0M A;  3RJV A;  1ZU2 A;  3LVR E;  1UJK A;  4BT9 A;  3OXL A;  4OVV A;  4A55 A;  3L16 A;  2I1J A;  2VSO E;  3CHQ A;  4CCA A;  5LFA A;  4KMO A;  4BSX A;  4GB9 A;  2CG2 A;  3BEE A;  2WVI A;  2YHE A;  1P5Q A;  3EHM A;  3ML9 A;  3FU5 A;  3I5P A;  3G2V A;  2L0T B;  4DI3 A;  4BX9 A;  3MKR A;  3LCA A;  4GZD A;  1E8X A;  2C0L A;  3QWV A;  1H6K A;  4UWL A;  3QOU A;  3FUJ A;  1SZ9 A;  4UWK A;  5G55 A;  1OWN A;  1INZ A;  3CHR A;  4M3O A;  3QB2 A;  4GCN A;  4PDX A;  2M63 A;  4GU5 A;  4JA9 A;  3FH5 A;  5D0O D;  3PUJ A;  5G2N A;  3SZ7 A;  4GZ3 A;  4GCO A;  4C0E A;  4NUR A;  3VLF A;  4IUL A;  3WXX A;  1U3C A;  2VGX A;  3FEY A;  3PZD A;  2VGX B;  2WXI A;  5BW8 C;  4BTA A;  5KCM A;  1A17 A;  4U04 A;  5AYW D;  3LVQ E;  3Q4A B;  3D9O A;  5JJ7 A;  1XNF A;  3PS6 A;  4GZC A;  3PRE A;  1EDU A;  1Z6T A;  4ANW A;  4OYS A;  4PH4 B;  2XRZ A;  4UWG A;  3QWP A;  3ZPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...