2V92A

Crystal structure of the regulatory fragment of mammalian ampk in complexes with atp-amp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v92A01
3TE5A 1UL7A 1V5SA 2EHBD 2QR1A 4EAGA 2QLVA 2YA3A 4EALA 2OOXA 2OOYA 2ZFDB 3T4NA 2V8QA 4EAJA 2Y8LA 2V9JA 2Y8QA 2V92A 3TDHA 4CFFA 2QRCA 4EAIA 3OSEA 4EAKA 2QRDA 2QREA
chains in the Genus database with same CATH superfamily
1UL7A 1LXTA 3D7QA 2H4LX 1KYDA 3OC3C 3RSMA 3HS8A 4B0AA 1KO9A 2NOEA 3VN5A 1UT7A 3I0WA 4TPSA 1QTSA 1P5GX 3ENCA 2QLVA 4EAGA 1N3AA 1UT4A 1QN4A 4C7PA 2OOXA 3CWAA 2NOFA 1KYFA 2OOYA 1TUOA 3NA5A 3SNSA 4EAJA 2Y8LA 1VTLE 1QN6A 3OH9A 1JDYA 2PWWA 2R5XA 1N39A 4WZSD 4D7QA 2F7LA 2QRCA 1RM1A 3OGDA 1YQLA 5JN5A 3N89A 1JFIC 5IYBP 1M3QA 4EJZA 2QRDA 1NVPA 1K2YX 3F0ZA 2QREA 2LAEA 3TE5A 5IYDP 1V5SA 3C04A 2QR1A 1T6AA 3D4VA 4EJYA 1KY7A 4Q11A 1LWVA 1QN5A 5BMPA 1E42A 4DULA 3CWSA 4BJUA 4ROCB 1QTPA 3RPJA 3EIKA 2YA3A 4D7RA 1C4GA 1YQKA 1QNAA 1D3UA 1QNEA 2DKDA 1PCZA 1QNBA 3KRMA 1QNCA 3CVSA 2ZFDB 2IV8A 3HS9A 2V9JA 3DPUA 1HU0A 1NGMA 1AISA 2HKPA 2DKAA 4WXAA 1C47A 1WQAA 2JHJA 3BKQX 2D0AA 4MRQA 1VOKA 2XHIA 3DPTA 1LWWA 1CDWA 3I3WA 2NLVA 2YH5A 1YTBA 5HSHA 1KFIA 1QN3A 2EHBD 2NOIA 3KTUA 1PCMX 2Z0FA 1FN7A 2G30A 1LWYA 3OH6A 3EAYA 2HL8A 2FUVA 4ROEB 1P5DX 1KFQA 3CWUA 4EALA 4IL8A 4WX8A 3OCIA 5EPCA 1TBPA 2JPIA 2NOLA 3OLPA 2V8QA 3CW7A 1K35A 2DKCA 5JMVD 1WJWA 2NVMA 2Y8QA 2HZMA 1B9KA 1EUVA 2V92A 4QG5A 3TDHA 1DIZA 3OSMA 2IV9A 1XSZA 5IYCP 1YQMA 1N3CA 2NWVA 2JOIA 4EAIA 1M5Q1 3OSEA 1VKLA 4EAKA 1C9BB 2I5WA 1KYUA 2NOHA 2D0BA 1YQRA 1QN7A 1YTFA 1MPGA 4HJHA 1MP9A 3ENOC 5BMNA 3OSTA 3I0XA 1TBAB 3CVTA 1VOLB 2VJ0A 1TGHA 2FGTA 1NH2A 2FKFA 2D0CA 5KL0A 5AN4A 5F9CA 1VTOA 1QN9A 1KY6A 3PDKA 2NOZA 4I8OA 2HL9A 1EBMA 3IH7A 2O3OA 2MJ7A 4PY5A 3T4NA 2Z8UA 2FKMX 3F10A 1QN8A 2MZ8A 3UW2A 1M3HA 3ASMA 3ULXA 1W80A 3PMGA 4CFFA 2JHNA 3H1ZA 4RODB 2NOBA 2HZSA 1R4XA 3CWTA 1PCJX 1PZDA 1PVSA 2H5AX 1J3MA 1Q9UA
chains in the Genus database with same CATH topology
3TE5A 1UL7A 1V5SA 2EHBD 2QR1A 4EAGA 2QLVA 2YA3A 4EALA 2OOXA 2OOYA 2ZFDB 3T4NA 2V8QA 4EAJA 2Y8LA 2V9JA 2Y8QA 2V92A 3TDHA 4CFFA 2QRCA 4EAIA 3OSEA 4EAKA 2QRDA 2QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TE5 A;  1UL7 A;  1V5S A;  2EHB D;  2QR1 A;  4EAG A;  2QLV A;  2YA3 A;  4EAL A;  2OOX A;  2OOY A;  2ZFD B;  3T4N A;  2V8Q A;  4EAJ A;  2Y8L A;  2V9J A;  2Y8Q A;  2V92 A;  3TDH A;  4CFF A;  2QRC A;  4EAI A;  3OSE A;  4EAK A;  2QRD A;  2QRE A; 
#chains in the Genus database with same CATH topology
 1UL7 A;  1LXT A;  3D7Q A;  2H4L X;  1KYD A;  3OC3 C;  3RSM A;  3HS8 A;  4B0A A;  1KO9 A;  2NOE A;  3VN5 A;  1UT7 A;  3I0W A;  4TPS A;  1QTS A;  1P5G X;  3ENC A;  2QLV A;  4EAG A;  1N3A A;  1UT4 A;  1QN4 A;  4C7P A;  2OOX A;  3CWA A;  2NOF A;  1KYF A;  2OOY A;  1TUO A;  3NA5 A;  3SNS A;  4EAJ A;  2Y8L A;  1VTL E;  1QN6 A;  3OH9 A;  1JDY A;  2PWW A;  2R5X A;  1N39 A;  4WZS D;  4D7Q A;  2F7L A;  2QRC A;  1RM1 A;  3OGD A;  1YQL A;  5JN5 A;  3N89 A;  1JFI C;  5IYB P;  1M3Q A;  4EJZ A;  2QRD A;  1NVP A;  1K2Y X;  3F0Z A;  2QRE A;  2LAE A;  3TE5 A;  5IYD P;  1V5S A;  3C04 A;  2QR1 A;  1T6A A;  3D4V A;  4EJY A;  1KY7 A;  4Q11 A;  1LWV A;  1QN5 A;  5BMP A;  1E42 A;  4DUL A;  3CWS A;  4BJU A;  4ROC B;  1QTP A;  3RPJ A;  3EIK A;  2YA3 A;  4D7R A;  1C4G A;  1YQK A;  1QNA A;  1D3U A;  1QNE A;  2DKD A;  1PCZ A;  1QNB A;  3KRM A;  1QNC A;  3CVS A;  2ZFD B;  2IV8 A;  3HS9 A;  2V9J A;  3DPU A;  1HU0 A;  1NGM A;  1AIS A;  2HKP A;  2DKA A;  4WXA A;  1C47 A;  1WQA A;  2JHJ A;  3BKQ X;  2D0A A;  4MRQ A;  1VOK A;  2XHI A;  3DPT A;  1LWW A;  1CDW A;  3I3W A;  2NLV A;  2YH5 A;  1YTB A;  5HSH A;  1KFI A;  1QN3 A;  2EHB D;  2NOI A;  3KTU A;  1PCM X;  2Z0F A;  1FN7 A;  2G30 A;  1LWY A;  3OH6 A;  3EAY A;  2HL8 A;  2FUV A;  4ROE B;  1P5D X;  1KFQ A;  3CWU A;  4EAL A;  4IL8 A;  4WX8 A;  3OCI A;  5EPC A;  1TBP A;  2JPI A;  2NOL A;  3OLP A;  2V8Q A;  3CW7 A;  1K35 A;  2DKC A;  5JMV D;  1WJW A;  2NVM A;  2Y8Q A;  2HZM A;  1B9K A;  1EUV A;  2V92 A;  4QG5 A;  3TDH A;  1DIZ A;  3OSM A;  2IV9 A;  1XSZ A;  5IYC P;  1YQM A;  1N3C A;  2NWV A;  2JOI A;  4EAI A;  1M5Q 1;  3OSE A;  1VKL A;  4EAK A;  1C9B B;  2I5W A;  1KYU A;  2NOH A;  2D0B A;  1YQR A;  1QN7 A;  1YTF A;  1MPG A;  4HJH A;  1MP9 A;  3ENO C;  5BMN A;  3OST A;  3I0X A;  1TBA B;  3CVT A;  1VOL B;  2VJ0 A;  1TGH A;  2FGT A;  1NH2 A;  2FKF A;  2D0C A;  5KL0 A;  5AN4 A;  5F9C A;  1VTO A;  1QN9 A;  1KY6 A;  3PDK A;  2NOZ A;  4I8O A;  2HL9 A;  1EBM A;  3IH7 A;  2O3O A;  2MJ7 A;  4PY5 A;  3T4N A;  2Z8U A;  2FKM X;  3F10 A;  1QN8 A;  2MZ8 A;  3UW2 A;  1M3H A;  3ASM A;  3ULX A;  1W80 A;  3PMG A;  4CFF A;  2JHN A;  3H1Z A;  4ROD B;  2NOB A;  2HZS A;  1R4X A;  3CWT A;  1PCJ X;  1PZD A;  1PVS A;  2H5A X;  1J3M A;  1Q9U A; 
#chains in the Genus database with same CATH homology
 3TE5 A;  1UL7 A;  1V5S A;  2EHB D;  2QR1 A;  4EAG A;  2QLV A;  2YA3 A;  4EAL A;  2OOX A;  2OOY A;  2ZFD B;  3T4N A;  2V8Q A;  4EAJ A;  2Y8L A;  2V9J A;  2Y8Q A;  2V92 A;  3TDH A;  4CFF A;  2QRC A;  4EAI A;  3OSE A;  4EAK A;  2QRD A;  2QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...