2V92A

Crystal structure of the regulatory fragment of mammalian ampk in complexes with atp-amp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v92A01
2QRDA 2Y8QA 2QR1A 2V9JA 3TDHA 4EAIA 4EAKA 4EAGA 2YA3A 2V92A 3OSEA 2QLVA 2Y8LA 2EHBD 2ZFDB 3T4NA 4EALA 4CFFA 2QREA 1V5SA 3TE5A 2V8QA 1UL7A 2QRCA 2OOXA 4EAJA 2OOYA
chains in the Genus database with same CATH superfamily
1KYDA 1FN7A 5IYBP 4Q11A 5IYCP 3DPUA 2QR1A 1YQLA 2HKPA 1WQAA 1XSZA 2DKDA 2JOIA 1VOLB 1W80A 3CVTA 2NOZA 1EUVA 1KO9A 1QN4A 3H1ZA 1N39A 3OSTA 2YH5A 4EAGA 4WZSD 2YA3A 3OSMA 2MJ7A 1C4GA 1N3CA 1TGHA 1TUOA 2FGTA 2HZMA 2EHBD 2Y8LA 2NOIA 4EALA 3D7QA 1PCJX 1QN6A 5AN4A 3C04A 1K2YX 1QNCA 1V5SA 2QREA 3HS9A 3TE5A 2O3OA 4EJZA 2HL8A 3EIKA 2OOXA 2DKAA 2R5XA 2OOYA 3PDKA 4EAJA 1VTOA 1LWWA 3IH7A 1C9BB 3CW7A 1KFQA 2I5WA 2NOBA 2MZ8A 2QRDA 5BMNA 4ROEB 3BKQX 1YTBA 2NOLA 2F7LA 1PCMX 3CVSA 1PCZA 2FKMX 1T6AA 4WX8A 3VN5A 4MRQA 1PVSA 1WJWA 2NOFA 2V92A 1LWVA 2DKCA 3KTUA 5JMVD 1KY6A 2IV8A 1QN9A 3DPTA 1VTLE 1M3QA 3D4VA 3CWTA 3F0ZA 3RPJA 4TPSA 1QNEA 1LWYA 1TBPA 4WXAA 1YQKA 1B9KA 3F10A 1VKLA 3OGDA 1RM1A 1UL7A 2JPIA 1LXTA 4PY5A 4BJUA 2NVMA 2LAEA 5JN5A 4ROCB 1QN3A 1R4XA 2JHNA 4RODB 1NGMA 2HL9A 3I0XA 2D0AA 3OCIA 3CWUA 4HJHA 4D7QA 2Y8QA 1HU0A 3I3WA 2V9JA 2Z0FA 4I8OA 3TDHA 3N89A 3I0WA 1YTFA 1QNBA 4EAIA 1AISA 3SNSA 3HS8A 1UT7A 3EAYA 4EAKA 4B0AA 4DULA 3ENOC 2G30A 1QN8A 1QN5A 1EBMA 1JFIC 1P5DX 2QLVA 2IV9A 1N3AA 3RSMA 1P5GX 1VOKA 3OH6A 3NA5A 2PWWA 2H5AX 1M5Q1 2VJ0A 1QTSA 2HZSA 5EPCA 5HSHA 1YQRA 1NH2A 1MPGA 1KFIA 1QNAA 2D0CA 1DIZA 2QRCA 1KYUA 1Q9UA 5IYDP 1J3MA 2Z8UA 5F9CA 2NOEA 5KL0A 1QN7A 2H4LX 3OC3C 1PZDA 1UT4A 3ENCA 2FKFA 4QG5A 2D0BA 2NOHA 3OH9A 1C47A 1KYFA 2FUVA 1CDWA 4EJYA 2NWVA 5BMPA 1E42A 3ASMA 4D7RA 2XHIA 3KRMA 1TBAB 1M3HA 3OSEA 1NVPA 1D3UA 1MP9A 3UW2A 3OLPA 3PMGA 2ZFDB 4C7PA 1JDYA 3T4NA 2JHJA 3CWSA 4IL8A 4CFFA 1YQMA 2V8QA 3ULXA 1KY7A 1QTPA 3CWAA 1K35A 2NLVA
chains in the Genus database with same CATH topology
2QRDA 2Y8QA 2QR1A 2V9JA 3TDHA 4EAIA 4EAKA 4EAGA 2YA3A 2V92A 3OSEA 2QLVA 2Y8LA 2EHBD 2ZFDB 3T4NA 4EALA 4CFFA 2QREA 1V5SA 3TE5A 2V8QA 1UL7A 2QRCA 2OOXA 4EAJA 2OOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRD A;  2Y8Q A;  2QR1 A;  2V9J A;  3TDH A;  4EAI A;  4EAK A;  4EAG A;  2YA3 A;  2V92 A;  3OSE A;  2QLV A;  2Y8L A;  2EHB D;  2ZFD B;  3T4N A;  4EAL A;  4CFF A;  2QRE A;  1V5S A;  3TE5 A;  2V8Q A;  1UL7 A;  2QRC A;  2OOX A;  4EAJ A;  2OOY A; 
#chains in the Genus database with same CATH topology
 1KYD A;  1FN7 A;  5IYB P;  4Q11 A;  5IYC P;  3DPU A;  2QR1 A;  1YQL A;  2HKP A;  1WQA A;  1XSZ A;  2DKD A;  2JOI A;  1VOL B;  1W80 A;  3CVT A;  2NOZ A;  1EUV A;  1KO9 A;  1QN4 A;  3H1Z A;  1N39 A;  3OST A;  2YH5 A;  4EAG A;  4WZS D;  2YA3 A;  3OSM A;  2MJ7 A;  1C4G A;  1N3C A;  1TGH A;  1TUO A;  2FGT A;  2HZM A;  2EHB D;  2Y8L A;  2NOI A;  4EAL A;  3D7Q A;  1PCJ X;  1QN6 A;  5AN4 A;  3C04 A;  1K2Y X;  1QNC A;  1V5S A;  2QRE A;  3HS9 A;  3TE5 A;  2O3O A;  4EJZ A;  2HL8 A;  3EIK A;  2OOX A;  2DKA A;  2R5X A;  2OOY A;  3PDK A;  4EAJ A;  1VTO A;  1LWW A;  3IH7 A;  1C9B B;  3CW7 A;  1KFQ A;  2I5W A;  2NOB A;  2MZ8 A;  2QRD A;  5BMN A;  4ROE B;  3BKQ X;  1YTB A;  2NOL A;  2F7L A;  1PCM X;  3CVS A;  1PCZ A;  2FKM X;  1T6A A;  4WX8 A;  3VN5 A;  4MRQ A;  1PVS A;  1WJW A;  2NOF A;  2V92 A;  1LWV A;  2DKC A;  3KTU A;  5JMV D;  1KY6 A;  2IV8 A;  1QN9 A;  3DPT A;  1VTL E;  1M3Q A;  3D4V A;  3CWT A;  3F0Z A;  3RPJ A;  4TPS A;  1QNE A;  1LWY A;  1TBP A;  4WXA A;  1YQK A;  1B9K A;  3F10 A;  1VKL A;  3OGD A;  1RM1 A;  1UL7 A;  2JPI A;  1LXT A;  4PY5 A;  4BJU A;  2NVM A;  2LAE A;  5JN5 A;  4ROC B;  1QN3 A;  1R4X A;  2JHN A;  4ROD B;  1NGM A;  2HL9 A;  3I0X A;  2D0A A;  3OCI A;  3CWU A;  4HJH A;  4D7Q A;  2Y8Q A;  1HU0 A;  3I3W A;  2V9J A;  2Z0F A;  4I8O A;  3TDH A;  3N89 A;  3I0W A;  1YTF A;  1QNB A;  4EAI A;  1AIS A;  3SNS A;  3HS8 A;  1UT7 A;  3EAY A;  4EAK A;  4B0A A;  4DUL A;  3ENO C;  2G30 A;  1QN8 A;  1QN5 A;  1EBM A;  1JFI C;  1P5D X;  2QLV A;  2IV9 A;  1N3A A;  3RSM A;  1P5G X;  1VOK A;  3OH6 A;  3NA5 A;  2PWW A;  2H5A X;  1M5Q 1;  2VJ0 A;  1QTS A;  2HZS A;  5EPC A;  5HSH A;  1YQR A;  1NH2 A;  1MPG A;  1KFI A;  1QNA A;  2D0C A;  1DIZ A;  2QRC A;  1KYU A;  1Q9U A;  5IYD P;  1J3M A;  2Z8U A;  5F9C A;  2NOE A;  5KL0 A;  1QN7 A;  2H4L X;  3OC3 C;  1PZD A;  1UT4 A;  3ENC A;  2FKF A;  4QG5 A;  2D0B A;  2NOH A;  3OH9 A;  1C47 A;  1KYF A;  2FUV A;  1CDW A;  4EJY A;  2NWV A;  5BMP A;  1E42 A;  3ASM A;  4D7R A;  2XHI A;  3KRM A;  1TBA B;  1M3H A;  3OSE A;  1NVP A;  1D3U A;  1MP9 A;  3UW2 A;  3OLP A;  3PMG A;  2ZFD B;  4C7P A;  1JDY A;  3T4N A;  2JHJ A;  3CWS A;  4IL8 A;  4CFF A;  1YQM A;  2V8Q A;  3ULX A;  1KY7 A;  1QTP A;  3CWA A;  1K35 A;  2NLV A; 
#chains in the Genus database with same CATH homology
 2QRD A;  2Y8Q A;  2QR1 A;  2V9J A;  3TDH A;  4EAI A;  4EAK A;  4EAG A;  2YA3 A;  2V92 A;  3OSE A;  2QLV A;  2Y8L A;  2EHB D;  2ZFD B;  3T4N A;  4EAL A;  4CFF A;  2QRE A;  1V5S A;  3TE5 A;  2V8Q A;  1UL7 A;  2QRC A;  2OOX A;  4EAJ A;  2OOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...