2V9TB

Complex between the second lrr domain of slit2 and the first ig domain from robo1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
210
Chain Sequence
GSLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Slit-Robo Complex.
pubmed doi rcsb
molecule keywords ROUNDABOUT HOMOLOG 1
source organism Homo sapiens
molecule tags Structural protein/receptor
total genus 70
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF01463 LRRCT Leucine rich repeat C-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2v9tB00
1U0ND 1FT8A 3W3GA 2ASTB 4LXSA 4QXEA 2O6QA 3A79B 1XECA 3G04C 3CIGA 3ZYNA 4LXRA 3E6JA 3WPCA 2ELLA 3WPHA 3OGKB 3UN9A 5AWBA 5GS2B 4NKGA 4Z94G 4GLPA 2OMTA 2OMYA 2O6SA 3RGZA 1JL5A 4LSXC 3O53A 4XOSA 3RW7A 4MQWX 1A4YA 3W3NA 4AY9X 4LSXA 4GT6A 1FS2A 3WPBA 2WFHA 4ARRA 1M9SA 4EZGA 3W3JA 1D0BA 3ZYIA 4R09A 4B8CD 4Y61B 1O6TA 4U09A 4LI2A 4BSRA 3WPIA 4BSSA 3W3LA 2V9SA 2Z63A 3C6NB 3ZYOA 2O6RA 1OTMA 5GQRK 2IFGA 5IYXC 2RA8A 1XKUA 2A0ZA 4V2DA 3G3BA 4KNGA 2WQVA 2Z82A 2V9TB 3OGMB 2WQWA 3REZA 4P8SA 4XGOA 4FD0A 5AZ5A 4QBZA 3TSRE 1ZIWA 4R6FA 2Z65A 4HQ1A 4R58A 3WN4A 4ARNA 4J0MA 1O6VA 4R5CA 4Q3IA 4FHOA 3WPEA 1WWLA 1M9LA 4RCWA 4R6JA 5HZLB 4R08A 3OGLB 5CMNA 4KT1A 4CP6A 4MN8B 5B0NA 4UFRA 5LFNA 1XEUA 1P8VA 2Y5QA 3OJAB 3UL8A 2P1MB 2ID5A 2V70A 4YEBB 3ULUA 3WPFA 3UL9A 4V2CA 4PQ8A 4U08A 4PKIG 4PERA 4TZHA 3E4GA 1KOHA 2P1OB 3O6NA 3CIYA 4G8AA 3UL7A 2Z7XB 3ZYJA 2Z64A 4U7LA 2Q4GW 4AW4A 3RW6A 5CMPA 1PGVA 1G9UA 4LSCA 2Z62A 2UZYA 2OMWA 4FDWA 1K5DC 1SQ0B 3E3ZA 1OZNA 1P9AG 5HDHA 2XWTC 4Z64C 5IJDA 2Z81A 4R07A 3DZEA 1LTXA 2XOTA 1XCDA 1H6TA 3G39A 1OGQA 4CC4C 4FS7A 4L3FA 2OMUA 4C2AB 3GOZA 4R6AA 3SB4A 4RWTC 1FO1A 1W8AA 3RJ0A 4FMZA 5GS0A 2OMXA 3ULAA 1M10B 4CC4A 4WYKA 3ULVA 3RFJA 4Z61C 3C6OB 2JQDA 4R5DA 3W3MA 2WQXA 4K17A 2BEXA 4BV4R 4R6GA 4XSQA 2R9UA 3RFEA 5AWAA 2JE0A 3RGXA 1XWDC 3E2JA 2RR6A 3VQ1A 5D3IA 4M7EC 2P1QB 4H09A 3M18A 1DS9A 2P1NB 1P8TA 4KXFB 5B0TA 1A9NA 4Z8GA 4M7EA 1FQVA 3M19A 3JB9j 4NKHA 3RFSA 5GMGA 4RCAB 4CNCA 3PMHG 4ECOA 4R0AA 5GMHA 2CA6A 4IM6A 3W3KA 2UZXA 4J4LA 3P72A 5IJCA 3RIZA 4PEQB 1DCEA 4FCGA 4LI1A 2ASSB 2JE1A 2OMVA 4WP6A 5IJBA 1M0ZA 3VQ2A 4PSJA 3OJAA 4LSAA 3FXIA 5FTTB 3G06A 2OMZA 2P1PB 4QC0A 4L3AA 5B4PA 1KOOA 2WQUA 4U06A 1GWBA 2FT3A 3C6PB 5A5CA 1QYYA 4BSUA 2Z7XA 1O6SA 1IO0A 3CVRA 1H6UA 2Z66A 1OOKG 3KJ4A 4Z79A 2BNHA 5GMFA 1OTNA 3G3AA 1DFJI 4CILA 1OTOA 4C2BB 4ECNA 5AWDA 1K5GC 3WPDA 4P91A 4Q62A 1Z7XW 3WPGA 5AWCA 4OQTA 4Q3GA 4CNMA 3BZ5A 4I6JB 1YRGA 4V2EA
chains in the Genus database with same CATH superfamily
1U0ND 1FT8A 3W3GA 2ASTB 4LXSA 4QXEA 2O6QA 3A79B 1XECA 3G04C 3CIGA 3ZYNA 4LXRA 3E6JA 3WPCA 2ELLA 3WPHA 3OGKB 3UN9A 5AWBA 5GS2B 4NKGA 4Z94G 4GLPA 2OMTA 2OMYA 2O6SA 3RGZA 1JL5A 4LSXC 3O53A 4XOSA 3RW7A 4MQWX 1A4YA 3W3NA 4AY9X 4LSXA 4GT6A 1FS2A 3WPBA 2WFHA 4ARRA 1M9SA 4EZGA 3W3JA 1D0BA 3ZYIA 4R09A 4B8CD 4Y61B 1O6TA 4U09A 4LI2A 4BSRA 3WPIA 4NZRM 4BSSA 3W3LA 2V9SA 2Z63A 3C6NB 3ZYOA 2O6RA 1OTMA 5GQRK 2IFGA 5IYXC 2RA8A 1XKUA 2A0ZA 4V2DA 3G3BA 4KNGA 2WQVA 2Z82A 2V9TB 3OGMB 2WQWA 3REZA 4P8SA 4XGOA 4FD0A 5AZ5A 4QBZA 3TSRE 1ZIWA 4R6FA 2Z65A 4HQ1A 4R58A 3WN4A 4ARNA 4J0MA 1O6VA 4R5CA 4Q3IA 4FHOA 3WPEA 1WWLA 1M9LA 4RCWA 4R6JA 5HZLB 4R08A 3OGLB 5CMNA 4KT1A 4CP6A 4MN8B 5B0NA 4UFRA 5LFNA 1XEUA 1P8VA 2Y5QA 3OJAB 3UL8A 2P1MB 2ID5A 2V70A 4YEBB 3ULUA 3WPFA 3UL9A 4V2CA 4PQ8A 4U08A 4PKIG 4PERA 4TZHA 3E4GA 1KOHA 2P1OB 3O6NA 3CIYA 4G8AA 3UL7A 2Z7XB 3ZYJA 2Z64A 4U7LA 2Q4GW 4AW4A 3RW6A 5CMPA 1PGVA 1G9UA 4LSCA 2Z62A 2UZYA 2OMWA 4FDWA 1K5DC 1SQ0B 3E3ZA 1OZNA 1P9AG 5HDHA 2XWTC 4Z64C 5IJDA 2Z81A 4R07A 3DZEA 1LTXA 2XOTA 1XCDA 1H6TA 3G39A 1OGQA 4CC4C 4FS7A 4L3FA 2OMUA 4C2AB 3GOZA 4R6AA 3SB4A 4RWTC 1FO1A 1W8AA 3RJ0A 4FMZA 5GS0A 2OMXA 3ULAA 1M10B 4CC4A 4WYKA 3ULVA 3RFJA 4Z61C 3C6OB 2JQDA 4R5DA 3W3MA 2WQXA 4K17A 2BEXA 4BV4R 4R6GA 4XSQA 2R9UA 3RFEA 5AWAA 2JE0A 3RGXA 1XWDC 3E2JA 2RR6A 3VQ1A 5D3IA 4M7EC 2P1QB 4H09A 3M18A 1DS9A 2P1NB 1P8TA 4KXFB 5B0TA 1A9NA 4Z8GA 4M7EA 1FQVA 3M19A 3JB9j 4NKHA 3RFSA 5GMGA 4RCAB 4CNCA 3PMHG 4ECOA 4R0AA 5GMHA 2CA6A 4IM6A 3W3KA 2UZXA 4J4LA 3P72A 5IJCA 3RIZA 4PEQB 1DCEA 4FCGA 4LI1A 2ASSB 2JE1A 2OMVA 4WP6A 5IJBA 1M0ZA 3VQ2A 4PSJA 3OJAA 4LSAA 3FXIA 5FTTB 3G06A 2OMZA 2P1PB 4QC0A 4L3AA 5B4PA 1KOOA 2WQUA 4U06A 1GWBA 2FT3A 3C6PB 5A5CA 1QYYA 4BSUA 2Z7XA 1O6SA 1IO0A 3CVRA 1H6UA 2Z66A 1OOKG 3KJ4A 4Z79A 2BNHA 5GMFA 1OTNA 3G3AA 1DFJI 4CILA 1OTOA 4C2BB 4ECNA 5AWDA 1K5GC 3WPDA 4P91A 4NZTM 4Q62A 1Z7XW 3WPGA 5AWCA 4OQTA 4Q3GA 4CNMA 3BZ5A 4I6JB 1YRGA 4V2EA
chains in the Genus database with same CATH topology
1U0ND 1FT8A 3W3GA 2ASTB 4LXSA 4QXEA 2O6QA 3A79B 1XECA 3G04C 3CIGA 3ZYNA 4LXRA 3E6JA 3WPCA 2ELLA 3WPHA 3OGKB 3UN9A 5AWBA 5GS2B 4NKGA 4Z94G 4GLPA 2OMTA 2OMYA 2O6SA 3RGZA 1JL5A 4LSXC 3O53A 4XOSA 3RW7A 4MQWX 1A4YA 3W3NA 4AY9X 4LSXA 4GT6A 1FS2A 3WPBA 2WFHA 4ARRA 1M9SA 4EZGA 3W3JA 1D0BA 3ZYIA 4R09A 4B8CD 4Y61B 1O6TA 4U09A 4LI2A 4BSRA 3WPIA 4BSSA 3W3LA 2V9SA 2Z63A 3C6NB 3ZYOA 2O6RA 1OTMA 5GQRK 2IFGA 5IYXC 2RA8A 1XKUA 2A0ZA 4V2DA 3G3BA 4KNGA 2WQVA 2Z82A 2V9TB 3OGMB 2WQWA 3REZA 4P8SA 4XGOA 4FD0A 5AZ5A 4QBZA 3TSRE 1ZIWA 4R6FA 2Z65A 4HQ1A 4R58A 3WN4A 4ARNA 4J0MA 1O6VA 4R5CA 4Q3IA 4FHOA 3WPEA 1WWLA 1M9LA 4RCWA 4R6JA 5HZLB 4R08A 3OGLB 5CMNA 4KT1A 4CP6A 4MN8B 5B0NA 4UFRA 5LFNA 1XEUA 1P8VA 2Y5QA 3OJAB 3UL8A 2P1MB 2ID5A 2V70A 4YEBB 3ULUA 3WPFA 3UL9A 4V2CA 4PQ8A 4U08A 4PKIG 4PERA 4TZHA 3E4GA 1KOHA 2P1OB 3O6NA 3CIYA 4G8AA 3UL7A 2Z7XB 3ZYJA 2Z64A 4U7LA 2Q4GW 4AW4A 3RW6A 5CMPA 1PGVA 1G9UA 4LSCA 2Z62A 2UZYA 2OMWA 4FDWA 1K5DC 1SQ0B 3E3ZA 1OZNA 1P9AG 5HDHA 2XWTC 4Z64C 5IJDA 2Z81A 4R07A 3DZEA 1LTXA 2XOTA 1XCDA 1H6TA 3G39A 1OGQA 4CC4C 4FS7A 4L3FA 2OMUA 4C2AB 3GOZA 4R6AA 3SB4A 4RWTC 1FO1A 1W8AA 3RJ0A 4FMZA 5GS0A 2OMXA 3ULAA 1M10B 4CC4A 4WYKA 3ULVA 3RFJA 4Z61C 3C6OB 2JQDA 4R5DA 3W3MA 2WQXA 4K17A 2BEXA 4BV4R 4R6GA 4XSQA 2R9UA 3RFEA 5AWAA 2JE0A 3RGXA 1XWDC 3E2JA 2RR6A 3VQ1A 5D3IA 4M7EC 2P1QB 4H09A 3M18A 1DS9A 2P1NB 1P8TA 4KXFB 5B0TA 1A9NA 4Z8GA 4M7EA 1FQVA 3M19A 3JB9j 4NKHA 3RFSA 5GMGA 4RCAB 4CNCA 3PMHG 4ECOA 4R0AA 5GMHA 2CA6A 4IM6A 3W3KA 2UZXA 4J4LA 3P72A 5IJCA 3RIZA 4PEQB 1DCEA 4FCGA 4LI1A 2ASSB 2JE1A 2OMVA 4WP6A 5IJBA 1M0ZA 3VQ2A 4PSJA 3OJAA 4LSAA 3FXIA 5FTTB 3G06A 2OMZA 2P1PB 4QC0A 4L3AA 5B4PA 1KOOA 2WQUA 4U06A 1GWBA 2FT3A 3C6PB 5A5CA 1QYYA 4BSUA 2Z7XA 1O6SA 1IO0A 3CVRA 1H6UA 2Z66A 1OOKG 3KJ4A 4Z79A 2BNHA 5GMFA 1OTNA 3G3AA 1DFJI 4CILA 1OTOA 4C2BB 4ECNA 5AWDA 1K5GC 3WPDA 4P91A 4Q62A 1Z7XW 3WPGA 5AWCA 4OQTA 4Q3GA 4CNMA 3BZ5A 4I6JB 1YRGA 4V2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0N D;  1FT8 A;  3W3G A;  2AST B;  4LXS A;  4QXE A;  2O6Q A;  3A79 B;  1XEC A;  3G04 C;  3CIG A;  3ZYN A;  4LXR A;  3E6J A;  3WPC A;  2ELL A;  3WPH A;  3OGK B;  3UN9 A;  5AWB A;  5GS2 B;  4NKG A;  4Z94 G;  4GLP A;  2OMT A;  2OMY A;  2O6S A;  3RGZ A;  1JL5 A;  4LSX C;  3O53 A;  4XOS A;  3RW7 A;  4MQW X;  1A4Y A;  3W3N A;  4AY9 X;  4LSX A;  4GT6 A;  1FS2 A;  3WPB A;  2WFH A;  4ARR A;  1M9S A;  4EZG A;  3W3J A;  1D0B A;  3ZYI A;  4R09 A;  4B8C D;  4Y61 B;  1O6T A;  4U09 A;  4LI2 A;  4BSR A;  3WPI A;  4BSS A;  3W3L A;  2V9S A;  2Z63 A;  3C6N B;  3ZYO A;  2O6R A;  1OTM A;  5GQR K;  2IFG A;  5IYX C;  2RA8 A;  1XKU A;  2A0Z A;  4V2D A;  3G3B A;  4KNG A;  2WQV A;  2Z82 A;  2V9T B;  3OGM B;  2WQW A;  3REZ A;  4P8S A;  4XGO A;  4FD0 A;  5AZ5 A;  4QBZ A;  3TSR E;  1ZIW A;  4R6F A;  2Z65 A;  4HQ1 A;  4R58 A;  3WN4 A;  4ARN A;  4J0M A;  1O6V A;  4R5C A;  4Q3I A;  4FHO A;  3WPE A;  1WWL A;  1M9L A;  4RCW A;  4R6J A;  5HZL B;  4R08 A;  3OGL B;  5CMN A;  4KT1 A;  4CP6 A;  4MN8 B;  5B0N A;  4UFR A;  5LFN A;  1XEU A;  1P8V A;  2Y5Q A;  3OJA B;  3UL8 A;  2P1M B;  2ID5 A;  2V70 A;  4YEB B;  3ULU A;  3WPF A;  3UL9 A;  4V2C A;  4PQ8 A;  4U08 A;  4PKI G;  4PER A;  4TZH A;  3E4G A;  1KOH A;  2P1O B;  3O6N A;  3CIY A;  4G8A A;  3UL7 A;  2Z7X B;  3ZYJ A;  2Z64 A;  4U7L A;  2Q4G W;  4AW4 A;  3RW6 A;  5CMP A;  1PGV A;  1G9U A;  4LSC A;  2Z62 A;  2UZY A;  2OMW A;  4FDW A;  1K5D C;  1SQ0 B;  3E3Z A;  1OZN A;  1P9A G;  5HDH A;  2XWT C;  4Z64 C;  5IJD A;  2Z81 A;  4R07 A;  3DZE A;  1LTX A;  2XOT A;  1XCD A;  1H6T A;  3G39 A;  1OGQ A;  4CC4 C;  4FS7 A;  4L3F A;  2OMU A;  4C2A B;  3GOZ A;  4R6A A;  3SB4 A;  4RWT C;  1FO1 A;  1W8A A;  3RJ0 A;  4FMZ A;  5GS0 A;  2OMX A;  3ULA A;  1M10 B;  4CC4 A;  4WYK A;  3ULV A;  3RFJ A;  4Z61 C;  3C6O B;  2JQD A;  4R5D A;  3W3M A;  2WQX A;  4K17 A;  2BEX A;  4BV4 R;  4R6G A;  4XSQ A;  2R9U A;  3RFE A;  5AWA A;  2JE0 A;  3RGX A;  1XWD C;  3E2J A;  2RR6 A;  3VQ1 A;  5D3I A;  4M7E C;  2P1Q B;  4H09 A;  3M18 A;  1DS9 A;  2P1N B;  1P8T A;  4KXF B;  5B0T A;  1A9N A;  4Z8G A;  4M7E A;  1FQV A;  3M19 A;  3JB9 j;  4NKH A;  3RFS A;  5GMG A;  4RCA B;  4CNC A;  3PMH G;  4ECO A;  4R0A A;  5GMH A;  2CA6 A;  4IM6 A;  3W3K A;  2UZX A;  4J4L A;  3P72 A;  5IJC A;  3RIZ A;  4PEQ B;  1DCE A;  4FCG A;  4LI1 A;  2ASS B;  2JE1 A;  2OMV A;  4WP6 A;  5IJB A;  1M0Z A;  3VQ2 A;  4PSJ A;  3OJA A;  4LSA A;  3FXI A;  5FTT B;  3G06 A;  2OMZ A;  2P1P B;  4QC0 A;  4L3A A;  5B4P A;  1KOO A;  2WQU A;  4U06 A;  1GWB A;  2FT3 A;  3C6P B;  5A5C A;  1QYY A;  4BSU A;  2Z7X A;  1O6S A;  1IO0 A;  3CVR A;  1H6U A;  2Z66 A;  1OOK G;  3KJ4 A;  4Z79 A;  2BNH A;  5GMF A;  1OTN A;  3G3A A;  1DFJ I;  4CIL A;  1OTO A;  4C2B B;  4ECN A;  5AWD A;  1K5G C;  3WPD A;  4P91 A;  4Q62 A;  1Z7X W;  3WPG A;  5AWC A;  4OQT A;  4Q3G A;  4CNM A;  3BZ5 A;  4I6J B;  1YRG A;  4V2E A; 
#chains in the Genus database with same CATH topology
 1U0N D;  1FT8 A;  3W3G A;  2AST B;  4LXS A;  4QXE A;  2O6Q A;  3A79 B;  1XEC A;  3G04 C;  3CIG A;  3ZYN A;  4LXR A;  3E6J A;  3WPC A;  2ELL A;  3WPH A;  3OGK B;  3UN9 A;  5AWB A;  5GS2 B;  4NKG A;  4Z94 G;  4GLP A;  2OMT A;  2OMY A;  2O6S A;  3RGZ A;  1JL5 A;  4LSX C;  3O53 A;  4XOS A;  3RW7 A;  4MQW X;  1A4Y A;  3W3N A;  4AY9 X;  4LSX A;  4GT6 A;  1FS2 A;  3WPB A;  2WFH A;  4ARR A;  1M9S A;  4EZG A;  3W3J A;  1D0B A;  3ZYI A;  4R09 A;  4B8C D;  4Y61 B;  1O6T A;  4U09 A;  4LI2 A;  4BSR A;  3WPI A;  4NZR M;  4BSS A;  3W3L A;  2V9S A;  2Z63 A;  3C6N B;  3ZYO A;  2O6R A;  1OTM A;  5GQR K;  2IFG A;  5IYX C;  2RA8 A;  1XKU A;  2A0Z A;  4V2D A;  3G3B A;  4KNG A;  2WQV A;  2Z82 A;  2V9T B;  3OGM B;  2WQW A;  3REZ A;  4P8S A;  4XGO A;  4FD0 A;  5AZ5 A;  4QBZ A;  3TSR E;  1ZIW A;  4R6F A;  2Z65 A;  4HQ1 A;  4R58 A;  3WN4 A;  4ARN A;  4J0M A;  1O6V A;  4R5C A;  4Q3I A;  4FHO A;  3WPE A;  1WWL A;  1M9L A;  4RCW A;  4R6J A;  5HZL B;  4R08 A;  3OGL B;  5CMN A;  4KT1 A;  4CP6 A;  4MN8 B;  5B0N A;  4UFR A;  5LFN A;  1XEU A;  1P8V A;  2Y5Q A;  3OJA B;  3UL8 A;  2P1M B;  2ID5 A;  2V70 A;  4YEB B;  3ULU A;  3WPF A;  3UL9 A;  4V2C A;  4PQ8 A;  4U08 A;  4PKI G;  4PER A;  4TZH A;  3E4G A;  1KOH A;  2P1O B;  3O6N A;  3CIY A;  4G8A A;  3UL7 A;  2Z7X B;  3ZYJ A;  2Z64 A;  4U7L A;  2Q4G W;  4AW4 A;  3RW6 A;  5CMP A;  1PGV A;  1G9U A;  4LSC A;  2Z62 A;  2UZY A;  2OMW A;  4FDW A;  1K5D C;  1SQ0 B;  3E3Z A;  1OZN A;  1P9A G;  5HDH A;  2XWT C;  4Z64 C;  5IJD A;  2Z81 A;  4R07 A;  3DZE A;  1LTX A;  2XOT A;  1XCD A;  1H6T A;  3G39 A;  1OGQ A;  4CC4 C;  4FS7 A;  4L3F A;  2OMU A;  4C2A B;  3GOZ A;  4R6A A;  3SB4 A;  4RWT C;  1FO1 A;  1W8A A;  3RJ0 A;  4FMZ A;  5GS0 A;  2OMX A;  3ULA A;  1M10 B;  4CC4 A;  4WYK A;  3ULV A;  3RFJ A;  4Z61 C;  3C6O B;  2JQD A;  4R5D A;  3W3M A;  2WQX A;  4K17 A;  2BEX A;  4BV4 R;  4R6G A;  4XSQ A;  2R9U A;  3RFE A;  5AWA A;  2JE0 A;  3RGX A;  1XWD C;  3E2J A;  2RR6 A;  3VQ1 A;  5D3I A;  4M7E C;  2P1Q B;  4H09 A;  3M18 A;  1DS9 A;  2P1N B;  1P8T A;  4KXF B;  5B0T A;  1A9N A;  4Z8G A;  4M7E A;  1FQV A;  3M19 A;  3JB9 j;  4NKH A;  3RFS A;  5GMG A;  4RCA B;  4CNC A;  3PMH G;  4ECO A;  4R0A A;  5GMH A;  2CA6 A;  4IM6 A;  3W3K A;  2UZX A;  4J4L A;  3P72 A;  5IJC A;  3RIZ A;  4PEQ B;  1DCE A;  4FCG A;  4LI1 A;  2ASS B;  2JE1 A;  2OMV A;  4WP6 A;  5IJB A;  1M0Z A;  3VQ2 A;  4PSJ A;  3OJA A;  4LSA A;  3FXI A;  5FTT B;  3G06 A;  2OMZ A;  2P1P B;  4QC0 A;  4L3A A;  5B4P A;  1KOO A;  2WQU A;  4U06 A;  1GWB A;  2FT3 A;  3C6P B;  5A5C A;  1QYY A;  4BSU A;  2Z7X A;  1O6S A;  1IO0 A;  3CVR A;  1H6U A;  2Z66 A;  1OOK G;  3KJ4 A;  4Z79 A;  2BNH A;  5GMF A;  1OTN A;  3G3A A;  1DFJ I;  4CIL A;  1OTO A;  4C2B B;  4ECN A;  5AWD A;  1K5G C;  3WPD A;  4P91 A;  4NZT M;  4Q62 A;  1Z7X W;  3WPG A;  5AWC A;  4OQT A;  4Q3G A;  4CNM A;  3BZ5 A;  4I6J B;  1YRG A;  4V2E A; 
#chains in the Genus database with same CATH homology
 1U0N D;  1FT8 A;  3W3G A;  2AST B;  4LXS A;  4QXE A;  2O6Q A;  3A79 B;  1XEC A;  3G04 C;  3CIG A;  3ZYN A;  4LXR A;  3E6J A;  3WPC A;  2ELL A;  3WPH A;  3OGK B;  3UN9 A;  5AWB A;  5GS2 B;  4NKG A;  4Z94 G;  4GLP A;  2OMT A;  2OMY A;  2O6S A;  3RGZ A;  1JL5 A;  4LSX C;  3O53 A;  4XOS A;  3RW7 A;  4MQW X;  1A4Y A;  3W3N A;  4AY9 X;  4LSX A;  4GT6 A;  1FS2 A;  3WPB A;  2WFH A;  4ARR A;  1M9S A;  4EZG A;  3W3J A;  1D0B A;  3ZYI A;  4R09 A;  4B8C D;  4Y61 B;  1O6T A;  4U09 A;  4LI2 A;  4BSR A;  3WPI A;  4BSS A;  3W3L A;  2V9S A;  2Z63 A;  3C6N B;  3ZYO A;  2O6R A;  1OTM A;  5GQR K;  2IFG A;  5IYX C;  2RA8 A;  1XKU A;  2A0Z A;  4V2D A;  3G3B A;  4KNG A;  2WQV A;  2Z82 A;  2V9T B;  3OGM B;  2WQW A;  3REZ A;  4P8S A;  4XGO A;  4FD0 A;  5AZ5 A;  4QBZ A;  3TSR E;  1ZIW A;  4R6F A;  2Z65 A;  4HQ1 A;  4R58 A;  3WN4 A;  4ARN A;  4J0M A;  1O6V A;  4R5C A;  4Q3I A;  4FHO A;  3WPE A;  1WWL A;  1M9L A;  4RCW A;  4R6J A;  5HZL B;  4R08 A;  3OGL B;  5CMN A;  4KT1 A;  4CP6 A;  4MN8 B;  5B0N A;  4UFR A;  5LFN A;  1XEU A;  1P8V A;  2Y5Q A;  3OJA B;  3UL8 A;  2P1M B;  2ID5 A;  2V70 A;  4YEB B;  3ULU A;  3WPF A;  3UL9 A;  4V2C A;  4PQ8 A;  4U08 A;  4PKI G;  4PER A;  4TZH A;  3E4G A;  1KOH A;  2P1O B;  3O6N A;  3CIY A;  4G8A A;  3UL7 A;  2Z7X B;  3ZYJ A;  2Z64 A;  4U7L A;  2Q4G W;  4AW4 A;  3RW6 A;  5CMP A;  1PGV A;  1G9U A;  4LSC A;  2Z62 A;  2UZY A;  2OMW A;  4FDW A;  1K5D C;  1SQ0 B;  3E3Z A;  1OZN A;  1P9A G;  5HDH A;  2XWT C;  4Z64 C;  5IJD A;  2Z81 A;  4R07 A;  3DZE A;  1LTX A;  2XOT A;  1XCD A;  1H6T A;  3G39 A;  1OGQ A;  4CC4 C;  4FS7 A;  4L3F A;  2OMU A;  4C2A B;  3GOZ A;  4R6A A;  3SB4 A;  4RWT C;  1FO1 A;  1W8A A;  3RJ0 A;  4FMZ A;  5GS0 A;  2OMX A;  3ULA A;  1M10 B;  4CC4 A;  4WYK A;  3ULV A;  3RFJ A;  4Z61 C;  3C6O B;  2JQD A;  4R5D A;  3W3M A;  2WQX A;  4K17 A;  2BEX A;  4BV4 R;  4R6G A;  4XSQ A;  2R9U A;  3RFE A;  5AWA A;  2JE0 A;  3RGX A;  1XWD C;  3E2J A;  2RR6 A;  3VQ1 A;  5D3I A;  4M7E C;  2P1Q B;  4H09 A;  3M18 A;  1DS9 A;  2P1N B;  1P8T A;  4KXF B;  5B0T A;  1A9N A;  4Z8G A;  4M7E A;  1FQV A;  3M19 A;  3JB9 j;  4NKH A;  3RFS A;  5GMG A;  4RCA B;  4CNC A;  3PMH G;  4ECO A;  4R0A A;  5GMH A;  2CA6 A;  4IM6 A;  3W3K A;  2UZX A;  4J4L A;  3P72 A;  5IJC A;  3RIZ A;  4PEQ B;  1DCE A;  4FCG A;  4LI1 A;  2ASS B;  2JE1 A;  2OMV A;  4WP6 A;  5IJB A;  1M0Z A;  3VQ2 A;  4PSJ A;  3OJA A;  4LSA A;  3FXI A;  5FTT B;  3G06 A;  2OMZ A;  2P1P B;  4QC0 A;  4L3A A;  5B4P A;  1KOO A;  2WQU A;  4U06 A;  1GWB A;  2FT3 A;  3C6P B;  5A5C A;  1QYY A;  4BSU A;  2Z7X A;  1O6S A;  1IO0 A;  3CVR A;  1H6U A;  2Z66 A;  1OOK G;  3KJ4 A;  4Z79 A;  2BNH A;  5GMF A;  1OTN A;  3G3A A;  1DFJ I;  4CIL A;  1OTO A;  4C2B B;  4ECN A;  5AWD A;  1K5G C;  3WPD A;  4P91 A;  4Q62 A;  1Z7X W;  3WPG A;  5AWC A;  4OQT A;  4Q3G A;  4CNM A;  3BZ5 A;  4I6J B;  1YRG A;  4V2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...