2V9TB

Complex between the second lrr domain of slit2 and the first ig domain from robo1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
210
Chain Sequence
GSLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROUNDABOUT HOMOLOG 1
publication title Structural Insights Into the Slit-Robo Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/receptor
total genus 70
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF01463 LRRCT Leucine rich repeat C-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2v9tB00
4PERA 2OMXA 1PGVA 4CNCA 1K5DC 3C6OB 4FDWA 1H6TA 1ZIWA 4H09A 4XGOA 4U09A 5IYXC 2Z62A 4NKGA 1YRGA 2V9SA 3G3BA 2Z7XB 3PMHG 4FS7A 3JB9j 1P8VA 2P1QB 4Z64C 2BEXA 3C6PB 2P1MB 4BSSA 2XWTC 3ULVA 5GMFA 5GMGA 3ULUA 4L3FA 4KXFB 3OGMB 1WWLA 4BSRA 3OGKB 4R08A 2Z82A 4Z79A 2CA6A 1IO0A 3M19A 4LSCA 2P1PB 4ARNA 2Z63A 1DFJI 1K5GC 3UN9A 2OMWA 2WQWA 5A5CA 1OTOA 1GWBA 1OTMA 4R5CA 4U06A 3W3NA 4WP6A 4U7LA 4CILA 2OMZA 2JQDA 4Q3IA 5IJDA 4ECNA 1Z7XW 4OQTA 4NKHA 3RGXA 1D0BA 4KNGA 3DZEA 1M0ZA 3UL7A 3O53A 3VQ1A 2OMYA 1XECA 3KJ4A 1M10B 1M9SA 4GLPA 3ULAA 4M7EA 4HQ1A 4IM6A 4R07A 4QC0A 4CP6A 3WPHA 1FS2A 3RIZA 4RCAB 2V70A 1M9LA 4FHOA 4QBZA 4CC4A 3ZYJA 4GT6A 4R6GA 2Z66A 2JE0A 4LSAA 1O6VA 4BSUA 4PSJA 3VQ2A 4LXSA 4K17A 3M18A 3RW7A 5B0NA 4EZGA 3RJ0A 1A9NA 3E2JA 4V2CA 3W3LA 5HZLB 1O6SA 1XEUA 4J0MA 4R58A 4FMZA 2FT3A 4R6JA 3WPFA 4XOSA 3WPGA 2ASSB 1G9UA 1FT8A 3G3AA 1KOOA 5AZ5A 1OOKG 3UL9A 4R5DA 3SB4A 4KT1A 3WPIA 2RR6A 4MN8B 3W3MA 3GOZA 5HDHA 4UFRA 5GQRK 5GS0A 1SQ0B 4R0AA 1FO1A 2Z7XA 1U0ND 4C2BB 2WQUA 1KOHA 5AWCA 4Z61C 4M7EC 3G04C 2Q4GW 3ZYOA 4RCWA 1P8TA 3BZ5A 5AWDA 4V2EA 3WPBA 3W3GA 2P1NB 3E4GA 4PQ8A 3WPEA 3ZYIA 4CC4C 4ECOA 3OJAB 4Z8GA 4I6JB 2Y5QA 1OZNA 4PEQB 3E6JA 4MQWX 3WPCA 2UZXA 3CIYA 2OMUA 2JE1A 4TZHA 4Z94G 2WFHA 1DS9A 4G8AA 3P72A 4LXRA 1XKUA 3RFJA 1O6TA 3UL8A 3G06A 4LSXA 4V2DA 4XSQA 3REZA 2ASTB 3TSRE 2ID5A 3OJAA 3E3ZA 4PKIG 2IFGA 1FQVA 2O6RA 1LTXA 5GS2B 4YEBB 1JL5A 2ELLA 3OGLB 2WQVA 4B8CD 1DCEA 3W3JA 4LI1A 3RFEA 2O6QA 2Z64A 5B0TA 5B4PA 4J4LA 2A0ZA 1OGQA 2Z81A 4P91A 3A79B 5LFNA 4L3AA 4ARRA 2UZYA 4QXEA 1H6UA 3G39A 1OTNA 2RA8A 4C2AB 5GMHA 2BNHA 2Z65A 4Q62A 4R09A 3RGZA 5IJCA 3RW6A 5D3IA 2O6SA 5AWAA 4R6AA 2WQXA 4P8SA 5AWBA 4LI2A 1P9AG 3C6NB 4AY9X 4Y61B 3CVRA 1XWDC 2P1OB 4WYKA 3RFSA 4RWTC 3ZYNA 3WN4A 4FD0A 4R6FA 1A4YA 4U08A 2R9UA 4LSXC 5CMPA 2XOTA 3WPDA 2OMTA 3FXIA 4CNMA 3O6NA 3W3KA 5FTTB 3CIGA 5IJBA 4BV4R 4AW4A 2OMVA 2V9TB 5CMNA 1W8AA 4FCGA 1XCDA 4Q3GA 1QYYA
chains in the Genus database with same CATH superfamily
4PERA 2OMXA 1PGVA 4CNCA 1K5DC 3C6OB 4FDWA 1H6TA 1ZIWA 4H09A 4NZRM 4XGOA 4U09A 5IYXC 2Z62A 4NKGA 1YRGA 2V9SA 3G3BA 2Z7XB 3PMHG 4FS7A 3JB9j 1P8VA 2P1QB 4Z64C 2BEXA 3C6PB 2P1MB 4BSSA 2XWTC 3ULVA 5GMFA 5GMGA 3ULUA 4L3FA 4KXFB 3OGMB 1WWLA 4BSRA 3OGKB 4R08A 2Z82A 4Z79A 2CA6A 1IO0A 3M19A 4LSCA 2P1PB 4ARNA 2Z63A 1DFJI 1K5GC 3UN9A 2OMWA 2WQWA 5A5CA 1OTOA 1GWBA 1OTMA 4R5CA 4U06A 3W3NA 4WP6A 4U7LA 4CILA 2OMZA 2JQDA 4Q3IA 5IJDA 4ECNA 1Z7XW 4OQTA 4NKHA 3RGXA 1D0BA 4KNGA 3DZEA 1M0ZA 3UL7A 3O53A 3VQ1A 2OMYA 1XECA 3KJ4A 1M10B 1M9SA 4GLPA 3ULAA 4M7EA 4HQ1A 4IM6A 4R07A 4QC0A 4CP6A 3WPHA 1FS2A 3RIZA 4RCAB 2V70A 1M9LA 4FHOA 4QBZA 4CC4A 3ZYJA 4GT6A 4R6GA 2Z66A 2JE0A 4LSAA 1O6VA 4BSUA 4PSJA 3VQ2A 4LXSA 4K17A 3M18A 3RW7A 5B0NA 4EZGA 3RJ0A 1A9NA 3E2JA 4V2CA 3W3LA 5HZLB 1O6SA 1XEUA 4J0MA 4R58A 4FMZA 2FT3A 4R6JA 3WPFA 4XOSA 3WPGA 2ASSB 1G9UA 1FT8A 3G3AA 1KOOA 5AZ5A 1OOKG 3UL9A 4R5DA 3SB4A 4KT1A 3WPIA 2RR6A 4MN8B 3W3MA 3GOZA 5HDHA 4UFRA 5GQRK 5GS0A 1SQ0B 4R0AA 1FO1A 2Z7XA 1U0ND 4C2BB 2WQUA 1KOHA 5AWCA 4Z61C 4M7EC 3G04C 2Q4GW 3ZYOA 4RCWA 1P8TA 3BZ5A 5AWDA 4V2EA 3WPBA 3W3GA 2P1NB 3E4GA 4PQ8A 3WPEA 3ZYIA 4CC4C 4ECOA 3OJAB 4Z8GA 4I6JB 2Y5QA 1OZNA 4PEQB 3E6JA 4MQWX 3WPCA 2UZXA 3CIYA 2OMUA 2JE1A 4TZHA 4Z94G 2WFHA 1DS9A 4G8AA 3P72A 4LXRA 1XKUA 3RFJA 1O6TA 3UL8A 3G06A 4LSXA 4V2DA 4XSQA 3REZA 2ASTB 3TSRE 2ID5A 3OJAA 3E3ZA 4PKIG 2IFGA 1FQVA 2O6RA 1LTXA 5GS2B 4YEBB 1JL5A 2ELLA 3OGLB 2WQVA 4B8CD 1DCEA 3W3JA 4LI1A 3RFEA 2O6QA 2Z64A 5B0TA 5B4PA 4J4LA 2A0ZA 1OGQA 2Z81A 4P91A 3A79B 5LFNA 4L3AA 4ARRA 2UZYA 4QXEA 1H6UA 3G39A 1OTNA 2RA8A 4C2AB 5GMHA 2BNHA 2Z65A 4Q62A 4R09A 3RGZA 5IJCA 3RW6A 5D3IA 2O6SA 5AWAA 4R6AA 2WQXA 4P8SA 5AWBA 4LI2A 1P9AG 3C6NB 4AY9X 4Y61B 3CVRA 1XWDC 2P1OB 4WYKA 3RFSA 4RWTC 3ZYNA 4NZTM 3WN4A 4FD0A 4R6FA 1A4YA 4U08A 2R9UA 4LSXC 5CMPA 2XOTA 3WPDA 2OMTA 3FXIA 4CNMA 3O6NA 3W3KA 5FTTB 3CIGA 5IJBA 4BV4R 4AW4A 2OMVA 2V9TB 5CMNA 1W8AA 4FCGA 1XCDA 4Q3GA 1QYYA
chains in the Genus database with same CATH topology
4PERA 2OMXA 1PGVA 4CNCA 1K5DC 3C6OB 4FDWA 1H6TA 1ZIWA 4H09A 4XGOA 4U09A 5IYXC 2Z62A 4NKGA 1YRGA 2V9SA 3G3BA 2Z7XB 3PMHG 4FS7A 3JB9j 1P8VA 2P1QB 4Z64C 2BEXA 3C6PB 2P1MB 4BSSA 2XWTC 3ULVA 5GMFA 5GMGA 3ULUA 4L3FA 4KXFB 3OGMB 1WWLA 4BSRA 3OGKB 4R08A 2Z82A 4Z79A 2CA6A 1IO0A 3M19A 4LSCA 2P1PB 4ARNA 2Z63A 1DFJI 1K5GC 3UN9A 2OMWA 2WQWA 5A5CA 1OTOA 1GWBA 1OTMA 4R5CA 4U06A 3W3NA 4WP6A 4U7LA 4CILA 2OMZA 2JQDA 4Q3IA 5IJDA 4ECNA 1Z7XW 4OQTA 4NKHA 3RGXA 1D0BA 4KNGA 3DZEA 1M0ZA 3UL7A 3O53A 3VQ1A 2OMYA 1XECA 3KJ4A 1M10B 1M9SA 4GLPA 3ULAA 4M7EA 4HQ1A 4IM6A 4R07A 4QC0A 4CP6A 3WPHA 1FS2A 3RIZA 4RCAB 2V70A 1M9LA 4FHOA 4QBZA 4CC4A 3ZYJA 4GT6A 4R6GA 2Z66A 2JE0A 4LSAA 1O6VA 4BSUA 4PSJA 3VQ2A 4LXSA 4K17A 3M18A 3RW7A 5B0NA 4EZGA 3RJ0A 1A9NA 3E2JA 4V2CA 3W3LA 5HZLB 1O6SA 1XEUA 4J0MA 4R58A 4FMZA 2FT3A 4R6JA 3WPFA 4XOSA 3WPGA 2ASSB 1G9UA 1FT8A 3G3AA 1KOOA 5AZ5A 1OOKG 3UL9A 4R5DA 3SB4A 4KT1A 3WPIA 2RR6A 4MN8B 3W3MA 3GOZA 5HDHA 4UFRA 5GQRK 5GS0A 1SQ0B 4R0AA 1FO1A 2Z7XA 1U0ND 4C2BB 2WQUA 1KOHA 5AWCA 4Z61C 4M7EC 3G04C 2Q4GW 3ZYOA 4RCWA 1P8TA 3BZ5A 5AWDA 4V2EA 3WPBA 3W3GA 2P1NB 3E4GA 4PQ8A 3WPEA 3ZYIA 4CC4C 4ECOA 3OJAB 4Z8GA 4I6JB 2Y5QA 1OZNA 4PEQB 3E6JA 4MQWX 3WPCA 2UZXA 3CIYA 2OMUA 2JE1A 4TZHA 4Z94G 2WFHA 1DS9A 4G8AA 3P72A 4LXRA 1XKUA 3RFJA 1O6TA 3UL8A 3G06A 4LSXA 4V2DA 4XSQA 3REZA 2ASTB 3TSRE 2ID5A 3OJAA 3E3ZA 4PKIG 2IFGA 1FQVA 2O6RA 1LTXA 5GS2B 4YEBB 1JL5A 2ELLA 3OGLB 2WQVA 4B8CD 1DCEA 3W3JA 4LI1A 3RFEA 2O6QA 2Z64A 5B0TA 5B4PA 4J4LA 2A0ZA 1OGQA 2Z81A 4P91A 3A79B 5LFNA 4L3AA 4ARRA 2UZYA 4QXEA 1H6UA 3G39A 1OTNA 2RA8A 4C2AB 5GMHA 2BNHA 2Z65A 4Q62A 4R09A 3RGZA 5IJCA 3RW6A 5D3IA 2O6SA 5AWAA 4R6AA 2WQXA 4P8SA 5AWBA 4LI2A 1P9AG 3C6NB 4AY9X 4Y61B 3CVRA 1XWDC 2P1OB 4WYKA 3RFSA 4RWTC 3ZYNA 3WN4A 4FD0A 4R6FA 1A4YA 4U08A 2R9UA 4LSXC 5CMPA 2XOTA 3WPDA 2OMTA 3FXIA 4CNMA 3O6NA 3W3KA 5FTTB 3CIGA 5IJBA 4BV4R 4AW4A 2OMVA 2V9TB 5CMNA 1W8AA 4FCGA 1XCDA 4Q3GA 1QYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PER A;  2OMX A;  1PGV A;  4CNC A;  1K5D C;  3C6O B;  4FDW A;  1H6T A;  1ZIW A;  4H09 A;  4XGO A;  4U09 A;  5IYX C;  2Z62 A;  4NKG A;  1YRG A;  2V9S A;  3G3B A;  2Z7X B;  3PMH G;  4FS7 A;  3JB9 j;  1P8V A;  2P1Q B;  4Z64 C;  2BEX A;  3C6P B;  2P1M B;  4BSS A;  2XWT C;  3ULV A;  5GMF A;  5GMG A;  3ULU A;  4L3F A;  4KXF B;  3OGM B;  1WWL A;  4BSR A;  3OGK B;  4R08 A;  2Z82 A;  4Z79 A;  2CA6 A;  1IO0 A;  3M19 A;  4LSC A;  2P1P B;  4ARN A;  2Z63 A;  1DFJ I;  1K5G C;  3UN9 A;  2OMW A;  2WQW A;  5A5C A;  1OTO A;  1GWB A;  1OTM A;  4R5C A;  4U06 A;  3W3N A;  4WP6 A;  4U7L A;  4CIL A;  2OMZ A;  2JQD A;  4Q3I A;  5IJD A;  4ECN A;  1Z7X W;  4OQT A;  4NKH A;  3RGX A;  1D0B A;  4KNG A;  3DZE A;  1M0Z A;  3UL7 A;  3O53 A;  3VQ1 A;  2OMY A;  1XEC A;  3KJ4 A;  1M10 B;  1M9S A;  4GLP A;  3ULA A;  4M7E A;  4HQ1 A;  4IM6 A;  4R07 A;  4QC0 A;  4CP6 A;  3WPH A;  1FS2 A;  3RIZ A;  4RCA B;  2V70 A;  1M9L A;  4FHO A;  4QBZ A;  4CC4 A;  3ZYJ A;  4GT6 A;  4R6G A;  2Z66 A;  2JE0 A;  4LSA A;  1O6V A;  4BSU A;  4PSJ A;  3VQ2 A;  4LXS A;  4K17 A;  3M18 A;  3RW7 A;  5B0N A;  4EZG A;  3RJ0 A;  1A9N A;  3E2J A;  4V2C A;  3W3L A;  5HZL B;  1O6S A;  1XEU A;  4J0M A;  4R58 A;  4FMZ A;  2FT3 A;  4R6J A;  3WPF A;  4XOS A;  3WPG A;  2ASS B;  1G9U A;  1FT8 A;  3G3A A;  1KOO A;  5AZ5 A;  1OOK G;  3UL9 A;  4R5D A;  3SB4 A;  4KT1 A;  3WPI A;  2RR6 A;  4MN8 B;  3W3M A;  3GOZ A;  5HDH A;  4UFR A;  5GQR K;  5GS0 A;  1SQ0 B;  4R0A A;  1FO1 A;  2Z7X A;  1U0N D;  4C2B B;  2WQU A;  1KOH A;  5AWC A;  4Z61 C;  4M7E C;  3G04 C;  2Q4G W;  3ZYO A;  4RCW A;  1P8T A;  3BZ5 A;  5AWD A;  4V2E A;  3WPB A;  3W3G A;  2P1N B;  3E4G A;  4PQ8 A;  3WPE A;  3ZYI A;  4CC4 C;  4ECO A;  3OJA B;  4Z8G A;  4I6J B;  2Y5Q A;  1OZN A;  4PEQ B;  3E6J A;  4MQW X;  3WPC A;  2UZX A;  3CIY A;  2OMU A;  2JE1 A;  4TZH A;  4Z94 G;  2WFH A;  1DS9 A;  4G8A A;  3P72 A;  4LXR A;  1XKU A;  3RFJ A;  1O6T A;  3UL8 A;  3G06 A;  4LSX A;  4V2D A;  4XSQ A;  3REZ A;  2AST B;  3TSR E;  2ID5 A;  3OJA A;  3E3Z A;  4PKI G;  2IFG A;  1FQV A;  2O6R A;  1LTX A;  5GS2 B;  4YEB B;  1JL5 A;  2ELL A;  3OGL B;  2WQV A;  4B8C D;  1DCE A;  3W3J A;  4LI1 A;  3RFE A;  2O6Q A;  2Z64 A;  5B0T A;  5B4P A;  4J4L A;  2A0Z A;  1OGQ A;  2Z81 A;  4P91 A;  3A79 B;  5LFN A;  4L3A A;  4ARR A;  2UZY A;  4QXE A;  1H6U A;  3G39 A;  1OTN A;  2RA8 A;  4C2A B;  5GMH A;  2BNH A;  2Z65 A;  4Q62 A;  4R09 A;  3RGZ A;  5IJC A;  3RW6 A;  5D3I A;  2O6S A;  5AWA A;  4R6A A;  2WQX A;  4P8S A;  5AWB A;  4LI2 A;  1P9A G;  3C6N B;  4AY9 X;  4Y61 B;  3CVR A;  1XWD C;  2P1O B;  4WYK A;  3RFS A;  4RWT C;  3ZYN A;  3WN4 A;  4FD0 A;  4R6F A;  1A4Y A;  4U08 A;  2R9U A;  4LSX C;  5CMP A;  2XOT A;  3WPD A;  2OMT A;  3FXI A;  4CNM A;  3O6N A;  3W3K A;  5FTT B;  3CIG A;  5IJB A;  4BV4 R;  4AW4 A;  2OMV A;  2V9T B;  5CMN A;  1W8A A;  4FCG A;  1XCD A;  4Q3G A;  1QYY A; 
#chains in the Genus database with same CATH topology
 4PER A;  2OMX A;  1PGV A;  4CNC A;  1K5D C;  3C6O B;  4FDW A;  1H6T A;  1ZIW A;  4H09 A;  4NZR M;  4XGO A;  4U09 A;  5IYX C;  2Z62 A;  4NKG A;  1YRG A;  2V9S A;  3G3B A;  2Z7X B;  3PMH G;  4FS7 A;  3JB9 j;  1P8V A;  2P1Q B;  4Z64 C;  2BEX A;  3C6P B;  2P1M B;  4BSS A;  2XWT C;  3ULV A;  5GMF A;  5GMG A;  3ULU A;  4L3F A;  4KXF B;  3OGM B;  1WWL A;  4BSR A;  3OGK B;  4R08 A;  2Z82 A;  4Z79 A;  2CA6 A;  1IO0 A;  3M19 A;  4LSC A;  2P1P B;  4ARN A;  2Z63 A;  1DFJ I;  1K5G C;  3UN9 A;  2OMW A;  2WQW A;  5A5C A;  1OTO A;  1GWB A;  1OTM A;  4R5C A;  4U06 A;  3W3N A;  4WP6 A;  4U7L A;  4CIL A;  2OMZ A;  2JQD A;  4Q3I A;  5IJD A;  4ECN A;  1Z7X W;  4OQT A;  4NKH A;  3RGX A;  1D0B A;  4KNG A;  3DZE A;  1M0Z A;  3UL7 A;  3O53 A;  3VQ1 A;  2OMY A;  1XEC A;  3KJ4 A;  1M10 B;  1M9S A;  4GLP A;  3ULA A;  4M7E A;  4HQ1 A;  4IM6 A;  4R07 A;  4QC0 A;  4CP6 A;  3WPH A;  1FS2 A;  3RIZ A;  4RCA B;  2V70 A;  1M9L A;  4FHO A;  4QBZ A;  4CC4 A;  3ZYJ A;  4GT6 A;  4R6G A;  2Z66 A;  2JE0 A;  4LSA A;  1O6V A;  4BSU A;  4PSJ A;  3VQ2 A;  4LXS A;  4K17 A;  3M18 A;  3RW7 A;  5B0N A;  4EZG A;  3RJ0 A;  1A9N A;  3E2J A;  4V2C A;  3W3L A;  5HZL B;  1O6S A;  1XEU A;  4J0M A;  4R58 A;  4FMZ A;  2FT3 A;  4R6J A;  3WPF A;  4XOS A;  3WPG A;  2ASS B;  1G9U A;  1FT8 A;  3G3A A;  1KOO A;  5AZ5 A;  1OOK G;  3UL9 A;  4R5D A;  3SB4 A;  4KT1 A;  3WPI A;  2RR6 A;  4MN8 B;  3W3M A;  3GOZ A;  5HDH A;  4UFR A;  5GQR K;  5GS0 A;  1SQ0 B;  4R0A A;  1FO1 A;  2Z7X A;  1U0N D;  4C2B B;  2WQU A;  1KOH A;  5AWC A;  4Z61 C;  4M7E C;  3G04 C;  2Q4G W;  3ZYO A;  4RCW A;  1P8T A;  3BZ5 A;  5AWD A;  4V2E A;  3WPB A;  3W3G A;  2P1N B;  3E4G A;  4PQ8 A;  3WPE A;  3ZYI A;  4CC4 C;  4ECO A;  3OJA B;  4Z8G A;  4I6J B;  2Y5Q A;  1OZN A;  4PEQ B;  3E6J A;  4MQW X;  3WPC A;  2UZX A;  3CIY A;  2OMU A;  2JE1 A;  4TZH A;  4Z94 G;  2WFH A;  1DS9 A;  4G8A A;  3P72 A;  4LXR A;  1XKU A;  3RFJ A;  1O6T A;  3UL8 A;  3G06 A;  4LSX A;  4V2D A;  4XSQ A;  3REZ A;  2AST B;  3TSR E;  2ID5 A;  3OJA A;  3E3Z A;  4PKI G;  2IFG A;  1FQV A;  2O6R A;  1LTX A;  5GS2 B;  4YEB B;  1JL5 A;  2ELL A;  3OGL B;  2WQV A;  4B8C D;  1DCE A;  3W3J A;  4LI1 A;  3RFE A;  2O6Q A;  2Z64 A;  5B0T A;  5B4P A;  4J4L A;  2A0Z A;  1OGQ A;  2Z81 A;  4P91 A;  3A79 B;  5LFN A;  4L3A A;  4ARR A;  2UZY A;  4QXE A;  1H6U A;  3G39 A;  1OTN A;  2RA8 A;  4C2A B;  5GMH A;  2BNH A;  2Z65 A;  4Q62 A;  4R09 A;  3RGZ A;  5IJC A;  3RW6 A;  5D3I A;  2O6S A;  5AWA A;  4R6A A;  2WQX A;  4P8S A;  5AWB A;  4LI2 A;  1P9A G;  3C6N B;  4AY9 X;  4Y61 B;  3CVR A;  1XWD C;  2P1O B;  4WYK A;  3RFS A;  4RWT C;  3ZYN A;  4NZT M;  3WN4 A;  4FD0 A;  4R6F A;  1A4Y A;  4U08 A;  2R9U A;  4LSX C;  5CMP A;  2XOT A;  3WPD A;  2OMT A;  3FXI A;  4CNM A;  3O6N A;  3W3K A;  5FTT B;  3CIG A;  5IJB A;  4BV4 R;  4AW4 A;  2OMV A;  2V9T B;  5CMN A;  1W8A A;  4FCG A;  1XCD A;  4Q3G A;  1QYY A; 
#chains in the Genus database with same CATH homology
 4PER A;  2OMX A;  1PGV A;  4CNC A;  1K5D C;  3C6O B;  4FDW A;  1H6T A;  1ZIW A;  4H09 A;  4XGO A;  4U09 A;  5IYX C;  2Z62 A;  4NKG A;  1YRG A;  2V9S A;  3G3B A;  2Z7X B;  3PMH G;  4FS7 A;  3JB9 j;  1P8V A;  2P1Q B;  4Z64 C;  2BEX A;  3C6P B;  2P1M B;  4BSS A;  2XWT C;  3ULV A;  5GMF A;  5GMG A;  3ULU A;  4L3F A;  4KXF B;  3OGM B;  1WWL A;  4BSR A;  3OGK B;  4R08 A;  2Z82 A;  4Z79 A;  2CA6 A;  1IO0 A;  3M19 A;  4LSC A;  2P1P B;  4ARN A;  2Z63 A;  1DFJ I;  1K5G C;  3UN9 A;  2OMW A;  2WQW A;  5A5C A;  1OTO A;  1GWB A;  1OTM A;  4R5C A;  4U06 A;  3W3N A;  4WP6 A;  4U7L A;  4CIL A;  2OMZ A;  2JQD A;  4Q3I A;  5IJD A;  4ECN A;  1Z7X W;  4OQT A;  4NKH A;  3RGX A;  1D0B A;  4KNG A;  3DZE A;  1M0Z A;  3UL7 A;  3O53 A;  3VQ1 A;  2OMY A;  1XEC A;  3KJ4 A;  1M10 B;  1M9S A;  4GLP A;  3ULA A;  4M7E A;  4HQ1 A;  4IM6 A;  4R07 A;  4QC0 A;  4CP6 A;  3WPH A;  1FS2 A;  3RIZ A;  4RCA B;  2V70 A;  1M9L A;  4FHO A;  4QBZ A;  4CC4 A;  3ZYJ A;  4GT6 A;  4R6G A;  2Z66 A;  2JE0 A;  4LSA A;  1O6V A;  4BSU A;  4PSJ A;  3VQ2 A;  4LXS A;  4K17 A;  3M18 A;  3RW7 A;  5B0N A;  4EZG A;  3RJ0 A;  1A9N A;  3E2J A;  4V2C A;  3W3L A;  5HZL B;  1O6S A;  1XEU A;  4J0M A;  4R58 A;  4FMZ A;  2FT3 A;  4R6J A;  3WPF A;  4XOS A;  3WPG A;  2ASS B;  1G9U A;  1FT8 A;  3G3A A;  1KOO A;  5AZ5 A;  1OOK G;  3UL9 A;  4R5D A;  3SB4 A;  4KT1 A;  3WPI A;  2RR6 A;  4MN8 B;  3W3M A;  3GOZ A;  5HDH A;  4UFR A;  5GQR K;  5GS0 A;  1SQ0 B;  4R0A A;  1FO1 A;  2Z7X A;  1U0N D;  4C2B B;  2WQU A;  1KOH A;  5AWC A;  4Z61 C;  4M7E C;  3G04 C;  2Q4G W;  3ZYO A;  4RCW A;  1P8T A;  3BZ5 A;  5AWD A;  4V2E A;  3WPB A;  3W3G A;  2P1N B;  3E4G A;  4PQ8 A;  3WPE A;  3ZYI A;  4CC4 C;  4ECO A;  3OJA B;  4Z8G A;  4I6J B;  2Y5Q A;  1OZN A;  4PEQ B;  3E6J A;  4MQW X;  3WPC A;  2UZX A;  3CIY A;  2OMU A;  2JE1 A;  4TZH A;  4Z94 G;  2WFH A;  1DS9 A;  4G8A A;  3P72 A;  4LXR A;  1XKU A;  3RFJ A;  1O6T A;  3UL8 A;  3G06 A;  4LSX A;  4V2D A;  4XSQ A;  3REZ A;  2AST B;  3TSR E;  2ID5 A;  3OJA A;  3E3Z A;  4PKI G;  2IFG A;  1FQV A;  2O6R A;  1LTX A;  5GS2 B;  4YEB B;  1JL5 A;  2ELL A;  3OGL B;  2WQV A;  4B8C D;  1DCE A;  3W3J A;  4LI1 A;  3RFE A;  2O6Q A;  2Z64 A;  5B0T A;  5B4P A;  4J4L A;  2A0Z A;  1OGQ A;  2Z81 A;  4P91 A;  3A79 B;  5LFN A;  4L3A A;  4ARR A;  2UZY A;  4QXE A;  1H6U A;  3G39 A;  1OTN A;  2RA8 A;  4C2A B;  5GMH A;  2BNH A;  2Z65 A;  4Q62 A;  4R09 A;  3RGZ A;  5IJC A;  3RW6 A;  5D3I A;  2O6S A;  5AWA A;  4R6A A;  2WQX A;  4P8S A;  5AWB A;  4LI2 A;  1P9A G;  3C6N B;  4AY9 X;  4Y61 B;  3CVR A;  1XWD C;  2P1O B;  4WYK A;  3RFS A;  4RWT C;  3ZYN A;  3WN4 A;  4FD0 A;  4R6F A;  1A4Y A;  4U08 A;  2R9U A;  4LSX C;  5CMP A;  2XOT A;  3WPD A;  2OMT A;  3FXI A;  4CNM A;  3O6N A;  3W3K A;  5FTT B;  3CIG A;  5IJB A;  4BV4 R;  4AW4 A;  2OMV A;  2V9T B;  5CMN A;  1W8A A;  4FCG A;  1XCD A;  4Q3G A;  1QYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...