2V9TB

Complex between the second lrr domain of slit2 and the first ig domain from robo1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
210
Chain Sequence
b'GSLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROUNDABOUT HOMOLOG 1
publication title Structural Insights Into the Slit-Robo Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/receptor
total genus 70
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF01463 LRRCT Leucine rich repeat C-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2v9tB00
4BSUA 4R5CA 5HDHA 4FD0A 4BSRA 3A79B 4Z61C 2R9UA 4PKIG 3REZA 5B0TA 4CNMA 5LFNA 2WQXA 3E2JA 1DFJI 3WPDA 3UN9A 4LI1A 3RIZA 1O6SA 2V9SA 1FO1A 3SB4A 5AWCA 1XEUA 1P8VA 2WQVA 2Z7XA 3P72A 5CMPA 4FHOA 3OJAA 4J4LA 1H6TA 1M9SA 3OGKB 4ARNA 3WPBA 4FMZA 1FT8A 1OTOA 2JE1A 4M7EC 4KXFB 4MQWX 3W3KA 3G39A 2FT3A 2RR6A 2Z81A 5IJBA 3O6NA 4CP6A 1ZIWA 4Q3IA 4OQTA 2UZXA 4NKHA 2Y5QA 4CC4C 1D0BA 2P1NB 5CMNA 4V2CA 4BSSA 1A9NA 2WQUA 4QBZA 4CNCA 3VQ2A 4U06A 1K5GC 4Y61B 3RW6A 3OJAB 3OGLB 2P1QB 1M0ZA 4Z8GA 2O6SA 4ECOA 3W3LA 3BZ5A 5A5CA 3WPCA 5B0NA 3ZYJA 5IYXC 3E4GA 3TSRE 4XGOA 1XKUA 1Z7XW 1K5DC 1A4YA 3ULVA 4U08A 3PMHG 3WPEA 1O6TA 1QYYA 3W3MA 1OTMA 2JQDA 3UL8A 2Z63A 3RJ0A 2JE0A 4YEBB 3O53A 4AW4A 1H6UA 5GMGA 1FS2A 4MN8B 4C2AB 2O6RA 5GMFA 4GLPA 1W8AA 1U0ND 4BV4R 2Z66A 3WPIA 3M19A 4K17A 4HQ1A 1IO0A 2BEXA 2A0ZA 2ASTB 1O6VA 3W3GA 4NKGA 4UFRA 4PERA 2OMYA 4U7LA 3G3BA 2V9TB 4V2DA 3C6OB 1OZNA 5FTTB 4WP6A 4P8SA 3E3ZA 1GWBA 2Q4GW 4L3AA 3G04C 4Z94G 4LXSA 4FDWA 3E6JA 4TZHA 3RW7A 2ID5A 2XOTA 3RGZA 4FCGA 2P1PB 4LSXA 3RGXA 3VQ1A 3GOZA 3KJ4A 5GS2B 3W3NA 4R09A 3WPFA 1KOHA 2UZYA 4Q3GA 1OTNA 3ULAA 4H09A 4QC0A 2Z7XB 3C6NB 5GMHA 1XCDA 2WFHA 4RCWA 1KOOA 3UL9A 4PSJA 2ASSB 1P9AG 1DS9A 1XECA 4GT6A 3W3JA 4R6FA 2ELLA 1PGVA 4Q62A 3G06A 5GQRK 3ZYNA 5AWDA 4R6JA 3G3AA 4C2BB 4IM6A 3C6PB 5B4PA 1P8TA 2O6QA 1LTXA 4P91A 4L3FA 4ARRA 3FXIA 3ULUA 3UL7A 3OGMB 5D3IA 3CVRA 3ZYIA 4R6AA 4RWTC 4PQ8A 5IJCA 4R0AA 1M9LA 2OMUA 3RFEA 1DCEA 4Z64C 4LSAA 5AWAA 4V2EA 3JB9j 4LXRA 4R08A 4KNGA 4G8AA 4R58A 4LSXC 1SQ0B 4R5DA 3RFSA 1OGQA 1JL5A 3CIYA 2V70A 2Z65A 3WPHA 2BNHA 2CA6A 3CIGA 4PEQB 4FS7A 4M7EA 5AWBA 4J0MA 1M10B 2XWTC 4XOSA 1FQVA 4U09A 4LI2A 1YRGA 4KT1A 1OOKG 2RA8A 3M18A 4B8CD 2OMXA 2Z64A 4WYKA 2IFGA 3DZEA 4LSCA 2Z82A 2WQWA 2OMWA 4R6GA 4RCAB 5AZ5A 3ZYOA 5GS0A 4R07A 4QXEA 4CC4A 1G9UA 4XSQA 3RFJA 3WPGA 4CILA 1XWDC 2P1MB 2OMZA 5IJDA 4I6JB 4EZGA 4Z79A 3WN4A 5HZLB 2OMTA 1WWLA 2P1OB 4AY9X 2OMVA 2Z62A 4ECNA
chains in the Genus database with same CATH superfamily
4BSUA 4R5CA 5HDHA 4FD0A 4BSRA 3A79B 4Z61C 2R9UA 4PKIG 3REZA 5B0TA 4CNMA 5LFNA 2WQXA 3E2JA 1DFJI 3WPDA 3UN9A 4LI1A 3RIZA 1O6SA 2V9SA 1FO1A 3SB4A 5AWCA 1XEUA 4NZRM 1P8VA 2WQVA 2Z7XA 3P72A 5CMPA 4FHOA 3OJAA 4J4LA 1H6TA 1M9SA 3OGKB 4ARNA 3WPBA 4FMZA 1FT8A 1OTOA 2JE1A 4M7EC 4KXFB 4MQWX 3W3KA 3G39A 2FT3A 2RR6A 2Z81A 5IJBA 3O6NA 4CP6A 1ZIWA 4Q3IA 4OQTA 2UZXA 4NKHA 2Y5QA 4CC4C 1D0BA 2P1NB 5CMNA 4V2CA 4BSSA 1A9NA 2WQUA 4QBZA 4CNCA 3VQ2A 4U06A 1K5GC 4Y61B 3RW6A 3OJAB 3OGLB 2P1QB 1M0ZA 4Z8GA 2O6SA 4ECOA 3W3LA 3BZ5A 5A5CA 3WPCA 5B0NA 3ZYJA 5IYXC 3E4GA 3TSRE 4XGOA 1XKUA 1Z7XW 1K5DC 1A4YA 3ULVA 4U08A 3PMHG 3WPEA 1O6TA 1QYYA 3W3MA 1OTMA 2JQDA 3UL8A 2Z63A 3RJ0A 2JE0A 4YEBB 3O53A 4AW4A 1H6UA 5GMGA 1FS2A 4MN8B 4C2AB 2O6RA 5GMFA 4GLPA 1W8AA 1U0ND 4BV4R 2Z66A 3WPIA 3M19A 4K17A 4HQ1A 1IO0A 2BEXA 2A0ZA 2ASTB 1O6VA 3W3GA 4NKGA 4UFRA 4PERA 2OMYA 4U7LA 3G3BA 2V9TB 4V2DA 3C6OB 1OZNA 5FTTB 4WP6A 4P8SA 3E3ZA 1GWBA 2Q4GW 4L3AA 3G04C 4Z94G 4LXSA 4FDWA 3E6JA 4TZHA 3RW7A 2ID5A 2XOTA 3RGZA 4FCGA 2P1PB 4LSXA 3RGXA 3VQ1A 3GOZA 3KJ4A 5GS2B 3W3NA 4R09A 3WPFA 1KOHA 2UZYA 4Q3GA 1OTNA 3ULAA 4H09A 4QC0A 2Z7XB 3C6NB 5GMHA 1XCDA 2WFHA 4RCWA 1KOOA 3UL9A 4PSJA 2ASSB 1P9AG 1DS9A 1XECA 4GT6A 3W3JA 4R6FA 2ELLA 1PGVA 4Q62A 3G06A 5GQRK 3ZYNA 5AWDA 4R6JA 3G3AA 4C2BB 4IM6A 3C6PB 5B4PA 1P8TA 4NZTM 2O6QA 1LTXA 4P91A 4L3FA 4ARRA 3FXIA 3ULUA 3UL7A 3OGMB 5D3IA 3CVRA 3ZYIA 4R6AA 4RWTC 4PQ8A 5IJCA 4R0AA 1M9LA 2OMUA 3RFEA 1DCEA 4Z64C 4LSAA 5AWAA 4V2EA 3JB9j 4LXRA 4R08A 4KNGA 4G8AA 4R58A 4LSXC 1SQ0B 4R5DA 3RFSA 1OGQA 1JL5A 3CIYA 2V70A 2Z65A 3WPHA 2BNHA 2CA6A 3CIGA 4PEQB 4FS7A 4M7EA 5AWBA 4J0MA 1M10B 2XWTC 4XOSA 1FQVA 4U09A 4LI2A 1YRGA 4KT1A 1OOKG 2RA8A 3M18A 4B8CD 2OMXA 2Z64A 4WYKA 2IFGA 3DZEA 4LSCA 2Z82A 2WQWA 2OMWA 4R6GA 4RCAB 5AZ5A 3ZYOA 5GS0A 4R07A 4QXEA 4CC4A 1G9UA 4XSQA 3RFJA 3WPGA 4CILA 1XWDC 2P1MB 2OMZA 5IJDA 4I6JB 4EZGA 4Z79A 3WN4A 5HZLB 2OMTA 1WWLA 2P1OB 4AY9X 2OMVA 2Z62A 4ECNA
chains in the Genus database with same CATH topology
4BSUA 4R5CA 5HDHA 4FD0A 4BSRA 3A79B 4Z61C 2R9UA 4PKIG 3REZA 5B0TA 4CNMA 5LFNA 2WQXA 3E2JA 1DFJI 3WPDA 3UN9A 4LI1A 3RIZA 1O6SA 2V9SA 1FO1A 3SB4A 5AWCA 1XEUA 1P8VA 2WQVA 2Z7XA 3P72A 5CMPA 4FHOA 3OJAA 4J4LA 1H6TA 1M9SA 3OGKB 4ARNA 3WPBA 4FMZA 1FT8A 1OTOA 2JE1A 4M7EC 4KXFB 4MQWX 3W3KA 3G39A 2FT3A 2RR6A 2Z81A 5IJBA 3O6NA 4CP6A 1ZIWA 4Q3IA 4OQTA 2UZXA 4NKHA 2Y5QA 4CC4C 1D0BA 2P1NB 5CMNA 4V2CA 4BSSA 1A9NA 2WQUA 4QBZA 4CNCA 3VQ2A 4U06A 1K5GC 4Y61B 3RW6A 3OJAB 3OGLB 2P1QB 1M0ZA 4Z8GA 2O6SA 4ECOA 3W3LA 3BZ5A 5A5CA 3WPCA 5B0NA 3ZYJA 5IYXC 3E4GA 3TSRE 4XGOA 1XKUA 1Z7XW 1K5DC 1A4YA 3ULVA 4U08A 3PMHG 3WPEA 1O6TA 1QYYA 3W3MA 1OTMA 2JQDA 3UL8A 2Z63A 3RJ0A 2JE0A 4YEBB 3O53A 4AW4A 1H6UA 5GMGA 1FS2A 4MN8B 4C2AB 2O6RA 5GMFA 4GLPA 1W8AA 1U0ND 4BV4R 2Z66A 3WPIA 3M19A 4K17A 4HQ1A 1IO0A 2BEXA 2A0ZA 2ASTB 1O6VA 3W3GA 4NKGA 4UFRA 4PERA 2OMYA 4U7LA 3G3BA 2V9TB 4V2DA 3C6OB 1OZNA 5FTTB 4WP6A 4P8SA 3E3ZA 1GWBA 2Q4GW 4L3AA 3G04C 4Z94G 4LXSA 4FDWA 3E6JA 4TZHA 3RW7A 2ID5A 2XOTA 3RGZA 4FCGA 2P1PB 4LSXA 3RGXA 3VQ1A 3GOZA 3KJ4A 5GS2B 3W3NA 4R09A 3WPFA 1KOHA 2UZYA 4Q3GA 1OTNA 3ULAA 4H09A 4QC0A 2Z7XB 3C6NB 5GMHA 1XCDA 2WFHA 4RCWA 1KOOA 3UL9A 4PSJA 2ASSB 1P9AG 1DS9A 1XECA 4GT6A 3W3JA 4R6FA 2ELLA 1PGVA 4Q62A 3G06A 5GQRK 3ZYNA 5AWDA 4R6JA 3G3AA 4C2BB 4IM6A 3C6PB 5B4PA 1P8TA 2O6QA 1LTXA 4P91A 4L3FA 4ARRA 3FXIA 3ULUA 3UL7A 3OGMB 5D3IA 3CVRA 3ZYIA 4R6AA 4RWTC 4PQ8A 5IJCA 4R0AA 1M9LA 2OMUA 3RFEA 1DCEA 4Z64C 4LSAA 5AWAA 4V2EA 3JB9j 4LXRA 4R08A 4KNGA 4G8AA 4R58A 4LSXC 1SQ0B 4R5DA 3RFSA 1OGQA 1JL5A 3CIYA 2V70A 2Z65A 3WPHA 2BNHA 2CA6A 3CIGA 4PEQB 4FS7A 4M7EA 5AWBA 4J0MA 1M10B 2XWTC 4XOSA 1FQVA 4U09A 4LI2A 1YRGA 4KT1A 1OOKG 2RA8A 3M18A 4B8CD 2OMXA 2Z64A 4WYKA 2IFGA 3DZEA 4LSCA 2Z82A 2WQWA 2OMWA 4R6GA 4RCAB 5AZ5A 3ZYOA 5GS0A 4R07A 4QXEA 4CC4A 1G9UA 4XSQA 3RFJA 3WPGA 4CILA 1XWDC 2P1MB 2OMZA 5IJDA 4I6JB 4EZGA 4Z79A 3WN4A 5HZLB 2OMTA 1WWLA 2P1OB 4AY9X 2OMVA 2Z62A 4ECNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSU A;  4R5C A;  5HDH A;  4FD0 A;  4BSR A;  3A79 B;  4Z61 C;  2R9U A;  4PKI G;  3REZ A;  5B0T A;  4CNM A;  5LFN A;  2WQX A;  3E2J A;  1DFJ I;  3WPD A;  3UN9 A;  4LI1 A;  3RIZ A;  1O6S A;  2V9S A;  1FO1 A;  3SB4 A;  5AWC A;  1XEU A;  1P8V A;  2WQV A;  2Z7X A;  3P72 A;  5CMP A;  4FHO A;  3OJA A;  4J4L A;  1H6T A;  1M9S A;  3OGK B;  4ARN A;  3WPB A;  4FMZ A;  1FT8 A;  1OTO A;  2JE1 A;  4M7E C;  4KXF B;  4MQW X;  3W3K A;  3G39 A;  2FT3 A;  2RR6 A;  2Z81 A;  5IJB A;  3O6N A;  4CP6 A;  1ZIW A;  4Q3I A;  4OQT A;  2UZX A;  4NKH A;  2Y5Q A;  4CC4 C;  1D0B A;  2P1N B;  5CMN A;  4V2C A;  4BSS A;  1A9N A;  2WQU A;  4QBZ A;  4CNC A;  3VQ2 A;  4U06 A;  1K5G C;  4Y61 B;  3RW6 A;  3OJA B;  3OGL B;  2P1Q B;  1M0Z A;  4Z8G A;  2O6S A;  4ECO A;  3W3L A;  3BZ5 A;  5A5C A;  3WPC A;  5B0N A;  3ZYJ A;  5IYX C;  3E4G A;  3TSR E;  4XGO A;  1XKU A;  1Z7X W;  1K5D C;  1A4Y A;  3ULV A;  4U08 A;  3PMH G;  3WPE A;  1O6T A;  1QYY A;  3W3M A;  1OTM A;  2JQD A;  3UL8 A;  2Z63 A;  3RJ0 A;  2JE0 A;  4YEB B;  3O53 A;  4AW4 A;  1H6U A;  5GMG A;  1FS2 A;  4MN8 B;  4C2A B;  2O6R A;  5GMF A;  4GLP A;  1W8A A;  1U0N D;  4BV4 R;  2Z66 A;  3WPI A;  3M19 A;  4K17 A;  4HQ1 A;  1IO0 A;  2BEX A;  2A0Z A;  2AST B;  1O6V A;  3W3G A;  4NKG A;  4UFR A;  4PER A;  2OMY A;  4U7L A;  3G3B A;  2V9T B;  4V2D A;  3C6O B;  1OZN A;  5FTT B;  4WP6 A;  4P8S A;  3E3Z A;  1GWB A;  2Q4G W;  4L3A A;  3G04 C;  4Z94 G;  4LXS A;  4FDW A;  3E6J A;  4TZH A;  3RW7 A;  2ID5 A;  2XOT A;  3RGZ A;  4FCG A;  2P1P B;  4LSX A;  3RGX A;  3VQ1 A;  3GOZ A;  3KJ4 A;  5GS2 B;  3W3N A;  4R09 A;  3WPF A;  1KOH A;  2UZY A;  4Q3G A;  1OTN A;  3ULA A;  4H09 A;  4QC0 A;  2Z7X B;  3C6N B;  5GMH A;  1XCD A;  2WFH A;  4RCW A;  1KOO A;  3UL9 A;  4PSJ A;  2ASS B;  1P9A G;  1DS9 A;  1XEC A;  4GT6 A;  3W3J A;  4R6F A;  2ELL A;  1PGV A;  4Q62 A;  3G06 A;  5GQR K;  3ZYN A;  5AWD A;  4R6J A;  3G3A A;  4C2B B;  4IM6 A;  3C6P B;  5B4P A;  1P8T A;  2O6Q A;  1LTX A;  4P91 A;  4L3F A;  4ARR A;  3FXI A;  3ULU A;  3UL7 A;  3OGM B;  5D3I A;  3CVR A;  3ZYI A;  4R6A A;  4RWT C;  4PQ8 A;  5IJC A;  4R0A A;  1M9L A;  2OMU A;  3RFE A;  1DCE A;  4Z64 C;  4LSA A;  5AWA A;  4V2E A;  3JB9 j;  4LXR A;  4R08 A;  4KNG A;  4G8A A;  4R58 A;  4LSX C;  1SQ0 B;  4R5D A;  3RFS A;  1OGQ A;  1JL5 A;  3CIY A;  2V70 A;  2Z65 A;  3WPH A;  2BNH A;  2CA6 A;  3CIG A;  4PEQ B;  4FS7 A;  4M7E A;  5AWB A;  4J0M A;  1M10 B;  2XWT C;  4XOS A;  1FQV A;  4U09 A;  4LI2 A;  1YRG A;  4KT1 A;  1OOK G;  2RA8 A;  3M18 A;  4B8C D;  2OMX A;  2Z64 A;  4WYK A;  2IFG A;  3DZE A;  4LSC A;  2Z82 A;  2WQW A;  2OMW A;  4R6G A;  4RCA B;  5AZ5 A;  3ZYO A;  5GS0 A;  4R07 A;  4QXE A;  4CC4 A;  1G9U A;  4XSQ A;  3RFJ A;  3WPG A;  4CIL A;  1XWD C;  2P1M B;  2OMZ A;  5IJD A;  4I6J B;  4EZG A;  4Z79 A;  3WN4 A;  5HZL B;  2OMT A;  1WWL A;  2P1O B;  4AY9 X;  2OMV A;  2Z62 A;  4ECN A; 
#chains in the Genus database with same CATH topology
 4BSU A;  4R5C A;  5HDH A;  4FD0 A;  4BSR A;  3A79 B;  4Z61 C;  2R9U A;  4PKI G;  3REZ A;  5B0T A;  4CNM A;  5LFN A;  2WQX A;  3E2J A;  1DFJ I;  3WPD A;  3UN9 A;  4LI1 A;  3RIZ A;  1O6S A;  2V9S A;  1FO1 A;  3SB4 A;  5AWC A;  1XEU A;  4NZR M;  1P8V A;  2WQV A;  2Z7X A;  3P72 A;  5CMP A;  4FHO A;  3OJA A;  4J4L A;  1H6T A;  1M9S A;  3OGK B;  4ARN A;  3WPB A;  4FMZ A;  1FT8 A;  1OTO A;  2JE1 A;  4M7E C;  4KXF B;  4MQW X;  3W3K A;  3G39 A;  2FT3 A;  2RR6 A;  2Z81 A;  5IJB A;  3O6N A;  4CP6 A;  1ZIW A;  4Q3I A;  4OQT A;  2UZX A;  4NKH A;  2Y5Q A;  4CC4 C;  1D0B A;  2P1N B;  5CMN A;  4V2C A;  4BSS A;  1A9N A;  2WQU A;  4QBZ A;  4CNC A;  3VQ2 A;  4U06 A;  1K5G C;  4Y61 B;  3RW6 A;  3OJA B;  3OGL B;  2P1Q B;  1M0Z A;  4Z8G A;  2O6S A;  4ECO A;  3W3L A;  3BZ5 A;  5A5C A;  3WPC A;  5B0N A;  3ZYJ A;  5IYX C;  3E4G A;  3TSR E;  4XGO A;  1XKU A;  1Z7X W;  1K5D C;  1A4Y A;  3ULV A;  4U08 A;  3PMH G;  3WPE A;  1O6T A;  1QYY A;  3W3M A;  1OTM A;  2JQD A;  3UL8 A;  2Z63 A;  3RJ0 A;  2JE0 A;  4YEB B;  3O53 A;  4AW4 A;  1H6U A;  5GMG A;  1FS2 A;  4MN8 B;  4C2A B;  2O6R A;  5GMF A;  4GLP A;  1W8A A;  1U0N D;  4BV4 R;  2Z66 A;  3WPI A;  3M19 A;  4K17 A;  4HQ1 A;  1IO0 A;  2BEX A;  2A0Z A;  2AST B;  1O6V A;  3W3G A;  4NKG A;  4UFR A;  4PER A;  2OMY A;  4U7L A;  3G3B A;  2V9T B;  4V2D A;  3C6O B;  1OZN A;  5FTT B;  4WP6 A;  4P8S A;  3E3Z A;  1GWB A;  2Q4G W;  4L3A A;  3G04 C;  4Z94 G;  4LXS A;  4FDW A;  3E6J A;  4TZH A;  3RW7 A;  2ID5 A;  2XOT A;  3RGZ A;  4FCG A;  2P1P B;  4LSX A;  3RGX A;  3VQ1 A;  3GOZ A;  3KJ4 A;  5GS2 B;  3W3N A;  4R09 A;  3WPF A;  1KOH A;  2UZY A;  4Q3G A;  1OTN A;  3ULA A;  4H09 A;  4QC0 A;  2Z7X B;  3C6N B;  5GMH A;  1XCD A;  2WFH A;  4RCW A;  1KOO A;  3UL9 A;  4PSJ A;  2ASS B;  1P9A G;  1DS9 A;  1XEC A;  4GT6 A;  3W3J A;  4R6F A;  2ELL A;  1PGV A;  4Q62 A;  3G06 A;  5GQR K;  3ZYN A;  5AWD A;  4R6J A;  3G3A A;  4C2B B;  4IM6 A;  3C6P B;  5B4P A;  1P8T A;  4NZT M;  2O6Q A;  1LTX A;  4P91 A;  4L3F A;  4ARR A;  3FXI A;  3ULU A;  3UL7 A;  3OGM B;  5D3I A;  3CVR A;  3ZYI A;  4R6A A;  4RWT C;  4PQ8 A;  5IJC A;  4R0A A;  1M9L A;  2OMU A;  3RFE A;  1DCE A;  4Z64 C;  4LSA A;  5AWA A;  4V2E A;  3JB9 j;  4LXR A;  4R08 A;  4KNG A;  4G8A A;  4R58 A;  4LSX C;  1SQ0 B;  4R5D A;  3RFS A;  1OGQ A;  1JL5 A;  3CIY A;  2V70 A;  2Z65 A;  3WPH A;  2BNH A;  2CA6 A;  3CIG A;  4PEQ B;  4FS7 A;  4M7E A;  5AWB A;  4J0M A;  1M10 B;  2XWT C;  4XOS A;  1FQV A;  4U09 A;  4LI2 A;  1YRG A;  4KT1 A;  1OOK G;  2RA8 A;  3M18 A;  4B8C D;  2OMX A;  2Z64 A;  4WYK A;  2IFG A;  3DZE A;  4LSC A;  2Z82 A;  2WQW A;  2OMW A;  4R6G A;  4RCA B;  5AZ5 A;  3ZYO A;  5GS0 A;  4R07 A;  4QXE A;  4CC4 A;  1G9U A;  4XSQ A;  3RFJ A;  3WPG A;  4CIL A;  1XWD C;  2P1M B;  2OMZ A;  5IJD A;  4I6J B;  4EZG A;  4Z79 A;  3WN4 A;  5HZL B;  2OMT A;  1WWL A;  2P1O B;  4AY9 X;  2OMV A;  2Z62 A;  4ECN A; 
#chains in the Genus database with same CATH homology
 4BSU A;  4R5C A;  5HDH A;  4FD0 A;  4BSR A;  3A79 B;  4Z61 C;  2R9U A;  4PKI G;  3REZ A;  5B0T A;  4CNM A;  5LFN A;  2WQX A;  3E2J A;  1DFJ I;  3WPD A;  3UN9 A;  4LI1 A;  3RIZ A;  1O6S A;  2V9S A;  1FO1 A;  3SB4 A;  5AWC A;  1XEU A;  1P8V A;  2WQV A;  2Z7X A;  3P72 A;  5CMP A;  4FHO A;  3OJA A;  4J4L A;  1H6T A;  1M9S A;  3OGK B;  4ARN A;  3WPB A;  4FMZ A;  1FT8 A;  1OTO A;  2JE1 A;  4M7E C;  4KXF B;  4MQW X;  3W3K A;  3G39 A;  2FT3 A;  2RR6 A;  2Z81 A;  5IJB A;  3O6N A;  4CP6 A;  1ZIW A;  4Q3I A;  4OQT A;  2UZX A;  4NKH A;  2Y5Q A;  4CC4 C;  1D0B A;  2P1N B;  5CMN A;  4V2C A;  4BSS A;  1A9N A;  2WQU A;  4QBZ A;  4CNC A;  3VQ2 A;  4U06 A;  1K5G C;  4Y61 B;  3RW6 A;  3OJA B;  3OGL B;  2P1Q B;  1M0Z A;  4Z8G A;  2O6S A;  4ECO A;  3W3L A;  3BZ5 A;  5A5C A;  3WPC A;  5B0N A;  3ZYJ A;  5IYX C;  3E4G A;  3TSR E;  4XGO A;  1XKU A;  1Z7X W;  1K5D C;  1A4Y A;  3ULV A;  4U08 A;  3PMH G;  3WPE A;  1O6T A;  1QYY A;  3W3M A;  1OTM A;  2JQD A;  3UL8 A;  2Z63 A;  3RJ0 A;  2JE0 A;  4YEB B;  3O53 A;  4AW4 A;  1H6U A;  5GMG A;  1FS2 A;  4MN8 B;  4C2A B;  2O6R A;  5GMF A;  4GLP A;  1W8A A;  1U0N D;  4BV4 R;  2Z66 A;  3WPI A;  3M19 A;  4K17 A;  4HQ1 A;  1IO0 A;  2BEX A;  2A0Z A;  2AST B;  1O6V A;  3W3G A;  4NKG A;  4UFR A;  4PER A;  2OMY A;  4U7L A;  3G3B A;  2V9T B;  4V2D A;  3C6O B;  1OZN A;  5FTT B;  4WP6 A;  4P8S A;  3E3Z A;  1GWB A;  2Q4G W;  4L3A A;  3G04 C;  4Z94 G;  4LXS A;  4FDW A;  3E6J A;  4TZH A;  3RW7 A;  2ID5 A;  2XOT A;  3RGZ A;  4FCG A;  2P1P B;  4LSX A;  3RGX A;  3VQ1 A;  3GOZ A;  3KJ4 A;  5GS2 B;  3W3N A;  4R09 A;  3WPF A;  1KOH A;  2UZY A;  4Q3G A;  1OTN A;  3ULA A;  4H09 A;  4QC0 A;  2Z7X B;  3C6N B;  5GMH A;  1XCD A;  2WFH A;  4RCW A;  1KOO A;  3UL9 A;  4PSJ A;  2ASS B;  1P9A G;  1DS9 A;  1XEC A;  4GT6 A;  3W3J A;  4R6F A;  2ELL A;  1PGV A;  4Q62 A;  3G06 A;  5GQR K;  3ZYN A;  5AWD A;  4R6J A;  3G3A A;  4C2B B;  4IM6 A;  3C6P B;  5B4P A;  1P8T A;  2O6Q A;  1LTX A;  4P91 A;  4L3F A;  4ARR A;  3FXI A;  3ULU A;  3UL7 A;  3OGM B;  5D3I A;  3CVR A;  3ZYI A;  4R6A A;  4RWT C;  4PQ8 A;  5IJC A;  4R0A A;  1M9L A;  2OMU A;  3RFE A;  1DCE A;  4Z64 C;  4LSA A;  5AWA A;  4V2E A;  3JB9 j;  4LXR A;  4R08 A;  4KNG A;  4G8A A;  4R58 A;  4LSX C;  1SQ0 B;  4R5D A;  3RFS A;  1OGQ A;  1JL5 A;  3CIY A;  2V70 A;  2Z65 A;  3WPH A;  2BNH A;  2CA6 A;  3CIG A;  4PEQ B;  4FS7 A;  4M7E A;  5AWB A;  4J0M A;  1M10 B;  2XWT C;  4XOS A;  1FQV A;  4U09 A;  4LI2 A;  1YRG A;  4KT1 A;  1OOK G;  2RA8 A;  3M18 A;  4B8C D;  2OMX A;  2Z64 A;  4WYK A;  2IFG A;  3DZE A;  4LSC A;  2Z82 A;  2WQW A;  2OMW A;  4R6G A;  4RCA B;  5AZ5 A;  3ZYO A;  5GS0 A;  4R07 A;  4QXE A;  4CC4 A;  1G9U A;  4XSQ A;  3RFJ A;  3WPG A;  4CIL A;  1XWD C;  2P1M B;  2OMZ A;  5IJD A;  4I6J B;  4EZG A;  4Z79 A;  3WN4 A;  5HZL B;  2OMT A;  1WWL A;  2P1O B;  4AY9 X;  2OMV A;  2Z62 A;  4ECN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...