2V9UA

Rim domain of main porin from mycobacteria smegmatis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
b'GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MSPA
publication title Designed Protein-Protein Association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 27
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09203 MspA MspA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1650 Mainly Beta Sandwich Immunoglobulin-like Porin MspA (Ig-like beta-sandwich domain) 2v9uA01
1UUNA 2V9UA
chains in the Genus database with same CATH superfamily
4DGWC 1L4IA 5DJCA 4KQ4H 2WWKO 2PWHA 1RZGB 4JM0A 3VVVA 2BNRD 4XNBA 1X4XA 3OBAA 4OF5A 2V2WA 4LBAA 5KJ7E 5AYUH 5B1CA 3LKRA 4WW1A 3V6OC 3D85D 3PWPE 4PVMA 3CC1A 4XP6L 3KW8A 3U48A 3AXHA 2YKLL 3VSVA 4CSTA 2YFNA 3OC5A 1M7DA 2BH0A 4XMPH 5A7EA 5JDSB 1SY6A 2QKIB 3UIZA 1QTYT 3DXAA 3QP3A 5EU6B 4LPXA 3KVPA 5FR3A 3VRJA 3KPLB 1AR2A 4UNVA 3ETBJ 4EQ2A 2BSTB 1MNNA 4JHWL 4WI2A 1KB5L 2FWOA 3EO9L 2F5BL 1PIGA 5TF0A 3DVNA 5I6LA 3MOQA 1KULA 2EDHA 4L5FE 3VXOA 43C9A 4QHUB 2VZ3A 2J4WL 5MHSD 4YHPA 3D0VB 4HMDA 3LVTA 3MRGA 4I0PD 4BKLB 3L3KB 1UZGA 2OR9H 1CI5A 2DTML 1EZVY 2R4SL 4G43B 2ZG1A 2L7UA 2C1PB 3GSOA 5HGHB 4WFGD 1EAJA 3VXRA 4G1EA 3P0GB 5KS9B 4X5WA 4NRZA 4PJCA 4ZX5A 1DVQA 3QFJA 5CD5C 1R0AH 1JNLH 2X4UA 4OQTA 3OTTA 4APXA 1DN2A 1PEZA 3CTTA 5KSAC 1JS4A 3UERA 3TJPA 3MV7D 2QSCL 3O4OB 2AKRB 2DQFB 4N87A 1RD6A 1M05A 1CE6B 3BESR 1CFQB 1XEUA 5D7KD 4Z77A 2CBPA 3H85A 4JL2A 5KYWA 1NGQH 3SKJL 2A3TA 2XWDA 5F1IB 3D25A 3WL9A 5CJXA 1LYQA 3BVTA 2WWOA 1Z5LB 4Z3HA 4M03A 3RWEB 1SDDA 1NBZB 2EC9T 1KUMA 2EIZA 3GSUA 4HCRH 5D7EA 4EBQH 4CU8A 1BZ9A 3VFRB 2XZCL 5B38A 3GIZL 4YSSA 1A0QH 2B2XL 2OMUB 5CLZA 4LPWA 2JNZA 3THMH 4ZFZB 5J8OA 3QDGB 2A73A 2JKWA 4Y2DA 3GSXB 2XG4B 4Y16A 5F0MB 4B9GA 4FI6A 2FBJL 4WW2B 4MMZA 3BEVA 4QWWD 5JQ6H 3TNNB 1KBGH 3QA3A 2GG1A 3VXPB 2ITEA 3GBNL 5CD5D 5H4ZA 3I84A 4V1DB 1K72A 4X4XA 3PGCA 3FUKA 2A77L 1J5IA 5TGBA 1I8KA 3MBEC 4H20L 2EUXA 2QMKA 3RTLA 3FTUA 4G6AD 2GT9A 3D0LA 3KPQA 5IB4B 4HS8L 2QVMA 4X7TA 3A6OA 3BLBA 3K71A 3BHBB 3RIAK 2Y5EA 5GZOC 2FT8A 3LEVL 5E4IA 4DO4A 4PJBB 3MGOA 1A21A 3MODH 5F72S 2ZUUA 3O3DB 3E6HA 1UD5A 3F83A 4E2OA 3B3IB 3RIKA 1ADQH 3CCHB 4YWGL 3VGFA 3VMPA 3W5NA 5AQ0A 1UD8A 3RIFF 4KNSA 4TS6A 2IANA 3BN3B 4H8QA 3REVA 4M48H 3Q8EA 4WV1C 3U36B 5IEKA 2F58L 4APQB 2ED6A 4L4VA 3EYFA 2J1ZA 2YA1A 3B9KA 4KRMB 3S3SA 2MPAL 4ZZFA 2JQZA 3D6GA 2QLYA 3EO0A 3JTSA 1HJBC 2I9LB 1OT1A 5CZRA 2DQGH 4FA6A 1NCJA 2CDEB 3BXNB 2E9JA 4LSQH 1Q9OB 1U8IA 2A9MH 2Q3ZA 3ESPA 3RDTA 2CBTA 4A7SA 5ADOL 5B1JA 4IEFA 3SDDC 3KE0A 1A1OB 3OKEA 5GS1B 1NDMA 5C6TH 4G5AA 4X6DB 3HNSL 5E5MA 1I9IL 2XQBL 3BGAA 1U8JA 1DVFC 1UXWA 1B4JH 1K85A 1WBZA 3UG4A 2G5BA 3HNTL 5I8EB 3E2HC 2R69A 1EWHA 5IF0A 1A25A 1JTPA 5BRZE 2P46B 1BZDA 3C09B 4ZUUA 4YDVB 5BUPA 2OMWA 1A1NB 2EO7A 3HUJA 2H1PL 4HHWA 2AS5M 3IDXL 5T1KB 4Y4KA 2AJXL 3WS6A 1BA9A 4LVHB 1DQKA 1ZLVK 5ANMB 2W9EL 1RFDL 2BVPB 4RGNC 5C0AE 1IM3B 3HMXL 5FECA 4QAWA 1PG7X 5KOMC 4DGYH 15C8H 1CR9H 5FUOH 2G30A 2R2BA 5I2IA 4OZFB 3VE0B 1T1ZA 3LN5B 3FBQA 4L4TB 1EHAA 1S7SA 1SHSA 2DDQH 4L9LA 5L0QB 4QTFA 2VLMD 4HIEA 1KBBA 2D4FA 2LLNA 4YFLI 3ZTDC 1U3YA 4FQLL 4R2GD 4WLCA 4B50A 2BP8B 2OTWA 3EJRA 1Z9LA 4GMSL 4NM4L 1C5DB 1GJUA 1WWAX 3OZKA 4A7GF 3O9WB 2BZDA 4LVNB 2BY3A 3WY1A 1VACA 5JPMB 3DO7B 4M7LH 4KC3B 4N2LA 4UDTA 2NX5B 1UKTA 4LEOB 5DD1H 1ACYH 3FUMA 1U0QA 3MXWL 3NFSL 1BFSA 2OTUB 4Y4HD 1WA1X 1FO0B 2WXMA 4JFDB 4XVJH 5ECJE 4ZUSB 5SWZA 4DTGL 4M62H 2E4FA 2DW5A 5KBKA 3X11B 2CKBB 1EHLH 1P2CB 3W81A 4FQ1L 1EXUA 5CUSL 5D4IA 3PWNB 4U1IB 1QSEE 2EDYA 1KGWA 3O0RL 3AY4A 3LNDA 1I1AB 3BP4B 3E3QE 4JCMA 4NJAH 3LXBA 4XX1G 4Y5YB 2CLRA 3IAQA 4MQ7B 3DDGA 1GGCL 4P2OC 5CEXB 3EH1A 5IVXB 1I9RH 2UXGA 1XAUA 4AYSA 3US1A 1XCWA 3T0DA 4BFRA 3WEXA 3AG2B 4XB7A 9PCYA 5J12C 4PREA 1HXKA 4PJEA 4KRPB 1PZSA 2WUCL 1GGBH 3L5XH 12E8H 5IJCC 4K94L 3VGAC 5HHVH 5M7QA 4L2LA 4NP4H 5DA0B 5DJZA 3ZSSA 4EN3C 1ZCRA 3F12B 3K8KA 1ULVA 2WAHA 3QDJD 3B2UC 3QEHB 3LDBC 3VD2A 4QAMB 1CD1B 3RVWD 4GMTL 4J2XA 2EIEA 2XN2A 2VXTL 5HYEA 3QJQB 4JHBA 1NM4A 1HOCB 1P84K 1SVZA 4XPAL 1DJWA 2L8AA 4WFHD 4OIIH 3E7JA 2DQEL 2EE6A 4MJ6B 1BP3B 4FXKC 1E4KA 2E75C 2LU7A 4CU7A 2FX8L 2Z0UA 3CSYA 4Q9RH 4BGDA 5C0BA 2DKUA 2VW4A 2V9UA 2C8NA 1A4KA 4RA0C 4J1UA 4XMKH 5EIIB 4HKJA 2E7LC 2VLKB 3O45B 3HRZB 5DK0A 5GQBA 4Z3JA 1NCWL 4Z5RA 2GY7B 1P4BL 3IMTA 3O11B 2FH6A 4JB9H 1E65A 5EBGA 3MRQB 1UT2A 1XB6A 4MQSB 5DEGA 2NXYC 1TKWB 2GPZA 4FQCL 4L8SC 3HG4A 4JREB 3GIVA 4IHOA 4JQIL 5IMMA 3UP6A 1A1MA 2VE6A 1MRFL 4PFEA 4OLWL 4U1HB 1R5VA 2BOBA 4WQOA 2IPUG 3MV9E 5CILH 3BKML 2Y7MA 1CDUA 1RURH 5D70H 4RX4A 4PJDE 2Z7UA 5EO0A 1L9PA 4KJWD 2LFGA 4KI5F 4TVUA 1RK0A 3PUCA 2GJZA 5CWSB 3ISWA 5AYTA 4MNQB 3RHWK 1A4BA 3O6MH 3UL4A 5CEYB 4E9TA 4I87A 2DEXX 1BZ8A 1OCWL 3JSSA 1O7DE 2OJZL 2OJEB 4BQBA 2V3EA 4YDKL 3KPSA 3BC9A 3FB7B 3NK3A 5HHOA 4EUPB 3AT8A 4KRNA 2P1YA 1FIGL 4LOUD 1Y07A 1ZLUH 2V2TA 2OS7A 2PWFA 4XI5D 2X70B 3S35X 3ISRA 4KGJA 1IX2A 4DFHA 4XNQB 5T3ZE 5HVHB 4PJAB 5I17B 5B3JE 4A6YA 1JVLA 2QLVB 3L5WA 2YD4A 2VDMB 1F6AA 1HQRB 1HYSC 1E4HA 4GRLA 1W0VA 1ORQB 5IHZB 4IQHA 1AG6A 1PLGL 1ZHKB 2X38A 3TPUB 4MASA 4YHNB 4F24A 2JKJA 4FD0A 4O9HH 5IEHA 1X9LA 2J5LC 3OV6A 3FT4A 5A40E 4PJXB 1IEBB 4XMWA 2ICCA 4Q2ZA 1I53A 4AC2A 2KDYA 4ZFFA 3N9GL 2XPGB 4E0RB 2NQDA 4WTWA 3TBSA 1TVBB 4PW4A 1Z0MA 2BVEA 5AL0A 4PGDB 4I2XB 3K81A 4YO0A 1J88A 4BZ2L 1RZKH 5H2BB 2WLZA 1OP3K 3BPLB 3ABMB 1SLXA 3LNEA 4MXVF 2ZYRA 3RA7H 1ZRUA 2FT7A 2DBLL 4MNQE 2FJHA 3EGXB 3C5SA 2PXYD 4MHHG 3KHQA 5BCAA 3SPJA 2CXKA 3HAEH 4AZ8B 5L7XH 5IJKA 4XPHH 3POCA 1SYSB 5DGQA 4N1HB 1YVLA 2KKQA 1O6SA 4PCSA 3CFMA 4QYOA 3VXMA 4XOCA 2ISDA 5C7XH 5K9OA 1NAMA 2B1HH 4XCNA 1HYSD 1FSKC 1Q4NX 1A6TA 3BSHA 4PJAE 4U2YA 1VB9A 3CLEL 1FNGA 4MCNA 1L9RA 2IDCA 1ZA3A 3B83A 2A83B 1PW3A 2WKGA 4CVZB 3ZE2B 1ONQA 4K3DL 1DJGA 3DPBB 3SBQA 4P23D 1AI1H 3ABKB 2F54A 2YPLA 1AHKA 3D2UD 2XKUA 3ES6B 4YIQA 3GBDA 4CGTA 5I6MA 3GJEA 4AX3A 5KYUA 2EIKB 2VLRD 4XVUC 1FNFA 1BBDL 1AS6A 3EFFA 3DUSB 2FO8A 1N4XL 3VDAA 1IO4C 2VXSH 4Z7OB 1JHKH 1G9MH 4PRHB 2PCFB 1TZGH 3LCYA 4XC1H 2WO4A 5EU7C 4U6TA 1HHHA 1KLFA 2GI0A 2AQSA 2EYTA 1MREH 2MNWA 4WWNA 4TSCL 4N0UB 1X9QA 1RUAH 3LZQA 3OJ2C 1R24B 3G6JA 4KUZH 4N2HA 4DAGH 1W8OA 3KH4A 4GW1B 3AAZA 5JLZA 3NZHH 5E9DD 5CLTA 3DSFH 3IFOB 4G1MA 4X4MA 1Z9SB 1NUDA 3QZBA 1B6DA 3KW7A 3VVWA 4WFFD 5DEFB 1D2OA 4OSUH 5EORH 2A6KB 3C2AH 4X5XA 3OKKA 3BUBA 2VDKL 4E42A 5DI8A 2ZCLH 3KNBB 4PI0A 4UB0H 2BIMA 2ERJC 5GGTL 1TO4A 3QIBC 4XRCA 5F97E 3DV4B 3P0YH 1MPAH 3X12A 3EYSL 3N55A 1ZHNA 4BUGA 1WZAA 5AOMA 1TSRA 1KELH 1LDPH 5GIRA 1ESOA 4DW2H 3ARFD 3IJEB 1KNOB 4NO2B 1YSOA 2YLKA 2FE0A 4WCYL 3BQUA 4PRDA 5MEQB 4HJGA 4JANB 1DCLA 1Y6MR 4JFFE 2WMPB 5CEZL 1NCOA 3V7MA 2ZT9C 2QADB 5C6PB 2R1YB 4E9QA 2WQWA 3D05A 3ESOA 3K4DA 3MUUA 3RI5K 5IB1B 2EXYC 4G8GE 3V9EA 3U9PH 4LCCB 4WI0B 3MRNB 4U3SA 5IQ9B 5E5UB 4KVNL 4H8PA 4UV7L 3VI4A 4AL8C 5B39B 2W88A 1N2RA 4FE9A 4R7NB 4WJ5A 3WELA 4NX0A 5DUMH 4DO5A 1E9OB 3ZHKA 2W0PA 2EDEA 4Y9GA 4PJ5E 4UT9A 1BVLA 4I4WA 4HXBH 3OKMA 1N59A 2QQLH 2C7FA 1RIHH 5INCB 2Q87A 1ZE3C 3QNFA 2H3KA 3ZL1A 4EI5B 1KZYA 1A6VH 1LE5B 4JFEE 4N0CD 4FABH 4F7CB 1MZYA 3X17A 1GTFA 1IGIH 2J8OA 1J5CA 2DIEA 2R59A 2VZTA 4MJIE 3CDZA 4N4YB 4EF3A 4ES8A 4LRNL 5EU4A 1KB5A 1SVBA 2K0RA 3BMWA 1KLUA 4KUCD 3VFSA 1OCRB 1MVUA 1HHIB 5IHWA 4GKLA 5FYLH 4WI4A 3JZYA 1R5WB 5E4EB 3ZYOA 2WBXA 3I6KB 3QDMD 5DRZA 4ACPA 4MBRA 3NJGA 5FAAA 1F58H 3G5ZA 3L3JA 2E56A 4ENEC 1PNCA 1QTSA 2A0LC 5H94B 3OMIB 3AFLA 2E7HA 3Q8CA 4JY5L 2CO1A 3ISYA 2ALWA 5E6SB 5D1XC 2EH7H 3FTSA 1GC1H 4XMXA 3C5ZC 4UT6L 1Q72H 3ECVA 1PPIA 3CK0L 1GGTA 4X80L 2NTFB 3OJVC 5J56B 4ODUA 1O5PA 2AEQH 2K6WA 1UWFA 4TLUA 4TOYL 3FOMA 5JO5A 1PMYA 1U8MB 4JZOB 1CLYH 5TFSH 1LP9E 3WEAA 3O2WH 3OHXB 3FO0H 4XPBH 4GRMB 2ICEB 1JPGB 1VPOH 4MNGA 5E8NA 3QQ9C 1EFXA 5E1AB 4CVXA 3DBSA 4ZAKC 4FLOA 2R1XA 3TA3A 2YLHA 2AK4E 1T83C 4L5FH 3WKNA 3IK2A 2Y7LA 2GI7A 3S37X 4RRPA 4XE5B 1TLMA 3Q6FB 4LNRB 4NO0B 5IOPB 1TETL 2HT3C 1RUKL 1F4XL 4XO9A 3VTAA 1AYOA 4KBPA 4TV3A 4Z7VA 2QR0B 4UMGA 1JUFB 2A0LD 3GC3A 4PV9B 4LRIC 2XVBA 5IREA 5B8CB 4C4KT 3SDXB 5IUCA 5BO0D 3NZ8B 4YSRA 2Y24A 3VRLE 2DLEA 2CNZA 1P6AB 3DURA 1W0WA 2DPKA 2NUTB 4L3EB 2OSLA 2YPKA 1AOHA 1NPJA 3KBHE 3DIDA 3WY4A 2HFFB 5DVOA 1Q9WA 2NZ9D 1KGIA 2BDNL 2N1KA 2AJUH 4IU2A 1NIFA 5TE7H 4BFBD 5F3BA 3FCGA 4AIZA 3IXTA 2Y5TB 1GW0A 1EEUA 1L5GA 4P8QA 4Z0BH 4PYHA 1J9TA 1FN4A 3EO1A 4FQQB 4UNTA 3K2KA 4GKNA 4PCKA 3H7BA 1OTUD 5FC9A 1G7IB 3FQWB 2O5YL 4ADJA 4Q9CA 1QMUA 2ZWNA 2JI2A 4QRAA 3APCA 3GUTA 4GAYA 1ET8A 3LMJH 4M8QB 2SEBA 4J3OH 3MJ9H 2FUTA 3EH5B 2YQ2A 4FNTA 4F20A 3S5LG 3SQOH 5JIHA 2DQUH 2RTTA 4HF5H 3O8XD 1MIMH 2V5MA 2ZD0A 5J13B 5ENWB 1Q8MA 1RUPH 4U1MA 1E43A 4JFOB 1QLEL 3HBPA 3K74B 4U1KB 3ZQ9A 3FQUB 4QO1A 1V7NH 5GJSH 1HC1A 3MLSH 4ERSL 2WKOF 3MSPA 3I9GH 2XOTA 2MEJB 4XVTL 3OX8A 4F2ME 1I1FB 4XBPA 1IRAY 4S11A 2UXTA 3CN0A 2FQFA 3EH4B 3D4GA 1ZPUA 3DETC 4P57A 4X7DC 2N01B 1WE5A 4FZ8L 4YC2B 1FLRL 4FQIL 4PJ7E 4ZMQA 2FH8A 2H9GB 2CZNA 1E4XL 3QJOA 3FZUC 4P2QA 2VDQH 2DI8A 3BUPA 2NY1C 5A2LH 3ROLA 4KVCH 1J0JA 4G42A 3RU8L 3BN9D 3QC5X 4RGMB 2ZOOA 5HGAA 3KR3L 4TUKH 2VXUH 3V2AR 2JB5L 4KKBD 5AD0A 2AANA 2SODB 3NTCH 3HMXA 4RH4A 4EI6B 5J89A 5LNDA 5SWSD 4PI2A 3WOVA 5FHBH 4FERA 1CQYA 3QUYA 1LMIA 5DHVH 1E3XA 4P46D 2BNRB 1F90L 1OD9A 4X6CE 3AROA 1MVFA 2XWJB 1L7IH 1ZLDA 5MENE 3UTSA 2O30A 2XIIA 2V9TA 3FYEB 3D85B 2PPEA 2GY5A 4PG9A 3BI9X 4GBXA 5BUGA 1PZ3A 4WWKB 2HRGA 1QATA 4HJJL 4MMXC 3QQ4A 1QRKA 5AKSA 1QFWI 5L8LB 3EBAA 1L0PA 4H2CA 1WT5C 3BWAB 3EJJX 4KU1A 3NDZE 4PTUA 2XQYG 4L18A 4C4KO 5DJXB 2K8MA 3AABA 1J8HE 3NAAH 5GISL 3QJRB 1BGXH 3F85A 1E6JH 4UOW1 5F71A 5EEVA 4HJ0C 5FUCC 2TAAA 1OAYL 2NY1D 2GK2A 1M2VB 1BFOA 3MO1A 4MCZA 1KCBA 5JOFA 3DROB 4I9WE 3H0TA 3EYVB 4V2CB 5A16B 1SFHA 3X1GA 5C08E 1JXGA 1F1DA 2MHAB 1WAAF 3MMEA 2GEQA 5T3XD 1SBBA 1ZDQA 5JA8B 1IKFH 2ZUWA 1IZJA 4DVBA 5EDSA 4MXVE 5AG8A 4O4YH 4XP4L 1NCCL 3MV7B 4ECNA 1CK0H 4E5XG 2P80A 4OCRH 3VGGA 1JZ6A 4G7QB 1UWYA 2K3TA 3C6SB 2J6EH 3P4MB 3AB0C 1ZT1A 1KC5H 4K3GA 3WJMB 5AWNL 4LSDA 3D4CA 1JV2B 4HIHB 1BG9A 6FABL 2Y36H 4JY6B 1EFQA 1SLUA 2MNJB 3DPDA 2B0SH 4JJ5B 5DLMH 5DR5H 5TK2A 4X5RA 1RZ8B 3ZKXB 4OZIF 3SE8L 1S9YB 1AIFB 1NLDL 4JM2A 2D31A 3QEQA 5A6LA 1SEQL 4R6UA 2AXWA 1E2ZA 1T1WB 2CO7A 3APNA 3RWGA 1DDHB 3VXTB 3HLAB 1KLGA 1N6UA 4Q4IA 4DP1X 1MCPH 1GH7A 2JH2A 1DJZA 2F53E 2B15A 1N26A 4OCSL 4XGZB 5LQBL 1XTLA 3CFKB 4OGXH 4CC1A 1MXGA 2LE9A 1CIDA 5L2KA 3UAJA 2EICA 4N0FB 4G5ZH 5DD6A 3C60D 3WN5A 5F7KC 5SX5H 3U4KA 3VD3A 1YUKB 1JGLL 3ECBA 2F8VA 1BYNA 4ODTH 3G9VA 5TDOB 4YAQA 3NABL 4JQIA 2VABA 1ZHBA 3KWWB 2J8UF 1UVQA 4NQED 3R06A 4OGYL 3D39E 2K4AA 3AMLA 3U25A 4CMMA 5EC2A 3BT2L 1AR1B 5DQJB 3HS0C 5E6ZA 3SJVE 5F9JA 3NYKA 3L6FA 4M5TA 3CIQA 1CGVA 3JZ7A 5KVFL 1G7LA 2YGPA 2Y72A 3C6LA 5JXAL 2ODIA 1C12B 1OW0C 3VWKC 5D9SA 3ZUCA 1CD0A 1VIWA 2JWYA 5EO1A 3ZKQD 2XC8A 1YEJL 2OMZA 2BP3A 3TCXA 2XWRA 3AITA 3QG6A 2FQEA 1CG9B 1FL3A 4YHLL 1TZHB 5JTWA 1J5DA 1IVLA 2BOCB 4XOBA 4FN0A 2X4OB 4UM8A 1BX2A 1MAJA 1QA9B 1BXXA 1WQVT 5F21B 5E08H 4PIRF 4PW3A 1MZZA 2F08A 3FB6B 5C0IA 4OGQC 3N1GC 5EO9A 3DX2A 2AHIA 1FYTD 2VQ1A 3JWOH 4IIQC 4QRFA 2GIMA 4KH9A 4S2SA 4JRWA 4TSAL 5TDNA 4EIUA 3B34A 4UINL 5CLYA 4GT7A 2EVHA 2CU9A 3UROR 3FFDB 2ED9A 1HDMB 2YD3A 3KGUA 5F7DB 4MA1C 1B9KA 3ZDZE 5TD4A 1VAHA 5E2TH 4ZMPA 5IM7A 4ZSOB 2EDXA 3GSQB 4PGCB 4PRID 3WNOA 2CXGA 4BZ2A 3VWKD 3NFNA 1XCTA 1CU4H 5FOBA 2QSTA 2ICWI 1VFMA 4GOSA 2Z34A 3EGDA 2W0FB 3MROB 3NCYP 4H8VA 4PLOB 2ZOLB 3GMOA 4B53A 4ZFGH 4BIKA 4F9LC 4CN4A 3SDAC 3TEZA 5DFWH 4AIXA 1ZY9A 4L0PB 1J5OL 1W16A 5DHYA 5BQDA 3ASNB 3BKJL 5T3ZH 4QTHA 3QUHA 2B3IA 4GQ9H 3VXNB 3WO3B 4CADA 1KACB 5JOPD 3T3MF 4ZXBB 3FFCE 1AQDB 2OXGA 4J8RA 4IGBC 4YLBA 1PZCA 4R2GB 5CS7A 1U8OB 1D3CA 4X8JA 5I5JA 2VKXA 3IGAB 1ZLWK 2ZP9A 5E0FA 3V79C 1UXSA 5C8JA 1CTMA 1LNUA 2VOTA 4AL8L 3ZIMA 3P73A 1JK8B 1I8UA 1HZHH 1TITA 1LEIA 2YD5A 3Q5OA 1FVCA 4D0BA 1E40A 5K33A 1WUNT 3ELQA 3FTVA 4O2FB 1TTAA 5F1KC 5IB5B 3ZYZA 4PJ9D 1IU1A 2G2PA 1JDAA 1YEKH 4JRYD 1GVIA 3SDAD 1JZEA 4KQ4L 4AE1A 2FZ3B 1U8NA 3BPCB 2DYSB 1MLBA 3II3A 3BZEB 5JW4N 5A3ID 5F8QC 1G0YR 5C9KA 4OLUH 1AD9B 3EOBA 1DE4A 3CUPA 2C9XA 5E2VH 3KCWA 5EZLA 4XMPL 1JYVA 4CVWA 2WQ8A 1G9MC 5KS9F 5JXED 4KTDH 3MX0B 3PDOA 2WKLA 2VLJA 2CHDA 2NRDA 1ZTXL 1C5BH 1I3VA 5C0JB 3RWJB 1M3JA 3CN4A 1UOKA 4X0KB 3P11H 4AQ1A 3NOIA 4F3FB 1BLNB 2WNGA 1JVKA 4RFNC 3MRBA 5KSAA 2LVCA 1S5HB 1TFPA 3QR2A 1RK7A 1P7KA 4LEXH 3BPNC 4QRTB 4JE4B 4XB3A 4K5LA 4YSOA 3MLRL 2IDTA 4U6HB 2Q76B 5ABZA 5EU5B 1LO5B 1QRNB 3ARWA 3GGWB 5EC1B 5D7JA 4AXWA 1TEFA 2FQGA 3PL6D 1S7XB 4P0DA 5I1AB 2HTLD 3MV8E 4KY1H 4OCLC 1R0AL 4MRCA 1KTCA 1JNLL 2ZKHH 3T77B 4DFIA 4CDHA 4C8XA 1AO7D 2EACA 4C54A 2D7PA 3L7EA 4YVNA 3V0IA 1MCKA 3W39A 4QJ5B 1XZWA 4G80B 3BDYH 1T7VA 5C86A 1JWMB 1XB3A 4DT2A 1VGKA 3LIUA 4NPYB 1NGQL 2B59B 1Z6JT 3GMPB 1K4DB 2YN5A 2RA1A 3RJOA 4LEBA 3RFZB 1AHWC 1MRCH 1NSNL 3DYPA 4MJ2A 1UM5L 3IMRA 4AM0Q 4JLRB 3CN1A 4HCRL 4JL1A 4EBQL 4JDVA 1I8LA 1AXSB 1A7OL 4BKTC 3V0EA 1A0QL 1GY2A 2NT0A 4OZGB 4KK6D 5AAMA 1QVOA 3UZQA 1LD9B 5E56A 5KVGL 1A3LH 3B8YA 3NJNA 1BIIB 1CTNA 4Y19D 1MCNA 4NZFA 3UBHA 3TN0D 3HE7D 2ZG3A 3PV6B 5GZOA 5JQ6L 1KBGL 1RXLA 1SHMA 4NN7C 2B5IB 5I76A 3WU1A 3W56A 4XXDB 3ABLB 4QHMB 3FJTA 2X28A 4MS8D 1GZQA 3EYUL 4WV1A 1UKQA 4XTRC 4G70B 3G5XB 1G9NC 1UOVA 1ZLUK 3X3FH 3VD7A 1MVYA 2I07A 2X7LA 3P02A 5DJCB 4WSGA 5F8RC 4UAOB 5KN5A 1JZIA 2DQIH 2G3MA 4UT6A 3KWVA 5I1LA 4ALAH 2V2WB 4ABVA 2ENSA 4JFHD 1HSAA 1MCOH 1OAKH 2ZXAA 3MODL 2R1WA 3EOAA 3LKRB 1J0IA 4WWOA 5I66A 5KANG 2FBOJ 3PWUA 2YAEA 1ADQL 4IJ3C 4M48L 4KI1A 1BFTA 3DXAB 4YBQD 1L6XA 1EAPA 4S10A 5EUOA 3VRJB 1UM4L 4S1RL 1DVFA 1TZOA 4X6EA 3DUUA 1X6NA 1HK6A 2FWOB 1X5YA 2LGNA 3OKLA 5C0DA 4PHXA 5EBLA 3VXOB 43C9B 1KENH 3FN3A 4YHPB 1XCQA 2CUAA 4PRPD 3MRGB 5AW9B 5E00B 4BFFA 1T0OA 2BXZA 4RZCA 2DICA 2LU3A 3WUWA 1IC4H 4MCYB 2Q2EB 3BVDB 2KUTA 4LCWD 2YJLA 1KCSL 4BCXA 2PYED 4DUXA 2VUOA 4QRRE 3RX9A 4ZDHA 5J1AA 3ZZSA 1ACCA 5IG7A 3MJ6A 4G1EB 2EDRA 3T04D 1CXLA 1KY6A 4X5WB 4NRZB 4PJCB 1BQUA 2GQHA 3QFJB 4P23B 2X4UB 3L4YA 3D2UB 4IBYA 2ZUYA 2YGQA 3P3SA 2VERN 2Z91B 3R19A 2QQNH 4NZTH 1DO6A 1QBBA 3HFFA 4N5ED 5IMOA 2GTZA 2CIIA 4YHMH 2GC7C 1EEZA 1M05B 2BVYA 1G4MA 2VRAA 1NGXA 2ZOUA 3HIZA 5JYLA 4XMZA 4DGYL 4Q89A 3C2SA 1ECZA 1V27A 3D25B 3EJTA 4H8WC 3DXAE 4FXLA 3M46A 4JS7A 5CSBA 3WL9B 1WRFA 1GTNA 3NCCB 1TZAA 1DVZA 3AREC 5JIPA 5LWYH 5E99L 4KOCA 4HS3A 1SDDB 1LM8V 2EIZB 3GSUB 2ZX7A 5GS2D 4CN1A 3BGFB 5BVPH 2O5ZH 1BZ9B 5B38B 3N40P 1PCXA 4HWUA 3SGEI 4OF0A 3FTGB 4RSVA 2WP3T 3DLQR 4GIPD 4U1GC 3OR6A 2D0HA 2WAQA 4Y2DB 4BGLA 4WSKA 3FN9A 4Y16B 4TYUA 1EZSA 3VGHA 4MMZB 3BEVB 1ACYL 3GPEA 4P2OA 7PCYA 5FA3A 2H6OA 1E5BA 1LILA 5L88L 1SJMA 1YAZA 1SHXA 4X4XB 1I7UA 1RPKA 2HLEB 3PGCB 4LSTL 4UQ2B 3V6FB 4S1QH 4N0YH 4AGNA 5I73C 1I8IB 5TGBB 1EHLL 1I8KB 2WGNB 1OGAA 3T6ZA 1S7TA 3ARFB 3TEYA 1AKJD 2ZYIA 3KPQB 2YC1A 4O2CA 4KJPC 4X7TB 2PP8A 4NJAL 3RJQB 4EN3A 2Q86A 4XXCC 5LNEA 2QGBA 4FHKA 1I9RL 4PU2A 3ARED 3N43F 2VERA 3E6HB 3EFOA 1U8PA 1X5GA 5IK3A 3O3UN 3BX7C 4L37A 5D93B 5IFJA 2EDJA 2IANB 3REVB 4L9DA 1OAJA 5IEKB 3AT0A 12E8L 1JPST 1TQBC 5HGBA 3GDCA 3EYFB 4LHUA 5HHVL 4BBWA 4DCQA 1KCRH 4FL4B 5T5FL 4NP4L 1F18A 3T08A 1K8IA 2FGWL 4ZPVA 3FUDA 3TEUA 3Q3GA 2E7LA 4MXWH 4MYWB 4UIKH 1MJ8H 2YD7A 3OXRA 4WUKL 2EE0A 4KH2A 2ENYA 4NN6B 4IEFB 4FG4A 1BQ5A 1SXSA 4K4KA 5C9JA 1NDMB 2IGLA 1DSFH 2ZKMX 4OIIL 4L8SA 3GWJA 4OLYH 5E5MB 4EKXA 3VSUA 1U8JB 2B1OA 2WGXA 3VFNA 4Q9RL 1WBZB 2G5BB 3RNQA 4LP4A 2NR6C 3ML8A 2D3LA 4FMKA 4MVBD 2DLIA 35C8H 3V52L 1UC6A 4K5NA 4ZUUB 2OMWB 4HX1A 4OLEA 5E0QA 3HUJB 3AC0A 2ZOKA 3S3JA 3QDMB 4Y4KB 1OD7A 3CZKA 2XXCB 3UG3A 3DGDA 4OVUA 2JTYA 3I50H 5D7LA 5EWIH 3A3YB 4EE2A 5IVOA 4J6IA 3CVHL 5FECB 4Z95L 2EADA 3LPFA 5CILL 2R2BB 3T1FA 4L4VE 5I2IB 3OGCA 1IAMA 1T1ZB 4AGQA 2DEYX 5AB9A 1RURL 4L9LB 5D70L 4F8QA 4UTBL 3V4VH 1V10A 2HN7A 1HTYA 1G5AA 1WFMA 3JBG7 2OTWB 5I71C 4L1HA 4ZD3L 2PMZA 2YA0A 4HWNA 3O6ML 2WP3O 2X6CA 5FW7A 4Z7QE 3IN0A 1VACB 3HG2A 4YK4B 1WFNA 3T3ME 4UDTB 1ZVYA 2NDGA 4A37A 1P1ZA 3NA9H 1NDTA 4W9HC 1DQQA 1U8QA 4G2AA 4I0KA 5IV2A 3NRFA 2JV6A 5DMJB 1X6LA 3T0EE 3BCFA 4DJMA 3QRGL 2EDOA 3CVIH 5SWZB 4A2DA 4JG1H 2PW1A 2Z7YA 3B9EA 3CSPA 5GGVY 4AQEA 3IDIA 3V4LA 1G87A 3S34L 3BVVA 3OZ9H 3HB3B 4OAWA 4YSUA 1XR9A 2JE8A 3GMRA 1D6EA 2CLRB 5DK3A 3W1ZA 2EE3A 5A2IH 3VB8A 3OKNA 2E9IA 1PD0A 1CDIA 5I15L 3QO0A 4PRAA 3NJXA 1A7RH 4DP8X 1WS8A 3S36H 3WEXB 4M4PA 1G0DA 1AD0A 3HHSA 4PREB 4K23L 4PJEB 4FMFA 1YYLH 1RZKL 1UWGH 1IBFA 2C3VA 3L4WA 4JMNA 3L9BA 3RA7L 4A55A 2LT9A 1GGUA 4TUUA 3AWEA 1SNRA 4GW5A 4HGWA 1L9NA 3DHUA 2HUHA 4MSWA 1NC2D 4XPHL 1U2HA 2ORBH 1R3HA 4FNLH 4XOAA 1D5ZA 4Z7OF 2ZAIA 2APXA 5DYOA 3UH8A 3DJZA 4JZJC 2Y6SC 1Q9LA 5KBNC 5BRPA 3MACL 3CSYB 1ZLSH 2O5NA 1M7UA 5C0BB 5GRZA 2J71A 3VXSD 2H26A 3HHMA 1KEGH 3O8XB 1OP5H 4HKJB 3MLZH 2FYVA 5K59F 2BRRL 3UYOD 5I23A 4Z5RB 5IMLB 4LL9A 3QAZC 2XX0A 5B22A 2DF3A 3UGUA 1SXAA 1Z1WA 1ZPLA 5DEGB 4TPRH 1NEZG 2D7QA 2DJUA 1YYML 4MAZA 3OKDA 2X41A 3GIVB 2VAJA 3FH5A 5IMMB 1JWSA 1JHKL 1A1MB 2IPKA 1G9ML 2VE6B 3EOTH 1T5XB 3K6DA 2ICWJ 4PBWD 1R5VB 4LFHD 4UTAH 1TZGL 4XC1L 1A2YA 3KZ8A 1FYHB 4ODXB 2OK0H 4WK0B 3QIBA 1H3XA 5HDLA 3VQ1C 1MREL 2FO4A 2CCVA 1PCSA 1U42A 3HC0B 5EO0B 1RUAL 1DUZA 3P30H 3TBCA 4E9XA 4KUZL 1RK0B 2I9TB 2UZXA 3NZHL 2XSKA 3DSFL 5I9QC 5SV4A 3DX6A 2DAVA 2Y6SD 3G08A 4G59C 4IW4C 2VDOH 2Z8WC 4K71B 3WEBA 4DF9A 4TNGA 2IGTA 2O72A 2CH8A 3I2CL 5GZNC 4OSUL 1IBHA 3KPSB 3C2AL 3NIFB 2A6JA 3F6JA 4O00A 5HHOB 1ICTA 4XPTH 1UJTA 5D1QC 2WTRA 2ZCLL 4UB0L 4W4NA 2WYZA 4AQAA 5G5DB 4LDEB 3WN6A 4M93B 2YK1H 4FZEH 4ZMXA 1JN6B 4I3SH 1UJ3C 1H8NA 4P46B 4BFJA 3P0YL 2DWXA 4KHTH 1MPAL 4BFOA 4A6YB 2WXFA 5E1HB 1BAWA 2HWZL 3GI8H 4GY4A 1F6AB 2ZCZA 4HUCA 4ZYKA 1KELL 1LDPL 4NQUA 1W0VB 4DW2L 3QEGH 3AXLA 3VX0A 1QFWM 5AOIA 5EDXA 3LD8C 3S96A 2EDDA 3FT4B 3VM7A 3OAZH 4A39A 3GNMH 2ZP8A 2WZPA 3QUZA 4Q9BA 4M3JA 4JRXD 3BZFA 3LEYH 3MRDA 4PVLA 1YMMA 3C5JA 5AYQA 3HJ0A 1INEH 4YO0B 1N64H 2VMJA 1WICA 2N4IA 3U9PL 3PAVA 2AXFA 2PLTA 3WG7B 2GHZA 5GZND 1JGDA 1OSYA 1LWRA 2Z8RA 5GGQH 4P5TD 4DN3L 3KL5A 3C5SB 5D1QD 3ALXA 3QORD 2CRIA 2YEQA 3BAYA 5AZ2L 2ZXDA 4XVOA 3BDXA 4H5SA 4PWHA 4OCWL 5FPIA 5AOJA 1NOLA 2CO6A 4HXBL 1K4CA 1YECH 1O6SB 2QQLL 3B7UX 3HKFA 1CGSH 2VR4A 4QYOB 5DUJA 4ZMTA 5HVFB 4OKVA 5E4OA 1NAMB 4XCNB 5CBAA 3RGVD 1KEML 1A6VL 2D3JA 2I5YH 1JPFB 1WZ1H 1FNGB 1G9NL 1IGIL 1ZA3B 2C9SA 3VWJC 1ONQB 2VSMB 4M6OL 4UOW0 1KFAL 1YY9C 1IQWL 5D1XA 3VB9A 1CXEA 2FX7H 3ZO9A 5I1HH 3C5ZA 2F54B 2YPLB 5E5RB 3T65A 3KPMA 4HGMA 4YIQB 2EDWA 5FYLL 4ZOEA 2CPUA 1E9PA 3GJEB 4KK5C 5KYUB 5T1LA 1RUQH 3J27A 5AKTA 4HOMA 3BWUF 1F58L 2HB0A 1I82A 2RMNA 2J12B 1RUMH 3V8CA 4ZMVA 4IKNA 3UZEA 2AJ3A 5EN2B 2M83A 4ZAKA 3KVDD 3S88H 1GC1L 2CMRH 1HHHB 3ILDA 1T83A 2O6DA 1HXYA 2IBZY 1BOGA 3U2IA 3FO9A 1T0MB 3G6JB 1BDYA 4LKCA 5JLZB 1IGCH 5KYNA 3S8GB 3LRSA 1ZS8A 1DJSA 3AU0A 4YE4H 5TFSL 3O2WL 3FO0L 4XPBL 4HWEH 3SDXF 3PAYA 2G2RB 1VPOL 1QI4A 2P5EE 4X5XB 3TVMD 2ZZUT 3VXME 2HX7A 3KAAA 3OKKB 5F2FA 1R9FA 4FEIA 5DI8B 4NQEB 4PJIA 2WJ7A 4IRSC 1K5NB 5LAXB 4NQQA 5E1IA 5IQ7H 5SX5K 4XRCB 4OZHA 3O6KH 1SN0A 2DQMA 3NJLA 1IC7H 3R18A 4M3HA 4HCRA 4R4BA 3X12B 1Y6NR 4IRZL 1ZHNB 3DX9B 5I18H 4FFWD 4U6XB 4LDCA 1PY9A 2DQJH 4CBPA 4F91B 3FO1A 3OZLA 3ZVVA 4X9BA 1T89C 4HW6A 3GFUA 1DQJA 5CCGE 5BUAA 2RFXA 2V17H 1ZXKA 3LKPA 5CBEA 5J06A 5LAPA 2Z31D 1TU2B 3QB7C 2XTLA 1XO8A 4H8WL 3ZU8A 3KD4A 5I5MA 1FAKT 2VN6A 3B7YA 1X3DA 3KXFE 3IJYA 4YZWA 5I1CH 1HILB 1YMHA 4AV0A 5I6OA 5C0CA 1N12A 4RAVA 5FFGA 4Z7AA 5D2LA 3B5GA 5K69A 1EX0A 2FEDC 3GXIA 2W9DH 1FYTB 2AJUL 3L4CA 4QXGL 5TE7L 2CG9X 1Z5YD 3B7RL 3MRPA 2XY1A 5DJAA 1M7IA 2J2ZB 4Z0BL 4NQCA 2NYZA 4DHLA 4FLSA 2LOEA 4F7PA 5C0FA 2ARJA 1MQKH 1ZA6A 1FNEB 1MAML 2H32H 3BZ5A 1FAIL 3C8KA 4BRVA 3G5YA 5LXVA 4CDGC 4Y8DC 3GSVA 1UADC 3OKMB 1N59B 3ULUF 2Z8VC 1T66C 4R90H 1ADQA 4D3CH 1J05A 1AXIB 3F3HA 3LMJL 1VKXA 5LXGH 4IM8A 2ZNXA 4PRIB 3MJ9L 1LEKA 3ASOB 3ILEA 4LLMA 5J4MA 1RHHB 4JGJA 1D9KC 4NIYE 2WQRA 4DKTA 3S4SA 5A7BA 4MA3B 3SQOL 3CDZB 5DD3H 5EU4B 4G8EB 1KLUB 4Y0GA 3T3PB 4ALAC 4FQJH 3PAZA 3VFSB 1CGXA 1RUPL 1MVUB 3AMKA 4NERA 4QRPD 3NBNA 3R1GH 1E4WH 4PB9H 2X2JA 1X44A 3AS2A 4UQEA 1IM9D 1V7NL 5GJSL 1JZFA 2AQTA 3MLSL 4M29A 3G5ZB 3I9GL 3UTTA 3FMGH 1S7UA 2FVNA 1T6BX 2ZXQA 2PPDA 3DV6A 4AYGA 2H7WA 3CX2A 3PWVB 2HYMA 5FWQA 4KMLB 3ARSA 1C1EL 1UQSB 5HJ3A 4C83B 3GRBA 5F9AC 3VI4E 1P4LA 2VDQL 5KTEH 1E5YA 1U92B 4LQFL 4HU8A 3FKUS 4KTYA 3FOMB 3DJTA 3GPSA 5HYJA 4KVCL 2O5XH 3CU1A 3UMTA 3T9WA 4TUKL 3RL1A 2NDFA 2YMOA 4MMXA 5LBVA 4AYMC 5I0WA 4MNGB 3D0AA 3NTCL 5E8NB 2TSBA 2XWZA 4PJ9B 5DRWA 1AXTH 2IWGA 4CVXB 3HE6C 4J3WA 1WT5A 4JRYB 1YEDA 5FHBL 3FT9A 2R1XB 2ZXCA 3Q1SH 4HUXB 3TA3B 5GS0D 5T1JA 1INDL 3HZMA 2YOAA 3A4FA 5IB2B 2E7MA 5E8EA 1GS7A 1GYAA 2HMIC 1XGQA 1L7IL 4UQCA 2MCPH 3T3PE 4KKPA 1QNIA 4Z7VB 3CZEA 1EZLA 1JJUA 5H4YA 1OK0A 2OXHA 3QULA 1NUGA 1P69B 5I0ZA 2BMKA 1C9SA 5J1SC 4E41E 3QIUA 2G9HB 2XV3A 5CZXD 5KW9L 1P9MA 4GXUM 3MI6A 4JKKA 3C08H 3GKZA 1S5IH 4OCMC 3FN0H 3NAAL 5E51A 1HKFA 1W0WB 1BGXL 2Q5BA 2OW6A 1L3WA 2OSLB 2VC2L 1H3PH 2Y2YA 2YPKB 1E6JL 4HIJA 4TNVK 4LCYB 1Q9WB 3QIWC 2LVEA 3BYTA 2EE9A 2X3CA 5F7WC 4IU2B 5F3BB 1FHNA 4P2RA 3QXDB 4AIZB 4DPRA 3IXTB 1L5GB 3IPFA 5F7BA 1FN4B 3LJ3A 4GEIA 4PR5B 5EMYA 1WK0A 4GKNB 2WO3B 4MX7A 2A9CA 4NUGH 4MJ5A 1UWXK 4MNGE 3PL6B 5MI0C 5FO8A 3Q5TA 4I3RL 3GUTB 5EBWA 4C58B 3TO2A 4Z7UB 4GAYB 2KH2B 4O4YL 4Z7WB 2SEBB 3VI3B 1I1YA 1I7TA 4KKLC 4AMWA 1XSJA 4F8OA 1W72B 3SPVA 1T03H 2J6EL 5T5FA 4OVVA 1A3QA 1MCEA 3MTRA 2VXVH 1MCIA 1KPRA 4AT6A 2YRZA 4UTCA 4U1MB 5DRNA 3MA7A 3V0AC 1FV1A 4F9PA 2Y36L 4UT7H 1FL5A 1KJ3H 4LMQI 2B0SL 4QO1B 1U91A 5DR5L 5E2WH 1A4AA 2YSSA 3QIWD 3OX8B 1FFPB 4XBPB 4CU6A 4D9QD 3I6GA 1NIDA 2BNQD 4TLTA 1CVRA 4P57B 2GSIB 3UJJL 1U95B 2JB6A 3NT0A 3SYCA 3B7SA 3HS0A 4Y19B 1YEIH 3TN0B 3HE7B 3T6VA 4P2QB 4OGXL 4ANVA 3ARGC 4UDUB 3IRPX 2FNBA 1OB0A 3IU3B 2NY6C 4G5ZL 3ARDC 4XWGH 3ROLB 2HKHH 1S7VA 1NFAA 3FPXA 1QPKA 4G42B 4RZKA 1OW0A 1M6UA 2UVFA 4ODTL 4UZSA 4MAYC 5JNYA 1DVTA 1OQXA 2CIKA 3KLLA 3CVHA 1P5VA 4PVNA 1XT5A 1CBVH 2C9QA 1OZTG 3QUYB 3WNLA 5DZJA 5I30H 3O6FD 2HVKA 2VR6A 4PS7A 4FG6C 4XNZB 4ZNEA 4WI6A 2OR7A 2X0UA 3PG2A 4QHPA 4FYTA 1OTSD 3UTSB 3L4TA 3VM5A 3RRQA 1D5MA 4PG9B 4OJFH 4IIQA 1KYUA 3RIFK 3ATBA 2NXZC 1KXTA 1CT8A 2Z4QA 5DJ2B 3QQ4B 5HD8D 2R83A 2I60H 4KI5C 3CHQA 3SOBL 3RZCD 2R2EB 3MC0A 3EJCA 4JR9H 1B4LA 2NY2D 2ZG2A 1H3WM 2CJUH 5CXPA 5GHWH 4DK3A 5BQ7A 1KTLA 2VDLH 5IWLC 3QUZD 3DX8A 2OFQA 2MKWA 2VLLA 1T21A 5LGJA 5E08L 4WFED 1W0YT 4A68A 1KCVH 4ZW7A 4LOFA 3ARGD 4LPUA 1P7QA 3D12B 5FW6A 2NY6D 3L3IA 2E76C 4OJDH 3WCYA 4PRPB 4WU5A 1BFOB 3J7HA 3MO1B 4MCZB 4RVBA 5JOFB 3ULVD 2G3ZA 1IFHH 3B56A 2OMVA 3H0TB 3FNKA 4MAYD 1QWNA 1EUTA 4HU2A 4F9LA 1MWAH 1XF3A 3Q44A 32C2A 4ODSH 4QUOA 3ULSA 3AUWB 2Z4TA 1AMYA 2KBGA 1DEEB 5C2BL 4FG6D 4DVBB 1FZOA 5DJDA 1RJCA 3CPLA 5F9OL 4B60A 4IGBA 1CU4L 1ZVSA 5CP3A 1BJMA 4MS6A 1ILUA 4OZFG 4AYFA 1NFDF 4ZFGL 4I85A 3CQPA 1S3RA 3GHBH 4WZ9A 4X5QA 1AGBA 4H0GA 2WXRA 4FTVD 5AW2B 3HAEA 4LHJB 2HKAA 3P54A 3EHBC 4QHNB 3TBYA 5BS0D 5E70A 4LOEA 1G6RB 3TO4D 3E6FB 3OMZA 2FJUB 1QWHA 2D31B 4YVUA 3QEQB 1FFOB 2XTJB 4UAHA 2YMXL 1NCHA 1XGYL 2RD0A 1S7WB 3WYRA 3DJ9A 1KLGB 2D03H 4LARH 1HESA 2WV3A 1DL7H 4NKIH 1HZHL 3ORJA 4QT5B 1BEYL 5L2KB 3ZE0F 2APSA 4JO1L 3WTUA 2OTPA 4HP5A 2VZVA 3WN5B 1MW1A 2XWTB 2DWDA 3SCMD 3T8XB 2PO6C 4ZX3A 4AV4A 3ECBB 3FQNA 4OU3A 1D7CA 1YY8A 4F33B 5L4IA 4YAQB 2QVIA 2VABB 4UQIM 3D3VE 1YEKL 2J8HA 3R06B 1HWHB 4WU7B 1G43A 3BZ4A 3TLRA 1E5CA 4CMMB 5EC2B 2P5WE 2X2YA 4PBDA 1EDYA 2N0KA 3L6FB 4O2EA 3EHBD 3RB5A 2BK8A 4KXAA 1WIPA 4OLUL 1BD2D 2KC0A 1QSVA 3V6BR 4OY9A 4ELKA 4JPWH 5E2VL 5EO1B 3SGDH 1L0QA 2IDQA 2OMZB 4LCIH 4KTDL 1JYWA 1JGVH 2PP7A 2B77A 1FL3B 1C5BL 2Q10A 2XTJE 4UM8B 3P11L 4QRBA 4HQQL 4M3KB 5FDWB 3H1ZA 3TBWB 2AABH 2XN9D 1GSKA 3IETA 4JVWA 2F6AA 4WUUA 3IJHA 4YDLC 2IXQA 3I3EA 4XO3A 5EO9B 1P5UC 5CMAA 1MNUH 4RWYH 4BV1A 1KN4H 3FH8A 5KJ4A 4BFEA 2YWYA 4S2SB 4AKPA 1EEYA 2DWEA 3NZUA 3IDGA 3ZHFA 5BJTB 3BAJA 2HFEA 2Z1PA 3PQYD 1XF2A 1DANU 4QRSB 3NP4A 2YXWA 2Z64C 4HUUA 2OI9B 3TBVA 1QBAA 2ZKHL 2DL9A 5IM7B 3N85L 2NY0D 4TNWF 2RQEA 3UMNA 2OYLA 3MLUH 3K72A 5BZZA 3NFNB 1XCTB 5FOBB 5HHQA 4YGVA 1OP4A 3LNIA 2E8ZA 3EGDB 3VYPA 3GINA 2WVSA 2H0JA 3BDYL 4R5TA 1S7QA 2WM0A 3GI9L 3P4LA 3ULUE 4Y5XB 3TIDA 2YJQA 4BQ9A 2F1EA 4PJGA 1T80A 2AK1H 1T1XA 3VD0A 1MRCL 2GJ6A 2C9RA 4JW3A 2IH3B 3GM8A 3U0WH 3VFPB 4HFWA 5CSGA 1R46A 3PJLA 4B9KC 3L5IA 1X4YA 4EUPG 1X5AA 3D30A 4BK8A 2FSEA 4X8JB 4UOJA 1CXIA 1BM3L 4UM9D 3N06B 5DURB 5C8JB 4WO4C 4GKZA 2FX9H 5ABDE 1LNUB 1ZOXA 2C3WA 1HE7A 1A3LL 2JK5B 3DOSA 4M1DH 1LEIB 3MXVH 4DZ8A 2WTOA 1FVCB 3MJGX 3W2DL 3FRPB 3RP1A 1MFDH 2Z3FA 5K9KA 3PHOA 2A7BA 3NCEB 3SKMB 1ZT7A 3MNWA 3V6ZA 4C56D 4Y2OA 5HSFA 1S9KC 5IT2H 4DPCX 4IOFC 1URZA 2CLVA 3X3FL 4X7SH 1YNTB 2MQ0A 5DA4A 2DQIL 3LV3A 5CSZB 1U8NB 1T5WB 3JYCA 4IRJC 1N68A 4ALAL 1HI6B 1MCOL 1EAQA 5CGYC 1OAKL 4JN1H 5B4MC 1FVDA 3EOBB 3GEWB 4LLWA 5KSBA 2E86A 5C09D 5EZLB 1U3HC 1EDQA 1BMGA 4R0LC 1Q1PA 5MHSE 1DVXA 1UFGA 4KZDL 4OUOA 3KLHC 2VDKB 2VLJB 2HG0A 2X88A 2PNDA 4AQ1B 1T4KA 2NY4C 1ZHLA 3TNMA 1NC2B 4X0NA 3MDJA 2O93L 5TTRA 3MRBB 5KSAB 1FFNA 3ZTCC 4IRZA 2NW3B 2JJWA 1U8KA 2R2HA 2F0CA 1SPDA 5DUBB 1UYWH 1AZUA 1IKOP 1OP9A 1MCWM 1X5MA 2IG2H 4HK0A 3QQ3A 1XF5A 5C07D 3V6OE 5I19H 3HZVB 4J3BA 1MI5D 5D8JH 5D7HA 3GJFH 1YYCA 5D7JB 4O51A 1YEGH 2JJUA 3EAKA 2EZ0C 3FU7A 4H1LG 2HLFD 4IRJD 5D7KE 5FFOA 3T1WA 2E9WA 3A4AA 3O4LD 1USQA 3U82B 4F15B 1TZIB 4NZTL 2QQNL 1SM3H 4N2OA 1OGPA 3OLGA 3TZVD 1QR1A 1U3HD 4HXAH 4YHML 3W39B 2JXMB 4MB3A 4N2FA 1USZA 4XN5A 3LXCA 1VGKB 4Y1AD 4BYHA 5KUKA 5ESAA 1Q0YL 2PCPB 4P49A 2Z93A 3NIDE 3GM0A 3BE1L 5BW7A 5K9QI 3MBWA 5C0GB 2NY4D 5I5IA 5HBBA 4GKSA 5LWYL 2VLJE 4U49A 2P47B 2KDGA 4U31A 5BVPL 3SZKC 2B3RA 2O5ZL 1CLVA 4MYPA 4FQXC 3MJ9A 4G7VL 4GJTB 5ADPH 3K4ZA 4F2FA 3UZQB 1QVOB 3WHXA 4LSSH 2RCSH 2VQ4A 1B2YA 1J0HA 1HH9B 2OZ4L 1HXMA 2V2XA 4C57C 1PKOA 4F5CA 3WFCH 1DBJH 4IYKA 1OAXH 4XXCA 2FJGB 1ITCA 5HY9B 4KZEH 2EZ0D 4I77H 4AG4L 4QOKD 5I76B 2DYPA 3KYKH 2C9PA 3FULA 1E7VA 1FBIH 3IF1A 4NHCH 4S1QL 5HDRA 4NBYB 3KPNB 1HEHC 4UOQA 5ICUA 1RIUH 4LPVA 1GZQB 3X1FA 5CEZE 3OQRA 1FNSL 1OCOB 3K6OA 4WV1B 3VH8G 1Q0XH 5IW3A 3RTQD 4J12A 3CXHJ 4FKEA 3QQDA 4LSUH 4U7SA 5FV1L 5KBPA 1NCTA 1XHHA 1XGUA 2PR9A 3JUYA 1HSAB 4AUJA 1F00I 1KPVA 1NANI 3EOAB 4Z76B 5I66B 2MOGA 1OHZA 2YXMA 4JRXB 3IN2A 4KK9D 1JZ5A 2BSBA 3NA4A 1SJXA 2Y22A 5B39G 3VFOA 4FMVA 2L0DA 2OL3H 3U46B 1QZNA 4L2YA 5EUOB 4NBXB 3PFUA 4X6EB 1YNKL 4KUCF 1UB6A 2Q8BH 3BO8B 3DUUB 3SY6A 2DMCA 4D0CB 2NR6A 4GP5B 4P5TB 3S2CA 3OKLB 5DHVA 4GPVA 2UV3A 4RMTA 1RZIA 3HA0A 4JO4H 4R5VA 5C0DB 4WI7A 4CJ1A 5EBLB 4HWBL 4MXWL 1MJ8L 5CP7A 1SOKA 4E9VA 1QACA 2VWEE 3KEDA 1PSKH 4RZCB 1QHPA 4P9HH 3WUWB 1DSFL 5JUEH 4GQZA 4KZ0A 5GRVK 3TYFA 4DEPB 5IG7B 2GTWA 2PETA 5GSRB 3CFUA 3WTVA 4QLRA 4HULB 5BRZA 3DI2B 3B2DC 2WUBL 4PIBA 3DYOA 4PS4L 3LZOA 2FB4H 3W9DA 3V5KA 1RL1A 4JFTA 1IT9L 1JK9A 5IMOB 3BH9A 2CIIB 2HG5A 3IKCB 4XP6H 1EEZB 5C0AA 2R0ZH 2HJLA 2YKLH 3I50L 2OQJA 4FYRA 4AEHL 4RFEA 5EWIL 3JV0A 5HDBB 3KDMA 3OL2A 2VDRH 1WA0X 2G0KA 3Q06A 1NMCC 2QV4A 4B96A 1N5YL 3NIGE 4A7QA 3CH1A 4NC1E 2VUYA 1QSFD 2NCMA 1ZDSA 1OB1A 4CSZA 5H37G 3BFOA 1BZOA 4UUJA 3RWIA 3V4VL 4AENA 4M9OA 1OHQA 4J4PD 4TXVB 4Y5VA 4YHYC 4M7JL 2WVVB 3D1MC 4M4RA 2W9LA 2J4WH 4ATTA 5HHMD 1X7TA 3ZDXB 1DEDA 3AZUA 2K1MA 2J6EA 3OR6B 4WDIA 2DTMH 3AG4B 1WS7A 3TVMB 1GJWA 2A1WH 3WNPA 2LQRA 3CSFA 5ESVA 2EQDA 3HNVH 3HS9A 2C1OB 4PJFF 2EAEA 4RGNE 1G1CA 1ZKAA 1U21A 5JZ7C 3LX9A 3KPRD 2VSKB 4JG1L 1FWXA 1BECA 4HKBB 1RY7B 1VZIA 2H2PC 4ZZKA 3AGVA 5F7AA 4JG0L 2Q20A 4B27A 2IALA 3HZYA 2A74C 1DYZA 1U8HA 4NKQB 3ZE0E 2YC1B 2CAKA 3Q0HA 5ECGA 4PUBH 1VA9A 4EN3B 3CFBB 3CXDL 4I0CC 2ADFH 4IHBA 1K9TA 3LDBB 1JVOA 2JJSA 2X4PA 4I13B 4GG6F 1U8PB 2JKXA 1A7RL 3VRIA 4KKAD 3S36L 4GUPB 5IK3B 4L37B 4YGAB 3QDJE 4OIBA 5FW8A 1Z9NA 1ZGLA 4H1LH 5JHDA 4WHDA 2UZYB 2Y69B 1UWGL 2XWBB 5HGBB 4BM7A 2XZCH 4LHUB 3GIZH 4DCQB 4HC1H 5AW3B 2B2XH 3AM8C 2Z7WA 1K8IB 2HKFH 4S0TD 2NW2B 3Q3GB 4WUUD 4BD4A 1NL0H 4QXTA 3NCXA 1E4XI 3OXRB 5GGUB 2ORBL 4Q52A 3NJIA 3VFWA 2WIIB 3IFNL 1YN7A 4LCUA 4OH2A 3TX4A 2F8XC 1Y7VA 2NXYB 1WCQA 3WIIL 1HIMH 1U58A 1A14H 1XR8A 2X89D 5J9PA 4GP4B 2VL4A 5ISZA 1ZLSL 4H20H 3RNQB 2ESVA 1UCTA 2BC4A 4XN2A 1OGAE 3MR9B 1KEGL 1BFVH 4HS8H 2M1KA 4KV5E 4Z1PA 3FL7A 1ZLEA 5BXFA 4Q9QL 4AQ8C 4NC2B 3S5LA 4RAUA 3LH2H 4QRPB 3SGJC 4TTDD 3FXIC 3LEVH 1KTBA 4HX1B 2GC4C 1FVEA 1UZ8A 1YN6A 3GXPA 3NIFF 4WWPA 4TPRL 4J3SA 1BAFH 3VCLA 5TDPB 2GYSA 4YWGH 3LH9A 1QAWA 1KIRB 2Z8SA 5D7LB 1HL4A 3Q8AA 3STZA 3MV9A 3OXSA 3TCLB 4UTAL 3A4DA 2PP9A 3NJJA 3TC9A 3T1FB 2XJKA 2GSGA 2Y7SA 5D7IF 3H42L 2ICES 4URKA 2XG5B 1RZPA 5F1OB 1NKGA 4G9FA 4FKKA 1UJ3A 3CV5A 4W9ZA 2HN7B 3P30L 1FGVL 2HPTA 4PRBA 1IBDA 4G6KH 2ID5A 1GL4B 1NC4A 4DQAA 2EXWC 1FA4A 5C0NC 3UJIL 1UACL 4R96A 1P1ZB 2XQBH 4MXQD 4XPTL 1DQQB 1U8QB 3DVFA 3OJDA 5IV2B 3KBPA 1IGYA 4NOBA 2Z7ZA 5GRWA 4FZEL 4ELMF 2DL2A 3WNMA 5FUZH 2X6MA 1Q90A 5ID0A 4JO2H 1B3JA 3P2TA 4CW1A 5DMKA 3OF6D 4KHTL 4GRWE 4AQEB 4FQHA 5TQ2L 3ZX1A 3GI8L 3IDIB 2H1PH 3H2PA 1ZWIB 1B0WA 2AJXH 2QEJA 1W6WA 3SD5A 3Q1EA 3QEGL 1RK1A 1XR9B 4FLRA 2C9AA 3GMRB 2W9EH 4AE0A 1XL4A 1RFDH 1LWJA 3WKYA 5L8JB 1D6EB 3T0EC 1FZJA 3HMXH 1FFTB 3GNML 3GO1H 3OKNB 3PWPD 4IBUA 5IFAL 2BCMA 5CJQH 3QO0B 1G7QB 4PRAB 1GOHA 4RRPM 2K9UA 3LEYL 2XQYA 3B9AA 3I02A 3NJHA 3WLWC 1AD0B 4L0YA 3RWFB 1INEL 5ICXA 4PJ8D 1R5IB 3PJSA 1N64L 4DK6A 3LZPA 4FQLH 2QKIC 2C3VB 1FSKB 1H6UA 3FSWA 2FDBP 2HTKD 4C47A 2EKSA 1PS3A 3VWJA 4BXVA 5GGQL 1XSKA 5HI3D 4GW5B 3VG9C 4DKFH 4MD5B 4MSWB 4LLQA 3L2MA 4K7PX 1X5IA 5FYKD 1VEPA 3MXWH 1R3HB 4KKCC 3RVTD 1I8MA 1YECL 4RDBA 1F4YH 1CGSL 2PW2A 3V8OA 1CFMA 2F15A 1CYXA 1G7PA 2I5YL 3TH4T 3MCYA 5CUSH 2VLRE 1JMXA 2J57A 2XACC 4ZT1A 4WHTA 5IROC 3M6DA 1TQWA 4E5XA 2WPGA 1PZDA 3D07A 2H26B 5I1HL 4Q6IC 1CIUA 3MLXH 1R17A 3O0RH 3LPGA 1UXLA 3KJ4C 3GS4A 3FQ2A 2XZZA 3FCTA 1LWHA 5CR1A 5DU7A 4NHUB 1RUQL 3K6FA 5FXCH 1RI8A 3O4OC 2X4QA 3N1MC 4KX7A 4YHIB 1JWSB 1N70A 5BZWA 4BCZA 5EU6D 5DJ6A 1S9XA 5E9DE 2Q7AA 1A2YB 4GQRA 4X6BA 4IRSA 2OZNA 2CMRL 2A6IA 4JHZA 1WH0A 2FO4B 2VN3A 2CDGB 1PAMA 2BP0A 1DUZB 5ACZB 2ZCKH 1IGCL 4GMTH 4J3OD 2UZXB 3RWDB 4QGTA 2WOBA 3DX6B 3DHPA 3G08B 1JCVA 1HT6A 1T89A 1UOWA 2W38A 1QTPA 4IKKA 4HIIA 2P4AB 2FX8H 3LZLA 2OCJA 4OBRA 1YPZB 4WW2C 1KB9K 5IQ7L 5EU3B 1IC7L 3S7GA 1M1XA 2J20A 3O6LH 5JW5B 1DSYA 1KIQA 2YGVA 1NCWH 1TVDA 2V8MA 4LLDB 5EU7E 2YFOA 3AU1B 4U6VH 5F9WB 4ZYKB 5I18L 3RDJA 2C7UA 4N85A 1GSMA 3F5WA 1JYXA 2EIBA 4HFUL 1OALA 4FQCH 3RZCB 1JI2A 2V5RA 3NQKA 2V17L 4JQIH 4N2CA 3ZRCC 2E74C 4JFFA 3EYOA 3HG1A 1E3FA 4OLWH 1M6OA 2AERT 2DQCL 1GKEA 5D1ZA 1WLHA 2PTUA 1A9EA 1R4XA 4GB9A 4B9PA 1E42A 2IV8A 3QUZB 1O6TA 3BKMH 3BZFB 1A4CA 3PDDA 3RE0A 4XX5A 1YMMB 3C5JB 5CGBA 5DO2C 1Y6KR 5A2JH 2W9DL 4GT0A 3GHEH 4FAAB 1YNLH 5EFIB 3VFTA 1D9KA 1RZ7L 3TYGH 3ULUH 1JGDB 1EO7A 4WNQA 4X6FA 1TQTA 5C0EA 1DN0A 4YDKH 4DP5X 1MQKL 3JQOB 4LLYA 4H5SB 1FE8H 4POZC 3V0JA 1MFBH 1FIGH 2CO6B 3F7KA 2WQSA 2DI7A 1T2QL 5BVJB 4D3CL 4V1DD 4JFYB 1IJNA 2X5PA 1HN1A 2H2SD 3JV4A 4JFEA 4OKVB 5LXGL 1QG3A 5E6RB 5GS1C 4MMYA 1TENA 2YAMA 1J9CT 1N0XH 3QPXL 3CN3A 4MJIA 5AL8A 4HZ1A 3CZFA 4XODA 3GSNH 1E5ZA 1MEXH 4Q0XL 4XVSL 5DD3L 1JF1A 4JE0A 3UAEA 3EOYG 1S9WA 1UKSA 4FQJL 4FTVB 3T65B 3IJSA 3KPMB 5IHUL 3FPYA 1LK2B 1E9PB 2F61A 3FUFA 4ISVB 4PB9L 3RURA 5F7HA 1IGFH 5I1JL 5EOCJ 3TO4B 1QD0A 5FCSH 4YDIH 4H25A 3E9TA 4APQD 4PRNA 2AJ3B 1TJIH 3HE6A 3RPIA 1Q94B 5IVZA 3ZMEA 4HK3J 3GXNA 1HXYB 1BOGB 3WD5H 5KTEL 5L0QC 5LDUA 1RSFA 1X7QB 3ASWA 4LKCB 4QHKJ 5K9JH 3KEHA 3MLPA 3LRSB 4NQDA 4QJ3B 1E27A 3SCMB 1BWMA 1F0LA 4GI8A 2AQNA 3APMA 5J6GB 3O9WC 3P77A 4LVNC 1AXTL 2AK4A 4YH6A 4PJIB 4MAUH 1NA8A 4M7KL 4EIBA 4A7GA 1OPOA 2OV0A 3I6SA 1JFHA 2X9XA 4PBXA 4QNPE 2D2OA 1ZTXE 1MFAH 3NCJL 2WXLA 5D5MF 5AVRB 5D1XE 2MCPL 1QSED 1LLAA 5CCKH 1BD2B 5HGGS 3MRHA 5T1KD 1CD8A 2J1KA 3DMMC 4JZNA 3FO1B 3PV7A 2OW7A 4PJFE 5CZVH 3PABB 1DQJB 2DMHA 4AUUA 2OZ4A 1N4XH 2RFXB 3ZE1F 2AJYL 3LKPB 4Z9KB 3SPCA 5CBEB 1IM3D 1E30A 1I1AC 4N2GA 4Y5YC 1BVOA 3MQIA 2G0LA 3C08L 4WNSA 2VO8A 2Y1ZA 1OSZA 4Z7UF 1S7RA 4NB7A 2KPWA 4Z7WF 3FN0L 3DRTB 4L4TD 3VI3F 4ZBJA 1F2QA 1PTZA 4XAKE 3V0DA 2WYHA 4GINA 1H3PL 2X9YA 4TSCH 5D2LB 3QJFA 2ZPKL 3DECA 2EEDA 4KRPC 4BZ1H 4LPYA 5DZOA 4PMFA 3MRPB 3MUY1 4MKMA 1M7IB 3WKQA 1M71A 3L3HA 4GG6E 1TLKA 3QJXA 5C0FB 4ZUVA 4W9JC 4MD4A 1ZA6B 2NX5D 3EDDA 1N7ML 3PQYB 1WWWX 3FQXB 3WNJA 4GAFB 4JPVH 1P6WA 5HYIA 5GGTH 3GSVB 1EERB 1HHKB 5EOCH 1FC1A 1J05B 4W6YB 5EEWA 4OTXH 4JFDD 2NY0B 1VKXB 4OZHE 4Y7OC 1LEKB 4XBEH 3EYSH 1SYVB 1C16A 3B1UA 3HFMH 3S4SB 1T03L 2WLIA 4X99B 5KUMA 4L0ZA 2NYYC 2AC0A 1L0YA 4WCYH 3D7PA 3CDFA 3JTTA 4HMEA 3HN3A 3N44B 3HRZC 4HWBA 4UT7L 5KVGE 5LDSA 1KJ3L 2GSMB 3ARDA 4H88H 4F2MA 3IVKB 1KYOJ 1S7UB 1G7JA 3DV6B 3UPRA 4KRPD 3QG7L 5JR1H 5J1TC 2X9ZA 4JREC 5C0CE 2V8LA 2WXHA 2YWZA 1GW6A 4G6ML 3L9YA 3EJYC 2APBA 2P24B 4KVNH 4DIXA 5HJ3B 1JZJA 4NQCE 3ROOA 5SWSE 1P4LB 5EEYA 1A47A 5EZPA 3DUHA 2QGCA 4HEMA 4XWGL 3IDUA 2ZUQB 3ZYJA 1JPTL 4UIMA 4P9HC 5SX4H 3RL1B 5ACLA 5D7IE 4MMXB 5CU9A 4C56B 1U8LB 4JUTA 2E27H 4GS7B 4N20A 4BINA 5DRWB 1MCRA 3BUIA 3RWHB 2QPDB 1YEDB 3FTXA 2NNCA 5T3ZD 2PR4H 4B0MM 2EIMB 3CPUA 4TKWA 2NY7L 3HZMB 2B4CH 1AQHA 3KYMB 1CGUA 4LRNH 5B3NA 1WUZA 5MENA 3IRCA 1ETJA 3V4VA 2WZ0A 1XGQB 5HVHC 3AG3B 4YZFF 2E3VA 2KZ1B 5KYXA 5ACMA 4CGUB 1ASPA 1WDAA 2NY5C 4XO5A 1DDTA 2VMDA 2OXHB 3QULB 2I60L 1UB5B 4ELME 5IFHH 2BMKB 1CICD 3UTTE 4JR9L 2UYLA 3QIUB 4YSPA 1J8HA 1D7DA 1KIPA 5CR8A 3VSTA 1UGKA 2ATKA 2HJKA 2D8KA 3PWLA 2EH8H 1D7BA 1KGCE 3NVQA 4UANA 4XBGA 3ZT6A 1NFIA 1KCVL 1W8NA 3FSZA 3CK0H 2VN4A 5DWPA 3K5RA 2BVOA 2LAAA 3LZFH 1LO0L 4P2RB 1IFHL 4MNQD 4DP6X 4WKXA 1NIAA 2WZ5A 1PIFA 3B2PA 5C08A 5INDA 3AB0B 4L05A 4WHYG 5GXBB 5HYJE 1SXNA 5G4MA 5F93C 3QWOB 4M7ZB 1MWAL 5E1GA 1U8CA 2DQHL 3U1QA 4MX7B 3P3RA 4MJ5B 2W1NA 3KLAB 5FK9A 1KCUL 3AG1B 4ODSL 3IGUA 5L4FA 2EDBA 4PP2B 1XWVA 4QF1B 4JN2A 1EJFA 5EBWB 4KO7A 4PH8A 3O4LB 3NESA 2BSDA 1DBAH 3V0HA 2MOQA 3QUXD 1AGDA 3G04A 4KHXL 5AB1A 2J5WA 3L1GA 1TETH 1E8YA 2BHZA 4BDVA 1JTTA 3BEWB 2Z35B 3IAPA 4KPHH 5HDWA 3H3PH 4GO6B 3TZVB 1F4XH 1TCMA 4M7LT 2R2CA 5DJ0A 5L6YL 1KPRB 2NUPA 4KXBA 3K46A 4Y1AB 3CSBA 3CVDA 5DRNB 2BX5A 5F88A 1FV1B 2A6DA 1C08A 1FL5B 3GXTA 4DOHE 3BWZA 3CNKA 1ADWA 1SJEA 3AGWA 5B7EA 1U91B 2PO6A 2YSSB 4FP8H 3T71A 3V0WL 2FJFA 3ZDYE 4F8LA 1X5HA 2V0AA 3T0WA 5MEOA 3I6GB 2BDNH 3HG3A 3SSGA 4Q6KA 4QXVA 4IOSD 2IV9A 3OLIA 1QSZA 1KBWA 2VITA 4LARL 3TCTA 3QHFL 4JY4A 2JB6B 2QBWA 2UWEB 1DL7L 1PZ2A 1HEZA 1QFPA 4NKIL 1NFKA 4A2LA 3ZHDA 4X9IA 3B4NA 1Q9KB 2IC2A 2O5YH 2X4RA 5JIQA 1WAPA 1S7VB 3V9CA 3PHSA 5KYYA 4ODHL 1OTTC 5JNYB 2CIKB 3FRUA 4PJHF 4U4IA 1P5VB 3D39A 4UTAA 1J9RA 5F3HA 1CZ8H 2HT4C 3TF7C 4NLAA 1CB4A 3RIAF 5ILTL 3A22A 4YFEA 5CM1A 5AZEH 4F7TA 4LPTA 2HVKB 4NQSA 1N10A 5DD5H 4NBZB 1U3ZA 1DQML 1GIGH 1O7VA 4JX0A 5D7SH 3STLA 5I0XA 4A2FA 1MH5B 4ESKA 1QLEH 4R7DA 3CFJA 1P5UA 4NQVA 4AH2A 1D5MB 2WINB 5D6DC 2YXVA 2KL6A 3R7RA 3KYNB 3F7LA 4O02H 1KXTB 1CT8B 2W59A 4Y9BA 4TVPD 1JGVL 1P6FA 4RDQF 3ZUNC 5IJDC 2C9UA 3R7QA 4OLVH 1OF2A 1MY5A 1ZJBA 2G75A 2MSPA 3DX8B 4MA1B 4FZ8H 2VLLB 4FQIH 5DVLA 1T21B 1ZMYA 2VW6A 5LGJB 3GBMH 1WEJL 6TAAA 4G8GD 1H0DA 4M1CD 1OARH 3ZDWA 3L3IB 3W0WA 2QADC 5F9DC 1MNUL 4RWYL 2EVGA 1KN4L 5FDYA 1HYRC 4L1TA 4G8AC 3L4ZA 1H5BA 3UIYA 4MTMA 3KR3H 1SN2A 1IBZA 4PJ5D 1XF3B 1KJ2H 2XV6B 3AWGA 3CE1A 5C0RH 2I7OA 32C2B 4X4KA 4XHJD 5FM8A 3SD2A 3FTZA 3QGVA 4IMLA 3UC2A 1BMZA 3ULSB 3X14A 4M43H 2HUEA 2W80C 1TF4A 1FZOB 3F64A 4X9FA 4XO4A 2DWTA 4NUJA 1N3NA 5DJDB 4XZUA 4IGBB 4TQEH 1ZVSB 2OP4H 4ONHA 4ZO8A 1XDTT 3TT1L 1RJYA 4KROB 3S8FB 4ORZC 1G1OA 4KO6A 5SWQB 1PKQE 1EVTC 2N1TE 4HJJH 4WO4A 1X9UA 1YJDH 2BOLA 1XCXA 3HAEB 2KPNA 3U30B 2AZAA 3FU0A 1F02I 3WY3A 4HJ1A 3TBYB 3SIKA 5ESQA 1WBXA 4GRWH 4OJEH 1PZAA 3K6IA 2CSPA 3OAYK 5E4EC 5GISH 5KSUA 5DC9B 4WJKB 2I25N 3U0WL 1U36A 4PWKA 1YRKA 2CQVA 3IEAA 1YNTF 1NBQA 1A4JA 1OAYH 4A7UA 3TL5A 3AT9A 2FHFA 3CDYA 5EUKA 3RBGA 2X4SA 5F0PB 1JGEB 1XGPA 2FX9L 4QXUL 5FM5O 3KLQA 4QD2E 4OD1H 4UQDA 2VO5A 3NSXA 4M1DL 3GBLA 2ITCA 4GXUN 1URLA 3MXVL 1OO2A 4Z3FA 4G8FA 1A7PH 2J88H 4OT1L 1KIUA 3FQNB 2QJDA 3VDCA 1SOXA 3CXHK 4Y4FD 4XP4H 1NCCH 2ZP0T 3OHXC 4EI5D 2F1AA 1VF5C 4R0LA 5DRXA 2ICEC 1HNFA 1JD9A 4PCTA 5F6HI 3VXUA 2Z92A 1E67A 2ALAA 3BWUC 4S1DD 3BZ4B 3ZSTA 1TNMA 3H9ZA 3ZO0A 1YEEH 2XV2A 4LAQH 2D3NA 3DSNA 4O2EB 4P99A 4WF7A 3PWJA 3PP3H 4WHYH 1IBGL 4JN1L 3TV8A 4RFNB 6FABH 3L08A 4Z23A 4ELKB 2HPOA 3QH3A 2EEFA 5BO1H 5FO2A 5CAYB 3QZMA 1EMTH 3BPNB 4RWHA 3M1BA 4M5ZH 3SE8H 5D5ME 2OMXA 3AWFA 2IWFA 3GD1C 4JFXA 2PTTA 3CIAA 3JTBA 5DFAA 3D08A 5B8CC 1BREA 2XVKA 2ZX6A 3RKDC 1G84A 1CLZL 2BSRB 3JT0A 4WUUB 1JGUL 3IETB 2AFNA 4D0DB 3IJHB 1NCBL 3BUYA 1RH8A 1K3ZA 3ZE1E 1MFUA 1NTDA 2R51A 1VERA 1NDGB 1O9WA 3HEIB 5BRQA 5I19L 1DTUA 1JGLH 4CAGA 1EEYB 2DWEB 5DZVA 3IDGB 1MLCA 3RY6A 1QBLH 2YZ8A 3PDGA 4U1NA 3NABH 2AEPH 2HFEB 5D8JL 5AW4B 2WXKA 1XF2B 3MV8A 5EEXA 4M02A 3ZKNC 3ZR6A 1HQ4A 4HUUB 4GSDH 3X2QB 3BT2H 5BOJA 1F2XK 3L1OH 5F7FA 3SPGA 1VDGA 2KYIA 3TBVB 1FO0L 1A3ZA 3F7QA 5L9DH 3B37A 3K72B 2JKLA 3QFGA 5HHQB 1SM3L 4FQXA 2ZX5A 2JVUA 4FI8A 25C8H 2NCEA 4JKMA 4A7VA 1HHGA 1VFUA 2RGSA 3O3BA 1ND0A 1S7QB 4L8CA 5E8DH 5JIMA 2V6HA 3UFIA 3BCDA 5JHLH 3MNVA 3TIDB 3DOIA 1NEZA 3UZVB 4J5VA 1NGZA 2BSED 2H32A 5J13C 1T1XB 4GI6A 4D2NA 2GJ6B 1TMCB 3SYAA 5FB8A 3FYIB 4HFWB 5DQDL 4IKLA 2OM5A 4NKDA 1RKRA 1DLHA 4OF6A 2MCG1 5CLWA 4ZS6D 1FRGL 4J3TA 1VZHA 2OKMA 1Z9OA 2FSEB 1XGRB 3I6LE 3ULUC 5LUMA 3Q2CA 2RCSL 3ATEA 5DTFA 3UO8B 4ZMOA 3TWYA 2V37A 2WKOA 1GYWA 4BCYA 2YN3A 2IWKA 4NAMA 3DOSB 1E90A 2LV4A 1DBJL 4HZAA 4YC2C 1I4FA 3WFCL 3V0GA 3ZKND 1OAXL 4NZDA 4DZ8B 2VMCA 3NCMA 2BSSA 3GYRA 1QW8A 3EFDH 3JV5A 1JZHA 3L5JA 4WEBH 5K9KB 2D9QB 3PHOB 5M95B 3E38A 5L4MA 2VAAA 4IJ3B 3S5YA 3SKNA 1RIUL 3EJZD 1ZT7B 3MNWB 3V6ZB 3VD5A 1Z66A 4Y2OB 3DNKA 4AEIL 3WE6A 4LT7A 2XV0A 4TNFA 2LAGB 3DX7A 5D6CB 3P0VH 3NJVA 4LSUL 5DWUH 2FATH 2BIOA 3T2PA 2AEIT 4ZJ9A 1SVCP 3E0GA 3PWPB 2WD0A 2E7CA 1TUPA 1FVDB 2YMTA 1DVUA 1N8ZA 3TFKD 4PJGE 5FX3A 4ENZA 5KSBB 2NSXA 2GJ6E 3BP5A 3ARYA 1THCA 1V3JA 3H4HA 4H8UA 4LB8A 2VDNH 2OL3L 3BVWA 4WWKC 1WSST 4GO9A 2PF6A 3MNZA 4XMTA 4Z78A 1FZMA 4AEEA 2E6QA 4LCWE 1T4KB 2X4TB 1I3RA 2PYEE 1JZ3A 4AL8H 4JO4L 3TNMB 1DUYA 3NPZB 1ID5I 1T22B 1TJMA 1S78D 4KRLB 3QISA 1U8KB 2R2HB 2YPVL 2HT2D 1PSKL 4M9PA 2DV6A 3DBXA 3DC0A 4HK0B 4P9HL 4YHZH 3QQ3B 1XF5B 4I0PC 4MLIA 5GRYA 2WTPA 2YD8A 5JUEL 4QRRA 1L9QA 3L48A 3LRMA 5L2JB 3UYPB 3GRGA 2ZICA 4G6FB 1NIBA 2LHAA 3FU7B 1IGTB 1I85C 4U33A 3W82A 2HRLA 2FB4L 4P9ML 1DQDH 1PG7H 4LSPH 1F5WA 1J1OL 2IAMD 1WAAA 1FG2B 4N24A 4MHHI 1QR1B 2NY5L 2DYRB 3EBGA 2VDML 1THAA 3AQXA 2R0ZL 4OFYA 2OMBA 4U1GB 1N6QH 1EO8H 4WWKD 3BZDA 5KSBE 2YKKA 2VDRL 1XMWA 3EG9A 5ESAB 1NGPL 3K4AA 3TJEH 3CFQA 2Z93B 2XUWA 1ZVNA 1ZTXH 3HS8A 4JPKH 4N3UA 1SF5A 3T0BA 3HCVA 3KM1A 3L3DA 4GKSB 4OQ1A 1DZBA 1ZSHA 4CKVX 3P4OA 4AIEA 1EDHA 3HVNA 5KVDE 3ML9A 4EO5A 1QHOA 4R7XA 4BSWA 1ODAA 3D34A 1SLVA 3ZKXC 8FABA 4NQTA 2CDFA 3IMSA 1AZCA 3ARBA 5F6IB 4RMQA 3WHXB 2N7BA 1TMQA 2F53D 2A74A 4MA8L 1HXMB 4L8DB 1Z9PA 4OZIA 2A1WL 2CHZA 3MLRH 3QFDA 3QYCA 4K5PA 3MLVH 4RMSA 3HI6L 3TIEA 1MAKA 2GFBA 4HWZA 3EGSB 1CUOA 1TTFA 3HNVL 3CLWA 1E5UI 4MQXD 2K3HA 2WVTA 4QWWC 1UCBL 2DYPB 1JOIA 2ZUVA 3RPBA 1V05A 3ECQA 3ZJAA 4E68A 4YDJB 1R47A 4M6ML 1OE2A 4LL4A 3SJVD 1CXKA 4N90D 3AM8A 3F7VB 1R3KA 3EUDA 4G6AC 4PUBL 5FV2A 2YEVB 2ADFL 2DRUA 3H9SA 1K3IA 2J8UA 3NJFA 2AW2A 2GITB 2EIDA 2VDQB 1KPVB 1CGTA 3MRKA 2AQ2A 3HZKA 1NSNH 3DVGA 1MFEL 1UM5H 1Z9MA 2CKNA 2FECL 2WANA 3FQYA 3KJ6H 4G7YL 1NKRA 3RI5F 4L3FA 3V10A 1LO4L 1XH0A 3H2QA 1F8TH 1A7OH 3HBQA 3B9DA 3W5MA 4HC1L 4YDZA 1UB6B 5BPPA 2HKFL 1MCDA 4EPSA 5DHVB 1F1AA 1G7MA 4U3CA 1RZIB 5KVGH 3SBWC 4AQ8A 1NL0L 1XZ0A 3U7YH 2QL1A 4NRYB 3SGJA 4PBVC 4F5CE 4AVHA 2XN1A 1M57B 2HSIA 4W6XB 1UM6H 1OEZW 4K8RD 1HIML 1UWEL 2UX7A 1A14L 4HS6A 2ZXWB 2APFA 3EYUH 4ANKA 3MCLH 1SBSL 4MDJA 1WJ3A 5D72H 4MJHA 3CBKB 4XNMA 5FGBC 1MG2C 2X3AA 3UG5A 1BFVL 1PL3A 2B4CC 5IQNA 5BRZB 1AR1D 5FYJL 1VADA 2EEXA 3LH2L 3V5KB 2VWEC 3NGBB 3BMVA 3QI9D 4Y8AA 5IW6A 5TJWK 1JK9B 4N6RA 4ZW6A 2DZEA 5CLXA 3BH9B 4MKTA 5I71B 1BAFL 1JWUA 5C0AB 3KCPA 2HJLB 5E8OA 2OQJB 3C5XA 4FNRA 3RUGF 3MRMB 3TBTA 3V0FA 1MWAA 5IKCB 1UM4H 4Z7NF 1VEMA 4M5YH 3RGBA 1FH5H 4YLCA 1ZD6A 3FFCD 1OB1B 5A6MA 4AENB 4UUJB 3RWIB 3LXAA 1A9VA 1OOWA 3Q13A 4Y5VB 3RY4A 4M4RB 4AC4A 1IC1A 3QRBA 4G6KL 4R2GC 5EIVA 1QFHA 1MFCH 2JIXA 1MY7A 4WDIB 1ROWA 1KCSH 1UZ6E 1JF5A 3K91A 4NC1C 2JKTM 3ARRA 4P3DA 4YBHA 2FEJA 5ESVB 3T0EA 2WXIA 1X7SA 1LQBC 3DHMA 1A6ZB 2ZXGA 3OM3B 3IRZA 5FUZL 5DYFA 4JO2L 4Y4HC 3QO1B 3MBXH 1QSEB 2P8MA 2IALB 2QKIA 3HZYB 5DT1L 1I3GH 1U8HB 4P4RA 3B1TA 1NEPA 4LK4A 5JW3L 2NZ1A 3H54A 2XNAB 2EABA 2R56H 5AVTB 2X4NB 2I32A 4J39A 2BSTA 2FLMA 1CYGA 4HKZA 3BYYA 3GO1L 1DJYA 2X4PB 5CJQL 4KXZH 4M56A 3RVXD 5TH2A 2W60A 2QPEB 4XZ4A 5E99H 1ZGLB 4ZXBD 4J3XA 4OB5L 3RWCA 4BKLA 5FS5A 1JD7A 1RQ5A 1WHPA 2G4GA 4OD2A 3FT2A 2CCWA 1CFTA 2CO4A 3PGFL 2YXFA 4HALA 5IROA 5ABAA 3H9YA 2IDFA 4Q97A 3ILPA 3OJMB 1JRHL 4DKFL 4Z3IA 4Q6IA 5KS9A 2YRBA 1XXFC 4HOXA 4FS0A