2V9UA

Rim domain of main porin from mycobacteria smegmatis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
b'GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed Protein-Protein Association.
pubmed doi rcsb
molecule keywords MSPA
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 27
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09203 MspA MspA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1650 Mainly Beta Sandwich Immunoglobulin-like Porin MspA (Ig-like beta-sandwich domain) 2v9uA01
1UUNA 2V9UA
chains in the Genus database with same CATH superfamily
5C86A 3T1WA 3EFFB 3N2JA 4ERSL 3VH8G 4GQRA 1A8JH 4YXLH 1H6FA 4QO1B 4U2YA 2A4CA 3T8XA 1QHOA 3O4OC 4BHUA 1OPGL 2MCPL 2WXKA 4X6DE 1V3LA 1MDTA 4JPIA 4KUCF 4XHQA 3WL9B 4Y4FA 5HGGS 4HV8B 4JRXE 4OCWL 4BXVA 5DMIH 2AITA 1LO5A 5DUPL 1FWXA 1LWJA 4XP4L 2A6DA 2K7PA 3W1ZA 5ANMB 1CE1L 2UY6B 3X14A 2I26N 4U1HB 3ESPA 4N3TA 4K9EC 2JELL 2L7EA 2OSLA 3DDFA 2VJ8A 4YPGA 2CJSA 2Y4SA 4L4VA 4X50A 2BIOA 2G9KA 3PWPE 2A9ML 4YHKH 3I6GA 5I6LA 2DI8A 2EIDA 3NYKA 3FQNA 1WF5A 1M71B 2YQGA 4ODVH 5D7JC 1G6RA 2EVFA 2JK5B 3WFEH 2JKJA 3SPVA 2EECA 5B38A 4TF4A 1QNZH 2BH0A 4WI6A 4GKLA 1B2YA 2C3WA 4Q6IB 1UZ8B 4M61B 1DBMH 1F42A 4N2MA 5F7FA 1IAKB 2G5BB 2G5RA 4M5SA 4RGOH 5D1ZA 2F8XC 3WTTA 4U05A 3C60C 3X3GL 2VLJE 3VD3A 2FSEA 1H5BA 1KLUA 3JWNH 4JMXA 4OM1L 5JW4Q 1FVDB 3K1KC 4OGYL 5DJZB 3UXFA 4LCYA 2LAAA 3L3JB 3F58H 3RY5A 3ULUE 5JPNB 2Z1PA 4X4XA 2BNRA 2HX8A 1KN2H 2G4EA 1I7ZB 4LPUA 3RWDA 2V9RA 3WTWA 2Q7NA 2X41A 3GXNA 4QEGA 2R69A 4B3EA 1JZ6A 1GGTA 4XN7A 4BKLA 1G7HA 5BW7A 1G0XA 1E7VA 1UUSA 3TT3H 3LZNA 4J8QA 1RXLA 3K2IA 3QHZL 2CGRL 4MMXB 1T80A 4YDJA 3GQFA 1J0HA 2CDFB 5INDA 3L5WB 1S9XB 4XNZB 1XIWB 3OAZH 4NQTA 5HJDA 4NCC2 4K8RH 2Z91A 1UOKA 4PBVC 2NR6A 1ONQA 3SDDA 3TL5A 4N6QA 3MRQB 4U1LA 4JRYE 5EO9A 5EZLA 2DJUA 3QUML 4S1SL 3TH4T 3WEXB 2NY6C 2VN3A 3CJJA 1P5UB 1PVHA 3L1OL 3G6JA 1SN5A 1J1XH 2CXKA 2X4SB 1AIFB 3APNA 3CFIC 3ES6B 3MRLB 3WD5L 3KPQB 3OF6D 5B38G 5D8JL 1IAOB 1UA6H 2BVTA 2DTMH 4AGNA 2VXUH 3HI6H 3L4YA 3S7GA 5KYXB 4MXVF 3BKYH 5EUOE 4N0CD 4XI5C 3TNNA 3CLFH 1K6QH 2Q3AA 4LK4A 1RU9L 1X6NA 4KKLC 3HMWL 1UWXH 5JQHC 1ZDSA 3IGKA 3JVGC 4WNJA 2IOIA 4P2CG 2VDPB 1NEZA 4NQXA 1NGYB 1U30A 2Q7YA 3AWFA 1IGFH 4Q74A 4LLVA 3MTXA 3UCQA 3L2LA 2HTLC 4MD4B 3U4BH 3X12B 2OSXA 5KSBA 3IFPB 4DP4X 5H4ZA 1JRHI 3VXMB 3GMRA 5FGCE 2YHGA 1CCZA 4FERA 4DKEL 4JS7A 1JZEA 1F3JA 1FCGA 4GG8A 3SGEH 2MNJB 2JJVA 2BOBB 1DJIA 2E9IA 2JI2A 4H2CA 3O8XA 4F7KA 1JVLA 2AZAA 4S1DD 2CIKA 2CZNA 3CFNA 1Q72H 1SHMA 3RX9A 4X83A 3OL2A 5IJCC 2QVIA 2J8UA 4EEEA 1YNTF 4U1JB 3W81A 3D18A 3FCSB 4FQQA 4LPXA 3O45B 4GSRA 4NT6B 2NY2D 4KTDH 3D7PA 2BXYA 3EOTH 2X6CA 2D2OA 3L9YA 1SLUA 1JNHB 1T20B 4JQVA 4JX0A 3OAUH 3EJCA 2OTPA 3S5ZA 3W9DA 3FQWB 3GHBL 3GDBA 4QRFA 1I3GL 1FNLA 4LPCA 3TA3A 2IBZX 2B7DT 1WFMA 2W38A 2OMVA 3REVA 1CURA 1N12A 3A5VA 3L08A 3M6DA 4M1DL 4MQ7B 3LH8A 1ZVSA 3O6LH 3S36X 4UQAA 1SEQH 3WMSA 1AZZC 2X87A 3L7FA 2EE9A 4FYQA 4PJEA 1M7DB 2RAMA 2CHWA 1A6WH 1S9YA 2O5YH 3L9RA 1TKWA 2H8PA 4FEIA 3PDGA 1KY7A 1H3TA 2ZUSA 3TT1L 2PW1A 1P1ZA 1R4XA 3EGSB 3GIVA 1MFUA 4RQQA 3OG6B 4TTDC 1DP0A 1M2VA 4NSKA 2QGCA 3ECWA 1NEZG 2XYCA 3GHPA 4R0LA 3WNLA 5C0CD 4N0UA 2O6DA 1KCBA 1RIUH 1X9LA 3GNML 4XO8A 1JYVA 3NJXA 1KYDA 1MREL 2EVGA 1ASQA 3TNMA 3IF1A 1IKFH 2P5EE 3B6SA 1QABA 1UATA 5F9JB 1DHKA 2F9BT 2EKSA 4NZTL 2JWYA 3T2OA 1DN2A 3FCTA 4QRPE 4ORZC 1Z2KA 4AK1A 1NL0L 1NC4D 1S8DB 3I6LD 4KNUA 3KJ4B 3V8OA 1BM3H 3FOLB 5SWSE 2B5IB 4PJIB 3E38A 2EIKB 4WO4D 3PABB 2DQEH 2WZ6A 5C71A 3DUUB 3IFOB 1EERB 3BAKA 4GNKB 4AXWB 1DQMH 3S34L 1F6FB 2OMYB 4HKXA 4DHLA 3SE8L 5HHPA 3HPJB 3ZJAA 1BYNA 1YY9D 4FKKA 4U0QB 5EA0L 5I5RA 2AV7A 5B1AB 4MMYA 3CZLA 1PZUB 3K4AA 3U6XA 1BYPA 4AIZB 3RVTD 1X44A 3ZYOA 5IHZB 4AGPA 4WI3A 4M1CD 3DVNB 4X6FB 3ETBF 3T0AA 3QORB 1HHJB 2A77H 3A4EA 1ZRUA 4XWGH 1OP4A 4R7DA 4WFHE 3JWDC 1RK1A 1QBLL 1UTDA 2CUHA 2XU9A 3QNFA 4U1MA 3QT2A 3O3AA 3MRFA 4HWEL 3KNBB 3RTLA 4JGNA 5F7WC 1JZFA 2W81C 5I76B 2YUZA 1LEGB 4RDBA 3TJEL 2DQCL 4OH2A 5FHAH 3S96A 2CGZA 5HPOA 4RMTA 1F6AB 5DRZB 4XR8C 5I1HL 4WHTB 3DX2A 4BCZA 2ZX6A 5IR1B 1K8IA 1DUZB 3BE1H 3LCYA 3LHAA 1SZNA 2DQGL 3EJJX 3EKCA 4M6OL 4KX7A 5JMOC 4H0IA 1VB9A 2NY0C 4FL4B 4NZFA 4OM0L 3P2BA 5EOCJ 3E8VA 5D7LB 1RZJC 1NBVL 1VFAB 2I07B 3WNJA 1J8HD 4LHQB 1VKXA 3WJLA 2D73A 2QV4A 3D39A 2PLTA 3VXSA 5I71B 1KB5B 4QHUB 2GJ6A 4XH2A 2F8IA 4IRJC 5GGQH 1T21B 5DUMH 3SDXF 3K6FA 1RP8A 4TUOA 1LP9F 3ZKSD 4HWNA 1LDPH 1MCHA 1IEHA 4X7FC 3FC8A 3JYCA 3R19A 5I24A 3CH1B 3LJ3A 2X28A 4S1RH 2NCMA 4N90E 5E95B 3GSVB 4G43A 3QCTH 1M9SA 1ED3A 2G75B 3P3SA 3QR2A 3S3DB 5ADOL 3AADB 3DSFH 2XWRA 2GUOA 3LX9A 1G1CA 4FXGA 4J3VA 5C7XH 1RHHB 4J3OD 4F1ZA 5C6WH 4K3HA 3H9HB 2AK4E 1YPZF 4FQJL 4HGWA 1V27A 3PGDA 4L29B 5A43C 2ZF9A 4U3HA 1CTNA 4B9JA 5CCJA 3L5HA 3TZVB 3ESNA 3HS8A 5KSVA 2CPUA 3BEWA 3HC0B 4YDKH 3FXIC 4FYSA 2LABA 3BCFA 5CCGE 4M8QA 3P30L 2ZXAA 5JA9A 4Q0XH 2BIMA 1KV3A 3QDMB 3T6QC 5BUAA 4RAUB 5D2NC 2QJDA 1IGCH 3OKYA 2JB6B 4MRCA 3LVTA 5E6RB 1JPTH 3EYVA 1MW0A 4MJJA 1VJSA 2WJ7A 4Z3GA 3OQ3B 3CXFA 5EU4A 1HL5A 2VDNH 3FFCB 4DP0X 1OM9A 3MXVH 4JG9A 1MQKH 3H6AA 3OGCB 3QP3A 5GQBA 1HI6B 3SGKA 3KPRB 4ENZA 5I6OA 4Y2NA 2ZNXA 4EDWL 5IVXA 2EO1A 3T1FA 3LEVL 3SKOB 3GSUA 4E9XA 3CPUA 1OSEA 5IGXL 2DQFA 4KVNH 2NY5H 2GEEA 4HIIA 4P2QD 4S0SD 4MJ5B 4PIBA 3HLAA 4PG9B 2BPBA 2RBLA 1BD2D 4XP9L 2IJ0C 4PGCA 2XI9A 3SDAB 4PWEA 2XTJC 2XIBA 3LN5A 5B1JC 3IFLL 4HFUL 4ODBD 2PCFA 3VWKD 5K9QG 4D7PA 4GUPA 1WK0A 4AVHA 1QYGH 5FYKL 4MJ2A 1WUNT 4AGMA 1CQYA 4X6DB 2VQTA 3N85L 4Y2DD 4Y7MA 3MUJA 5C0IA 3HRZA 4BUGA 3D1MC 4K94C 3PIQB 3RJDA 3BD3A 1NFAA 5DZOA 4XB7A 1YC7A 3VDCA 2J5LC 2FH6A 4YDNA 1UGKA 5CXPA 4PG2C 4QXWA 1ZPUA 3ILEA 3TU6A 4MAZA 3B7SA 1HEHC 4YR6A 1IC1A 3RWIB 2BZ7A 3PWPB 3F00A 4TUJB 3WYRA 2DWYA 1HWHB 1KBGH 1PCSA 4YGVB 4H26A 4MCYA 4MD5B 1O5DT 4YHMH 4NQSA 5IMLB 2R8SH 3T3ME 2OR7A 2IDSA 1MZZA 4XCFL 1E9PB 2I7SA 1OSZA 4E41D 5IW6B 3T0EB 3DIVA 4UNVA 5DJXA 2PUQT 3MODH 1UG9A 4I3GA 4ZI8A 1SHSA 4KHXL 4NN7C 5C0GA 5I1IH 3UTOA 3Q5YA 5IHLB 2ESVA 5KW9H 4H1LH 5DJ2B 4Y4HC 2VISB 4NO0A 3DETD 3BVXA 5IG7A 1X9QA 3Q05A 3VO0A 2DYPD 4LLUB 1GYWA 2QADD 2R1YB 1U8QA 4L4TA 4ES9A 4LCUB 4X6CF 4UANA 4L8SB 4MQXC 4ZDHB 4G9DA 4EIBA 2PN5A 4YSQA 5GSRA 1UKQA 3AWGA 1ZY9A 3FF8A 3MKGA 3NEOA 3WFBL 1E5AA 1I3VA 4H8WC 4X9BA 3FZUD 4B3VA 1AQHA 3KEDA 3ZPDA 1QFPA 4NN6C 2J88L 3WHXB 4LASL 1MWAB 3FUKA 2W0FB 2IMMA 2B15A 3RB5A 3GHEL 4NUPA 3SQBA 1I1YA 2QQKH 4XO9A 1MW2A 1SN0A 1KCVL 4ACPA 3RFZB 3BZ4B 3RKDC 4ONFH 2VDMB 5J1AB 4LNRA 4LF3B 4HUUA 2Q0ZX 5E8OA 5E1AB 4GRWF 4XODA 1GMEA 2FECI 4AEEA 1F4HA 3LNHA 4HIPA 3ULUH 5E56A 4KKZA 1RULL 3DX7B 3LNEA 1X5YA 3MV7E 1CFQA 5FK9B 1CFTA 1J10A 1F18A 1XH2A 1AAJA 2L7JA 5EUOB 1S7WA 4PV9B 3NFNB 4MJ4A 4DUXA 4OGQC 4NKMB 5D96B 1K72A 5CSGA 2FBJH 1KJVB 3P77B 2JJUA 4NDMA 4ZUVA 2EXYD 2FO4B 1CUOA 4HV8A 2R0KH 1PLGL 4RGNB 3VI4F 1IAIL 1J0ZA 1H3UA 3A6CH 3MUGA 4G7RB 3OC8A 5L6YH 1AD0B 4DOHB 3BAJA 3D4CA 4L3EA 2OJ1A 4PY8J 5AB1A 3IWUA 5L9DL 4U3SB 3U2SA 2NTSP 4ISVB 2VDMH 4P5TB 2ZTBA 3B83A 3JTSA 3MO1B 3HNSH 3NH7H 4C56D 3VCLB 1S9WB 4CSZA 1CTOA 1ZE3C 1FV1A 1WH0A 2DJ4A 2JK5A 4NXKA 1TQBB 4IOSD 4QOKE 1BWMA 1W9XA 3TN0B 4KDTC 5E2TH 4KROB 5K9OB 1QKZL 2FBRA 3LQMA 2AEQH 1QVOB 4OLZH 5J6GB 1KPRA 2E27L 2EE6A 3D85D 2GJRA 2ZKXA 2D2CC 3N44F 2YMXH 1JAEA 2AP2A 4JBSA 3NQKA 4I89A 4XAKD 5HI4C 3C5ZC 3L3GA 2QPUA 1YYCA 5DJZA 4Z7UA 3QXDB 2VDKL 1DQJB 5EH1A 1SYVB 4LFHG 1XBRA 5HVFB 3LKOA 3TCTA 1WISA 2ATAA 4KJQC 3TPUA 4HSCX 1I7ZA 4YLQT 2Y2YA 5MEPB 2GIMA 3CZFB 1P7QD 4DH2A 5DC0A 3CDZB 3VB9A 3AQYA 2WNXA 1ZEAH 2ZUQC 3AB0B 1DQVA 4PRPD 3JWNG 1U9KA 1UJ3C 2WZ0A 4GW1A 3KYMB 2CDEB 4AGLA 5B4MD 3U9PH 4NGHL 4EKXA 1JWMB 5HPMA 3I6KB 4U1IB 4K5MA 1DBKH 2CDFA 4ZFGL 1KOAA 3L5WA 2H41A 3UBGA 4BYHA 2FX7L 3WFHB 1YEFH 2P5EB 4HWBA 3C09C 4AEFA 4DK6A 1N2RB 4TV3A 4A7GF 3Q8EA 3DECA 4X5LA 1AO7B 5DO2C 3VD2A 2EIJB 3NAAL 4YXKL 3F2LA 3CN3A 3H56A 2BSBA 3VFMB 4FTDA 4HK3N 4JG1H 4YSAA 4RNRB 2DLEA 4LSQH 5SWSB 3SQOH 5CD5D 3W5NA 3RUGB 5AW1B 3S35L 1MFCL 3U2JA 2GK0A 2L7UA 1PYWB 5HI3C 1AIFA 3ES6A 2BFVH 3T4AB 3VACA 1BPVA 5C6TL 4RWYH 3ARFB 4H8PA 1JI2A 5JO5A 2DQIH 3UTTA 4FFZA 2VJXA 5DWUH 2B1AH 2UY7A 3QQ9D 5FA3A 5HSFA 3GEFA 2WWMC 1EK3A 5T3XL 2ZXQA 1QPKA 5BZWA 3A6BL 2CWRA 4XWOC 3NCYS 4QT5B 3BYTA 5DS8A 5E94A 3N42B 5L7XH 2HRHA 1DN0B 1X5MA 3TBVA 4KI5C 2B0SH 4DVBA 1XH3B 1TTAA 3EO9H 4ETQA 1LO3L 3QUMB 2GJPA 5IIEA 4JHWL 5A16B 1TUPA 3N43B 1U41A 3QG6A 4PJHF 2JIXD 3FU8A 4NJ9L 1MPAL 4P46B 3X12A 1S7XB 2ZP9A 3IFPA 5E5MA 3OLIA 1Q0XH 2PR4L 2UXGA 4PRIA 5HGHA 4M7ZB 5AYTA 1F02I 3E0GA 4ZS7L 3FB7B 4XPFL 3FSAA 2BOBA 4DPAX 4CW1B 1B0RB 3OLEA 5GRVK 1IQWH 5D1XE 3MOAL 4JFPA 1KYAA 4M00A 1BGXH 5TQ2L 5E2WL 2E7LA 2CO6B 2WVTA 3G5YA 1PS3A 2OMXA 4AW4A 2APSA 3NOIA 3GT6A 1MJ7H 4EUPH 4NT6A 3O45A 2CBOA 4KTEL 4KZDL 2J3SA 3HNTL 1W0VA 1BVOA 3CHOA 3V0IA 1WYJA 2Z7ZA 2PMZA 3U30C 4GSXA 1JNHA 3M8OH 4GKNA 2R0LH 5I6KA 2UYLB 1A9EB 1ET5A 4NQDD 1G7MB 2FNBA 3HZ3A 1PQZB 2VOTA 4MTMA 4OCLC 4YJZL 3V10A 4AYBA 3S88L 2NYYC 4X7DC 2YAFA 3D4ZA 3VGGA 5C0AD 1M7DA 1E4KA 1GGBH 3D2UA 4GO6B 3U36A 3TBWA 3GJFB 2DN7A 2MQ0A 1WJ3A 3QG7L 5CCKH 3C6EA 2MCG1 4C4KO 5T5FL 2AGJL 4HW6A 1ZTXH 4JPQA 3L7EB 5D2LA 5C70A 5IOKA 5DA4A 4NQVB 1YUKB 4NIYE 4WU7A 3IAGC 2ATPB 2ZUTA 1I75A 3LQAC 2E7CA 5F9JA 4HJ0C 3VRJB 2IV9A 2ZYIA 4U1NB 1HESA 3V0WH 4FABH 4UMSA 2ALWA 1LE5A 3MGOB 4AQ8A 1G0YR 3D69B 4GS7C 3FOLA 4XZUA 4PJIA 4HPOL 3DHUA 4KK9C 4MNQE 4WHCA 5EF1A 3B7YA 3IFOA 3QZPA 5F8RC 2DQJL 4AXWA 1U3HD 2NUTB 2OMYA 4X8XA 1ACYL 3HPJA 5LO7A 4OZFH 3E2HB 3EO0B 3PNRB 4UQDA 2ENQA 1NKRA 2YJQA 4WHYH 4F7MB 1RY7B 4NS0A 3QUYB 4ADIA 4AIZA 3GB7B 1XSIA 4PRNB 4U6YB 1AANA 4PRHA 3WS3A 1Z9SB 1HH6A 1QI5A 2VJ0A 3ZZLA 1KG0B 3BWAB 1HHJA 1TFPA 2G2NA 4N0YH 3E80A 5E1GA 1IGJA 3FO0L 2ZX8A 1QTSA 3IFNH 4R97C 1BF5A 4K7PX 1A02N 4WRLA 4JZOA 4XVJH 2IXQB 1KEMH 4WEEA 4P4KD 4DN4H 3MCLL 2OCCB 2JF1A 4IEFA 5HHOA 5AFAA 5F89B 5I76A 1AQDA 3DSNB 4PJAE 1OCWL 1BXUA 3RWGB 5F7KC 2NY7H 4M6MH 4RWHA 3S8FB 2PTVA 5T3XE 4LOEA 3X2QB 4M43L 1F6AA 1N4XH 3ARWA 4GRLA 5DRZA 5ESAB 1BEYH 3S37L 3UAJA 3IDXL 4CGTA 4Q4IA 2N0KA 1NCAH 2AXWA 3WMPA 2HLAB 1F41A 4ABQA 3C9NB 4O4YH 4WUUA 1EHKB 2NX5E 2QSQA 4JMNA 1OANA 4NIKB 4JB9H 1MNNA 4WI0B 1WFOA 4XMKH 3ZXAC 1MZYA 1VFAA 1MKFA 4MVBC 1BSIA 2I07A 2NY2B 5AL8A 3C12A 2YEVB 2W59A 1QTPA 4ICWA 2XWBB 1B0GB 1MCPH 4NC1C 5CIPB 3QJTB 4K4KA 4RISL 4GEJA 3ROOB 1T21A 2GK2A 3QO1A 2N01B 3B5TA 1AP2B 2AEIT 1GHFH 4IOIB 3UZEA 1AGFA 1UA3A 3UYOD 4E9LA 3VFOB 3V0VB 3TO4A 5E4OA 2G75A 2ILLA 2VN7A 1NBZA 4OCRH 1U0QA 3O41B 3E3QE 3Q1SL 3ZK0A 3ATAA 2ITCB 5DHVH 2HKFL 5D1QD 2WCSA 3IMBA 1TYRA 4PTUA 4FGMA 3ZE1F 4OB5H 3H9HA 1KELL 5HHQB 3OVUB 5ILTH 4JG5A 1ZHBB 3CN1A 5J13C 1CYWA 4O5LH 4KQ0A 5FYJU 2PNDA 3OAZK 1NC4B 3GMLA 5MEOA 1HXMA 3QDMA 5D1ZC 3WGUB 4EBQL 1HS6A 5BO1L 3FQXB 4EQ2A 4HUVA 4FCHA 5MERA 3RGBA 4FG4A 5ICXA 1H5BC 1I1AB 2H9GB 3G5XB 1EBAA 4LRIA 1ORQA 2YRZA 3KGRA 3WENA 3H3KA 3FHQA 4EI6B 3MRNB 5JMRA 5DHMC 5DI8A 1PKQE 3BFQG 3FRPG 4DZBA 3M1CA 7TAAA 1QAWA 1XXDC 1N0XL 2Y3NA 3MYZA 3OGCA 1WDAA 1HI6A 3KPRA 5B8CB 1E4HA 3Q43A 4IGBD 3TTYA 4HCRH 4GG6E 3CUPB 5EC2A 1V54B 3SKOA 1ZT1B 5F9DC 3PQYD 3ZKMC 1AR1C 4XMLH 5ALCH 1NANI 5EFIB 1PZSA 4PG9A 1UWXK 1TQCB 5L2KA 2BSSA 1U8MA 4BWTA 3CVIH 1KGJA 4IU2A 4LL9A 5DWPA 3RWCB 4YSRA 5I66B 1G9ML 3T4YA 4Q2ZB 3LPWA 2AI0L 4PS8A 4M4RB 3HZYB 1OCOB 1RH8A 5KZCB 5E6ID 3VFUA 5CEXA 4X6DA 3BQUC 4J6RL 5ABDE 3IJYB 3VD5A 4KO7A 4FQXD 1S5HB 5DGQA 1MFBL 3UTQB 4JPKL 4H1LA 4JRXA 3QIUD 4U1GC 1W8EA 4KK5C 1R75A 3LB6D 5TF1L 4YAQA 4J4PA 1MI5B 2D3VA 3GBNH 4YC2B 3ZDYB 4NZJA 1FZOB 1I9IH 2V7NA 5FCUL 4LSPL 1V7MH 1GGIH 1A7NL 3N1GC 4N24A 1RVFL 5IV2B 4JFEE 3W11C 4HCGA 1IEBA 1ZIAA 3WIFB 3RWIA 4F92B 4DGIL 3NRQA 3V6ZB 4FDWA 5E9NA 1NDMB 2KUTA 4GMSL 5CMAA 4XPAL 4YGVA 5FUZH 2PR9A 1E40A 3LQZB 4LDEB 3TXAA 3AQDA 1NUNB 1SBSH 3SEPA 4AMKL 4CSTA 3ETSA 1E9PA 3FJTA 5EOCL 3UJTH 4QOKB 2OSWA 4KKRA 4QCIB 4WEUD 4NYLB 5IW6A 1HXYB 3Q6GH 1AI1H 3ABLB 2K45A 3D48R 4LOUC 3GRGA 5I8CB 3QQ3B 5C0RL 5IWLA 1HE7A 3LH2L 2PYED 1CBVL 3KAAA 3B2MA 5K9JL 4KI5F 4M48L 1FRGL 2QVFB 2VLJA 3WIIL 5DJ2A 1MFAL 4PJ7B 3EFDH 4HK3J 1FE8H 3JV6B 4K5PA 5EN2B 3TIEB 2DKMA 4BZ1L 1K85A 4KJYA 2R2EA 2R1YA 4FMVA 3TH3T 3OJVC 5A3IC 3HE6C 2GI7A 5HYJD 1CZ8H 3FN9A 4IBSA 1C5DB 4ELKB 3NIFB 4B5ZA 4YGAB 3HRPA 4HFUH 2C3VB 3VWJC 4LPVA 4JLRB 4JQVC 3ZE0F 3UO1H 2AVFA 1RLBA 4PRDB 1TENA 4LIQE 4H1LG 3TA3C 4YDZA 2OR9L 5GS0D 3SE6A 4QUOA 2IWGA 1YYML 5DFVD 3VYNA 5LDSA 4TL4A 4HOMA 5F6HJ 1FIEA 1F8TL 1N0LB 2XN9D 3I3DA 5L0QB 4K3EH 4YZFF 4HIQA 1DSFL 3IDYC 3RFZA 4H88H 4QHMA 1GJIA 2V5TA 4OZIE 4JRYA 3UERA 1G9NC 4LF3A 4UAOB 1E4XL 4R0LC 5CKGA 5E1AA 1IFRA 2PW2B 1S9KC 1NAML 2V17H 1C5BH 4M4PA 4CKQA 1L9PA 1BVLA 1CLZH 3V6OE 4PMEA 4Y9CA 4YHPB 2QV2A 2X2UA 1BD2B 2E4TA 3H9SE 2HLEB 5FK9A 3N06B 2IO5A 5EUOA 1UFGA 1DBJL 2XDHA 4W9JC 3GLAA 3NFNA 2X9WA 5CJOH 2X6BA 1UOLA 5KS9F 4HQQH 3HG1B 4HF5H 1UD5A 5EO1A 2H7WA 3ZDXB 1AXTL 3CK0L 5DVMA 3BJLA 4GAFB 2OXHA 3BDYL 3VD4A 2FO4A 5F6IC 4FHBD 3JTBA 4LDCA 5AKRA 1QWHA 4PREB 5HGAA 6CGTA 1FAIH 4PY7A 3IJSA 4YK4B 3DGCR 4KZEL 4OGAC 4QF1A 3EH1A 3QIBD 3QWQB 3FRUB 4PJ8B 1AD0A 5LCVH 2WLZA 3NN8B 2DQ6A 4YSOA 2WCGA 4U7SA 1PG7X 5T1DL 4PFEA 1AKJA 2I24N 3UJIL 2VXQL 1G1YA 3BD4A 4P5TA 1XWVA 4GSDL 4ZSOA 4YSPA 4JM4L 4OFQA 3ZO9A 1MY5A 1I1FB 3MO1A 2VITB 1CFNB 1NBYB 2NY1C 2DOCA 1DEDA 4Y8DC 4DEWA 2YGNA 1S7SA 3D3VE 5JDSB 2YD5A 4HISA 3L3OA 3VFGH 5DVLA 3BFOA 4XE5B 2XVBA 5FM5M 2DBJA 5J7CC 1GJWA 3HR5A 4NKIL 2YLKA 3TN0A 3ZRCC 5K9OA 3MA7B 3EGDB 4IBTA 4G8IA 1QVOA 2WAHA 1SHXA 3VD9A 5DLML 3UPCA 3HZVB 3DO7A 3AS2A 5E2UL 4QHPA 3IGLA 4QRUA 1ZCRA 4OGZA 4N5UA 3TIDA 2UZXB 1FLRH 2JLPA 2N56A 5KJRH 4YE0A 5DCCA 3ZTNH 2YQBA 4KKAC 1KV7A 1BIIB 2R27A 2WBKA 4GRMA 5HHVH 2WZ5A 2E3VA 4Z3FA 2YRBA 4PJ5D 1UQSA 5KYNA 1P9MC 1XB6A 2DYPB 3G5WA 4UIKH 3N41F 1BQSA 2EH7L 3ULVE 5CJXA 4XCEA 3CDZA 1OKEA 1E2VA 4I0KA 5JLZB 3BPLC 4XO4A 3GMQA 4JN1H 4JHVA 1Q94B 5CZVH 4WLCA 1IQDA 4Z0XB 3UAFA 3WKML 1I9JH 3NG5A 2LVEA 1JF1B 1JWMA 3I6KA 5AVSB 1P2CB 2DMCA 3ZUCA 1OK0A 1WTLA 5GIRB 3UJJH 2P5EA 4N1HB 1SDDB 2VSDA 2CBPA 3TESA 2XY2A 3KLAA 3A4FA 1GC1C 4LLWA 4BXSV 1E3FA 3CFEA 3SKNA 4OIAA 1E28B 1ZOXA 4QRPA 2VDKB 1NWOA 3L3IA 4K5OA 3ARGC 3ASWA 4GYBA 5SWSA 2V3DA 4YX2H 5D7JD 3BEVA 3BH9A 2BVPB 4FXGC 4MNQB 1IC5L 4MA1C 5TGBB 3T4AA 3TBBA 5CFHA 5F7LB 4OKDA 3W0WA 5E9DD 4JL1A 4QTIL 4XMTA 2J5WA 4XP1L 4A04A 4JO1L 4QDGA 3SPHA 3IBOA 3EJSA 4OCXL 4LHUA 4V2CB 1UGNA 4Y5XB 5D7SL 4EUPA 5EOTA 4QRRE 2OAAA 1GYAA 3ZMEA 4LLYB 4QT5A 1JK9A 1IZKA 2IVFC 2RJMA 4PJCE 3C60D 1P4LA 2E27H 1J48A 3PLYA 1QFUL 1Z9MA 4OQ1A 2CKBL 1KZYA 1QEXA 1QRNE 1XH3A 2VR4A 1I7TB 1OGPA 1HCYA 4LDLB 1TTRA 5A16A 2HFTA 1F90L 1INQB 1VGEL 1S7XA 5ICZB 4PJAB 2G60H 2AQNA 3GS4A 2XY1A 3FMGL 3SGKC 3MMEA 4XOEA 1CVSC 1ESOA 3KBHE 4QRAA 3VNYA 5I2IB 1PJWA 1AQKL 3CVHB 1JGUH 5BQ7B 3CZNA 5IBTL 4AIEA 3GMMB 1DR9A 2EJ1A 2XN0A 2A38A 3MRPB 2Z35B 4X9FA 2PXYA 4ZMXA 3SYQA 1MCQA 4Z18A 2ZKMX 1EVTC 4LSUL 5HDBE 1EJOL 4PR5B 2X4UB 3SB3A 3MRHB 3DUSB 2IAND 3VXQB 1ZHNA 2OI9C 4LSTL 1T0MA 3ARBC 4NEHB 4U0RC 4YVUA 1PDKB 2H47C 3FFOA 3PY9A 1HEZB 4X7TB 2Q8AH 3V5DB 2NY6D 4OBSA 3VD7A 5I1JH 1DEEB 5F97E 3B7RL 4WIQA 4OKVA 2Y36H 5FW8A 4PB0L 1A9EA 3BX7C 2NLJA 3J8F7 3TEUA 3P0GB 1G7MA 1UXSA 3HRZC 4ZUWA 3UP6A 2MQGA 5KVEE 2VTFA 3I2CL 3RAJL 3GF8A 1ES0B 1MFCH 3D07A 4YDLC 4XI5D 1REIA 3ARXA 2IEPA 3KW8A 4LHUG 4EUPG 5IKCA 4K0OA 1JMZA 3THMH 2DJSA 4KKLD 5BS0B 3L6FB 4ZXBB 4PGBA 3CVHH 1B90A 2YPLE 4X9HA 1P7QB 1MEXL 1LEKB 4UNUA 2ZD0A 1WPCA 5C2UB 4HEPA 3L7EA 5BQDA 2WPGA 3KLQA 3U7WL 5CAYB 6FABL 3SCMA 4PRPB 2X70B 1FFPB 2FQEA 1NIDA 5AYUH 1XCTB 2HTLD 2JTDA 4S10A 2AK4A 2BVEA 1D6VH 3QQXA 3FFDB 4U1NA 4ESKA 3MGTB 3WTXA 3D69A 2NW3B 3BLPX 1MCIA 5CLTA 2VW4A 2W60B 1JZHA 1CDJA 3UTSD 3UTZB 3JZYA 5DA0B 1ZSDB 2Y22A 4OSUL 4NP9A 1BF2A 1VESA 2NUTA 2P42B 3ULSA 1R24A 2GBUA 4Y2OB 1LO0H 4F2EA 1NCDL 5B39G 2Q20A 1KGWA 1UFUA 5J6SA 5FYJH 2MMXA 4O02B 1PKQB 3QUYA 5IQ7L 4KPHH 5KSBF 3TWCH 5DD5L 3PAVA 5LGYA 2IFGA 1OAKH 1VZGA 5I6XB 1KG0A 3BWAA 4GG6B 3CNKA 4XMXA 1SLWA 2EDWA 3BO8B 1QPXA 1OSYA 4HK0B 2VLKE 2FIRT 4MQSB 3K2KA 2ICWB 5KTEL 3GTTA 4HH8A 4P5MB 4OZFG 1BMZA 4PI0A 3WFCL 5J1TC 4EPSA 2ZAIA 1AZBA 2W94A 4WHYG 4B7LA 3HLKA 5J6HB 1NCOA 2JIXB 3I9GH 5F93C 2L04A 3B2VH 1X4YA 5K1VA 1UZGA 2EO7A 2WM0A 4LVHB 5JXAH 4TTDD 4HHAB 3S9DB 3WJJC 2YXVA 3EUDA 5L88H 4OZ4A 2DJMA 3CZGA 3GKWL 4L1LA 1OAJA 1URIA 4G6ML 2FYVA 1HWGB 3G9AB 5DHVA 3WLBB 5ACLA 4JJHA 4UILH 4O02H 4JY5L 4MWFA 2CRIA 1D5IH 5LAXA 4HUKB 4APXA 1PU0A 4B9YA 1TJGL 4LBAA 3EYOB 3AQZA 1CFVH 4UB0H 1YNLL 3K72B 3O2VL 2O4EA 3LH9A 3O3BA 1WCQA 4M3KB 4ADJA 4QXGH 2DLGA 3K3QA 2V5YA 1DJZA 2BZDA 1WFUA 1U8IB 4L37A 4UU9A 4XC1L 4FQHB 3UZVB 3RP1A 4WW2A 3JWNC 5DQDL 4G8EB 3H4HA 5CU9A 2P3YA 2HUHA 1MIML 1IC4H 4X7EC 4IOIA 1CD9B 1QW9A 5C0AB 4NRZA 2XWCA 4OZHF 3L1EA 4JPWL 3V0VA 3DV6A 2DL9A 3OBAA 1IM3B 1MIEH 4JM2B 7CGTA 3CFBB 4HCRA 3S2CA 1A3QA 2WO4A 2WOYA 2ZCLL 3OLDA 2J72A 2EDQA 4JO3H 4OCYH 4JDTH 1LEIA 5H35B 2H1PL 4AM0Q 1BAFH 2MH4A 2R9HC 1NJ9B 8FABA 2FAUA 2AMGA 4BSVB 3HAEB 4PV8B 4YSUA 4L1HA 5HHQA 1AGBA 4ZFFB 1I8MB 4IS6A 1NCHA 2IMNA 1A3RL 4Q6IC 2C9UA 5T3ZD 3VRLE 2WC7A 1CN4A 4UT6H 2GSGB 4A7VA 3Q8FA 3AG3B 3WNOA 1B3JA 1RLWA 1JXDA 4FQCL 2Y5EA 3HHSB 3DROB 4G8AC 1QSED 3U25A 3ZIYA 3G5XA 1U3HB 2RMNA 2XWZA 3VD1A 1S78C 2OQJA 3QNXB 4WUKH 5EWIH 1QUPA 5JPNC 3QRLA 3FH8A 3QXUA 2NY0D 1QMUA 4G72B 4JUSA 1JWSA 2ENSA 3KYKH 3MJ6A 1INDH 1D2OA 4DUWA 4FMKA 1GZQA 4B9FA 3PXLA 3VXUB 1DQTA 3LN4B 1SMAA 4AEHL 2A4ZA 3LNDA 4AI7A 3NIGE 5F1SA 1U4EA 1X9UA 2DQDL 4MASA 4IRJD 2ZYRA 4BKTC 4OZIB 2MKWA 3A0OA 4DQAA 3CC5A 1NMBL 4MMXC 1GPOL 3NCWA 4KMLB 4LEXH 1WGVA 3JYBA 2OMZB 3BWUC 1RPQA 3Q3GB 4H20H 4XNZC 3C75A 1NEPA 4HUWA 1XIWC 2PETA 5CBEA 5EU6E 1P6AB 2YPVL 3MV7A 4ODHH 5I66A 4TLSA 1A6PA 5JHDE 2OPCA 3BESR 4CGUB 1HEJC 4AYID 1XF2B 1QLFA 5FB8B 3HZYA 2A74A 1YY8B 3K6NA 4UM8A 5TE4L 3UYRL 1P5UC 4LIQH 3IJYA 3CG8A 1Q9WA 2WQ8A 5EHFA 3I85A 1G7QB 5ENWA 2H32H 4XN1A 3BKCL 5DZPA 5GJTL 4G7QB 2EDKA 3UTQA 2J73A 1JFHA 3CFDA 3TM6A 3RNQB 2RQ8A 4JRWA 4R9HA 3REWA 1BMWA 1KELH 1FZOA 3ABKB 3FN3A 5FKAA 5DJDB 3CSGA 3RA7L 4NUMA 4ELDA 4NHUA 4L1BA 4KNTA 5SWQB 1G7PB 3F64A 3V6ZA 1OGTA 1KXTB 3K2UH 3A4AA 4GKZB 4K23L 4AYFA 2EDJA 2AJSL 3OXRA 3D0AA 1WAAE 2IQAB 3LQZA 2F54B 4OLUL 1IM9A 4CDHA 4L0YA 5IQNA 4GP4B 4DESA 1YEHH 4NYLA 5DTFB 4AY0A 3J2PA 3M17A 3WKYA 3LEXB 5CEYB 1Z0MA 2FJGA 1A9BB 3QQ3A 4N2LA 3UBXA 3K81A 1CF1A 4IMLB 1FP5A 3IU3A 4NUGH 5DO8A 1KENL 4XBGA 4GLRH 1R17A 4FQLH 5TPWH 5HDQL 3UIYA 1CGTA 4QHNA 3KYNB 1P69B 1A14L 1RERA 2DKSA 3G08B 3RTQB 3QIWB 2XTJD 1HHHB 3D25B 4KXDA 4AENB 4UQEA 1DVZA 1S7VB 2K8MA 2R23A 4NFDA 1ZA6B 2OKMA 3K7UA 3BN9C 1C5DA 4IDJL 1B9ZA 5AZ2L 5BJTB 1P53A 4Z7NF 4OV6F 3U7AA 5MEND 3L45A 1J11A 4KMTH 5IREA 1ZV9A 2C3VA 4TRPL 1KBWA 3UH8A 1JGDB 4Y9EA 4QWWD 5E23A 2X12A 4RFEB 1B4JL 5I15H 3CDYA 1G7JB 1RUKH 4DQOL 3UTPE 4KVCH 3BAIA 1GH7A 5AW7B 1A9VA 4PJ9B 5AENA 4XB8A 3MCKB 1OT4A 4N2HA 1EXGA 2EH8L 3L54A 2X4RB 3SKJL 3QFJD 1N0LA 2SODB 2XV6B 3IDMB 2R4SH 4HKJB 1E4KC 3GXTA 3DYOA 3O4LB 5DD6A 1KLFA 5CU5A 1EO7A 2EADA 2HJLB 2ZCZA 3IMTA 4JR9H 4JHAH 4I13B 2H3KA 2HKHL 1V7NL 3KWVA 2AQTA 1U3NA 3VG9B 2IH9A 1BA9A 3UDWC 4F20A 2XKNB 2ZCHL 4DGIH 2DM3A 5IB4B 4AV0A 4RA3A 5DEJA 1MFNA 1TJXA 4TQIA 5EEXA 5D72L 5J3HC 1U6AH 1MJUH 4TULH 3RIFF 3TYFB 1FL6A 4EN3B 2H26B 4IW4C 3UBXG 5IK3B 3ULVH 1GAFL 3GSQB 2L8AA 1P4BL 2VMCA 2ZP8A 2X4OA 5JOEA 4AQ8C 2BY0A 3H7BA 1OAYL 1G1KA 3KJ4C 4DKDC 1CR9L 5BVPH 2B5IC 3AITA 1M7IA 1W15A 2CLVB 4Y4HD 3KS0J 3BVTA 1WICA 4PREA 1X9RA 3QR1A 1QRNB 2NQDA 2OBGA 3D05A 3GK8H 5FM8A 3WFZA 1TVHA 4D0BA 5C2BH 1OAZH 5JPMB 2XCMC 3FRUA 3NN8A 2HG5A 5EUKB 1EPFA 5C0BA 4AC4A 4APQD 4BZ1H 1NAMB 3Q8CA 3CIAA 2XG4A 4XT1C 3T71A 4FA6A 4OZGF 3TJHC 5CEZL 2W95A 2Y7OA 3QDGE 3QORC 5LGHH 4EMZA 2BVOA 4KKBC 1ZLDA 4Y1AE 4TNGA 3RWHA 3WFDL 1ZA3B 5D1XA 5GGVH 2AK1L 3S36H 2IG2H 3QCUH 5D1ZI 2HZHA 4Y88A 2D03H 3MRKB 1EGJH 3MA7A 3OAYH 2OP4L 4X2UA 1B6DA 1B2WL 2X4QB 1T3FB 4H0HB 1NCGA 1AHKA 3HZVA 3U1SL 3RKDD 3IDNB 5E8EA 4G6KL 2CPCA 4RMUA 1SM3L 3OX8A 4GSQA 3LXBA 2AQ1A 4TVSa 4GMTH 3RDTB 3UAJC 3AS0A 1YJDH 3MLVL 2F18A 2E6QA 3UAEA 4EI5B 1BHGA 1A7OL 3MBXH 1JCVA 3OKLA 1ZSHA 4IM8A 4I3SH 2GPZA 2XN1A 1BAGA 1A25A 4BINA 5DJ6A 4U49A 2WBWB 2YQ3A 4ANKA 3QUKB 5A6MA 1M05B 4JZNA 4TVPD 4FL4C 4JDEA 3N1PC 3SSGA 2JVUA 1RZIA 4ZMYA 4ZYKA 3QRGH 2CAKA 3QDJA 4ZD3L 2MTPA 1RFDH 1XBDA 2E59A 1U42A 1OD9A 2YPLB 4HIXH 4LHJB 43CAB 3H4FA 1ZJAA 2ZOKB 1O7VA 5JW3L 1UD8A 3LKNA 4L8CB 4TQ8A 4NERA 1WCBB 5I71C 1AXSB 4CU8A 1P2CA 3O11B 1NC2D 3SOTA 4E5XA 1JNNL 4JL2A 1DANT 1SDDA 1HKLL 2B14A 4C4UA 2ID5A 1CWVA 5IJDC 2GTQA 5KG9A 4JFHD 3WO4B 4HLZH 4I3RL 1V10A 3ROLB 4MCMA 2C8NA 4P3DA 3KLHC 2JE8A 3MA9H 4QYOB 3UZEC 1OAXH 3DXAB 3NCJL 3U0PA 3OG4B 5FF6A 3MLUH 4Q14A 5T1DH 5HVGB 1GZPA 5EOQL 2B1OA 4L8DB 5DZNA 4P2OA 5C92A 5T33L 2JQMA 4GQPH 3H1ZA 3BJ91 1CK0H 4XPGL 2BVPA 5KVEH 4MNQA 3HUJB 4JFFD 1FYTE 3MRMA 2NY5C 1R3JB 2GC7C 4K55A 4V33A 5I8EA 5C0CE 2ZWSA 4LLQA 5L4MA 3GS0A 3QR0A 1N8OE 3MCG1 4YBQD 5AKTA 3CZEA 4KKPA 4F58L 3ZSTA 5GPRA 2UWEE 1QSFE 2OJZH 4JFZL 4NAJA 4E9WA 3TZVC 2ZXEB 3TVMB 3C8DA 1BDYA 1YN6B 4H25B 4LCWD 5HI4D 3C5ZD 2G3XA 43C9A 3H42L 5PAZA 3BT2H 5EU3A 4FX5A 5J0BA 2HVKB 1A6ZA 4KJQD 5DMKA 1INQA 4PB9H 1DVQA 3QULA 1E4JA 3MOQA 4PJAA 4XNAA 5AB0A 2VKWA 1U8PB 4EO5A 4J3XA 3FB5A 4YSDA 3MRGA 3CFTA 3CVHA 2FIKB 3STLA 2NPLX 2Y1ZA 3B37A 3T6VA 1TOXA 2NZ9C 3X11B 1ETJA 2Z35A 4NENB 4F2ME 4LE8A 4R4FH 5IY5B 4E5XG 4HAFA 4O2FB 1YEKH 3WY1A 1TVBB 4N20A 2IQ9H 4HEME 4TVPL 4HJ1A 1YEGH 3N40P 3QFDA 3U1QA 1BXAA 3N0AA 4LU5L 3SDAC 5KSAB 3MRHA 1CDUA 1FJ1B 2CKBB 2GJJA 4HKZB 2NX5A 1W8OA 2WKGA 4JZJB 4MS8C 5DO2D 5JUEL 4Q9QH 1Z3GH 4ODWB 4XNYH 1PDKA 1IBZA 1WIUA 3V5DA 3IVKB 3CLWA 2OSYA 1DEEA 1XF3A 4D9RD 2LR4A 3GINA 5E99H 5HI3D 2WLMA 1T5KA 4HS8L 4I2XE 3DYMA 3GSWB 2E4FA 1L0PA 1TCRB 5B3JE 3BWUF 2XPZA 2P24A 1ES0A 4NKQB 4ZTPL 3ZBMA 4A7QA 3MLTB 3R8BB 1I7UB 2WWMD 5FLVA 1PY4A 1NSNH 3V4VH 3GBML 4YXHL 4XWOD 3L6FA 3DMMA 2DH3A 2CCLA 2PP7A 3LPPA 1VFUA 3IJ8A 1MVYA 4UM9D 3DRQB 3DJSA 3MACL 3QZWA 1Y07A 4KI5D 4RAVB 3PPSA 1LEKA 1CL7H 1J8HE 5E6SB 2RR3A 3PJSB 1RZKH 5IQOA 1M3IA 5IB5B 2QDVA 2AEPL 1YEJL 4D2NA 2HJKA 2V5SA 3GSNH 2ZXGA 4B41A 5AVVB 2CK0L 1G4RA 2ZYHA 2OL3L 2N3JA 1XEUA 2FX9L 1BX2B 4V2BA 3H6JA 5JIQA 3FTSA 4ZMAT 3UG3A 3T0EC 4BSJA 4TLKA 2NW3A 3O9WB 3SE9H 3O6MH 3OJ2C 1EZLA 1H8SA 1ZSDA 3SDCA 1FPTL 2EABA 1HKFA 2CA3A 4Z77B 4P5KB 1FCCA 2AC0A 2AHIA 5LB1A 5E9DB 2HT2C 1SJHB 4WJG3 3ULUC 2ZYSA 4O02A 1EMTH 2WMPA 1PKQA 5F96H 4N3UA 4OQTL 2PPAA 4QRTA 4XZ4A 2DWDA 4OD1H 5K33A 1MRCL 4OF6A 1IGYB 3WAJA 4ECNA 3MLRH 4XB3A 4F9LC 4GG6A 1AHWA 3BP5A 3C60B 4MAYB 5FR3A 4JO2L 4DGYH 2ICWA 4R2GB 4PCKA 1J8RA 4LSRL 2C4FT 3K5SA 1U8CB 2NYYD 1MF2L 4MCZA 3U9UB 5EC1B 5KVGL 1IIIA 1SDYA 2VIRA 4PUBH 5G4OA 5PCYA 5IMOB 1IZJA 2FYYA 4WTXA 5CZRA 5EU6B 5I5MA 3I75A 5FC9A 3VXNA 5JHDB 3QZWG 2VH5L 4E9SA 4YMPA 3RFZC 1FNSH 4DEPB 2OMBA 4WV1B 1W72H 2EDMA 1R5VA 4A2MA 5IUSA 4OUUA 5DZVA 3UC2A 4TN9A 1NAKH 4AITA 1JV2B 4P2QE 2A6JB 1SFHA 12E8L 4FA8A 2IALA 2F1BA 1L7TH 2CO1A 3QPKA 5IB1A 1DQLH 4D0CB 4KUZH 3MV9D 4K07A 3QNZB 4M1GL 3MBEB 1WZKA 3LZRA 5LKNA 4KK9D 5D96C 6PCYA 4PS4H 4JFEA 3K72A 3TV3L 4UT6A 1KIQB 4NUJB 3UZVA 1U8IA 1BZ7B 4TKWA 2XVGA 1CDHA 4RGNC 4X5WA 1R3IH 4PJFE 4G8EA 1JK8B 4YHYB 1AHMA 2X0WA 1J9CT 3P11L 3WTVA 3K1DA 1PSKH 3A24A 4WFFE 1KGUA 1KPUB 4NUQA 2WTPA 4R90H 3GO1H 4XNQB 1NFIB 2LT9A 1R33A 4R4NC 5L4JA 2VUOA 3LNFA 4P5TC 4PLKC 3IBEA 1IM3A 4JM2A 1KIUB 3CFBA 4G8GD 4PJIF 2F8OA 1HIMH 2X1OA 2ZX9A 3T9WA 5J56B 2ICEB 4KMQA 4V1DD 4ZOBA 1TZHB 4NNYB 4A7TA 1KXQE 1NJ9A 5JOFB 5ISZE 5LGJB 1TQBC 4TNVF 3F85A 4P23A 4XTRC 2VR8A 2JMRA 1J9TA 3HAEA 4PV8A 1IJ9A 3HG3A 4YDIL 3TN0C 4ZFFA 1I8MA 4KROC 1KGYE 5F1OB 3ESMA 3TV8A 3S3BB 2D7TH 2Z8WC 2F53E 4JN2A 1T83A 4E41E 3QE5A 4JGMA 5IB3A 1CD1B 4WKZB 1SVCP 2YA1A 3EIFA 3L2NA 3UTSB 4Z7QB 4IBUA 3V4UL 3L5IA 4DPCX 5I6PA 2D0HA 2HP4A 2E7BA 1XGQA 2H32A 3WUWB 1HZHL 1FI8C 5HYSA 2NY3B 1C7TA 3AC0A 2XFXA 3FT2B 4MMZB 5AWNL 4KITB 1OLLA 4MVBD 1TSRA 2ZKHL 1M1XB 4QTHA 2VAAB 1JNLH 5CJXC 4HPYH 2ZONA 5JIPA 5I30H 4Y4FD 3LIZL 2EIZB 1XR8B 4IRZL 1GSKA 4JHUA 4OZIA 2X4NB 2DBLH 1BM7A 1Y0LB 2CXGA 3KE0A 2Y6TE 1NBQA 5F71A 3KJ6H 3QJHB 2G2RA 3S8GB 2HFEB 1T6VN 1WFTA 2DEYX 3HMXH 2EDDA 1RIHL 1OOAA 3V6OA 3C6LA 2N7BA 3DWTA 3EDJA 3H9SA 3QWRA 1FO0H 3T77A 5M94B 1WLHA 4Q9RL 2W0KA 4AQEB 1N6UA 3EJQA 3KPPB 4L4VD 1YMME 5HHXH 2YGPA 5CN2A 5FB8A 3UG4A 4HJSA 3BZEB 4FQ1L 3EH4B 1H8LA 2Z64C 4N2KA 2IH1B 3ZT5A 1BVKB 4ALAH 1G7QA 3T4AC 4N8CH 2YARA 4DF9A 5EPMB 5GJSL 3L9BA 1DLHB 3ARFC 3RNQA 2CDGA 4TNWF 4WWKA 1FZJB 4O58H 4XBEH 4C4KT 1U8OB 4O9HH 1GMIA 1RZ8B 1WRFA 4WENB 5DJDA 5TJWK 4N0RA 4FI8A 5K5YA 5HGBA 2BW4A 1JG9A 2BDNH 5D1ZD 4QXTB 3MJGX 4F37F 2P4AB 5SWQA 3DX6B 4XBPB 3LKRB 3W2DL 2WQUA 5BPPA 1DE4A 3VGDA 35C8L 4KJWC 4CJ0A 5IQ9B 2BVYA 3D3VA 2IQAA 4PYGA 5HYSG 4LBEA 5DQJB 2BNRD 4QHLB 1SXCA 1U8JA 3MREA 3ML9A 4P46C 4P2RE 2V5RA 1D7DA 2YBGA 5DTFA 2YSSB 4K2UH 1JV5B 5CEYA 1A9BA 4M7ZC 4EKJA 4F57H 3ZKMD 3INOA 1AR1D 4G1EB 3QDHA 4KRMB 4DVRH 3ZYIA 3MOBL 4WWNA 2RFXB 1EIBA 3KYNA 3II3A 4MSWB 1BLNB 4Z95L 1NUFA 3VXPB 3LZFH 4L3AA 3G08A 4DP2X 3OKMB 4EIUA 3G9VA 5IROA 4AENA 3B5GA 1CQKA 5B7FA 2WD0A 3ZHFA 5LBGA 1MHHA 3L3HB 2HRPH 2WZAA 1M57B 3U46B 3VXOB 1T4KB 2C3GA 2NR6D 3SDDD 5BJTA 1OSPH 5C8JB 2I5YH 3MNVA 1MCNA 1TJIH 2Z8SA 3FBKA 5GRYA 2KLTA 3G04A 3FQ2A 4Q56A 1JGDA 5JW5B 1MOEA 1N8ZB 1QWUA 4BE6A 3RL2B 4Z7WE 1G7JA 2MCAA 4DTGL 2EE2A 3WTYA 4IIQA 5E00A 4JFWA 4PJ9A 2YUXA 1QSEB 3MCKA 4KK5D 1FL3A 1U58A 2UXFA 3EH5B 1IKNA 5HP5A 2X4RA 5A6LA 4MHHG 1BAWA 3TO2B 4AYMC 2LW3A 1J0YA 2NY0B 4HKJA 2CCWA 3QB7C 1EXUA 3W11D 4BH7B 1TPXB 1YECL 4BZ1A 1KN4H 4KGLA 4R4BB 1G0DA 2BVQB 2HJLA 3OXSA 4A2HA 4FNLH 5EN3A 4JY6B 3L13A 4X6DF 5BV7L 4P06A 4RGMC 4RFNB 1E3ZA 4HWUA 4Z7AA 3DBSA 5IB4A 2VT0A 1FYTB 3MLXH 2YKKA 4P59H 3ZT6A 4AW7A 3KCPA 2V37A 4LPTA 1Z6JT 2AJYL 4U6XB 4AK2A 4EN3A 1S2EA 2H26A 4ODSL 2WUCH 4FP8H 1EGJA 2UWEB 1CB4A 4LOUD 1QSFB 2EIEA 4ZMPA 4L0ZA 2W07A 3VJ6A 3LNGA 4IHBA 1A6UH 5E0QA 4QRRA 2V8MA 4RZKA 4Q4EA 3QUXA 4PJCA 1HCFX 2CLVA 2F5BL 3X3FH 1AC6A 4ETYA 5AW2B 1ACXA 2VDRL 4NLAA 1QRNA 4LB8A 1X5AA 3E2HC 3HE6D 2IAAC 2R69L 2VDOL 1GZHA 5EUKA 1HINL 4FZ8L 1RUAH 3LIUA 1PLBA 3SO3B 5C1MB 3QUYC 5HD8C 2CO7A 5FA4B 1CDYA 1IVLA 2YAPA 3QI9B 4JFDE 4YE4H 3VAEA 3VWJD 1U95A 4HHWA 1NLBL 1UWEL 2OMTB 3CBRA 4QJ5B 5JIDA 5JW4M 4TOYH 1UXWB 4Y4KB 4KY1L 4PJBB 4Z7VB 1JTOA 1EA9C 3TA3D 1ORSA 3CHPA 5DR5L 5LN4A 5L8LB 4Z8FL 1ZA3A 2WLLB 3KWWA 3G6DH 1A2YB 1T7YA 4F2MB 4DQOH 3OPZL 5IESH 1BFOB 4JGJA 5KBDA 1L7IL 3EDKA 1CBJA 1UCBH 3GBDA 3HI5H 3MRKA 4FOMA 5F72S 5D5ME 4AG4H 4F2FA 2G5UA 3O6FA 3ZE2E 3UBHA 2JB5L 2WUBH 2X4QA 1T3FA 4NM8L 2J1ZA 3F5WB 4UIMA 5DFWH 5FHBL 3DJTA 3IDNA 1GS7A 4BRJA 1EEYA 1FH5L 4PJGE 3V95A 1PZ5B 1JUFB 4JREB 5F7MC 1HSBB 1FDLH 3RDTA 4X7SL 3B8SA 2O5ZH 3IU4H 1MUJB 2PWEA 4S1DC 3EYQC 2AJVL 2X4PB 1KBKA 2B4CL 4L5FH 1DVYA 2XFGB 2ZCHH 1UT9A 1M05A 4GUCA 3AG2B 3B2UC 4UT7H 5DT1L 4U4IA 1EAOA 3RRQA 1NCCH 4X0NA 1AMYA 3DURA 1OGSA 3KGUA 1FNGB 5MENB 3FONB 2VXTH 5JXEA 4W93A 2F1EA 1HH9B 1NGPH 1P4BH 5DQ9B 43CAA 2ZOKA 3TBYB 2VMFA 4YNYB 1OQOA 4HX1B 3FT3B 1CR9H 1WCBA 4PEEA 2CO3A 5G4MA 1AXSA 4NZUH 5KJ4A 4JVPA 2P7TB 3O11A 1NGZB 3K6SB 1CMOA 5I1AA 4AUYA 1AGDB 2J5LB 2RACA 1K3ZA 1QP1A 1FFOA 5EUOF 2VXSL 1Y7VA 4QYOA 2JV6A 2Q86A 2E75C 4XP6H 5KOVC 4QRQA 1WD9A 2NY1D 1R19A 4OF0A 4K7PH 4ONHA 2V2XB 1N59B 4JO5A 1K5NA 4OAWB 2E46A 1R3HA 4W9IC 1MCSA 1JGIA 4OFVA 1R3JA 1TU2A 1LE9A 2E6JA 4PBXA 5AAWA 2WXRA 3E8UL 4BZ2H 4HLZG 3TVMA 2X38A 4U1SA 3P9MA 1YN6A 3MNDA 2MQCA 4D3CH 3X1EA 1PZCA 2AS5M 3VW3H 1QPPA 3FUIA 4KX9A 3SYAA 2COQA 3NBNA 1K5WA 2P80D 3M1BB 3ARSA 4YHOL 4NO3A 5JW4N 4F8OA 2VLKA 15C8H 3TYGL 2IPTL 5E6ZA 4N26A 1I1AC 1O6TA 5MHSE 1IBFA 1B4RA 1VFOA 2WSPA 1YY9C 3OZLA 2CRMA 4TSBH 2YRPA 4PWIA 2Z0UA 5CUSH 2VL4A 3RU8L 5ITBH 3GMNA 4APQB 3GI8H 1U36A 3V4VA 3SODB 1XGZA 3VSQA 5EU5B 5I1CH 3BZ5A 1DVTA 2PYFB 4HFWB 4NQCB 3D39D 3VXSD 4KKQA 2GT9B 4LVOB 2GJ6D 2AXGB 3GZOA 3X11A 1F6LL 4DAGH 2X9ZA 3HZKB 5AZEH 2A6KB 1UADC 1Z0NA 1X7QA 2EYRB 2F61A 4PJDB 1RD6A 4UDUA 1TQCC 4J3OH 3RY6C 4K3JL 5I17B 5JYMA 5KSAA 3KM1A 5SWZB 1RIVL 3GSNA 3EG9B 4JZJA 4MNHA 1MLBB 2HKAA 4PWGA 4XCNB 4GI6A 4Y89A 3DPBA 4UOQA 3ARGD 3F7VB 3NFSL 4NFCA 3IVKA 32C2B 4P07A 4I1NB 5I1KH 2H3XC 3P0YL 1JPSH 4OD3L 2DQHH 2XA8L 4OT1L 3U0WH 2A73B 2ODIA 5LBVA 1EEUA 2I25N 3SJVE 1M2OA 2BP8A 4YQXH 1IGIL 2VSCA 1YMHB 3WO3B 2OLDA 5B7MA 1ZGLA 2CO2A 3MPCA 2Z9TA 4Z0BL 5C08E 5EF0A 3BZFA 2Q9OA 2ITDB 3FN0L 4WTZG 1I7UA 4UV4H 4NRXB 3F6JA 4GQ9L 2XZAH 4JKMA 4J3SA 2CMRL 5ID0B 2COVD 4UZSA 1OARL 4YC2C 4P9ML 2AQ2A 2R29H 3LHPH 3VMNA 4BEIA 3O6KL 2P1YA 3NJFA 1RSFA 2C1PB 4WAFA 4LRNL 5DRWA 3PWUB 3UZQA 2EXWC 4RAVA 3Q5TA 4X4ME 1XV8A 2FEJA 1ZHLA 2RCSL 1J8KA 3RUGF 1J5OL 2EDXA 3PJSA 3EZ8A 3IKCB 5IB5A 4D9LL 1RZFL 2G9HB 4GLRI 1U92B 2EVJA 5DK0B 3VXRE 5ISZB 3AAZB 1E9OA 4DGVL 1EQWA 1L3NA 3F65A 1NC2B 1U93B 2R1XA 2F74B 3F04A 1H19A 3WEOA 1EVUA 4J8RA 2EYTA 2JCCA 2QPDB 3MRIA 4MHHI 3MYJB 4EZJA 5AW3B 1NQBA 2EIBA 2F53B 3N42F 1KNOB 4YDVB 4JQXC 2KPWA 3ZR5A 1W72A 2MOQA 5E08L 3VI3B 3W39A 4XRCB 1NCWH 5H2BB 4Z77A 1A3LL 3CSYB 4JFFB 3PHQB 4P5KA 4KOCA 5D1QE 5BXFB 1GTFA 3GSRA 1SJHA 2K0RA 4QKTA 1KJ2H 4CJ1A 4CSSA 2ICCA 3W82A 1MW3A 2DDQL 3O0RH 1CFSB 2V0AA 5GZOC 5GS2D 2XC8A 4TUKH 3SGDI 2VR9A 2EQDA 5FUOL 3D09A 2OL3B 3RZWA 3QWOB 2XYBA 1FYHB 3LTVA 4KKNA 2QL1A 3WDJA 1Q9LA 4X4YB 3U9UA 5K93A 2G3MA 2M8XA 4D0DB 2P8LA 1UM5L 5K59E 5DD0H 3BP6A 3MRRB 5EU6A 3F83A 5L0QC 3QO0B 3C08H 3M07A 5TFSL 1VHPA 5JHDA 2QKSA 3TEWA 5I1LB 2QQNL 1XCWA 1YMMB 1T03L 4UTAL 3AREA 4UAOC 5FKPB 2CIIA 4JFSA 3SIKA 1MDAA 2EXTA 1SXZA 4JG0L 4LQ1A 5BVJA 3CSPA 1OHQA 4ZO6A 3R0MA 4WI9A 4KQ3H 2Z34A 4EF3A 2AEPH 1J1OH 4X99A 5HGDB 2M83A 3N04A 2O6FA 2XG5B 1IBGH 3HZMB 3IDIB 3QNZA 4BGLA 4G82A 2I60H 3MBEA 2YOAA 3PV6A 3KWXA 3VU1A 4TSAH 2IF7A 4G5ZL 2FATH 3OAYK 2ESVD 3IGUA 1BZQK 4MD0B 4MA3B 4BIKA 4NO0D 6TAAA 1MJ8L 2DQTL 2HRLA 5C7ZA 2UZYB 5T1JA 2CBQA 4O51B 1WAAA 2FRGP 4YK4C 3LV3A 5FW7A 1OALA 4L4TD 5GRVL 1M6UA 2WQAA 3WNPA 4PJ8C 2X6MA 3PWNB 4PP1C 3WXWL 3INUL 1C5CL 4AEIH 4P2RB 3NDZE 3ARUA 1R3KB 1YAZA 5CS7A 5D93B 4PGJA 1NCBL 4FC3E 1DANU 1ZPLA 2XPGB 5F0LB 1UVQB 4XXDB 4CA4A 4UM9B 2J4WL 4X80H 4ANXA 4Z78B 3RHWK 1TZHA 2A4EA 3B9EA 2FHCA 5LGJA 2NZ1A 2FD6L 5A6IA 2FZ3B 2BINA 3AG4B 3WEAA 2LFEA 4BFEA 3V4PH 3HMXA 5IHHA 1XF1A 2JJWA 2ZE0A 3CMOL 4XO3A 4D7BA 4E9VA 3PE9A 1U91B 2ZXDA 5I1GL 4TM9A 2XBDA 1FO0A 3BKJH 3VGBA 2W5PA 2QZ5A 3HC4H 3V6FB 1OTTD 1TZGL 3RVVC 1F13A 4NNPL 4OVVA 1NFDB 3L81A 1CD1A 1T1XA 4R7LA 1NPJA 1UD3A 2EEFA 4OLXL 4DZ8A 3RNKB 3QJUB 5FOBB 3R0NA 3V9EA 4MJIE 4MAUH 1SVBA 2ZSVA 1JRHH 4LFHD 2MJWA 3CN2A 1WUZA 3ALXA 1HILA 3RWEB 1A66A 1MAML 1CE6B 5KYYB 1YO4A 2A5UA 5E9AA 3QK0A 1MRFL 2Z93A 4GO8A 2L4OA 3V52H 4HDIB 3D2TA 5FFGA 3CAFA 2OMUB 4R96B 3CDGB 2YK1L 5IQLA 4KZ0A 4EOWH 5IMKA 5F3HA 3O3UN 5AAMA 5KBNC 3QJHA 2WQSA 2HFEA 3BKMH 3HVNA 1PG7H 3DI3B 3I6SA 4L3ED 2O5XL 1U8LA 4A6YH 1HL4A 3B3IB 5KVFL 4CMMA 1XH0A 3JTTB 3IJHA 4XNUL 4AQEA 1MLCA 3FAWA 3FUHA 1ODUA 4FNPA 1CDCA 2Y5TA 1ID5I 3HKZA 2AJXH 1X4XA 1SMDA 2ZAGA 2D9CA 4UWQB 2Y6SD 2IH1A 4K3GA 1FFNA 3EBIA 4UINL 4ABWA 2QTVA 1BVKA 2R9HD 2ROYA 3KHQA 1YZZA 3RBSA 4PLOB 5CM1A 4EVNA 2WV3A 2WHVA 4ILDA 3RIAK 1RK0A 4KDWA 5G4NA 4YXLL 2DLTA 2AANA 4I85A 3PFQA 3LSOB 1DL7H 3EOBA 2F7IA 2NXZB 1RZ8A 4ABVA 1WBZA 4Y5XC 2HAZA 3I02B 4I9WE 3D9AH 4JFDB 2ARJB 3MV9B 3VH8B 2H6PB 2YR3A 5EZIH 1PLCA 2FGWH 2ZCKH 4BFBD 4U7KA 3CQQA 4Y2LA 2R0WH 2FEEI 3QDGA 3IJEB 5DMIL 2FQDA 2NTFB 5BRZE 5IQ9A 2HN7A 1PY0A 4Y1AA 2YD8A 1T22B 5D9SA 5T1KB 2EDTA 3CX5K 1QI3A 1H8OA 1W0WA 4NB7A 3U6RB 5L2JA 2CJUH 4QHLA 1EANA 5I6NA 5FO8A 1PZAA 2YSSA 5EORH 4YHKL 2ZX7A 3Q44A 4AM0A 5D7KD 5T1LB 4B9PA 5KEZA 3UPRB 4ODVL 1AFVH 3D34A 4BH8A 4LEOB 1OB1B 2HJFA 5H94B 4W68A 4OF8A 4HBQA 3WFEL 2Y3AA 3BUPA 4L3FA 2NYZA 1QNZL 4IJTA 3OKMA 4IRZH 1D5RA 4IYKA 4Y9GA 1DBML 4TQPA 4OFDA 2O6PA 3HS0A 4RGOL 4JKLA 4F7PA 1G5GA 3DX9A 1KLGB 2KQMA 2JLLA 1N8ZA 1HK6A 4KH9A 4L2YA 4Y19E 3F58L 2I9LB 2CH8A 3P3YA 4JAMB 3QJFB 3UMTA 3T2NL 1TZAA 1BQHA 1KN2L 5GGRB 1Q9OA 3OKNB 3FTUA 3SDXE 4MBRA 3H3PH 5IJKA 3BGMB 1LP9E 5E2JA 4ZBJA 4MJ6A 5KYWB 3S5LG 4PJ5E 4BH7A 1LO2H 3JWOH 4ZXBC 3T8XB 3TT3L 4R4BA 2MFNA 2BVQA 5JW4R 1CICB 2VWEC 3S3SA 4JY6A 5GISH 3BVDB 4YFDB 4JGUA 1ILUA 4H44C 3KDMA 3MUZ1 4Y4FB 3E3QC 2YWZA 5AG9A 4DEUA 5DEFA 4K8RL 1FYTA 1LO5B 5C0CA 1GIGH 4N9OB 4K71B 4MQTB 4U6XA 5HVWA 2A6DB 2WLHA 3ZDYF 3X14B 2UWEA 3DOSA 4PRID 3VXMD 2OSLB 5AVZB 4YS4A 3HA0A 4YPGB 1J1XL 3HPLB 1QFWI 5DZAA 5AZUA 1TQVA 1WHOA 3I6GB 3FQNB 1D5MA 1UA6L 2DTML 4S1QH 2VXUL 3HI6L 3W9EA 1XD0A 1Z9PA 3BKYL 3QXTA 5DJAB 3LS5H 4AL8H 5BV7B 3CLFL 4RMBA 1ILSA 1K6QL 3NA9H 4HXBH 5B38B 5EEZA 4MB3A 2Y5QA 2NNFA 5TDPA 4EZKA 3DJ9A 5FA4A 3QI9A 2XV2A 3QQ9C 4RRPG 2OMTA 2X6UA 5M7QA 2VLRE 2JKIS 4F1SA 2R83A 1AJ7H 4MX7A 1RJZA 1NM4A 1IGFL 1IILE 1KLUB 1BQHG 1BZ9B 4WVRA 1A2YA 2P5WE 4PJ7F 3RI5F 4PAZA 1XGTB 4F2MA 4LCYB 1MCCA 3U4BL 2NT1A 4X4XB 4HEMA 2BNRB 2DM4A 2VDRB 3D2UD 1TQSA 3QEGH 3NIFF 1EEQA 1PAZA 3WEMA 5C3IA 4L4JA 2VDOB 4LVHC 4MDRA 1R5WA 3L3DA 2J7LA 3A67H 3UYPA 3PGCA 4BKLB 2NNAA 1PZ5A 1G7HB 1JUFA 3P02A 5DFAA 1CFBA 1IIKA 3LPFA 1Q72L 2DYRB 3SJVB 4I2XA 4NQEE 4ZS6C 1V55B 4H5SA 3SZ6A 5J3HD 2VSKB 1WA0X 1O6VA 4KTDL 2X0VA 3EOTL 5BZDB 2Z91B 4NLHA 1DVFA 2NOYA 3SDDB 1ONQB 4FULA 3BVUA 4WI7A 4XAWH 1HNYA 3RGVB 4BZ2A 3O81A 3FONA 4U1LB 1WTGT 3FTGA 3SD5A 4EIGB 5EO9B 5EZLB 1N5YH 4TQHA 5AVYB 5KVMC 3TBYA 4HX1A 2Y23A 3FT3A 3IEAA 1J8HA 3O6LL 3WN6A 1SEQL 3TGXA 4UZUA 2O5YL 3SOBH 4UTCA 3VXRB 2Z4QA 5ECGA 4HWZA 4XCCH 2N1KA 5TE7H 3TNNB 4U7MA 5F7NC 4PRHD 2EEDA 3PHAA 3TFKC 3RVWD 1UWYA 3GSOB 3VFTA 2XWEA 4JM2C 1RIUL 4KKBD 3ZDXF 1EFXA 2V2XA 3CQPA 4HGKC 5EZJA 2F6AA 1IBHA 1J1PH 1IKFL 4HG4K 4FXKB 4YFEA 4OAWA 1NEZB 3Q2LA 3SY6A 3T2QA 2Q7YB 5HHOD 4M5YH 4XPTH 4JJ5A 1CTMA 4LLVB 2XACC 4I0CC 3D87B 3WY4A 1BM3L 1WFJA 2DEXX 1TTGA 4I48B 4X6CE 4F27A 4JRFA 2DQEL 3HC3H 5DFTA 2WIIA 3FO9B 4GRLD 1T83C 1F3JB 4YSCA 1DQML 4HMCA 3UAJD 4HOZA 1IARB 2G2PA 3M88A 3O8XB 1TXKA 2BW5A 2AQ3A 4CDGC 3L95A 2ETWA 2CIKB 3GZQA 4XOCA 3ZUNC 2J8UB 5DJCA 5CN3A 3D0VA 4ATWA 3D18B 3O0LA 2XOTA 2E86A 4YUEH 4GJTB 4FQQB 4XO5A 1DVXA 2PCXA 3HB3B 2A77L 2R29A 4N2GA 1TLKA 4XWGL 2J55A 4GXVH 2BERA 3NRFA 2BNQE 4N6RA 4N2NA 4PW9A 5CINH 5K1NA 1JYXA 3AVEA 3W9DB 2AXGA 2B77A 4ZMTA 1ZANH 3HZKA 3EYSH 3OB0H 3R7RA 5CBAA 3F7KA 2EYRA 1T89C 2OMVB 4GRWE 4KHTH 3G5VA 3REVB 3WKQA 3AS3A 2X2HA 3KLHD 1UHVA 1A7QH 4KVPA 4P2QA 1YQ2A 5FHAL 3C6LC 1MLBA 3L7FB 4PJEB 4XCNA 3IXAA 2VQ1A 1S9YB 3L9RB 4XPBH 3TO4D 2BY2A 1TKWB 2H8PB 5IF0A 5BUGA 1EFQA 2EKJA 4RQQB 1CF8H 2A73A 3BE1L 3ZTCC 3VWKA 1M2VB 3QSKB 1FN4A 3MJWA 4N0UB 1TTFA 1YMHA 1K2DB 3APCA 3TNMB 4HIHA 3IF1B 4Q7DA 4Y2DA 1YNKH 2B9AA 4J3OG 3N5AA 3B6SB 4NRXA 3LXAA 3HG4A 4PJFA 3VI4E 4A2LA 7PAZA 3C8HA 3TZVD 4B53A 2EKSB 2M1KA 3FCTB 1BECA 1WV7T 3FTWA 1BVZA 2JFCA 2XT1B 3FL7A 1XEDA 3QDMD 3CFJA 3ZKNC 3QEHB 2W91A 1SJMA 2WXQA 5GGQL 5DK2B 5DUML 1G9MC 3IKCA 4HKXB 1LDPL 1N64H 2FB4L 5ISZA 5IBUG 1QZ1A 2AV7B 3NZ8A 4GXUM 4MMYB 2CKNA 4S1RL 1LL1A 3I3BA 3GXMA 3KPRD 5AVRB 2GBVA 3QCTL 4PBWD 2H4EA 1JZ3A 2GC4C 1KC5H 3DSFL 4BCYA 5DZ9A 1X5IA 2WXHA 1SYSA 3U4KA 2CHDA 2F53A 5C7XL 2NZ9D 4E41A 1QHPA 3PL6A 4JPSA 5DUBB 5EO0A 1XMWA 3V0FA 1KXHA 4PGDB 3EYUH 4XRCA 1KTJA 5H2BA 3VU2A 4AV4A 3RTQC 3CSYA 3ECUA 3QIWC 5IROC 4MJIB 3O3AB 3MRFB 4MS8D 2JCWA 4YDKL 1XB8A 4TSCH 4JE4B 4YO0B 4E9QA 4PJAF 4FD0A 1Y1UA 4Q0XL 5EEUA 4ZO9A 3NEXA 3S96B 3SE4A 1CGYA 1MVUA 2J2ZA 5TTRA 5T3ZE 1IGCL 2OL3A 5CLYA 1JPTL 1TT6A 1BV8A 6PAZA 1CGSH 4HC1H 4PJ9C 5CJ8A 1C8QA 2VDNL 3MXVL 1O7SA 3Q13A 1OAUH 2F68X 1MQKL 4ODTH 1L9TA 4J4PD 3GJEA 1IKNC 3LMJH 3E9TA 4XOAA 2CUAA 1HWWA 1E6JH 3SPJA 3GUTB 4KVNL 2NY5L 2EEXA 1KCRH 5TK2A 4E9YA 1YMMA 1F3DH 2ATKA 3BP7A 3PWPD 4DKFL 1VKXB 2DIAA 1JZ4A 5LNEA 3D39B 3E6FA 3AT9A 3VG9C 4YEEA 4LEBA 4QRSB 3VE0A 4P5RA 1NINA 5DRXA 3B2XA 4TUOB 3KPNA 5HGDA 5I0WA 2B3RA 4EN3C 4ZUTB 3HZMA 1UYWH 3IDIA 1QYGL 3T0ED 3V4PA 1BBDH 3UP1A 4G43B 1ED3B 3D0LB 1MWOA 1VLXA 2EC9U 3QJSB 2XSKA 4NZRH 4MA3A 5F88A 1JHLH 4F9PA 2P43B 3VM7A 2JH2A 2WQWA 3ZMNA 3ECBA 2UZYA 3WG7B 2IV8A 1SPDA 4JDZB 1JGEA 2HT2D 4O51A 3ULUD 3ARTA 1H3PH 5DDHA 2FJHB 5CO1A 4HGWB 5GS0H 1XGYH 5JPMC 4N1EA 1GZHC 4OLYL 4POUB 4HH9A 3LB6C 3JV4B 5KSVB 3KPLA 4P2RA 1F4XH 3BEWB 4GXUN 1CI3M 7FABH 1R3KA 5BNXD 2F19H 4UT9H 5GRWA 1KBGL 1KUMA 4UI2A 3BLBA 1C08A 4Y1SA 1G43A 4DW2H 1UVQA 4XXDA 3RDJA 3ZKXC 2X40A 2C3XA 3D30A 1M1SA 1T0OA 4YHML 5CHNA 2R8SL 3P4OA 2AQPA 4KNQA 5D2NE 3ZDZF 2ZICA 4W9KC 1UM4H 4M62L 1F97A 2FZ3A 3EYVB 1DDTA 3N1FC 2K6ZA 4ZMZA 5H4YA 4HBCH 5EU4B 1WZMA 3FT9A 3VGAB 4A6YA 1U91A 3DRTB 3MODL 4MXWH 4MS6A 1WBXA 5I1IL 4G3YH 3BD5A 2QMJA 1E5UI 4JRYD 3V6FA 4IU3B 5KW9L 1QBAA 2N0MA 3GSUB 3CGTA 1TO4A 2OK0H 4LVNB 4DT2A 2QQLH 1FVCB 3M7FB 3T08A 1G7LA 4Z7WA 3RDTC 3APFA 5D7IF 4HIIB 4Y19B 4EI5C 4UTAH 4MB1A 2MOVA 1JGVH 3B7TA 3S48A 1N19A 2K9UA 2CK2A 2CUMA 3HFFA 4ORGA 1SJXA 2OR8A 2C9AA 3KBPA 4JFOA 4H0GA 4BK8A 2KS0A 4JFUA 3LN5B 2AJUH 3SKUD 5FGBA 1CE6A 2QT6A 2F15A 1MJJA 3WI9A 3UG5A 4HDIA 2OMUA 1KF9B 3QH3A 3I3EA 5C0IB 1DQIA 4RGND 1V3JA 3HRZB 2DWTA 5FX3A 2TRYA 3EBAA 3E1F1 2QQKL 2DMKA 5BRQA 1K4DB 1HU8A 1AKJD 3CDFA 3WO4C 3KGSA 1U2HA 2O6CA 1S4IA 4P5TD 3HNVH 4ONFL 4PLKD 3C2AH 4B9IA 4ZW8A 2BIQA 5HJGA 3ULUL 2YAEA 2GTZA 1J05A 1P7BA 2B3IA 4H26B 4YHIA 4MCYB 4XTRD 2OZ4H 4NQSB 3TN0D 4IRZA 1MFEH 1ZKAA 4KROD 3I9PA 2FWLB 5CSZA 3FULA 2AV1A 3M86A 5AAWC 4OJDH 2VE6B 3B9VA 4ZO8A 1OSZB 5KVDE 2A9DA 3ZU8A 3TVMC 2IC2A 3I02A 2FBJL 4B60A 4FXLA 3PDOB 1SHWA 2ARJA 3VH8A 1JFQL 4NFBA 5DJXB 4JM2F 5B3SB 1ASPA 2R0KL 3OHXA 2B59A 4ZO7A 3IJEA 3KH4A 2NTFA 5EBMB 2ESVB 2BIIA 3WLWD 1KYOK 3A6CL 2A1WH 4CC4A 4C4BA 1DCEA 2WYTA 5T1KA 1T22A 4NO0B 5L6YL 2QVMA 1AZRA 2K6YA 5IG7B 2P5WB 5GS1B 3AS1A 3U6RA 5I28A 2VM9A 5IEKA 1U8QB 4UV7H 5D5MA 3QHTC 1YUHA 3NFPA 2LU4A 4J12A 1KTRL 1QG3A 3NCMA 4K9EH 3HNSL 4G9DB 1UH4A 5T1LA 3QZBA 5JIIA 1FLTX 3UPRA 1MAMH 1UB5B 4LEOA 4PJGA 5DU7A 4WJ5A 5F9OH 5E2TL 1VFBB 2P5ED 2AEQL 3CFCH 1D7CA 4OLZL 4WU5A 1BREA 5KSAC 1ICTA 3AWEA 5JOPE 1I1YB 5I18H 4JZJC 1YEWA 2YMXL 4NM4H 3ZGHA 1LQBC 4UYQA 3DLQR 5SWSD 3RZCB 4NZDA 1NBCA 4LNRB 4W9DC 4OZIF 4HUUB 2KZBA 4KC3B 4W6WB 5E8OB 1UACH 1H15B 3QJFA 4QY8B 5AKVA 1T5XB 3ARFD 2H6OA 2APFA 4XVSH 3VTTA 2VZSA 3MJ9H 5GGRA 2BLFA 2B2XH 1RZQA 1CFQB 5DJYA 1T7XA 1CFTB 5KYWA 5FW6A 3C5SA 1C7SA 1S7WB 1BJ8A 1UENA 2YD3A 1ZEAL 1W6LA 4L9LB 5DRNA 1Q0YH 1QA9B 1CICA 1DBAH 4ZOEA 1M9WA 5I19L 4BFOA 1RPUA 2VL5B 4KJWD 3U9PL 5EBWB 3QQNA 5BZZA 5E70A 1DBKL 2PCPB 4LLMB 4NDMB 4WFHD 4ZUVB 3FSOA 1YEFL 4RCAA 5CILH 3ZE1E 3SKMA 4NKDB 2FH8A 3MUGB 4P46D 3KPTA 3GPSA 4L3EB 4R5VA 2LHAA 2DTSA 4I0PA 4V11A 5F0JB 4JG1L 3U2SB 2W9LA 2R56H 3IMSA 4X9YA 4LSQL 3SQOL 4XPHH 1ULVA 5GGUA 1QLEH 3HPLA 3DBXA 2FT8A 3JTSB 3O9WC 1L9RA 2BFVL 1WT5A 3HG5A 4WTWA 4RWYL 2R39A 5I73B 1EWHA 2DQIL 1DCLA 1FV1B 3FTXA 5DWUL 4R26H 2B1AL 2ZXWB 4R5XA 5DJAA 1IAMA 3GYRA 1EAJA 1OWWA 4GFXA 2Z1KA 1OF2A 4IBLT 1ZT4A 4PHZA 4EN2A 3WN5B 2XLLA 2WYIA 4G9FE 5CD3B 2XKUA 3WIHH 2R0ZH 4O2EA 1KPRB 4X4ZA 5L7XL 1A4CA 4B27A 5F7EH 4M6NH 1NLDH 2B0SL 4MNGE 3VM5A 1E4WH 2FR4B 2W80C 1FA4A 2BNQB 3EO9L 1IAII 3NTCH 4LCWE 4MAYC 3L4ZA 5E8DH 3L3GB 5C0EA 1BZ9A 3CD4A 5E8NA 4R2GC 1XGTA 1OXYA 1ID2A 4NOFA 2EDYA 4Z7UB 1ZLVK 1ZGLM 5ACZA 2BZCA 1Q0XL 2GQHA 1HAWA 3T2NH 5EU7C 3LKOB 3ZGIA 3ECVA 3TPUB 3AMLA 4P4KA 5KUKA 2OYPA 1F2QA 1E50A 3LOWA 1E5BA 1IQWL 2WXLA 1IT9H 2F58H 2ICWJ 4DEPC 4WV1C 4UQIM 1BGXL 1YEIL 3AREC 4G1MB 3VFRA 2XETA 3DHJA 4LL1A 4N2OA 3SCMD 3SJVA 5F7UA 1UZ6F 4GW1B 1Q1JH 2NW2A 1NMAH 1D7FA 1ND0A 2VXVH 5HPMB 4MKMA 1MJ7L 2AK4D 5C08A 1JD9A 2JJSA 4NO5A 4JO8A 3NEEA 5BZDA 1EHLH 1OE1A 3M8OL 2R0LL 3RGVA 2BJMH 4WWID 3MBEC 4ZMWA 1NANH 3UCRA 4HOXA 5LWYH 1IFHH 3BSZH 3TFBA 2AQSA 2KLRA 1WS8A 3GSXB 1LLAA 4X4MA 1WIPA 3T0BA 3MV8E 4ZW6A 4EZLA 2GK0B 4GRWH 3LRGA 1C8PA 1L9MA 2VQUA 3GRBA 2YA2A 3EDFA 3N1MC 3A21A 1GGBL 4YHYC 5JO5B 1CDGA 3UTTB 3VXRA 3QUYD 3R06B 5HD8D 2UY7B 2Y7NA 3QAZB 2BY1A 1T2QH 3H2PA 1JZIA 5FA3B 3F7RA 2IWEA 2KZWA 1N9PA 4TYUA 1QI4A 5F9WB 3F7QA 2EACA 3N0PB 5BZWB 5CCKL 1JPGB 1I3UA 3SGJA 3GSOA 2LQRA 1ZTXL 1II4E 2OYMA 5DS8B 5E94B 4JQIH 1QBMH 5DZLA 3MUHL 2WP3T 5LBSH 4A2EA 4FXKA 3TBVB 1FAKT 4RDQF 2D7PA 2ICEC 4KI5E 3U7YH 3ZRFC 4JHBA 4DVBB 5FFOA 4ETQB 3X1FA 5I23A 1SQMA 3S8WA 3V0WL 5IIEB 4Y5YA 5D1QA 4FABL 1CLCA 3QG6B 1V3MA 2XJKA 4A38A 4HZAA 1PD6A 1E90A 4I48A 5E5MB 1INEH 1NOLA 1YQVH 2Z8VC 4IBZA 1ETZA 4PRIB 4ZSOE 5HGHB 3FO9A 5EBLA 2BSEA 2HTKC 3DGGB 2D3NA 4E0RA 1OAQH 4UBDC 3EYQD 2XZQH 1JD7A 4JFPB 3BHBA 2VZUA 4ALAC 3M7OA 3B2UD 3G5YB 2OMXB 3K80A 3NABH 2NY3C 2CG9X 2G0KA 4MMZC 3UACA 4HKBB 2AJZB 1EZSA 3TS8A 1W0VB 4N0YL 3A23A 4YZFE 3ML8A 2Y06H 3IFNL 1NCIA 1WA2X 4GKNB 4NJAH 5J9PB 4N8VA 4YEFA 3P40A 3IETA 5ANHA 4XVJL 1QASA 4NHCH 1KEML 3DTXA 5F1IB 3HG0A 4DN4L 5AAMC 1AS7A 5I0DA 5GRJH 3U79A 1JDCA 4X9GA 2W65B 2NY7L 4M6ML 4BUQA 4PCYA 5J4MA 4IJ3B 4LOFA 3FQTB 2Y1VA 3PF2A 3P2TA 3D2UB 2XWDA 3U36B 1XCQA 1N4XL 3TBWB 4AJVA 3TJPA 1BEYL 1C1EH 1A5FH 2JTYA 3N50A 5KS9E 5C09E 1EO8L 4DO5A 1NCAL 5T3ZH 3WGVB 2W0LA 4LZKA 5TQ0H 1DLFH 1JZ8A 4O4YL 5D2LB 3ZYJA 3KDPB 1K2DA 2AXHA 2MPAH 1RUPH 4GB9A 5I1EH 5E6IA 4WU7B 1L6ZA 4JB9L 1QO3B 1AQMA 4HJJH 3ZHNA 3ET9F 4XMKL 4FQXA 2ZOLB 3ZMRA