2V9UA

Rim domain of main porin from mycobacteria smegmatis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MSPA
publication title Designed Protein-Protein Association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 27
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09203 MspA MspA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1650 Mainly Beta Sandwich Immunoglobulin-like Porin MspA (Ig-like beta-sandwich domain) 2v9uA01
1UUNA 2V9UA
chains in the Genus database with same CATH superfamily
1NC4D 3VSVA 3DYMA 3W38A 2W0FA 4NFDA 2DQ6A 1RK1A 1J9SA 3DSFH 3OLIA 1FV1B 4R4FH 1FYHB 1QBAA 2P46B 3RVVD 5IHBA 3GMQB 4G5AA 2BSRA 5KSUB 2RA1A 3WEXB 1RL1A 3QAQA 3U0WH 2D4DA 1PAZA 3Q9QA 3QCVH 1JPFB 2WXFA 4MLIA 4FRWA 3AQDA 4H26B 2XN0A 5EOQH 4GXUM 1AQ8A 2D73A 1WIOA 2X10A 5E8NB 1JHKH 1CQYA 2K1MA 1BAGA 2GFBB 1RULL 4LP4A 1JZ2A 1CT8B 4LLUB 2BIPA 1U93A 1A4CA 1TQSA 2BNRB 1JWUB 3P77B 4WV1A 4JM4H 3WBDA 2OMYB 1OCCB 1GZPA 1ZT4B 4NJ9H 3KLKA 5GGVY 4JPWH 1PYWA 2APFA 2RGSA 4IHOB 5ADOL 3VXTB 4HPYL 4HWEH 5E2TL 3TPUA 1CFTA 1PZDA 4HISA 3M7OA 1DBAH 1FVEB 2QMJA 3RLSA 1J8HB 1AE6L 3OAWA 4PWJA 4ALAC 3HHSB 4AV0A 4XOAA 1E0OB 3CMOL 3VH8A 3A5VA 4HK3J 1BVNP 1WO2A 3QIUA 4IKKA 1WEJL 1J5OL 1J0HA 1G7QA 2QPEB 5TQ2H 4A55A 4DFIA 1U8IB 2C9VA 2VCOA 3WY4A 2FL5B 1QFHA 5IV2A 1LO5B 2X6VA 4X0KA 4QF1B 5F7FA 1CFNA 4DEUA 1BZDA 5JOPE 3N85L 5HHOB 4P4RA 3HAEA 4J3XA 2QSTA 4M6AA 3D0VB 2D9QB 5LCVH 5CZVL 2IPUG 4HS6A 1HJBC 4KI5E 3RDTD 4OZHF 1L9TA 4DW2H 3WHE0 2ICWI 1W72H 4G6JL 1A3ZA 3II1A 2HLEB 1KGWA 1N6UA 1D7CA 5FCUH 4UTAH 1Z9MA 3BGMA 2P5ED 2WD0A 2I32A 4KRNA 4LQFH 4F9PC 3LKSA 2OJZH 3EGSA 4LLVA 1NCNA 2GTZA 1JVOA 2ZOKA 5C0FA 3KJ6H 2J4WL 3E2HC 4OM1L 1YYCA 3NCXA 3KD4A 5IQNA 1XT5A 1F1DA 4Z95L 1YEDB 1M9SA 3FU3A 4G1EA 3VCLB 3UEQA 5T3XL 3KPSB 2PWEA 5KSBE 1LO0H 2BSBA 1CXKA 3GD1C 3RYMA 3HNSH 4YE4H 1DVFB 4BK5C 3DDGA 5DRNB 4L8DA 4ODWA 1EJOL 3FDWA 4KKQA 3S36H 3TBYA 1A65A 4R8WH 3WTSA 3CZLA 4OF6A 2GUOB 4PJDE 1ZDQA 1KT2B 4EKJA 2CLZA 2HWZL 4YHKL 3FU5A 3WJLC 3L16A 3RWIB 3NCFB 1DBJH 3ZKQD 2WLZA 3W57A 1N5AB 3BDYH 4HJJL 4MD0A 3LJ3A 1AHWC 5C0RL 4MZ2A 2DMBA 4MMXA 5C0EB 4Y7MA 4RDQG 4HMEA 1FO0A 4A63A 3SBWC 1YSOA 3U6RA 2H41A 1UQSA 3MRFB 3L4TA 3IGAB 4POUB 4MZRA 3L48A 4NQCD 5F3BB 4FFYL 3GSNL 2ZUYA 3H6JA 1X9UA 1KB5L 3HS8A 3LKNB 1CDYA 2LAAA 5E94B 4MTMA 3DETD 4FQQA 4EI5A 1QZ1A 4JRYE 4JY4A 5E8EB 3VRIB 3LB6C 2X44D 2AJZA 3WNNA 43C9A 4N4YB 2UUDK 4QJ5B 5H2BA 1MRDH 1WJ3A 3BO8A 1MAJA 1M1XB 4NB7A 5JDSB 3MA7B 1DVYA 1QEWB 4YPJA 3SKMA 3FC8A 4GUPB 1DEDA 5CN2A 4FI7A 1KIPA 5DMIL 1ZVHA 4A04A 1TG8A 2EILB 4BWWA 3APMA 5AOZA 2P7TA 3PL6C 1NCDH 3I2CH 1UM6L 5D7LD 1KLFB 1NWOA 4HP5A 4RFOH 2Q86B 1XH2A 2JCWA 5LAXA 1YUKB 2YK1H 3TH4T 4TLUA 3PNWA 3RU8H 5TE4H 1YYLL 2WPGA 2K78A 3W0WA 1T0OA 1FUNA 2BNQD 4P3CL 4HKBB 2NY7L 3QIBD 1MKFA 3EOBB 5J0BA 5MP6L 1IGTB 1KCBA 2EE2A 2UZYB 1IAKA 4GKLA 2CD0A 1UYWH 1CLVA 1AZUA 5FCSH 2FDBP 2LGNA 1F3DH 4NZDA 3IRCA 1I3GL 5DWUL 4HUVB 1S9YA 2R29H 3D1MC 1A21A 2H5UA 4ZMTA 5EOCH 4GMTL 2XZCL 4L3EA 2HRGA 1CDUA 3BD3A 4R97C 3Q8AA 2IQ9H 2YSTA 3GO1H 4QKTA 3QUZB 3EGDB 4LCWD 1JI2A 1NWPA 1OO2A 3MV01 2VDRB 5F3HB 3U4EA 1T6BX 4LIQL 3FQXA 3QXDA 4KROD 5ABAA 3RFZB 2UVEA 3FCTB 3GJEB 5GGRB 4U3SB 4NPYA 4QHLB 1K4DA 1NLDH 3MHZA 1VZHA 1FE8L 3GYRA 3FUEA 3I9PA 4NHUA 3RRQA 4AE0A 3QJTB 3ARQA 1IC5L 4FXLA 5DUJA 1G9NH 1TNMA 1LO3L 4IRSB 4M7LT 4QKXB 3DO7B 2YD3A 4PJ7B 4PRHD 4NBXB 1X5XA 4NC2B 1T0PB 2E46A 1NH6A 3FOLA 3FFCA 1KFAH 3SDDA 4DN4H 2LOEA 5FO9A 4N2NA 2EIZB 1T89C 1KBVA 2HH0H 2PCPB 2VQ4A 2H32A 2HP4A 4MAYB 4KRMB 5FS5A 4OZGA 1XDTT 2X87A 4M6OH 3QRLA 1Z3GL 1WTGT 4EN2A 1DFXA 1ETB1 1LNUA 3DROB 5AAMA 1J5HA 1FNSL 3B9KD 2EDOA 4BQCA 1U30A 2P80D 3MXWL 5E8DH 3U4AA 2P43B 3MTXA 3SE8L 3SQOH 3VNYA 3ULUD 1PD6A 4U1KB 3ASWA 4W9FC 3UZVB 1NA8A 2C3VB 3DX0A 3SKJH 3BKJH 4JGJA 1ACCA 1T04A 4NO5B 2ATAA 2F1AA 2VMDA 2WMPA 5F7KC 5KSBB 1AXTL 4PVBA 2RBLA 1NIBA 2YR3A 4GQZA 3RJQB 2APWA 4OSUH 1AIFA 3VMOA 2W9LA 3FBKA 4RBPK 5CFHA 1NL0H 2BC4B 4JHAL 4UCFA 2VDLB 1MF2H 4S1QL 3AXHA 4PJDB 5JXAL 3KDMB 3NZ8B 3P4NB 2ZTBA 1W72B 4KVPA 2DB8A 1DCLA 4RGNE 2CHNA 3IJSB 5FF6B 4A7UA 1I1FB 3QA3B 3ARBC 2J20A 3ARDC 3OAZH 2BJML 32C2A 3UZEC 4EBQL 5K9QI 4R6UA 1IGMH 3QSKB 3O6KH 3VB8A 1BFVL 2F5AL 4WU5B 1DQLH 3WIIL 1DQIA 1QBBA 1K8IB 4ZS6C 1PNDA 3GUFA 5DHXB 1U58A 2LAGB 3QO0A 1HILA 1TJIL 2ADFL 2ADGA 4L5FL 1PCXA 3TT1L 2B8OT 1M7DA 4JVWA 1T5WA 3IMVA 2CQVA 4ZSOE 2VW7A 1RLWA 4TNWK 4QYOB 2FNBA 2NY0C 2VQTA 2NUTB 1ECYA 2GJ6D 2HTLC 3HE7B 3HJ0A 1U3HA 2VAJA 1A7NH 1WRFA 5CJBA 5CJOH 5T5NG 2R4SH 3RL2A 1A6VH 1KZQA 2L7UA 5TH2A 3QORC 3D4YA 3KBEA 4UI2A 3VXSD 2R39A 4ELKA 3ARWA 3RUGB 3GMOB 3F12B 1DR9A 3NTCL 3I75A 5JHDD 1FSKC 2GVYA 2SEBA 3F83A 4R0LA 4ZMAT 4HHAB 4P23A 1CXHA 1YNTB 1YRKA 2ZWNA 3B5TA 2YAFA 4APXB 3VFVA 2WLLB 4JFDD 4TMPA 4ZUSB 1ASOA 1CUOA 5F93C 2XA3A 2HLFC 3NH7H 4RSVA 1KJ3H 4K9EH 4XNYL 3KYMA 3IDGB 2NY3B 3UIZA 1ML0A 2WIIA 3FH5A 4X5WB 5D72H 1P0SE 5C09A 1P7QD 5EZIL 2O4EA 2EDEA 4LOUD 3THML 3IBEA 2WWKO 5EUKB 1JMZA 5DHYB 5EZLA 3F65A 2A4CA 3LN4A 3TO4C 4GKSB 5JIPA 1MI5A 4PWGA 1B9ZA 2X0WA 1WZ1H 3BIKB 5ACZA 5GZOA 5I0YA 5MEOB 2P8LB 3CXHK 2AEOA 5E4AA 4G6KL 4Z7OE 2J57A 5C6PB 3BH9A 3FULA 5CM1A 4JKKA 4FNRA 2P49B 2X2HA 4AYFB 1K3IA 2YMXH 3KPPB 3SE4C 3QEHB 1KV7A 3LRSA 4PS8A 3D07A 2XQBH 4U05A 5D2NE 1GCFA 1G9HA 2ERJC 4WI4A 1XF5B 3LQAC 4HWNA 3UJJH 4FZEH 2AMUA 2OLDA 3PWPB 3WUWB 2XWDA 3ILPA 2OMVB 3D2UD 5M7QA 2Y3AA 1YEJH 2EADA 5AOMA 4NHCL 2UZIH 1TNNA 2V7NA 4GB9A 2B5IB 3GI9L 2OMBA 1QPKA 4MJIE 4TULL 4LF3A 1P4LA 3SY6A 1WCBA 2WUBH 2VM9A 4WI7A 1NIDA 3II3A 4PPTA 4UTBA 3IU3B 1V3KA 2IC2A 3OKDA 1ZVNA 4H25A 4XNQB 1MQ8A 5E5RB 1F3RB 1A3LH 5F8QC 2VC2H 1XEDA 1UD4A 3PV6B 1I1YA 3OGCA 2LV4A 2VN6A 3PQYE 4HS3B 1SM3H 5FHAL 1FDLL 1VGEL 2V8LA 4YPGB 3SJVD 1FV1A 2JV6A 5AB9A 5L0QB 1G6RB 3WFCH 3HC4H 5DVPA 1ZY9A 4PRAB 3GMQA 2BP3A 3MDJA 5KSUA 2WZPD 4JJHA 3WEXA 4U1LB 3ZGHA 1NLBH 1JPFA 4IOSA 2IPKB 2RALA 4FXTA 1DL7L 3BKYH 1NKRA 3QDHA 3GDCA 4M3KB 2GIYA 2CXKA 3SOTA 4ZPTA 5E8NA 1S7QA 3GPEA 1GOGA 4GAYA 5CJXA 1BJ1J 3FB6A 3POHA 1JWMB 1UB6A 1KCRL 4FNPA 3P77A 1SHXA 4Q9CA 5MEPB 4YDJB 3ZTCC 1IU1A 2W07A 4RGNB 1KYDA 5BO1L 5J8OA 5D5MA 2G9HB 2QVFB 1U92B 1W0YT 3Q1SH 5CILL 5SWSA 1N5YH 1CVRA 4BXVA 4GRWH 3DGCR 4FFWD 1CVSC 3L9BA 2YOCA 4JFTA 2AS5M 4JFXB 2IGLA 4HUUA 1CICC 4M93B 4OZGF 4QHMA 2QQKL 3CSYA 5DS2A 5J7CC 2HG5B 4LNRB 3TBVB 5F9WB 3QDGA 1A1NA 1ZHBA 4XBPA 2CZNA 4FYSA 5AZ2H 3VXME 4EXKA 3RVTC 4ZSOB 1UJTA 3E3QE 4GXVL 3WFDH 1TYJA 1D7DA 3LH2H 2FL5A 2VDRL 3TF4A 1LO5A 2OMWB 3JTTB 1BFOA 1AKJD 2OSXA 4N90D 4NT6B 4JKMA 3ZYIA 3K0YA 5KJRH 1HHGA 5HHOA 3DSFL 1J48A 1OF2B 1A5FH 3L4YA 2Y5TB 5E6IC 2G60H 1UWXH 4JFFE 5I8CA 4MXQC 1SQMA 2DQCL 4I1RA 2CBQA 3LNEA 3U46B 1KY6A 2GK0B 3RVWC 3RWEA 3C08H 2UXVA 1L9PA 3C9NB 4S1DC 2K70A 3RTQC 3W82A 4Y16D 2OPCA 2AXWA 3MJ9H 4GPVA 2ZP8A 2J21A 1M3IA 2F9BT 2MQCA 5HGHB 4DHLA 4GRWE 4MCZA 3RGVC 5F1KC 4AG4L 2UY6B 4FQLH 3L8QA 4BUHA 1I8KA 3ISWA 1ECZA 3T77B 3QZWB 1MHHA 3IMUA 1QBML 4H0LC 4UDUB 4N0CD 2WBJC 1LM8V 5CKGA 1S3KL 5H35B 3WMSA 3ZX1A 3V4VH 1G4MA 3DX2A 3VCLA 3FHEA 3RE0A 5IWLC 1BXAA 2D3JA 3KPSA 1DBAL 4FTVE 4OCRH 4RZKA 2QPSA 5HHQB 2R1XB 3DO4A 3ZIMA 3S8GB 1OSZB 1P2CB 4FQ2H 1SBSL 3DXAB 5DRNA 2LU3A 1N7ML 1VPOL 2Q5BA 1VZIA 1M71B 4B41A 1NBVL 1BBDH 1X4YA 2F58L 4Z7OB 2GUOA 5JA9A 2UX6A 1XWVA 2IDFA 3BRGC 1P4BH 3MBEC 1N5AA 2Y7QB 3D69B 2PWGA 4HXAH 2G5BA 5KZCD 1U3ZA 2K3TA 4OM0L 1CD1B 2ITFA 4AYEC 3LV3B 2ZAHA 5D2NB 2VDLL 4ZMYA 4B3EA 5C0EA 2BP0A 3ET9F 3NZUA 5HGBB 4LKCA 2KUTA 3QRGH 1W72L 3IGAA 3X1NA 1HL9A 3QJQB 5F3BA 3F84A 4TSCL 4OLEA 1T80A 4UM9B 4FFZA 3CFIC 3RNQB 3LKNA 2EIMB 2A4EA 3QJZA 3VFSB 4U1IA 2VRKA 1P84K 5E8EA 2ENYA 4MJIB 3UBXB 3HOGA 2E47A 1JUFB 1IGYB 3QQ9D 2NY1B 4F5CA 1M1XA 5ETUA 5JDSA 4JO3L 3US1A 4AEHL 3MA7A 5I6MA 2PCXA 1ZVSB 4AQAA 1FZOA 2ZYSA 3KGRA 1U8JB 4CNIB 1T1XB 3HLAB 4R5TA 4YE4L 2PCYA 1E6JH 3QH3B 4PTTA 5IQ7H 5L4IA 4HBCL 4KRPC 3BPNC 4JRXE 2JI2A 3ATDA 3T6WA 1BFTA 3UGXA 1UM5H 1WFMA 1OGAA 2NZ1A 2YD5A 4DVBB 4LCWE 4ZX3A 2UXFA 4LVNB 1BQLH 3PQYB 1DDTA 2CHXA 3Q7JA 4M9PA 4L05A 4M56A 4KX9A 1SLVA 5IIEB 1NBZB 1XGRA 4UNVA 3ERXA 4Q52A 1RKRA 3LDBB 4RMVA 1DZ0A 4S2SA 3TWCL 2R0WL 3HG1B 2V2TB 1V3LA 1UXSA 5CJ8A 3EOBA 3SODB 2Y1ZA 4IKIA 3ALWA 2AQQA 1T5XA 4GQRA 1J8SA 5D9SB 4MJ5A 4QD2E 4M62L 5D7IE 2J2ZB 2AKRB 5FUZH 3DV6B 4QHUA 4AVJA 2BSCA 4B53A 2EEAA 4N1CA 5E0QA 3FT9A 5HI5D 1KV3A 3STZB 3W9EB 2XXMB 3S96A 5KSVA 4NN5B 5D7SL 1PLGH 4Y2DD 4HS8L 4ELME 4XRCB 3C60A 4NRXA 2FGWH 4DP2X 4Z0XA 2VDOB 1QUNA 4IS6B 3QUZA 5BUGA 4Y4FA 4J3OD 2C1OB 5GRUL 2JIXB 1B6UA 3EF7A 1B3IA 3RZCD 1BREA 2R56H 3GS4A 3HNTL 2V17H 4K5LA 4P3WA 1KGCE 3VQ1C 1T66C 3FCTA 3GJEA 4P2OB 4U3SA 1I4FB 4QHLA 3D25B 2OMZB 1R3LB 3NJVA 4HWUA 4OCNC 5CGBA 3OGOE 1HL8A 2VDQH 1KDIA 4LSVH 1ODAA 1S7SA 5FFOA 3KJ4B 4GG8B 4RFOL 3WL9A 5KBDA 2YK1L 4BKTC 2WO3B 1IC7H 4Q9BA 5B4MD 3SY0B 2FJSA 1A4AA 4IRSA 5TE4L 4XZUB 3TEUA 4AGMA 1YNKH 4JFFB 3UBFA 1CF8L 4MZ3A 4P2QE 4I1NB 3EYQD 3B1TA 3CXHJ 4APQA 2A2QT 4PGDB 3RA7H 1UYWL 3SGKA 2YBRB 5ES4B 2ZOLB 4PRIE 1UH2A 4R7DB 1D5XB 5CCHE 5C0DA 2K7QA 2BNRD 2QZ5A 3LS5L 3NCEB 1E27A 1RZ7H 4AM0Q 5IP4A 5JW4M 3RB5A 2HT4C 1CDHA 4MXVF 1MCRA 3QEQE 3DROA 4MB3A 3BEWB 2GI7A 3LZLA 4ZMPA 3FHQA 2YQ2A 3QDMD 2DL2A 5D5MF 3ZTJH 3BESR 1AJ7H 2IQ9L 4ZG1A 4U1KA 1JYNA 5TK2A 2R69H 2R83A 2FBOJ 1J8HD 5KSBA 1UEMA 4FTVB 1JE6A 1OOAA 3FMGL 1NPUA 1QAWA 3EJJX 4Z7VB 1WLHA 1ZPUA 2HT2C 4YGVA 3T04D 4JPQA 2X4SB 1G6RL 3T4AB 4X9GA 5EU6E 1WBXB 1M4KA 2GJ6E 1A7BA 5LCVA 3VE0A 2E76C 4PJDA 1S78C 2C7FA 1OT1A 4DETA 1MCPH 3RAJH 5JQIB 4BCZA 1H6EA 3REWB 4LL1A 3MRCB 1J1XL 1QMUA 1W72A 3DSNA 5HGDB 1E5ZA 3BN9C 4FMFA 4H8WH 2NDGA 4UTAA 1HOCB 2VZSA 3QA3A 3FSVA 3A47A 4YQXL 3MRBA 2F8VA 4U7SA 2BOLA 2CBTA 2JKRM 4G2AA 5DFVC 1A14L 5EZOH 3RJDA 1II4E 4NKOB 2HJKB 4Q9QH 1MREH 3V4VB 2CO3A 4RQQB 2XV6B 4UBDD 4OKDA 1LEKB 4S10A 2BVEA 1T7VA 4WWKC 1KCKA 2D8KA 3E8VA 3LXCA 5E8DL 2NUTA 3ILQD 3SQOL 4JRYA 3TT3H 2JH2A 2OZ4H 3S34H 4N9OB 4FA7B 4NIKB 1UJ3A 2XKNB 3C8KA 3O2DH 4DGVH 1AG0A 1HN1A 4LCUB 2RFXB 5FHBH 1IBYA 1FIEA 1KCVH 4Z7UF 3TP4A 5AOKA 5FYJL 2GCYB 1WPCA 1DVFD 1FGNH 3AMLA 4OLWH 3QJRB 4X7SH 3S35L 3W2DL 2IBZX 4HHAA 5DURD 1YNTA 1LMKA 2APTA 1ZK9A 5DC9B 3LIZH 4JRXB 4ZUSA 3JWDL 3MMEA 2XXCB 4DQOH 2RR3A 3IB4A 4S1SL 3OX8A 4R9HA 4PP2B 3QZBA 2X9ZA 3IU4H 2VZUA 4R4BB 4UU9A 1E4JA 2PP7A 3H2QA 3IDGA 3RP1A 3UJTL 4XT1C 4YLCA 1M1SA 2D3VA 2JCCE 3AGVA 5EBLB 5H94A 4I88A 2YPVL 4BHUI 2QZQA 2Y7MA 2VB5A 3ZDZB 3OHXC 1BQHB 1ZLVH 3O6KL 1V8HA 2BS9A 3AGWA 4KV5F 1UVQB 2BHFA 4QY8A 3DBXA 5DHYA 3VXPA 4HEME 5D7IB 1RCYA 3GM8A 1M7UA 2A1WL 3OXSB 5IR1A 3BIKA 5DHEA 4PH8A 4X9YA 4KO7A 2EECA 2D9CA 3MV11 1WV7T 3T0EB 3O4OB 4U1JB 1QFWL 2CO1A 3DMMC 2VL5A 5DK0A 1H8NA 4I4WA 2HFFB 1DLFL 4AYFA 3EYSL 3O8XB 3KPPA 3LRHA 5CLWA 2NNXA 3L3HB 3QEHA 1N64H 4N2FA 1RZFH 3GZQA 3JT0A 3NJJA 1RIUH 5K93A 4MA3B 3RTLA 1ZV9A 2BLFA 2X5PA 2AJVH 1ED3B 2K6WA 3VGDA 1J10A 1RUAL 2JXMB 2ARJA 3ZL2A 3F62A 3NUKA 4H5SA 3GM0A 3DX3A 1U2CA 3B3IA 3WUWA 4MJ2A 5EEYA 2QPUA 4G8FB 4DPRA 3PIQA 4OFPA 3UO1H 4JQXC 1WWWX 4H8VA 4G42B 3JWOH 4JDZA 5KANG 2JB5H 4XPTH 5TDPB 3IMSA 1YEEH 2W0PA 3HZMA 3BD5A 3QDAA 4P2QB 3V6FB 2R29A 2IDCA 3SKNA 3QP3A 3IU3A 4O5LH 3V6OC 4PRIB 2DWEA 3GKWH 4BH7B 4DP1X 5I1CH 1V27A 2BY1A 3GJFH 5EU7E 2OBGA 3QEQB 5IVNA 4R90L 3WNIA 3ATBA 5KOMC 2XFGB 3PV6A 1LL1A 2JELH 2DM2A 2J1ZA 4W4NA 1R33A 4JHVA 1U8NA 4GLRH 4AQZA 2AI0L 1RZGB 3H7BA 3X3GH 3SYPA 2Z31C 3HPLA 1FZMB 2YMTA 5I1DA 2YMXL 3KPNB 2EIKB 4NN7C 1E65A 4PRAA 3AQYA 1IEHA 1OAYL 3VFPA 1FFRA 5C0BB 4KVNH 3X14B 3ULVH 3SYQA 5F7AA 4U1LA 4V1DE 3C8DA 4Y4KA 5HHMB 5F0LB 4M48L 4IIQB 4OKVB 4DAGH 2Z7ZA 2X1PA 5EU6B 4N90E 1BIHA 2XUWA 1P84J 4FQPA 1JWMA 2LTQC 3MUGB 3DJ9A 3BRDA 2IMMA 4ODHH 4XVSL 5MEPA 4YDJA 2AZUA 1FAIL 1YEJL 1AHKA 4W4OC 3U25A 4D9LH 2G9HA 3G6JE 1WHPA 1U92A 4FABL 5ICYB 4I3SH 2WLHA 1R46A 4GAJL 5KYYB 4PP1C 3ZKXC 3Q5TA 1YN6A 1IIKA 1SLXA 4JFXA 4XVTL 4MAYD 3O6MH 1X5KA 2HG5A 2J43A 1FP5A 2VDOL 3OMAB 4MAZA 1KUMA 2W38A 2FX9H 4ZSOA 3UPRB 3MRMA 3ULVE 1X5HA 3K8MA 3VX0A 1X44A 2EH8H 4PJ8D 4NKMB 2EDFA 2EYTA 5F7DB 1J5IA 3JTTA 4NT6A 1KB3A 3KCWA 1UADC 3MLSH 3HC4L 3QBTB 2JKNA 5DD3L 5JPNB 1RJZB 1OPGH 4U31A 5ILTL 5BV7H 2DQGH 1ZVYA 2GK0A 3BQUC 1G7IA 1UM4L 3P30H 3B2VH 4MBRA 4M8QB 3SSGA 3VG9C 3IRZA 4WRLA 2Q6WB 3FH8A 4Y19B 3W11D 4P9MH 3ASOB 2KZWA 1PZBA 3LZNA 1S6NA 4FCHA 3VM7A 2ZJSL 1YEHL 1R3JB 3F7YB 3ZO0A 2VZVA 3L9EA 5D2LE 1OGPA 2ZUSA 2MCMA 3V52L 1QYGL 4J28A 4KUCF 4K7PX 4OH2A 4YC2C 3HI5L 2WWKT 3P3RA 1N5YL 1GGCH 4JHWL 4ZMNA 1G4RA 5TE7L 1O7VA 1OM3H 4CKQA 4ZK8A 4OI9A 5HHQA 3K6SB 4HIXL 2R1XA 4QGYA 5LWYL 2J88H 3INUL 1OSZA 4XXDB 4Y5VB 1P2CA 1E30A 4NUGH 1QX1A 2Y2TA 4Q2ZA 5AZ2L 1M71A 3O9WD 4UQ2A 1G0DA 2YGNA 1ETA1 5FWQA 4JJ5B 3VXRE 3HE7D 3VQLA 4LRIC 2NNFA 2PABA 4P59H 2CPUA 4XNBA 1UZGA 4DIXA 5I9QC 1WZAA 2BMKB 2X6AA 4DVRL 3D69A 1FZJB 1R24B 4O2EA 1A5FL 4UOW0 4WKXA 3LV3A 5D2NA 1EFXB 4FE9A 1GYCA 2QDVA 5HGBA 1YNTF 1E5YA 1XMWA 4OVVA 5KSAB 2JSFA 4OI7A 4I9WE 5KS9B 3C08L 2OYMA 5E4OA 3UXFA 3E9UA 5IKCA 3NSYA 3O45A 4H0IA 4C57C 1KSRA 1YNLL 3AREB 4BUQA 3H54A 2Y07L 5TDNB 1OT4A 4EIGB 3TU6A 4OCYL 1F6FB 4N25A 5K1VA 3VFSA 1PLCA 1ZKAA 3BH8B 4I3RL 4U3XA 4MJIA 3RIFF 3UBXA 2IANB 1AXSA 2Q7YA 4OF7A 1JUFA 3OMIB 1R3IL 1X7TA 3HS0B 1IGFH 2XX1A 1ZVSA 2XV2A 4JR9L 5DJ8B 1T3FB 3DI2B 1PDKB 4UT9H 1U8JA 1T1XA 3HE6A 3SE3A 2VOTA 3FTYA 2HJLB 4M8VA 3IGLA 3AQXA 4X99B 2R15A 2ZX7A 5B38G 1U3YA 2N1KA 3NSDA 4A7VA 3OLDA 3PQYA 4Y4HD 3GXMA 1BEYL 4ADJA 2XWTB 2K45A 4RMWA 5TF1H 1ZOXA 3RWFA 3ZTNL 5AVQB 1FFPB 2RQEA 1JPSH 2VR3A 2YOAA 4KKNA 2V2TA 5F9OH 1A6UH 2Y3NA 1XGPB 1K72A 1OW0A 2Y6SC 4XCCL 5E9NA 3V5HA 3O6FC 2Z64C 4V1DB 1IVLA 4MNQE 5D9SA 4PB0L 4R4NC 4X4KA 3SPGA 3IAQA 4NSKB 3CWGA 5I73C 4LPWA 2J2ZA 3IJ9A 1FNAA 3DV6A 4ZUWB 1KFGA 5SX4I 2DAVA 3PFQA 5FA3B 3STZA 5LXGH 4PJAF 2ATPB 2JLPA 3V7AG 3ZSSA 2YXWA 3IJ8A 5EF2A 4QOKE 3UBGA 4RESB 1X9QA 4K9JA 1UCTA 4YBLC 1R1CA 1XCQA 4IRZH 1JZ7A 2AABH 3X17A 1RZ8B 2C9XA 3WN5B 1BM3L 4DOHE 2KLSA 2X2YA 3BW9B 2QADC 4AQ8A 3ZDXE 1AHWB 4P5SA 2NUPB 4RISH 4I5BB 4E9TA 1NCAL 3IDUA 2WWNA 3GMMA 4P2OA 1MFDL 3QDME 1QI4A 1I4FA 1NGQL 3VXMA 2OMZA 3G6AA 1R3LA 4R7NA 3FT3A 2R27A 4NO0B 5K9OB 1VZGA 2VUOA 5L2KE 3CBRA 4GG8A 4DKTA 3CN0A 4DZBB 2NW2B 1D7BA 1Z9LA 1N0XH 2IWGA 2XVBA 3R4RA 3NJGA 1O7DE 3N1PC 3FF7A 5DYFA 1K2DB 4U6VH 1OE1A 4JFFA 1CGVA 3AY4A 4LLMB 5C8JB 1PBYA 3ZR6A 3KNBA 4E41E 4N1HB 4PGDA 5FYKD 3PAVA 3VNZA 3S4SB 2XX0A 4ONHA 1HHKA 4D0BB 5HDWA 4R5VA 1UGNA 2GC7C 4NI6A 4LXFA 1ZEAH 3BEWA 5BW7C 1QTYT 3VGHA 1R3KB 5D2LB 1RZKC 3VRJB 5LUMA 2ZAIA 2VW6A 1PLGL 3U83A 2WVSA 3IE4A 4ZMQA 1XEUA 2ZUUA 1X7SA 4G80B 5GRJL 5F7YC 4NKIH 2AZAA 4LGRB 5H4YA 3B2UC 5HVHC 1XSKA 1ZTMA 2J44A 4J2XA 5L7XL 5CGYD 4FTVA 3VD0A 1UXMA 1TMQA 3Q6GH 1H6FA 3H9ZA 3RWCA 3L5XL 3HR5A 1QO3B 1WBXA 4BQBA 3REVA 1A6WL 1SN2A 1FNHA 4QRPE 5FYJD 3EH1A 2DS4A 5BV7B 4LSVL 1FYTE 2NTFB 3MRCA 5FKPA 4ACTA 3IVKB 4EXPX 4ZODA 3MJ9A 1HOCA 4PHXA 1P9MA 2DJSA 2B4CL 2X53A 3DYOA 3H42L 2J8OA 4FN0A 4JUTA 3L5WB 3HZYB 4PVMA 2PUQT 1OE2A 3EDDA 3FTSA 4Z76A 4XI5D 4NKOA 4DZ8B 1CXEA 4DP0X 3GNMH 5IMMB 3V4VA 2YSSB 2IV8A 2N59A 1CLZH 1RI8A 2LU5A 1RZ7L 1XF3B 35C8H 2DQFB 3M17A 3CLFH 4M1DH 3FONA 4RMRA 4LHQB 4MB4A 5E9DE 2IALB 4OB5L 4CC0A 3PXHA 1AJ7L 3MUUA 4ESKA 2COQA 2IPTL 4OQTL 3WY1A 2XKNA 4JJOA 4WGKA 5AW3B 2IG2H 5GZND 1HSAB 5FYJU 2RFXA 2HX7A 2RAMA 4HHGA 4Y2NA 3IPBA 4MJ6B 3P2DA 2NNRA 1HAWA 3DXAD 4W9KC 3TESA 4HWBH 1IAIL 2XBZA 3T71A 4JRXA 2A0LC 4L4VB 4LCWA 3QWRA 4HKJA 4R4BA 4XXCA 4WSGA 1FNFA 1NCHA 3OXRA 3EIFA 4G8GD 1NQBA 3VTMA 2F08A 4WKZB 4FGMA 2NR6C 3FTUA 4QRQB 1RZQA 4AVHA 4GRLC 4JM0A 4GAGL 5FYLH 3CC1A 4MAUL 5BZZA 3TJHC 5EF0A 3KVQA 3HTLX 5I1LB 4MNQB 3GINA 2AC0A 2DMHA 1Y07A 2VXTH 2H7WA 1UT1A 2NX5E 3DV4B 3NCMA 1ZHNB 2FB4H 1UVQA 2FX8L 4M3HA 4O9HH 5I19H 1F4WL 2BZDA 3MV9D 5D7IA 4M43L 4P8QA 5EULV 3T2LA 3BUDA 4XP1H 3OXSA 2H9GB 4M8RA 4UM9D 5E2WL 1MREL 4DERA 3QJFB 4PS4L 1PX8A 4AYSA 4D8PB 4GUQA 1U91B 1U8OA 3CDYA 4MDJA 1EZUA 4QOKB 2WBWB 4FYQA 1FNGA 3KE0A 4ELMA 4IU3A 3Q01A 2GBVA 3CXDH 2HFFA 3RKDD 2Q3XA 4ZAKC 4FULA 7CGTA 1BVKA 2IH8A 3L3HA 4WJ5A 4DGVL 2HJFA 3O2DL 2AV7B 5AVVB 3LEVL 4DOHB 1TJHL 1KCVL 3KPLA 1MXDA 3H56A 1KJVA 1QFUL 4WVRA 3E1F1 1D9KC 4E68A 2JXMA 3MRQB 3QG6B 1TZAA 4JFPB 4D0CB 4ANXA 5FYLE 3MRRA 2D03L 3NPSB 2F7PA 2CR6A 5L2KB 4MWFA 1RPKA 5AKVA 4F57H 4J39A 4JFSA 4L8SB 5IW6A 1DLHA 8PAZA 4N2GA 4ORGA 2I9TB 5IOPB 1SJEB 5TDPA 2XPZA 2E86A 3HG1D 1MCKA 5CFAA 1NCBH 4ATWA 3V0EA 4ALAL 1CDGA 4OLVL 4P2QA 3SDYH 1QSFE 5EPMA 4LASH 3T1FB 1P7KB 4DEPB 3SGDI 4AJWA 1G9MH 1FG2B 1TIUA 2LVCA 3HMWH 3JV0A 4PRIA 3A67L 3U0TB 1Q0EA 3N55A 2CUHA 1OCZB 2BHZA 1U8MB 3QEQA 3GIVA 1FJ1B 3SO5A 3Q43A 2I60L 3AZUA 3C5ZB 1ZLUK 3ZT6A 3S88L 4ACPA 4N1EA 3VW3H 3CHQA 3ZR5A 1RZGA 2H26B 2NY6B 2JIXD 4S0TD 4KO5A 4ABQA 3KYNA 2VLMD 4QRTA 3VA6A 4HVBA 1JHTB 2X4RB 5AYTA 3V9EA 1DSFL 5AOLA 1N70A 4L4TB 1D5RA 2FYYB 5EU6A 2GJ6A 3PREA 3TOPA 3BMVA 4QRPB 4K3EH 1WA2X 5C9KA 2FATH 3MUGA 4MNGB 1PSKL 4N87A 4NI3A 3UO1L 1FYTB 3BKCH 5J6HA 5C0IB 3JVFC 5DRXB 4ODBD 3KWVA 5DEFB 3CHXA 1SVCP 4EN3D 4HJ1A 5ICYA 3APCA 3GI8L 5DUBA 2OR7A 4GBXD 1D2PA 1J1OL 1ND0B 1KPRB 2DIAA 1B0GB 3N06B 4NUMA 4ZUUA 1LQSR 4JO4H 1Z66A 2V37A 4HCIA 2QHRH 1MJ7H 5D8JH 2ZPKL 4GRWF 1W8EA 1KXHA 2R69A 2R0LL 3QUKA 5F97E 4F15C 3UPRA 1GC1H 4PJHE 1EQWA 1ZPLA 3HC0B 2DQUL 1JBJA 5E9DB 1P7QA 4NKMA 4UDTB 1J12A 5FB8A 1QFWI 3EO9L 1X4XA 3QRFM 2ADYA 1EX0A 5I30L 3VI4F 2PO6C 3UFIA 4BUGA 3ZTEA 2PWHA 3EDEA 5I76A 3OZ9H 4P06A 4XN5A 3KLQA 3AT0A 2CPCA 3B2DC 3ME0B 3RIKA 5SX5H 1FHNA 4M8QA 1HSBB 1RJLA 3A22A 2B9AA 1B0IA 3VWKB 4DAGL 2B1AH 3VI3B 3I84A 5T3ZL 3S5LA 4BYHA 4EOWH 3V55A 1NFDB 5LHDA 2Y1YA 2UZPA 3MFGB 4F9LC 1UC6A 4HUMB 4FC3E 4XVJH 1MUJA 4LP8A 4HX1A 2JI3A 2BS8A 2JKIS 2JCCA 3QULB 1TETL 3PXJA 1OLLA 4CC4C 3GSVB 3D52A 4I3SL 4KAQL 4L3CB 5DQDH 2D31A 5F7NC 4KJWC 3GXNA 2NX5B 3RBSA 1AMYA 2F8IA 3K6SA 4HEMA 3LN9A 4ONFH 4XXWC 1CFQB 4XXDA 4ANVA 2LABA 3WD5L 4NQDB 4Z78B 5AVSB 4XC3L 1CGWA 3IDJA 5C86A 2OZ4A 3HLKA 4ZUTB 5J56B 3UBXI 4FKHA 4W9LC 2XYBA 3RG1C 4JJ5A 2EH8L 3EOTH 1QSVA 3F58L 4OZFH 1XGUB 4Z7AA 3K6DA 3I02A 3WFBH 1S5IH 5GIRB 2BMKA 3V5DB 3W39B 1FL5B 1IM9A 3LXAA 1HC1A 1OAKH 4J3VA 4ZJ9A 3LIZA 3QQNA 1PD0A 4WHYG 4AX3A 1EFXA 4MHHG 4LCCA 3P30L 2FTAA 4W9ZA 1F58H 2E0PA 3LNGA 4ODSL 1EHLH 1QW9A 1S3RA 3Q2NA 4I2XE 4V2CB 4XNZB 3JYBA 3RPIA 1EIBA 3AITA 3GXPA 3X1BA 1PAMA 2NXYB 2Z0BA 4FQHB 1B4TA 3O0RL 3CDGB 1S8DB 3MCKB 2HRHA 4ZZKA 2GY5A 4W81A 2DQJH 4J4PC 4FXGB 3MLWH 1OAQH 3NA9H 2XBTA 4OIAA 3BH8A 3Q2VA 3U9PH 4FXKA 1XF2B 2R7EA 1NGXB 1VENA 2YGOA 3B83A 3MREB 1VKXA 1QSFB 3ORJA 3AJ7A 5D7IF 1DP0A 1QKZL 2WXKA 4FQ1L 4NYLA 1OM3L 4IBLT 5IHHA 5JW5B 4XBMA 2J6EL 4ZO6A 1H3VA 2CRMA 5FPIA 1C08B 3OAUH 1KCWA 3QXAA 1CE1H 4V33A 5H8DA 4OD3H 4ELMF 3UAAA 3IAPA 1ZLWK 4H1LB 2DY2A 2XYCA 3T0ED 4XODA 4W1TA 2Y7NA 1C16A 4BJLA 1FZKA 3CFUA 2XWTA 2BVUA 4P59L 4JM2B 4DH2A 2J71A 1DANT 3I6LD 5IFJB 7FABH 4HCRL 1OK8A 3QT2A 4AWJC 4UIKL 4V1DA 2AJYH 3BSHA 1GHFL 2P8MB 4NSKA 2W5PA 1G94A 4LSQL 3WKQA 1QWUA 1YUHA 1BZ9B 4ZUWA 5G55A 1AKJA 2CRZA 4HC1H 5FA3A 5EBMB 4W9EC 1NTDA 2VR4A 2ATPA 4WIQA 4H8HA 4WO4C 4N28A 5EN2B 3ROOA 1RMFH 3L45A 4TNVK 2HT3C 4LKXB 3OAYK 2F7RA 1GA2A 4KVCH 2OTWB 3G6JA 3MC0A 3QQDB 3PLYA 3SHSA 5BJTA 3WTVA 1I85A 2ZXAA 3FB8A 3HMXH 4JPKL 4HIJA 1E6OL 1JDCA 3MBEB 3GJFA 2PR4H 3SD5A 1O9WA 2VDMH 3BW9A 4NWTL 5J3HC 3UC2A 3QAZC 4P2AA 2DLFL 4Z9KB 3UTZA 4FDWA 4UT9L 3VGFA 2JTYA 5E00B 3VSQA 1D2OA 3TNMB 1PEZA 3QUXC 5K9OA 2KZBA 4NZTL 1EEZB 1I1AA 4ISVA 2NW2A 4PQXA 4HH8A 5DD5H 5SV3A 3JV4B 3AABA 3LNHA 4YL4A 3FQTA 4GKNA 3UG3A 5IGXH 1BG1A 5C0BD 1JGVL 3NABL 1EDYA 4FFTA 1JPSL 5C0CE 3MGTB 2YRPA 3CFEA 3LKOB 3AXLB 1IM3D 1UA7A 1DBBL 4X6DE 2GW5A 2CA4A 1MFEH 2C4FU 3G5VB 2GAZA 3SZ6A 1RFDL 2P3YA 1DUZA 1G7HA 3OSKA 4PRBB 1TOXA 3QNYB 4DP9X 4YDIH 4FHBD 2J1YA 3DOSA 4HIHA 4P4KB 3BUPA 4Q6IB 4Z7QB 2ICEC 3FSOA 4Y5XA 4D3CL 4HGWB 3E6HB 4P46C 5D2LA 3QS2A 4KRPB 1THAA 4PG9A 8FABB 2K6YA 2OTUA 4ZXBA 1SDAB 2H2SD 2EUVA 4LLQA 2MH4A 5CHNA 4XP4L 3TZVA 2UXGA 5CCKL 1RJYB 5IQLA 5JXEA 5MENE 3GK8H 1NGWA 2EO7A 1QO3A 4GW5A 4TOYH 5EEUA 3PP4L 5LDSA 2ZICA 2O6EA 3VXRA 2B39A 5CIPB 2EH7L 1BJ8A 3SDAB 3MLTB 3IVKA 1WE5A 3NVQA 5IVZB 3W9DA 3CZSA 1CZ8H 3UTTD 3T08A 2BO0A 3JUYA 1L9QA 2FEEL 3HCVB 4RGMC 1M3JA 5CD3B 3HZYA 1IC1A 4MVBD 1LGVA 2EDYA 1MFNA 1D5MA 4M6NH 3N9GL 2WXMA 1Z7JA 4M02A 4KXAA 2CG9X 4N8CH 5F71A 2YSSA 1GMIA 4K7FB 4G8GE 1XF3A 3VDCA 4X4ME 2XG5B 2KHAA 2JCCF 1XX9C 1A6ZA 2IALA 3OQRA 3VU2A 4E9LA 1KIQA 1KXVA 1OAUH 1X5LA 3UTPE 2H2PC 1N18A 3GQFA 1GZQA 3TIDA 3ZZLA 2WCGA 3MYZA 4MMZC 2GEQA 1CWVA 3U1PA 3AWFA 1HSAA 1NAKL 4LVOB 4U0QB 4URTB 2GBTA 4RETB 3LQAL 1F02I 4YWGH 4OZFB 2FGZA 3Q6GL 1OXYA 3TVMC 1P4IH 3HB3C 1KENH 3ATAA 1TJXA 2F0CA 4XNAA 1LO4H 1JXFA 1BMWA 5I15H 2ZNXA 3DETC 5L6YL 1IB5A 4A2EA 4WKZA 3LZFH 4PD4K 4QRQA 1Z5YD 3AFLA 2D7PA 5A6IA 4TSBL 5I82A 5GGQL 3J2PA 3SGJA 3H4HA 4XBEH 4MNQA 3NCYS 5AOIA 4UM8A 2NW3B 5KSAD 1CFVH 3ECQA 1ZHNA 4PV1C 2LW3A 2YA0A 3VX1A 2R9HC 5A16B 3LPOA 1RUKL 4F1SA 3ARED 2H9GA 2X3AA 3GNML 4NQEE 1G1KA 3QJFA 2EAEA 5TF0A 2KDGA 35C8L 3V7MA 1FFTB 2BY0A 3U4BH 2H0EA 4ODXA 4PVNA 3EFDL 4QOKA 3ZE2B 1UH4A 4I87A 6FABH 2IAND 3MNWA 4UT9A 3N5AA 3QIBC 1K4CB 4WFHD 4YHOL 4F58L 2YZ8A 3T0BA 4GH7B 2AV7A 2IG2L 4EO5A 4Z6AT 1AY1L 3HI6H 1BECA 3EBGA 4OLZH 3MGAA 5D6DC 2BSSB 3FYEB 3KPTA 3X13B 1GL4B 1WA1X 3MRQA 3QDMA 3QG6A 2XZAH 1TMCB 1VESA 1E4KA 3V6ZB 4JLRA 5A2KH 3RURA 5JW3L 5L2KA 3KYKL 2ITCB 1W6LA 2VLME 2EO9A 4Y9CA 5I6OA 2I9TA 2FECL 1HAUA 1SJEA 4GEIA 2B14A 1REIA 3CZJA 3L3DB 2HN7B 4WWKB 5B1JC 4C4KO 3O3AB 5HYIA 2E9GA 2CKBB 2NT1A 4LEXH 2OP4L 1JF1B 1P7KA 2CK0H 3PE9A 4XN4A 4E41A 1FG2A 2FB4L 1SJVA 3IFLL 5I19L 3UTSE 3WNKA 1SRDA 1JD9A 3OKMA 1E9PB 4O02L 1JPTL 4XP1L 1GIGH 4IRZA 1FJ1A 1VFOA 3C5ZA 5CCJA 2WP3O 5JORB 1JZGA 1ET8A 3G6JF 5F7EH 5I0VA 4FQIL 4XP6L 2L7EA 1F6LL 1HKLH 4JZNB 2X4OB 1NCJA 5F88A 2GJZB 1ZANL 3U30B 2V5RA 4IIZA 1L6XA 4CSSA 1CLOH 4C83B 3MACL 3MLYH 2JQMA 4WV1C 1MG2C 4NO0D 3ULVF 1DUYB 1IAII 1J9RA 4YZFE 1NCTA 1SHWA 2YD7A 1UA6H 3N2JA 4QRPA 3CFCL 4KUZH 5DUML 2E7CA 5D93B 5I6XC 1AZNA 3KR3L 1QD0A 5C0IA 5IM7A 3HVNA 1OGSA 5E6YA 5DEFA 3F5WB 1IJNA 4LSRL 5GS0H 1PZ5A 5T3ZD 4N8UA 15C8H 3QZOA 1EDHA 4QCIB 1GPOH 5FECB 4UT6L 5DGQA 2P24B 5B7MA 3LB6D 4HF5L 1UWGH 1KPRA 4LASL 2O6CA 1UB5B 3MI6A 3PPSA 1KCUH 3G5XA 1T21B 4KK9C 3PHQA 2WYTA 2B3IA 4L23A 3TN0A 4DO6A 1U8LB 4UQEA 2PWDA 5D2LF 2VIRA 2EDJA 3HC0A 4ORZC 2VISB 3PL6D 4A2FA 1EXUB 5I5IA 5E9DA 2CO6B 2G3NA 5I1AB 3DBSA 3MV8E 3QO1A 4CN1A 3X1EA 4FOMA 5DJCB 1ESOA 1KELH 3QQ3A 5IMOA 4PUBL 3S35X 4BZ2L 3WTUA 1BZ7B 2G2PA 3CBKB 1H3PH 2VSDA 1F8TL 4ZBJA 3OWRA 3OZKA 1HSBA 4NRZB 3Q48A 3SCMA 3CCHB 1U33A 3FCGA 3S9DB 3P11H 3OLEA 2XWJB 3EGXA 4PS3A 3M8OH 1DN2A 5FDYA 4UQBA 2BSDA 3CC5B 4P49A 4AIZA 4K3EL 1ZA6B 3IGUA 3VD7A 2QVTA 4K8RC 1I3UA 4LPVA 3KAAA 1FH2A 2A77H 1H3TA 3EG9A 4WW2A 3KLHC 2KLRA 5CGMA 1AD9A 2ZUWA 3FO0H 1AANA 1CQKA 5SWZD 1ZGLB 2CDFB 3QUMH 1G1OA 1QHPA 2VM4A 2B59A 2NX5A 1MLCA 2YGPA 2Z31B 4IMKA 4KXDA 2HB0A 1JIBA 4W9CC 3LPPA 1OB0A 2V7HB 4Z78A 1MJ7L 3CE1A 1KN2H 4ABWA 2COVD 2ZCHL 5L2JB 5A7BA 3PAUA 3QWOB 1B2YA 1GC1L 3WTTA 2PYED 4ETYA 2EUWA 1N6VA 2VN7A 3PGCB 4WTXA 1PTZA 1C12B 4MMXC 5GIRA 1BPLB 1FC2D 2KDYA 4K23L 1B90A 1FL5A 4HWBA 3OZ9L 1RHHA 3KXFD 3QQ4A 4N6QA 1U95A 1EV2E 2X0VA 1EMTH 2HFGL 2W9EL 2O5NA 3BAEL 4JGNA 4FF9A 4UYQA 2CLRB 4L9LB 3RY6C 1NC2B 2BIIA 1T1WA 4ZW3A 2HLAB 3CFKB 4L4VD 3P0YH 3IWUA 1XB8A 2Y69B 2UY7B 5J06A 5AW5B 5FOJA 3LPGA 3BMWA 4GS7C 4XVJL 4AH2B 4MQ7A 4YIQA 1XF2A 2ETWA 1NGXA 3MLXL 4L8BB 1HL4A 1MXGA 1QSFA 1EAPA 3DYPA 4UV7H 1JPGA 1LJMA 2ZSVB 3BP7A 4Z0BL 4H13C 2D7TH 2NLJB 3EJUA 1UD8A 3ISRA 5AKSA 2JLLA 2BIOA 1S9VB 4LCIH 4RDQF 3EOAB 3D4ZA 2KS0A 1NKOA 3OJ2C 1MVFA 3IDIB 1O6SA 1OALA 1ZD6A 3K2MC 1AAJA 4KK5C 4XMZA 3SYCA 4KKAC 5JZ7C 4Y5YA 3KPMB 2EXSA 1DBKL 1G7MB 1DCEA 2AXGB 1HVXA 4DP4X 4D2NA 4JZJB 4JM2A 4GLRI 3B5HA 4P0DA 3WFBL 4PCKA 3G5ZB 3UTOA 2MHAB 4JDTH 5IFJA 3ZDXF 1A3RL 1DQQA 2FWLB 2XV3A 3ARBD 1S7RA 1WGVA 3PHOA 2DTSA 1I8MB 3K8KA 4WEUD 4A7GA 1AD0B 1V10A 4HZLB 3A6BH 4ZS6D 1GGUA 1CLYH 4QUOA 5EBMA 4AL8C 1NUFA 4HJEA 4OIIL 4H2CA 4I3GA 3BGFB 3JXAA 4LKXA 1KTLA 3B5GA 2KLTA 2PXYC 2DQJL 3NIDE 1ORSB 2NY0D 2JJTC 2OTWA 5HHXL 3V4PH 4U1GC 3U9PL 5BRPA 2HTLD 1NCIA 1A4JA 2YAPA 2A83A 4YSSA 3FCBA 3I50L 5GGUB 1A25A 3QORD 2AXFA 3ESMA 5E2VH 2VDPH 5JHLH 1BAWA 2GTWB 5JPMA 1J0ZA 5E00A 4YVNA 1TFPA 1LO2L 5HHVH 3QFJE 3SZKC 4UB0L 1MIEL 4PD4J 4HFWA 4PJHA 1ACYH 2Q8AH 2G4EA 4OD3L 1EEZA 1HESA 3FUHA 3UZQB 3JV4A 3TASA 1DQML 2HLFD 3MV8B 2NY6D 4UM8B 2OXGA 3MKGA 3IFPA 1WP6A 3SDDC 3NJHA 4FFWC 1H3GA 3TIEB 4U1MA 3TH3T 3LKOA 3AXLA 4LARH 4RFNC 3VXNA 5BOPA 1IMHC 2CLVB 1GGIH 1TLMA 3G5VA 2N0MA 4HJIA 3LXBA 2XA8L 2QQNL 2CXGA 1EANA 4CDGC 2BP8B 3WN6A 4Q14A 3TO4D 4L8CB 3QWNA 3HW7A 2EVHA 4P4KA 2ZONA 3CVBA 3I6KB 3WG7B 3OKKB 4IQHA 3RX9A 1DVSA 2CKBL 3WNJA 3SQRA 1FNLA 1GTNA 2YPKA 3NJNA 5EMYA 4PM1A 4HGWA 3CUPB 3E6HA 1URLA 4FP8H 3UTTE 4AMWA 5HBBA 5K39B 4YUEH 1JXKA 1YO4A 3IRPX 4YSPA 2EXTA 5IF0B 2ZX5A 8FABA 4PGBA 2LLLA 1PQZB 2Q2LA 4ZFOB 1F4YL 1IEBB 4PJIE 3ZSTA 3M1OA 1I7RB 4W9HC 4ANWA 4Q56A 1RJYA 3VGGA 4S1RL 3MR9B 4FL4B 5E03A 1WG3A 3R4DA 3B3BA 4MA1C 4F7PA 3TFKC 1T20B 3IMRA 4I77L 1WFOA 1MNUL 4M61A 2BDNL 3LKRA 3DHJA 3LRMA 3SDAA 4MQTB 3MLTA 2JB6B 2XNAA 3GB7B 4AZUA 1FH5H 2R0ZL 2ORBH 2YAMA 3WE6A 5D7JA 3HCVA 1D6EA 1SLWA 3ETBJ 4B9GA 2AEQL 5CD3A 3Q8CA 1KG0B 2O72A 1KJ2H 1MFEL 1AFVL 1L0YA 2OYLA 5C6TH 1IC4H 2XVLA 4I2XA 4JMXA 4UINH 3AW5A 2QADB 4FNLH 4YO0A 4A67A 1OP9A 4JPVH 4KOCA 4K71C 4FJZA 4ES9A 4WW2F 4Q0XH 4BFOA 1J8KA 3L5HA 2GPZA 4XCFH 1E4XL 1R3HB 4KKBC 5FM8A 4EDWH 4F3FA 2MNJB 4OFDA 3S3BB 4YSUA 4YAQB 1VAHA 1L7TL 1RIVH 3DRTA 4IEFA 1RD6A 4KNTA 4JK0D 3H2WA 4R0LC 5ADPL 1N8ZB 4P23C 1AZRA 2UWEB 4NQDD 4OZFA 3MRJA 3GK8L 3HUJE 1CTMA 1B4RA 3FAXA 1IBGL 3ARUA 2W59A 3WXWL 3UG4A 4RA0C 1AACA 3P4OA 1ETJA 1RK0B 4QHNB 1BVNT 3LXUX 4CBPA 4L18A 3UAJD 3VU1A 4QR7A 4N2HA 4ZD3H 4OLUH 4L1LA 3BVVA 4MQXC 1ZLDA 2FLRT 2C9SA 2Y36H 2DBLH 1M2VB 5T5NF 2WJ5A 2X41A 3DJTA 2CALA 1MEXL 2XTLA 4X83A 5HVHB 5CJQL 5A16A 5E8PB 3K2UL 2P5PA 4K4KA 1CICD 4RGOH 2FWOA 3OHMB 3FN0L 1HNFA 1MWAL 3C87A 4WUKL 4F92B 2A4ZA 2X6UA 2Z35B 1J0YA 1MJ8L 1MG3C 1P5UC 2M83A 4OCSL 5EDSA 3ZBMA 4NZ8A 3L6FB 3BP4B 3L7EA 1E4HA 2E6QA 1KIRA 5ITFB 5E6ID 2N7SA 5DK2A 3MJWA 1MPAH 4MXQD 2BSSA 5IVXF 5I1KH 5IBUB 3RVWD 3LZQA 2DKMA 2YC1B 2NSXA 1IBZA 1JPEA 2IDSA 3GBMH 5HYEA 3QFJB 3RTQD 4S1DD 5GJTL 1AGCB 1OAXL 2BCKB 3B37A 3FUNA 5HI4C 3VFMA 5IZ7A 4Y2DC 4BA8A 3QJXA 3MRPA 1I8UA 4JM2F 4JRWA 1U3NA 1CS6A 2X1XR 3RGVD 4YDZA 1DTUA 5CGTA 1IQWH 3BAJA 2P52A 4HC1A 5C0CA 1FGVL 2M1KA 2WBJD 3O3AA 4X6DA 4ANKA 2FEEI 3RZCC 4AQ1A 5CR1A 2WLNA 4PJ9A 4UAOC 4A7GF 4OGXL 4PJ5E 1LP9E 3QB7C 4XMXA 4TUKH 1UWEH 3LH9A 4MLSA 1IX2A 4Y0GA 3AB0C 4E9WA 1WFNA 2QTVA 4OV5B 1IQDA 3S0PA 1E9PA 5GXBB 5LG6A 3HMXA 4PFEA 4J5VA 2VKWA 1O0VA 3B7YA 1XGTB 4DPCX 1S7TB 3P0GB 4OCLC 2ZD0A 1U8QA 5B4MC 1QHOA 2DBJA 4QYAA 5MERB 3BCFA 5IT2L 2VDPB 3TEXA 3LEYH 4MB5A 4M9OA 4LCYB 2O1AA 4JY5H 3MBED 2PP9A 3PABB 4AC2A 3IF1A 4W6WB 5ISZB 2HX8A 2G5RA 1U4FA 4OLXH 4PJIB 4WSJA 3DHUA 4C83A 4PREA 3LSOB 3L13A 1V7MH 5MENA 1FBIH 1OF0A 3WMPA 1G7JB 5ESVA 3QNXB 4PJHF 3TJEL 1DUYA 3MAWA 3OBAA 1URIA 1Z0MA 3O3DB 2VLRE 1HXMB 1UD6A 4LBEB 4OUUB 5GJSL 3F64A 2G9KA 1Z6JT 4OJFH 5I8OL 3AXIA 3KYOB 4L2LA 5EEXA 5FUOL 4AITA 2X70B 4OCXL 3HJEA 3MPCA 4QCIA 1A7PL 2EVGA 4IW4C 4ODUB 5FECA 2CJSA 2P24A 3O41B 3WEOA 1MCOL 4LEXL 4WW1B 2CK0L 4UV4H 4PJFE 2YN3A 3H9HB 2K0RA 5IUSA 3BE1H 2L7QA 3QJHA 4ZS7H 1YPZB 4G8GA 2QL1A 4X4MA 1GIGL 4KRPD 2AQNA 5SWZE 5C08B 2IGFL 3NGBB 5F7EL 2I27N 4AYDC 5T8IA 5DJCA 5F7BA 3MV9A 3TA3B 2YARA 2V8MA 3Q5YA 5J9PA 4I0PB 1KTCA 3N3EA 2ZQKA 3F00A 4IRJB 4P2RE 1CXLA 5J11C 4ZFFA 4B60A 1CLOL 1TVHB 3OSVA 3SPJA 5D1XE 4KH9A 4NRZA 2PYEE 5EBWA 1TTUA 2NY4B 1VCBC 3LN5B 2XWJA 3KPOB 4KITB 3NT0A 3OR7A 4IGBB 1CBVH 1RVFH 1ES0A 3OKLB 5A40E 1KJ2B 2EC8A 2F5BL 1JOIA 4ODVL 3TV3H 3ULSA 2FECI 3HKZA 2E59A 1E5BA 3NCWA 3NRQA 15C8L 4ZOEA 5IB3B 3CK0L 1MRCH 4MKMA 4I8DA 4P99A 4DGYL 3DHMA 2A9ML 4HOZA 4AJ0A 4OGYH 2ZWZA 4NQEA 1T66D 5BZXA 3HBPA 1LDSA 4RX4A 4WLCA 1QSEE 4R84A 3P73A 4ZFOL 3LIUA 3QWOA 3ESOA 5EN3A 5HYQB 1IL1B 4GY4A 3WJMB 1C12A 2DI7A 3MRIB 1MZYA 4JDEB 3QPXH 3VQMA 1GAFH 1XGZA 3ZRCC 3R7RA 1JFQL 3GTTA 8CGTA 4CGUB 1IKOP 1H3PL 1P53A 2VLJD 4X4XB 1OSPL 3F7LA 4F24A 3TA4D 5DU7A 2B0SH 3EUDA 1XZ0B 2CLRA 4E2OA 3WAJA 1TITA 1NC2A 3LNDA 4H7VA 3KWTA 4A2HA 3UDWA 2HLAA 5AW1B 2GG1A 5KVGH 3DX9A 5E1AB 4D94A 2HSIA 1YCSA 2UY7A 5IHZB 5IB2A 4HIQA 5MEQB 4C4KT 1YDPA 1BVLB 2J8HA 4AH2A 4B9JA 2IADB 3RHWK 2VSCA 2CU9A 5ID1B 1PVHA 1LWHA 4WHYH 4L8BA 4AENB 5BXFB 3BKMH 3FO0L 4HOWA 4N3UA 4PJ5B 5CEZH 3UERA 2PO6B 3BLKA 1M6OA 2CUIA 3NCYP 1B4JH 4N8VB 2NLJA 2NTSP 3RIAK 3UTSA 2GC4C 3RDJA 3R1GH 3SDCB 1S9VA 3L1OH 4ZW7A 4N2EA 3EOAA 1JV5B 1KN2L 5I18H 1YYMH 2WP3T 1J7VR 1JTPA 3MZTA 2DQDH 4EN3A 4P5MA 1JGIA 4WJG3 3E9TA 4GBXA 2IFFH 1YEKH 2IMNA 3QIWB 1JZ6A 1G7MA 1H8LA 1S78D 3BZFB 4LHUB 5EORH 3MUHL 1RZPA 2Z9TA 2BWDA 1OB1B 3IDMA 1NGPH 4OZ4B 1GW6A 1NPNA 3BN9D 3E6FB 5CCGE 5KVGE 1CYWA 4KMQA 5IB5B 1GGBL 2C3HA 1I8MA 5GGSB 5IBTH 2ZF8A 4HZLA 5DFVD 1SEQH 2FT8A 1EK3A 3QHZL 5TGBB 1VA9A 3IJHB 1RZKL 3W5MA 5F44A 2WW8A 4TTGA 4KFZC 1GRWA 4PI0A 1IFHH 1WQVT 2CIKB 3QUZC 3ZMRA 5CEZE 4KHXL 4U1HB 4YHLH 4WTWA 4WWKD 1ORSA 4X6DF 5AALA 3LTVA 2R4RL 1AGFB 1GS6X 2R1WB 3VXUD 5AG8A 1U41A 1JNHB 1KBGL 3IPFA 4GUCA 1TT6A 5GGUA 5HHPB 4XNUL 1X5ZA 3T3ME 1QASA 2PLTA 4Z1PA 1HIML 5EU3B 1AS7A 4RCAA 1LWJA 2F15A 4KU1A 1UZ6E 3MCLH 4U0RC 3QE5A 1TQBB 4K3HA 1RUPL 1GGYA 4U1SA 4BSVB 1KC5H 4IRSC 1KLGA 1GW0A 3OKNB 5DYOA 5CEYA 3UZQA 5F9JB 1FLRL 3BP5B 4K55A 4UTCA 3W56A 5BS0D 5HYJE 3MV8A 1DBMH 5DT1L 4GSUA 4PLOB 2Q7NA 4M6MH 4KI5C 3TBWB 1DQDL 2BVQB 1SYVA 3TIEA 2QR0A 4P2RB 5IMLA 2OKMA 2XCMC 4MAYC 5D1XB 1T7YA 2N56A 3UROR 4LRNL 4OTXL 5FGCE 4OJDH 1XCTB 2R2BB 1J1PH 2C9UA 4UUJB 4KTEH 5DDHB 5L8KB 4L8CA 1M53A 4R2GB 2LLNA 3MBXL 3V0WH 3V0VB 3I6KA 5AW7B 4UT7H 3OKKA 3QISA 3IETA 2DH2A 2XC8A 3T4YA 1CL7H 4G7QB 4BE5A 1R6VA 1W0VB 2L8AA 5BUAA 1JHLH 3UACA 4EEEA 1MFAH 4HPOL 5K39A 5D96B 1TQWA 3CFDB 4P5RA 4CAGA 1YY9C 3DMMD 5AAWC 1PQZA 3D39B 2DKSA 3NFNB 1NGZB 4FG2A 4YHIA 2CA3A 1YMHB 6TAAA 4NQTA 2J6WA 1W15A 4TVPL 1FN4A 4NO3A 3U9UA 5KWYC 3MR9A 4MA8H 2FAUA 1MFBH 5HHVL 5K9KA 4EAEA 3MUJA 1QSEB 3AS2A 1NANH 1ZTXL 2WVVB 2Q8AL 1K85A 3GDBA 3OPUA 1HI6B 3T0WA 4QXUL 5E08L 2JB6A 2QVKA 1XD0A 3P9MB 4XPHH 2P26A 4YHNA 4F7EA 2FBJH 2YPLB 5DLMH 5AD0B 3A6OA 4NRYA 1QVOB 1CU4L 2PCFB 3MRHB 1S2EA 5F70A 1EVTC 3TBSA 2XN9E 5DQ9B 2GSGB 1HEJC 1RUMH 2X1QA 2ZCLH 4XMKL 3GIZL 2VJXA 3VFUA 5M95B 3QEUB 1F4XL 4QNPE 3DTXA 2G3ZA 3QAZB 4Y9FA 2ZXWB 3QUMA 4LDOB 4EUPG 2Y6TE 3FT1A 4G1MB 4HKXB 2BOCB 3QUXB 4JKPL 1JGUH 1XAUA 1NEPA 1NMBH 4YAQA 4NQUA 1BD2B 5IROA 3WS6A 3TC9A 1GZHA 2OK0L 1O5DT 1PG7W 2AFNA 2Z31D 1WBYB 1NICA 2Q0ZX 2KMWA 1N8ZA 4N0RA 5I71B 3OC8A 5JUEL 3STBA 4AT6B 2GTQA 2DZEA 1LEIB 4JZOB 4WY7H 1TTAA 1RZJL 3QUYB 4RLDA 1F11A 4YXLH 1U8HB 5D1QE 3TNNB 1C5BL 1MVUB 4M5ZH 2NY3C 1BPVA 4OZIE 3BC9A 4PRPD 1YEFH 1NCUA 3MLZH 4X8CA 3WJJA 4XR8C 3CX2A 4G43B 4QHNA 4R26L 1N6QL 2E27H 3L3IB 5CD5C 1SY6H 5IFHL 1FH5L 1BVOA 1HHHB 2ORBL 3FNKA 4YFLF 2EIJB 3F7PC 5DD0H 5E8PA 4AZ8A 2J1WA 5EO9B 4YX2L 1N8OE 1OTTC 4OZHB 5CZXC 3GMLA 3ZRFC 4FNSA 2HYMA 4ERSL 1NEZB 1RIHL 1BF8A 3U48A 1H0DB 4KWUA 4I89A 3RY4A 4DKEH 5T1KB 1YN7B 1N19A 1U3JA 2D0FA 2Z35A 4G9FB 4J27A 4RAUA 5AEAA 2H6PA 1RIVL 5DJ2A 1OV8A 1TTFA 3BP4A 4B95C 5JQ6H 1QWNA 2YZ1A 1OSEA 2ZWYA 4WFED 4XNXL 5ITFA 1G7LA 4KPHL 3T3MB 4GAAA 4HG4J 4W9GC 3EFFB 3MOBH 1LMIA 2Z3FA 2AVGA 4J6RH 3L3KB 4BZ1L 3EO0A 1HOEA 3BQUD 3F7RA 2YO3A 3RWGB 3KMDA 2X28A 1QNZL 1L3WA 3QFJA 4C4UA 4M7KH 2ZCKL 1AGCA 2BCKA 5TTRA 3Q3GB 1B9KA 3SOBH 4X6FA 1NBCA 5DA0B 5GS1A 4H88L 5HYJB 1B2WH 4YS4A 4KXZH 4DGIL 4PLNC 1G0YR 3C6LA 3FTVA 4ICWA 2CCLA 4KQ4H 5GGTA 3E7JA 4PJEE 2PWFA 5E23A 4GJTB 5B38A 4FNQA 1WD9A 3HRZA 4QTFA 5HD8C 3UP6A 4ABVA 2R2HB 3GBNH 2IWFA 5KVDL 3NIFF 4MMZB 4BDVA 2ZXGA 3OF6A 4YZFF 1WF5A 2ZXDA 2G0LA 4OD1L 1BBJA 3V4PA 3IJEB 5FKAB 3QZNA 3ES6A 3L4CA 1S7TA 3UABA 2DMGA 1I9IH 1OARH 2CSPA 3MJ8B 2OMTB 3HB3B 3UTTA 5L0QC 5AKTA 5MERA 1E4XI 5LG1A 4BQ6A 5JHLA 2JE8A 1IFGA 3WUZA 1OAZH 4LCYA 5FW8A 4Y4KC 1TPXB 5JR1H 2QGBA 1S7WB 3PABA 1G9NC 3WXVL 1ID5I 1BM7A 2I07B 4PJIA 4XAWH 2CJUH 4XN2A 3MZGB 1JN6B 2CAKA 4KK6C 1ZA3A 2C1PB 4KHTL 3JZ7A 3L95A 1AGEB 2ZOWA 2GT9B 1SMDA 2J56A 2X4UA 3MV7D 4FQJH 4LAJH 2APBA 4A6YH 3GSRB 1BDYA 2JK5A 3E8UH 2DJMA 3SIKA 1QRKA 5DJAB 2AEPH 3O3DA 4RGNC 5JHAA 2H8PB 1CTNA 3DNKA 1YY8B 3KYOA 1OE3A 1K5NB 1MLBB 3R0NA 3I6GB 3Q2LA 4AW4A 1WICA 1SDDB 2X70A 3HZVB 3VGEA 4LCVA 1D7FA 4P9HH 1QQDA 5MI0B 4M93C 4GQPH 2E8ZA 5F9WC 4L0ZA 3DWTA 4WW1A 4AQOA 1HKFA 3KEDA 3MROA 3H9HA 3T8XB 2UYLA 3CHSA 1NFAA 5MHSD 1AO7B 3O2WH 2FWUA 1Q94B 5I1GL 2EYSA 5LBSL 1GOFA 1XGQA 3ENEA 3LVEA 1T83A 2AK4D 2DYPA 4OV6F 4PJGE 4WUUE 1QPXA 1DJWA 1QLRB 4DGUA 5KVMC 4C4BA 4YK4B 3B34A 3RGHA 2NNAA 4NJAH 3TA3A 2O6DA 1INDH 2KI6A 1JL8A 4I0PA 3PF2A 4U6YB 2DI9A 1TVHA 1KLUB 2Y6SD 4NUPA 4HYTB 4LU5H 4XCEB 4PS7A 4OCWH 2ZE0A 4R4ND 3IKCB 2AHIA 2O61B 3HUJA 3HKFA 1E67A 3DVFA 3EYFB 4WI2A 5D1QB 4JRLA 3KPOA 2YKKA 4F91B 5CZKA 5A6MA 3IDXL 3WIFB 1LEGB 5EO1B 1TZHB 3CZFB 2HVKB 2BSED 3TEWA 1KJ2A 4U7KA 2A9BA 2W0FB 4J3TA 3F7KA 4G7VH 3AQZA 3JT2A 3K2IA 1I9EA 1HXYB 2DQMA 4WO0A 3OKYA 5CEXB 3S37L 4QWWC 1H5BA 3CFQA 3WS3A 4UV4L 2ICWJ 2YWZA 2QADD 4PMFA 4NEHB 4B5ZA 4F9PA 3KVPA 2H6OA 3EH2A 2Q1EA 1AGDB 5I74B 2Y7OA 4AGPA 1MCEA 4A2DA 1U93B 5KW9H 5K9QG 2APVA 4PSRA 4GFTB 1LDPH 4IBWA 5D2NC 1PYWB 5FK9B 4EI0A 2ED9A 4IYKA 4JDEA 2EINB 1CD9B 5FV2A 4K9EC 1IGIH 4BK4A 3TPUB 4Y9EA 1H15B 1CFTB 1RUQL 1Y1DA 4BK5A 1Q4NX 3K6IA 4AEEA 3TYFA 2AANA 2X9WA 3QIUB 3UIYA 3CQFA 4YSEA 1A7RH 1DJYA 2FX7L 2MQ0A 1KGJA 3F7QA 2EVJA 5C0AE 1DSYA 5F8RC 5MEQA 3TEYA 1N4XH 4IBUA 3FSWA 2VWEE 3CFBB 1BVLA 4X0KB 4GO8A 3TV3L 2NY1C 1CFNB 1E9OB 2IADA 5ID1A 1QBLH 3SE9L 4P4RB 3HAEB 3U2IA 2DD8L 2R0KH 4U4IA 5GISH 3B9VA 3NQIA 4NENA 4HS6B 4PJ5A 1LP9A 4TUJA 1GR7A 3LHAA 3S97C 4LVHB 1HEHC 4XTRC 1D5BA 4N8PA 4OAWA 4X8JB 4G6FD 1Y6KR 4LVNC 2IBGA 1JV5A 1LD9A 4OGYL 5DO8A 4NGHL 1ETZA 4O4YH 1N0LB 4OJCA 2ED7A 3NIDF 2Z8SA 5DUPL 3EGSB 5LGHL 5J6GA 1WUNT 3LDBC 3QIWA 4LLVB 1AZZC 5EH1A 2DQIH 4G9DB 4C56E 2ZOKB 1BOGB 3BZFA 2K4AA 2VXQH 4NM4H 3RI5K 1TZOA 3RX7A 3QPXL 4RWHA 1CR9H 4G1EB 1J9QA 2Z8RA 3E6FA 2VSKB 2WSPA 1CXFA 4JB9H 1VDGA 5DJ6A 3ECUA 2WSKA 2IF7A 1JNLH 1M7IB 4XPGH 2NY5L 1GKOA 4NN5C 1T2XA 3IJHA 4XP5L 3R8BB 4ODWB 4AW7A 2DM3A 2VLRA 3CHOA 2DQEH 4NNYA 3TBYB 5C1MB 5KVGL 1CK0L 1QR1A 3D85B 2G2RA 5C07E 4X9IA 3I6SA 1NZRA 2CLZB 1NFKA 4ZUVA 4DN3L 1SZNA 4P05A 1YAIA 2HX9A 6PCYA 4MD0B 4L1DA 1AGFA 4AQ8C 5K9JL 3FK3A 5IFAL 4PW9A 5ICUA 2E8YA 3H9SE 2YAHA 2XTJE 4P2OC 3D50A 3LOWA 3TV8A 5HHPA 1FO0B 1MSPA 3N42F 4PJFA 3NACL 3E3QC 5IQOA 2GB2A 2NXZB 3QK0A 3U6RB 4X7TA 3L3OB 1AI1L 1ET7A 4X42A 2OSWA 3CMGA 2DTML 4ZW5A 3COOA 1QZNA 1YVLA 4IK7A 4BSVA 4PJGB 4WUUB 2X6BA 2DN7A 4TVPD 3OKNA 4J3UA 5SWZA 5F9JA 3BP5A 2A0LD 1EGJL 2AQ3A 3KL5A 2YLKA 3AY4C 3SKOA 4FQQB 4EI5B 4WQOA 3TBWA 5HDBE 4M7JL 3WIHH 1TTGA 4PJIF 2AJZB 43C9B 5ISZD 4K3JH 4A6YB 2H3NB 2QGEA 4GS7B 1KNOA 1E5CA 5H2BB 3BO8B 4P2RA 4GRLD 4RAVA 2VDKB 3TJHD 1V7NH 5D1XA 3RWJB 1Q0YH 2PYEA 1XCTA 5GRVK 4UOZA 2R2BA 1Z9SA 2E3VA 1SEQL 5DDHA 2EIBA 3V0VA 3M6DA 2FQEA 2XQYG 3LMJL 1UATA 2IXQB 4O58L 2VMJA 3H3PL 2VM3A 5LAXB 1HU8A 4YR6B 1DVXA 3PRZA 2VYRE 3P54A 4G11A 2MQ3A 2P4AB 4KTGA 3W0WB 2BCMA 1KEGL 1BQ5A 4ZAKD 3NFNA 3PWVB 3Q44A 2PMZA 4PY8I 3V6OE 1W8OA 3T4AC 4WK0B 1E5AA 3QHFH 3K71B 1OQXA 1J5DA 3ZHDA 5IJVB 2FJHA 2HVBA 1D9KD 1QSEA 3A4AA 3IN0A 1S9YB 3JTSA 2VAAB 1MFMA 5C08D 4L3EB 1EO8H 1KIUB 1HI6A 1P9MC 4OGAC 4XNDA 1F6AB 3K4AA 3ZUNC 4LSPL 3BVWA 4F7KA 3P9MA 1I75A 4IOIA 4PLKC 3IEAA 2ZOUA 4JL2A 1CURA 2WB7A 5EWIH 2PCFA 3MRHA 4J1UB 3U4EB 1A8ZA 3HUJF 5DQ9A 1KYAA 2GSGA 3FQXB 1C5CL 1CF1A 3D9AL 4ENZA 1CI3M 4R7VA 4K15A 4KTEL 4NPYB 2HKHH 1JGDB 1K4DB 1ZS8A 2PTTB 5B1KA 4NHUB 4F8LA 5B7EA 4G1MA 4KOBA 5IVOA 4WGVB 4WWPA 5CSGA 1ASPA 2BOCA 3ARDA 3UZEA 3PNRB 4AEIH 2XKSA 4KZEH 4XP9L 3GF8A 3ZGIA 4XE0A 4LOEA 1WBYA 2OJ1A 2NY2B 3FOLB 5CP7A 3U2SB 4OFQA 4AT6A 3O3EA 4X6CE 4JZOA 3BUIA 5GGVL 2GEEA 3QUYA 1A7QH 4X5XB 4IDJL 4MA8L 1U8HA 2WNXA 4QJ3B 1RH8A 4OZGB 4QT5A 1MVUA 1FL6B 4XXCC 3TNNA 2VMEA 1WFIA 5DEZA 5TE6L 3UGEA 1MFCL 1Z5LA 5KAQG 1FORL 2CM6A 5FO7B 4Q74A 4G43A 2FLBT 3ZZ1A 3L3IA 4D9RD 5I16B 4W6YB 5E7FA 3SGEH 3DUHA 2RACA 1NJ9B 4KDVA 1T04B 1HHHA 4YZWA 5FX3A 2GITB 2WMPB 4KK8C 3CSBA 5I1IH 1ZJBA 4CU6A 3A4DA 3NSJA 2J3SA 3UCRA 3GSQA 2P5WD 1AIFB 1YQ2A 5EO9A 3W5NA 1TDQA 3RNKA 2WOYA 3ZW3A 3O4OC 4P5TB 4U4BA 5F7UA 4AM0A 1Z5HA 1H0DA 3O8XC 3EH3B 3OJDA 4FEIA 3BVUA 4JG1H 4WGWB 12E8L 3NOIA 3EJCA 4JG0H 4DPAX 1T7XA 1LP9F 1FF5A 4N2CA 3NN8A 3SYOA 32C2B 3EDJA 2PO6D 3H9SB 2XTJB 3PGFL 3CVHH 4L1TA 2BWQA 5ACLA 1L7IH 3SDCD 2X89D 4XPAH 4WEBL 3VWJB 3C5JB 4YDKH 1HILB 2ADGB 3RILA 4CUCA 1M7DB 4GSDH 1PIGA 3Q3GA 1YEFL 4LHUD 3MLZL 2HVJB 5HYJA 1QRNE 1W6WA 5A2IH 2TAAA 2QSCH 5HDBB 1U3HB 3OMNB 1NMCB 1W16A 3K72B 4O51A 3RL2B 3CVIH 3MA9H 2IVFC 5L9DL 5TH2B 1FVDA 5LVEA 2XWEA 2R2HA 4MZIA 4ELKB 3ZHFA 2AAAA 2NZIA 4KJWD 4YXHH 5DD0L 4M4RB 5JA8B 1R34A 3BWAB 1CGSL 1INEH 1XB6A 4AUJA 4B50A 5FKAA 5C7XL 3EZJB 1A9VA 2XIDA 3CX5K 3F8UB 4HFUL 3GRWA 4WFFD 5IESH 3OB0K 2CUAA 2C9QA 3NRFA 1RXLA 2R23B 5C09B 3UMTA 1HCYA 4PJFF 1X9RA 2I07A 2EE9A 3LNIA 4IIQC 2BS71 3JVGC 4GG6E 4X98A 4TQEH 2C1PA 1NMAL 5IJDC 1ZHKA 5EZLB 1H9DA 3LN4B 1ZSDB 5J12B 1MI5B 1DJHA 4Z7UE 3KLLA 4TQHA 1I9JL 3GSRA 4K8RL 1NIFA 3ASNB 5DJAA 4QXGH 3SOBL 2WXJA 3BH9B 4P07A 4QTIH 2GK2A 1VACB 2BRRH 2FK9A 4QJ4B 1K5NA 5I26A 4OQ1A 3NCJH 2BW5A 3FOMB 4LPYA 4J4PD 5EU5B 3WEAA 2DDQH 5KVEL 5ECGA 3NFPA 1UZ8A 3LRSB 3RY5A 2IFGA 2N3JA 1DQJB 3S6CA 2XN9A 3GBNL 3CN2A 4QRRE 1XIWA 1CFSB 1ZGLP 1HT6A 1CDJA 1VEMA 3BDBA 3WNPA 1A0QH 1Q1JH 3GSOB 1PY9A 3ESPA 3ARGB 3NFSL 2YAEA 3EYUL 3WLWC 1FO0L 1QLRA 1WA0X 3MLVH 1YLBB 1OTUC 4EIZC 5JPNC 3LEXB 1LK3L 4AKPA 2V7NB 2G4GA 2WB1A 3ARZA 3D39D 5GRVL 4WHDA 4AKOA 2XWZA 1J8RA 1QI5A 3SPIA 4U1NA 1WCBB 2WV3A 1CB4A 4NLHA 4XAWL 1VEOA 2CJUL 1MH5B 1KLUA 1CDIA 4HULB 3IKCA 3QEGH 4H25B 2ZG3A 2DQTH 3II2A 4UAOB 2IGTA 2EIDA 4YDLB 4FQJL 3V5KA 4KXCA 2AJXH 2Y1AA 1Z0NA 3OZLA 1T1ZA 3PWUB 4OZIA 3VGBA 2AEPL 1AS8A 3WIFA 1TZHA 2VDKL 2HVKA 3CSGA 4KO6A 3OGCB 4WO4D 4HZ1A 4GT7A 5EUOE 5A2LH 3NJMA 2HT3D 5JNYA 1PZ3A 1NOFA 3LZPA 4XH2B 1X3DA 3R0MA 2XWBA 2R1YB 5LQBL 4Y5VC 1HXYA 1H6TA 5JTWA 5CEXA 4DP8X 1BLNB 5LGJB 2K8QA 5J3HD 3O2WL 4NC1E 4ZPTB 1S7QB 4GAYB 2C9AA 1MCSA 4GSQA 1AGDA 3FB6B 2Y4SA 3FPYA 1TZGL 2Y06L 1UB6B 1NAMH 2J1KA 3QUXD 5DD1H 4A1RA 1E4WL 1E50A 5BZDB 4FYTA 4MXWL 1IE5A 2CMRL 4Y7OC 2ARWA 5CO1A 1BD2D 2W07B 3IXAB 5FK9A 1N2RA 1MFVA 3MVSA 4X80L 5D5MB 4NJAL 3AM8A 5C3TA 3MLUL 5SWSB 4M1GH 3X1GA 3IJYB 4LCCC 3OJVC 4JQIH 5KSAC 1H15A 2VR7A 2MOGA 2YEVB 3OPZH 3KVDD 4PGEB 3AREC 4AL8L 1DQKA 4HUUB 2XN2A 4QHMB 4KQ0A 3CSYB 3J27A 1K6QH 2EEBA 1SY6A 3QDGB 1A1NB 1ZHBB 4XBPB 5ESQB 1E8ZA 5JMRA 2AEWA 4MA7L 1I8LC 2BSTB 3CLEH 1KCLA 3BAYA 1L3NA 4Y8AA 5HYSG 1QRNB 4MFHA 2MCPH 2V2WA 3CFBA 1BFOB 2ZKHL 1E9OA 4P46D 5AZEH 1HHGB 1T03H 2WUCL 3HG4A 4PJEA 3HS0C 3NK4A 5I8KL 3VMNA 3D0LB 3D3VE 3D2TA 4A2MA 4ZTOL 5I8CB 4XC1L 3RWEB 1ZT1A 3EYVA 5KUMA 4OD2A 3G08A 3BAKA 2W1NA 3IM1A 4X8JA 4KTDH 5J11B 3KLAB 3L7FA 3LQZB 1N0LA 4FG4A 2W65B 5DR5L 2E7BA 5T1KD 3ZKNC 3SYAA 5KBLA 1WAPA 4MCZB 3CVHB 4G9FD 4GIOA 4NQSB 3ELAT 1O6TA 2N0KA 1I8KB 4G9DA 3T3PE 3TCTA 1BOGA 4UNTA 1MHHB 3K4DA 3AS0A 4L3FA 1XH3A 3FH7A 3GHBL 1SOQA 2RCSL 1EHKB 2WC7A 1OCWH 4G5ZH 4ZTPH 3T3MF 3MU3A 3JWOC 3EH4B 5EIVA 1IGIL 3WSQH 4GG6B 4U6XB 2CRIA 1F41A 1UZ6F 1IZKA 3I9GL 2HKAA 2JMRA 1EBAA 4J3OG 1LQBC 4UQIM 3RVXC 1M7IA 4KY1L 2IDTA 2X38A 1YJDH 4Z7UB 2ZUQB 1OANA 2Y1VA 2ZYRA 1R0AH 5IMKB 3G6DL 4ADIA 1QLEL 2QSVA 5FO2A 4H20H 2VDNB 2FO1A 3EJPA 1EZVX 1OQOA 4K94L 4XBGA 3D85A 3VXOB 3ARTA 4H40A 2WNGA 3VB9A 2KQNA 1GH7A 1JTOA 1SXBA 4Y1AD 3WN5C 2G5BB 2HMIC 5IHUL 2H2PD 1L0XA 1HK6A 1ERNA 1OIOA 2A6JA 2BP0B 1BIIA 1FC1A 3I9AA 1BZ8A 4YH6A 3NESA 4LKCB 2X9XA 1JVLA 2X4PB 3ULVC 3NJFA 5LAPA 1A22B 2MMXA 2DLEA 2ZX8A 3L3OA 4PMEA 5HJDA 4EI6A 4PR5A 3QDJE 3WDIA 2BVPA 3TVMD 3SO3B 3HB3D 2ESVE 4PJGA 4WUUA 5T1DL 5KN5B 4WCYL 1MQKH 2EKSB 5J4MA 1GKEA 2XSKA 1FCCA 5B3SB 1E8WA 4MYWB 4U1IB 5ICZA 1PEWA 2FNWA 3U4KA 4A6YA 2H3NA 2DWDA 1SVZA 3DHPA 1KYOK 3B8SA 1OP3H 4LDLB 3NPZB 5ETUB 5L4MA 5I1JL 1PS3A 3H4FA 3JV6B 3RWJA 4XWGL 4AQAB 1FZOB 4FZ8L 3RX8A 4Y5XC 5EIQA 3MRLB 4JN1H 1P5VB 2VLKE 4QI3A 2R9HD 4PTTB 3WENA 4FQCH 2IXQA 3O4LE 3TXAA 2DQEL 1OGAB 1U6AL 4LHJB 4ZDHB 2Y9RT 3BWUC 4YR6A 2VSMB 2E4FA 3HFFA 3PAZA 5F0MB 2W60B 4U49A 1XGRB 1E9QA 2VLJA 2QQQA 2CGRL 4S2SB 4PGCA 3TZVC 2WBXA 2A9NL 1VEPA 1UXSB 5LNEA 4NKDA 2ZXQA 3FU7B 3PWVA 1T5XB 4MJJA 2J55A 4MJ5B 1R9FA 3VD1A 1AO7D 1JV2A 2PPDA 3K71A 1VFBA 4LSUH 4QNPF 3VFGL 1LK2A 5IJVA 4QHUB 4P2CG 5BV7C 4DUXA 2Y7SA 1IZJA 2XTSA 3FRUB 3S96B 1YEIL 2VAAA 5KSVB 5M94B 2F8OA 3KWWB 1KIUA 2YQBA 3VYOA 2VR8A 1C5DB 2Y25A 1F6AA 2CRYA 3C60B 4NRXB 2MFNA 4Z0XB 2E6JA 1DFBH 1O7SA 1QUNB 2AVFA 3QR0A 2DH3A 4Y4FB 3RPKA 4JFEE 4JANA 4IBZA 3AROA 5I5MA 5HI3C 4J1UA 1TU2B 2FHFA 3HC3L 1KJMA 1BGXH 4HXBH 2W81C 3LZOA 4OZIF 5E0FA 3B7RL 5HTSA 1JGDA 3OKEA 3NZHH 3PHAA 4QRSB 3CVDA 4OY9A