2V9ZA

Structure of the rhodococcus haloalkane dehalogenase mutant with enhanced enantioselectivity
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Engineering of Rhodococcus Haloalkane Dehalogenase with Enhanced Enantioselectivity
rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
total genus 94
structure length 302
sequence length 302
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v9zA00
4WDQA 5CBKA 1W6RA 4OB6A 4BZWA 4Y2VA 4QDUA 1CUXA 3QPCA 1Q83A 5E4YA 2PUHA 3D3NA 5BOVA 2HRRA 1ODCA 5DNVA 4KAFA 1G4HA 5D6OA 1NU8A 1QONA 5AKJA 2PX6A 3AIMA 1GQRA 5LKAA 2WIKA 1TCBA 4V2IA 2ZSIA 3RARA 1UXOA 4DMFA 3FCYA 3H2IA 2JGKA 4Y2JA 2BUBA 2QM0A 3WL8A 5EHNA 1AQLA 2ZYIA 4WCVA 3OG9A 2JBWA 2JGEA 1GPNA 4KE9A 1VJ5A 3R3XA 3F8SA 4OYLA 5C81A 4BAZA 3WYNA 3PDCA 2OGTA 4PF1A 1FFBA 1LZKA 2JF0A 2Z8XA 1GPKA 4CG2A 2Z8ZA 2CEKA 3MUOA 1KU6A 3IURA 4FBLA 5A6VA 4Y2SA 2HA6A 3DDUA 4RNCA 1YCDA 3D2BA 1CUDA 1SCIA 2EDCA 3HSSA 3VJLA 4OD0A 3WLAA 1CUCA 2HA7A 5ALMA 3OOSA 4PSDA 4J7AA 3PFBA 1OCEA 1CUWA 4H77A 3A2NA 2H7CA 4H0CA 1F0NA 1LPAB 5ALFA 5LIPA 2ZJFA 3ZLVA 5LZ9A 4CG3A 2WIGA 5CH3A 3PF9A 5AM4A 1ZI8A 4Q3LA 4EA6A 1EX9A 5AK4A 3PE6A 3TRDA 2GYWA 3RK4A 1AX9A 4DTCA 4GECA 4B83A 3HABA 3IUQA 5I8PA 2FJPA 3OTQA 2DHDA 5AOAA 1VKHA 4OU4A 1K5PA 1TQHA 1XZHA 2WHPB 3DNMA 3AINA 3R3ZA 5IVHA 2OGSA 1N8SA 2GYUA 1S8OA 4Q3KA 2WG0A 3O4HA 2XLBA 3L1JA 5AKLA 4QLAA 4JYMA 3G0BA 4QWMA 1GKLA 1LPMA 2WFZA 3L1IA 2B61A 2BGNA 4LHEA 5HCUA 5JATA 5C8VA 2IIVA 4H7IA 2RAUA 4ZRDA 2WHPA 4Y2XA 4EZIA 4XWGA 3QVMA 1XZGA 1VLQA 3R40A 4HZGA 5A62A 5C8ZA 4DMCA 1CUSA 1WHTA 2YH2A 1FJ2A 1XZLA 1ZJ4A 1Q84A 2PUJA 3VJKA 4DNQA 1ZD3A 4I4CA 1CUHA 3YASA 4QZVA 2Z3ZA 4OCZA 5ALTA 1RWQA 4F21A 2BAGA 1EINA 2RHTA 4C6HA 2HFJA 3RM3A 3AFIA 4B7ZA 2G5PA 2PVSA 3IB3A 3GZJA 1MAAA 1QFMA 4X95A 4QLOA 4AB1A 5ALYA 5HF6A 3F98A 5AKHA 4Y2PA 1UT6A 1QIMA 1YAJA 2HU7A 4UHCA 1BRTA 5LZ4A 4FNGA 2HA0A 2AJCA 3A2MA 2WJ3A 4U2FA 2X76A 2QXUA 2XI4A 1PFQA 2ZJ7A 3DJYA 4FBMA 4PSUA 5ALNA 3PFCA 3H1AA 1W4LA 3HLKA 5AKYA 1N1MA 3V1KA 1HPLA 4B80A 3F97A 4EB0A 4H7HA 3ESAA 4EUSA 4HAIA 1DWOA 1WPRA 3DQZA 1ETHA 5D3ZA 4J0CA 1UKCA 4DMKA 2HL6A 3GUUA 3WZLA 3GELA 4GHWA 2CJPA 3V9AA 5AI9A 1CQWA 5JAOA 1MX1A 3ESBA 3STYA 3C87A 2JGJA 1VA4A 4M0FA 4OSEA 4Y2RA 4KJXA 4JH0A 1K4YA 2ZYSA 4L3WA 5ALOA 1ZD2P 1LBSA 1LPOA 5K3FA 2HIHA 5EHQA 3UUEA 5A2GA 4H35A 2B20A 1CUAA 4C88A 2VJCA 5AIBA 1TIBA 1JJFA 4UPDA 5AOCA 4J0DA 3STVA 2QOEA 3ZLUA 1JJIA 5EI5A 1XZCA 3W04A 3G9TA 4Y7DA 3BE8A 4S0XA 2XDWA 3M82A 4GLBA 5T4BA 1MNAA 3ILSA 1EH5A 5HFNA 1WHSA 3F96A 2WG1A 1BCSA 4WJLA 5T4FA 1E8NA 1JT2A 1A8UA 3QM1A 3TEJA 1FSSA 4JYPA 4AQDA 3STUA 3IULA 1HBJA 2VF2A 4BZZA 5CTAA 5AI8A 4QA9A 1C7JA 3BL8A 5CT5A 4BP8A 5K5EA 3U0VA 1PJAA 2QJWA 1L7AA 2HA2A 4GI1A 4KEAA 2OAEA 1WB4A 3N2ZB 1I6WA 3OPMA 4QEKA 2JGFA 2ZYHA 4OB7A 4JNCA 4BBZA 1W76A 5CT6A 1VZ2A 3O0DA 4H7JA 2C4HA 3GROA 5DTJA 5HFAA 3GBSA 1WCYA 5FPPA 5CT8A 4C4XA 2C58A 4J03A 2GBGA 5CH8A 4DSAA 1JI3A 2G4LA 3JWEA 1H22A 5ALGA 1EK2A 2JGMA 1ZI6A 4QNNA 1LGYA 2LIPA 3BDVA 3FSGD 5ESRA 3BDIA 3V1LA 1HL7A 3G0DA 3I6ZA 4X97A 3STTA 1ZJ5A 5AKZA 4MXDA 4M0MA 4UHDA 4OPMA 4RE6A 2PL5A 3C5WP 2JGLA 1WB5A 4BCDA 4JUIA 5CXUA 2WUGA 3I6MA 4X85A 4B0OA 3WWOA 1EB8A 1OXMA 1UKBA 2AXEA 5AKXA 1ZIXA 3DOHA 2QUBA 2D0DA 1QIGA 2AJLI 4FFWA 3A70A 2UZ0A 1YSCA 3AIOA 5ALLA 1LNSA 3DKKA 4J0GA 2XT0A 1ZD4A 4LXIA 5AKKA 2AJBA 4IH9A 1TAHA 3BXPA 3FVRA 1CV2A 1R88A 3C70A 1ZI9A 3G9UA 4I19A 1J07A 5ALHA 4AX4A 3DS8A 3F9CA 1THTA 5KREA 1IUOA 1E3QA 5DJ5A 1YB6A 1Q0RA 5CMLA 4ARAA 1GQSA 1XZEA 5CW2A 5JADA 4ZXFA 3ESCA 2ORYA 3CXUA 5ALZA 4KYVA 2FJ0A 3C5VA 2VA9A 1H2YA 4QE3A 4CCYA 5JANA 5JASA 2B9VA 3JW8A 1MX5A 2XUKA 2XQIA 2EDAA 5DLPA 4FLMA 4G8CA 4BDSA 1OILA 4FNMA 2G5TA 1J1IA 2HADA 2HM7A 4X71A 2YYSA 2OQIA 4DIUA 2JIDA 4PV7A 1YB7A 5AI5A 3LLCA 2OLEA 2BGRA 1J2EA 2Z3WA 3ANTA 1DWPA 4ZV9A 1R50A 3I2JA 5JZ9A 1XQVA 1VA5A 1XZFA 1JU4A 3MGAA 4N5IX 5JAUA 3K2IA 4X7BA 2VAXA 3H2HA 1H2WA 1LPNA 1UKAA 5A7HA 2Y2UA 4UBMA 4UFOA 4X92A 3WKCA 1UK7A 1TCCA 2JEYA 3R3WA 1BE0A 2VT6A 1L7RA 1XZKA 4X6XA 3WK4A 1XQXA 1U2EA 1LPPA 3FOBA 2H7XA 3VVMA 5AK5A 2WFLA 4BE9A 2J3QA 5FRDA 3TGLA 3DOIA 5EGNA 4P08A 1EA5A 1XZAA 1IZ7A 4Q3OA 3ED1A 4DM7A 4D9JA 5FKJA 4RE5A 5I7UA 1SC9A 2Y2VA 5AICA 4DLNA 3H2JA 4J0KA 1CUJA 1EB9A 3HJUA 2XUDA 3HXKA 2I03A 4Y9SA 2FX5A 3IVMA 2I3DA 1ODSA 4QDOA 4PW0A 2XUPA 1K63A 4BE4A 5LYYA 5I9IA 4XVCA 2QKYA 1THGA 2B4KA 1FFEA 3QITA 4CI9A 2XMSA 1F0PA 5FLKA 5C7YA 4UFPA 2HU5A 3NGMA 2V98A 3VDXA 4Q82A 1E66A 2OXEA 1N5RA 1QTRA 5AOBA 4BC0A 1BROA 4AO8A 5AM2A 5T4EA 1CQZA 5ALKA 1UWCA 4X3CA 1EDEA 4AO7A 1P0QA 5DYTA 4J0HA 2DQYA 2PPLA 2HHAA 4Y2YA 1LZLA 4U2EA 4B0PA 4LXGA 2Y6VA 2CKMA 3H18A 1UK8A 3O4JA 5IH7A 2HFKA 5AJHA 1QGED 3I1IA 5K3CA 2WUEA 3WK7A 3STWA 4FFVA 3DKRA 2O2IA 2J3DA 1XRPA 4EY8A 5HQ3A 4P93A 4BVKA 5HF5A 4KRYA 4BVJA 4UUQA 3IA2A 4G4IA 5LZ7A 4YK7A 5JIBA 2H1IA 4UFNA 3VISA 2X8BA 4UBNA 4G4JA 1EDBA 4U2BA 2ES4A 1SCQA 5A7GA 2XUHA 2CB9A 1ZIYA 3CCCA 1LPSA 5YASA 1MAHA 1DTEA 1QJ4A 1VZ3A 3PUHA 3WI7A 1R4ZA 3QMWA 1QIKA 3ZI7A 4G4GA 3A2LA 4HVTA 3EF3A 2JEZA 3WA7A 5SYMA 3O4GA 5FP0A 2XMGA 1XZJA 1GKKA 3FLEA 2XB6A 1YAHA 4IO0A 3RKSA 1CRLA 1MTZA 3D0KA 3IUJA 2RHWA 5AM1A 2HU8A 2ZJ6A 5HKAA 1P0IA 1QOZA 2PSEA 1XRLA 2WFMA 2PU7A 4GDMA 4Q05A 1AUOA 1T2NA 1HKHA 1MN6A 5EIHA 1XLVA 3FYUC 3FYUA 2GBIA 5IVKA 3PUIA 4Q1VA 1BCRA 2DCMA 2OQVA 1IUPA 3D5EA 4ZV7A 4H18A 1QIJA 4IH4A 1WOMA 5HKBA 3I2FA 3UUFA 2QZPA 3WK9A 1RP1A 5CT4A 4TVKA 3I6YA 4NS4A 3I1YA 5JAHA 1EHYA 4X93A 1R1DA 1AKNA 1X70A 4C4YA 1MX9A 1R9NA 2BCEA 3O4IA 5AHXA 3M81A 4XIIA 2E3JA 4C01A 2QXTA 4H7FA 4OU5A 1UOQA 4DNOA 1MU0A 2WU4A 1EXWA 2CBGA 2ZSHA 4MYDA 1H23A 1EK1A 4OUKX 3IBTA 3WQHA 2XUQA 2VJDA 5FDFA 5AKGA 4AO6A 5AK3A 1YS1X 3ZLTA 3WA6A 4BVLA 3H2GA 5EHZA 1Z68A 4GW3A 1QTIA 4BDTA 2Y1KA 3R0VA 3G7NA 3KXPA 1NX9A 1YR2A 5DNWA 1XRMA 1RYYA 1XQYA 4YX9A 4B84A 2XUOA 3HZOA 2W6CX 3MUNA 2PKYX 1UK6A 1ZD5A 1XKLA 1Y7IA 5ALDA 2QTBA 5EIAA 4ROTA 2XMQA 2HDWA 4W63A 3V1NA 4KAJA 5JD4A 5D7BA 3C43A 4C4ZA 2HRQA 4PO3X 3CCBA 2K2QB 3BIWA 3FLAA 1PV1A 3C6XA 2WSLA 1QIHA 4NMWA 3C6BA 3DEAA 4MEBA 4KACA 3KOOA 2Y6UA 1HDEA 3H04A 1MNQA 4WDRA 3CN9A 4AN0A 5CURA 5K3AA 3BIXA 3B12A 1Y7HA 4B82A 1MPXA 1CUIA 3EQ7A 4C87A 5CT9A 4X6YA 4XJVA 4FKBA 2WUFA 4EY7A 1CUZA 4OYYA 2DSNA 5AM3A 3H2KA 2RGUA 1ISPA 1ODTC 3OM8A 4UBKA 5T4HA 1LBTA 3D4LA 1GZ7A 4TGLA 4UHFA 4XX1A 2PSHA 3QZUA 3C8HA 1C7IA 5JD5A 2VAVA 1G5FA 4AXBA 5JZSA 3LP5A 2I78A 2YASA 1ORWA 2D5LA 1A7UA 1IMJA 3RLIA 4GWLA 3X3HA 1P0PA 4Q34A 2Z5GA 3KWFA 2VQ6A 3IDAA 4IH1A 4X00A 4BCBA 4BTVA 3QMMA 3AJAA 1XZMA 5AM5A 1XRNA 3KSRA 4BCCA 2OCIA 1KU0A 4F0JA 2RIPA 2WIDA 4INZA 4BC1A 1CUGA 3N0TA 4EBBA 2CUTA 2RI6A 3W2TA 5AI6A 2PBLA 1YS2X 1JU3A 2H9YA 3U1TA 4BATA 2BKLA 2PSFA 5BV7A 3H0CA 2HA4A 1SFRA 3DD5A 1VE6A 1MO2A 4CCYB 2C7BA 2NW6A 4AN1A 2QJRA 3LS2A 5HK9A 1UOPA 3ICWA 3AILA 5ALXA 3WMRA 3PICA 1ZGCA 2V97A 1CUUA 1C4XA 3AZOA 1AGYA 3LIIA 4C89A 5AK6A 1JKMA 2OCGA 1W75A 3GFFA 2XMCA 1K8QA 5JAPA 1GT6A 3AZPA 5E4TA 4MWTA 5AP9A 3QPDA 1WB6A 1SOMA 1BS9A 4G9GA 4P9NA 1O6FA 3D2AA 3WK5A 6YASA 3Q8WA 3H1BA 4IHAA 2WU3A 4BTLA 2CZQA 4L0CA 3G9ZA 4X90A 1T4MA 4MEAA 2XUFA 3HACA 2XQGA 1D07A 3DL4A 1ZICA 2PM8A 5C8XA 2O2HA 4WFIA 4IQ4A 2WIJA 2BUAA 5A7FA 3AIKA 4KR0A 3S8YA 3WJ1A 2OAGA 1JJBA 1VXRA 3S2ZA 1XQWA 5KBYA 1Q0ZA 5FPQA 3STXA 1G66A 3HC7A 3WZMA 5ISMA 1ZGBA 2VATA 5K3BA 3ESDA 4J0JA 5AI0A 2C5GA 3NOXA 4CIBA 2H7YA 4FMPA 3ZWQA 1QIEA 5K3EA 4JEIA 2WTNA 1AZWA 2PU5A 1ACJA 4G9EA 5FUMA 4DNPA 3FSGA 2WM2A 1X2BA 3FWHA 5ALEA 4UHEA 2ONCA 3FAKA 3WKDA 3ZV7A 3D59A 1L7QA 4E11A 5AH0A 3QBJA 1JFRA 3FYTA 1CVLA 1USWA 3WKEA 5AKIA 1P0MA 3G0CA 5JZBA 4G8DA 3FVTA 5BWBA 1FFCA 3C45A 2GZSA 5AKEA 5ALUA 1EDDA 2WILA 3V48A 5HF9A 3O95A 5E4JA 4N8SA 4CCWA 2XLCA 4BRSA 1DWQA 3DCNA 1K6EA 4YPVA 3LCRA 3FCXA 3SWWA 2QMQA 3EQ9A 4H7EA 4EHBA 2C0QA 4TPKA 1W1IA 2DFPA 3W05A 4Y2QA 4WFKA 3NWOA 4G5XA 2Q0XA 4W1QA 4EY6A 2JGIA 1E5TA 1AMNA 3WWDA 2J4FA 5CRIA 4B6GA 2QS9A 4K2AA 3FBWA 3F67A 5EFZA 4L9AA 3R3YA 1XFDA 4FHZA 1BN7A 3WL5A 2AJ8A 1LLFA 1O6GA 1B6GA 2ZYRA 4HXGA 2OCLA 4BAUA 2VEOA 1F8UA 2C0PA 4H7DA 2R11A 4FWBA 3VXKA 5LKRA 4ARBA 5DYYA 3K9BA 4BYMA 2YXPX 3VVLA 5KWJA 5BWCA 1YA8A 3OC0A 3EQ8A 2BUCA 4HXFB 2ACKA 5LZ8A 2QRUA 1A88A 3DYIA 4N8DA 1CIJA 3G02A 1GGVA 2BFNA 4I3FA 3WIOA 4E14A 4UBLA 3V1MA 2OPHA 5K3DA 3WK6A 1EI9A 5DTIA 4X94A 4PQEA 4DMHA 5ALIA 1QO7A 3G0IA 4Z49A 4U2CA 5E2IA 4MYSA 3AUKA 4BB0A 4B9EA 1BEEA 4GEGA 1YASA 4H7KA 3HI4A 1UZAA 1NU6A 1XROA 5J3JA 4UBIA 5LP1A 1QO9A 4UHHA 1R3DA 2WKWA 3SC2A 2ZVDA 1HLGA 3KDAA 1DQZA 2VT7A 3I2KA 2EEPA 2WFLB 3Q0TA 4KE7A 2AJDA 3DLTA 4K6KA 1SCKA 2IX9A 5SYNA 5EIEA 1GPLA 3WL7A 5ALSA 4AZ0A 3DYVA 1WPXA 4HTAA 1XZDA 4F60A 1CUVA 1FFDA 2DR0A 5IVDA 1A8SA 1MT3A 4W1RA 4W1SA 1QE3A 3M83A 4FLEA 4FDMA 4U2DA 2G63A 5FOQA 4HRYA 1X2EA 1UOOA 4PSCA 1E8DA 4L72A 5CXXA 5HQ3B 4LXHA 5DWDA 1XRRA 5JALA 1VOTA 1KEZA 1W52X 4KAAA 4QDZA 1CPYA 4ZI5A 4AMZA 5FXMA 1ACLA 2FUKA 4N5HX 2WIFA 2P8SA 5HF8A 3WKAA 3BF8A 1DX6A 3FLBA 4J0IA 3KD2A 3K6KA 4ZWNA 2BJHA 2XUIA 4HXEB 1QIDA 1CLEA 2XE4A 4QDTA 5ALRA 3HRHA 2QVBA 1XZBA 1TRHA 5F4ZA 2ACEA 1XRQA 3GA7A 3G9XA 4G8BA 4UHBA 1UK9A 4FOLA 3W06A 4RGYA 4E15A 2WLSA 3IUMA 3HEAA 4ETWA 4WY8A 4A23A 4B9AA 2WJ6A 5AO9A 1HQDA 3FYUB 4EY5A 4HS9A 1MJ5A 3R41A 3BJRA 4M0EA 1R9MA 3IIIA 3MVEA 4MQMA 4O08A 4B81A 4CG1A 5K3FB 2WTMA 4KE6A 4QWWA 1VE7A 1QIFA 5DYWA 4CFSA 3B5EA 4X91A 3QYJA 5LZ2A 2ECFA 2HA3A 3C8DA 4HRXA 5AM0A 2WUDA 2WHRA 3A6ZA 1DINA 4LYDA 3E3AA 3JYHA 5H3HA 3P2MA 2R8BA 5LLSA 2O7RA 1DQYA 1M33A 4WY5A 5AIAA 1CR6A 2V9ZA 4BAGA 3BJMA 1G42A 4OB8A 3FNBA 4W9RA 1CFJA 1CUEA 3EBLA 2VJAA 2OGZA 3PF8A 4ITVA 4YASA 2VJBA 3DL7A 3WKBA 1EVQA 3H19A 4A16A 4KE8A 2XQKA 3R3UA 1GXSA 2XUAA 3VJMA 5KWIA 5HK8A 1TKRA 1QZ3A 3I2GA 3QPAA 4J3JA 1H2ZA 1CUFA 3NUZA 1DT5A 4ZREA 2XMZA 4GBGA 3VKFA 3R3VA 2X5XA 5ALQA 1JMYA 3QH4A 4X6UA 1WM1A 3EIOA 5JYCA 2ROQA 1BN6A 4E46A 4WFJA 1AC5A 5DNUA 1N5MA 1E89A 3WJ2A 3WWCA 4F5ZA 2PSJA 4MJ3A 3C6YA 4RPCA 1QFSA 4CIAA 1E8MA 4UBOA 1BEZA 1TK3A 5IVIA 1XLUA 4Y2TA 2QUAA 4DYHA 4BRZA 1DU4A 3O9MA 4B85A 4LKOA 3I2IA 5IKXA 3H17A 2DHEA 4FLFA 3C6ZA 1EVEA 4LIPD 1CUYA 5CH5A 4MQLA 2VTVA 3IUNA 1VXOA 1J06A 5AI4A 3HYSA 4G1FA 2DQZA 1QLWA 3SK0A 1AURA 2XMBA 2DHCA 4AMYA 2VSQA 4N8EA 3T52A 2I3ZA 2XUGA 3SX4A 1DT3A 1U4NA 3O9VA 3T4UA 4QDXA 4DGQA 3WYDA 1H2XA 2WQZA 2GBCA 3ZPXA 2IITA 4ZGBA 3PI6A 2WJ4A 5JARA 3E4DA 5ALJA 3M3DA 2V96A 4K6GA 3ICVA 4EY4A 5JD6A 2GYVA 1U65A 2C5FA 3QMVA 1XLWA 2XMRA 2XMDA 4NVRA 1JMKC 1IUNA 1IZ8A 2XQFA 3L1HA 3TJMA 1ORVA 3AZQA 3G0GA 3W9UA 4K6HA 4DNFA 5EHXA 3WK8A 3LIPA 2J4CA 1XKTA 1FFAA 1DX4A 4FTWA 4K5QA 4A5SA 3OURA 3CN7A 3D7RA 1QIIA 1TCAA 1XZIA 4LYEA 2QT9A 3D2CA 3ANSA 2WG2A 3W9BA 3I2HA 3BWXA 4Y2UA 4MWSA 2HA5A 2PSDA 5FV4A 7YASA 1BU8A 3E0XA 3E1GA 5HZGA 1U8EA 3KWJA 1LPBB 1CUBA 2O7VA 3I28A 2XQJA 4GXNA 1F6WA 5D3KA 4W1PA 5LZ5A 4PNZA 3B3QA 2GBFA 5ALWA 2GZRA 3WWPA 2XUJA 2O2GA 1Y37A 1YA4A 3WWEA 1CEXA 3UMJA 3WIBA 2CMFA 1A8QA 5ALPA 3WL6A 1IVYA 4P92A 2RONA 2OG1A 1B41A 1UFOA 3BF7A 5ALVA 4DSZA 4KRXA 4UBJA 4U2GA 2OCKA 4NZZA 4AZ3A 3G8YA 2W22A 1ZOIA 2QR5A 5A71A 2WHQA 4BP9A
chains in the Genus database with same CATH superfamily
2B2CA 4P54A 1FCJA 3VH3A 2WOJA 4JYZA 3GT7A 4OXIA 2QP3A 2VCHA 4MUFA 4S1NA 2GD6A 1TVKA 1L4HA 3I39X 3G82C 1HNXB 1PIWA 3WRXC 4QDUA 2GTIA 2PIAA 2PRYA 5AUNB 4BMDA 2VXYA 1CJMA 2OV6A 5AW2A 2FEPA 3QPCA 4IJUA 4KXVA 2QG6A 3SE0A 5JSZB 1Q83A 5A5EA 1V2GA 2AUMA 3D3NA 4HAWA 1MQAA 4KQ9A 1DCMA 2I8LA 4TMVA 4OLAA 2HK8A 1XD9A 3ADOA 4IF6A 3PC2A 4IP0A 2UUAB 3DYBA 5BWOA 1JP7A 2XV1A 4NICA 3U26A 1ZUNA 3QU2A 4TLAA 3DT8A 4XJSA 4CV2A 4TMWA 4MI6A 1W5TA 3BM5A 3ZHTA 2ERXA 2OXFA 1YO6A 1G4HA 3OCUA 2XCIA 4L6AA 4LMBA 3ZBQA 3A1NA 2HWWA 2C9YA 1YONA 1G5IA 2VRCA 3NOVA 5G2OA 1L7XA 1UDXA 4NBUA 1T1EA 2PX6A 3BMXA 3KU4A 4RPHA 4EL5A 5L3SB 1RKVA 2JK0A 2QAGB 3D6JA 1CY7A 2A9RA 1DCKA 2B4YA 4QASA 5CA0B 3OZAA 4AY4A 1GZDA 2IZ1A 4MCIA 3M4JA 4FR0A 3OLZA 2Q9CA 2ZSJA 4RSGA 1BX0A 4XM2A 5LKAA 2XXAA 1PJTA 5GIPE 5HS4A 3S27A 1JYSA 2O57A 4KLZA 3CB2A 3DH0A 4BN0A 5HIIA 5IJ9B 2W2NA 4J0EA 3TNFA 1UXOA 2OPBA 3X1ZA 4DMFA 5LQAA 2QRVB 1JILA 1HURA 2PWBA 1LRLA 4R9UC 4E03A 4V0SA 3HDQA 2GPNA 1YVDA 1G3IA 1Q1BA 2FHSA 3HVJA 3LV8A 2PX4A 3G68A 3PUXA 3V4PB 3WJAA 4M1YA 4Y2JA 3T9CA 2Z98A 2BUBA 3A6DA 1DAEA 3V8BA 1TVKB 4OXXA 2RGYA 1XB2A 3RPEA 3WL8A 2EWMA 1GWNA 2ZYIA 4LK3A 1BVRA 5T3UA 3WRYA 1YS6A 3I6BA 1Y9DA 1KEVA 4G0QA 5KJ1A 4FN4A 3DMPA 4BLQA 4PAWA 3PKJA 2E55A 4R3UC 1E20A 5FEMA 3U5ZB 3WYFA 1IJBA 2WTUA 1GZ5A 2CT8A 1QDLB 1T13A 1QHFA 2WWVD 2NV0A 2W5UA 4B6PA 5M2QA 4MH0R 1IBKB 2A78A 1OROA 3OE1A 3BRWD 1JDBB 1FW8A 2GN0A 1UFKA 1W5EA 4Q37A 2RK3A 3T4XA 2XB8A 1FFBA 5U4XA 4PG7A 5JR3A 3L07A 2B5VA 4WL0A 3I9JA 3GZ4A 4ZOQI 3IP8A 2O06A 3UK1A 1YB1A 3PA8A 1X8LA 3KJEA 3KR1A 4CG2A 3B38A 2KHZA 1Z2PX 1CX9B 2CEKA 1B0ZA 1JE1A 3MUOA 2RGRA 1QQ6A 3SYMA 1PUXA 4CIVA 2H1LA 3P4UA 2H8GA 4HP8A 1GQYA 3VC2A 2CFRA 5MDHA 2HA6A 2V7GA 1YCDA 3D2BA 4LV6A 2V6GA 1IK4A 8ABPA 4K3UA 2EDCA 3I0ZA 4ER3A 4GGOA 2CDNA 2PYIA 1P0CA 2Y66A 1VMIA 4ZYTA 4CKYA 2A9KA 3BFJA 5AJYA 4B3RB 1W88A 5L8VA 3EDRA 4WAUA 3RS0A 3TTYA 3OPNA 2IZZA 4GIBA 2BFFA 4ITRC 1KEWA 5LJIA 2DFVA 1PD0A 1I24A 4CF7A 3N75A 4FZVA 5IFLA 3E8MA 1P6UA 2V7BA 2HREA 3HKEB 3I58A 4XI9A 1WNTA 1ZHHA 3A2NA 1WW8A 2VDUE 2H7CA 4HRAA 1X7YB 3MTEA 3MMPA 4XGRA 3TI7A 1VLJA 3UMCA 4D41A 5ALFA 1IHDA 2L82A 5DGIA 4W5RA 4QBGB 1PD1A 5BMOA 5JCXA 1MQ9A 4G1VA 4TM8A 4CG3A 1O95C 1ZG3A 1EWKA 1T5TA 3SF8B 4TMKA 4B2YA 2HCJB 3ND5A 3RNOA 5KNBD 5CH3A 5KO2A 5EJAA 4QXMA 1QRUA 1S2MA 4DCUA 2HRDA 2VZLA 3B1FA 1G20B 3KRTA 4HFNA 2IIQA 1ZI8A 4K81B 4M22A 3RGWS 4Q3LA 3WY9A 1NI3A 4D9FA 1YB2A 1Q77A 2CHQA 4RD1A 2GNPA 4ZAXA 4DSTA 1JWLA 3Q2IA 4OI4A 1FRFS 2VDOB 3GDFA 1TQ6A 1PL8A 1U04A 1KE1A 3RFUA 4XASA 4PYMA 1GQOA 3WNZA 1AX9A 2XVXA 3WG9A 4G0YA 4HAVA 4Q1AA 4D99A 1K27A 1VHLA 3FETA 3C3WA 1YRLA 4XAQA 3RB8A 5LUAA 5DHRA 2D00A 3GJ8A 4CMJA 4ER5A 3V4LA 2RH8A 4AULA 3KZKA 2Y77A 5EPOA 1XOIA 2WTAA 2ZWMA 1FZTA 1CCWA 2OCXA 3IUQA 4U7HA 2VTBB 2DH6A 3NYQA 3QU4A 3K71B 1Z5GA 4CQJA 2DHDA 3SLKA 1VKHA 2CDCA 1SULA 1TM5E 2O3JA 1K5PA 3NHUA 4RGVA 1P2BA 1XZHA 3EJWA 3ABOB 5SY9A 1BFUA 4AP6A 4FZJA 4CLOA 2I2CA 2C3MA 3LLUA 5BOSB 1TYAE 1Q7GA 5EP1A 4KN6A 3SHFA 1BE1A 2DFNA 3G2LA 4AT1A 4BO4A 1M83A 4UUBA 2GN6A 1ZK0A 4D3YA 2VDLB 1LU9A 4Q3KA 3CZPA 3O4HA 4R8MA 4FPXA 3L1JA 3ZDZB 4CF4A 1BKYA 1MB4A 5FTMA 3EZNA 3KKOA 1WV0A 4FYHA 1OXBB 1C41A 3JX9A 4JYMA 4R1UA 3G0BA 5SYAA 3KKMA 5AJTA 5TGDA 2QD2A 3II6X 1CR2A 4MQ6A 1TB4A 4BLTA 1ULBA 3LUBA 4IV5A 3WBBA 4IZOA 5FB3A 3JD1A 4MVJP 4RQAA 1P39A 2GZAA 1GKYA 1H0SA 3HCCA 1ECFA 4MRSA 4PYLA 1K6XA 3QTTA 4B3MB 4F4FA 1I80A 2WHPA 4J1SA 4BX0A 3TXYA 2IJGX 1P73A 4W99A 4EZIA 5KHLB 2QMYA 1C2TA 1UQRA 1G63A 4GL4A 4GXRA 1GGNA 4X20B 4XWGA 4BPBA 2ZCUA 2Z30A 3X2EA 1G19A 2OOSA 3R40A 2JHGA 5A62A 3CTPA 1WHTA 2JI6A 2W9XA 4LS3A 3Q6IA 1AV7A 1DIGA 3TKAA 2FHPA 1UINA 1GR0A 1E2GA 3KAPA 5KCMA 1SGWA 4F97A 1EVYA 2C5EA 1V47A 1H5NA 2P2SA 1ZD3A 4MDFA 2PKXA 4Z51A 1CUHA 2H8KA 1WXGA 4JJIA 3FNHA 2GO7A 4YQYA 1FDIA 4QREA 5DYIA 1RRFA 4ZICA 3W2HA 2QMUA 2G8NA 2FX3A 1DRVA 2VZ0A 3SQDA 1V5WA 3UMSA 3UQYS 5JNRA 4DCGA 1PTJA 3GRPA 1EJ6A 1JYEA 1E6CA 1RWQA 1SZDA 4YGYA 1Y8AA 1EINA 3FOWA 4LX0A 5J2TF 4I1IA 5FH9A 4KITB 2AC2A 1IRIA 2HFJA 4LRTB 4DQKA 4DDWA 1H3NA 3PGLA 3A6PC 4GM4A 3PUKA 3TBKA 1OLUA 4FGJA 1E62A 4HN9A 4LZOA 1RZUA 3RM3A 3FBTA 2OYRA 1XU7A 2IXDA 5EG5A 3REQB 3TAUA 3IEXA 3OZGA 4E13A 4F4CA 4Z0NA 3E9QA 3GZJA 4AJ9A 1EM8B 5MGBA 2DFKB 3USES 1RQ2A 3PNQA 3KKEA 5BY2A 3NPMA 4GYYA 2AFIE 1AH2A 4W9NA 3OD5A 5HIAA 2QZZA 4X95A 2WEKA 1N1EA 1RABA 2O1SA 4REMA 4AB1A 3PIRA 1UDCA 2B8TA 3CNLA 3KYIB 3L4EA 1QMGA 3MT9A 5G02A 3W2FA 1EGHA 1PBNA 1T9ZA 4N18A 5CXQA 1NKSA 1UT6A 3MZ0A 1X3LA 5HPYB 3HR4A 5IKOA 4QTYA 3JD3A 2CSXA 2GZHA 4NPAA 2AJCA 1CP2A 1JKFA 2XCSB 4FT2A 2O5EA 2CFSA 1YMVA 2QTMA 1I30A 2EZTA 3M6XA 3T06B 1FP4A 5J5VA 2ZAGA 4B40A 1OGJA 1B14A 2X76A 3HU5A 3RUPA 1X80A 1NNSA 1Q0SA 3PRHA 4YWHA 1ZGJA 4F4DA 1X7HA 4IDCA 2ST1A 4JKIA 4OVKA 5FWAA 2FW0A 1J8VA 4HS4A 1Y1QA 3HLKA 4IJ6A 3ST7A 1Z0FA 4UNPA 3OIUA 2LTAA 2AQ8A 3IAUA 4IVQA 4BFWA 1RJGA 3BE5A 3FPKA 5JCOA 1EWRA 4AJKA 4S05A 1A5SB 1ECCA 1Y6GA 3LF2A 2BFPA 3BA1A 2FR0A 4H7HA 2AZDA 2RJNA 3JQ8A 2Q5FA 3QYFA 4QODA 3S2EA 4Z4IA 1DWOA 1NNI1 4Z0HO 4L74A 2X5NA 4FCTA 1Z88A 2GWRA 4B76A 3AOEC 1UKCA 4DMKA 3Q41A 2G3YA 3U3OA 3WZLA 1W4AA 2C2YA 4GHWA 2CJPA 4WESB 1VKJA 3NBMA 3AF4A 1WXIA 1CQWA 4U02A 5JAOA 2FR8A 1OH8A 1T6XA 2DR3A 3HSYA 3IEUA 1UBFA 2G72A 5I47A 3DZDA 3X1WA 2P9FA 2ZJ3A 1F2VA 2G7ZA 3BMNB 1U9IC 1WZIA 1ORTA 2GAAA 2ZJOA 3H5RA 3IE2A 5JYEA 4KZPA 1KP9A 1XRSB 5EJ7A 3SBEA 5T67A 1A9YA 2IPAB 3DZ8A 2C1EA 2OR3A 4I1YA 4CM8A 5INTA 4W5QA 1ZRNA 4PAOA 1W36D 1Y3IA 2GCOB 3I23A 3RFCA 2DTEA 4OA8A 3ZJVA 2ZYSA 3FSEA 5ALOA 1ZD2P 1LBSA 1JGTA 4PM4A 2TMYA 3ROFA 1XU9A 2QD4A 5KAMA 2V6IA 4U39A 1SB8A 1G3QA 2XTZA 3FTDA 2CNBA 4YUXA 5EHQA 3RJZA 5E6SB 2V7TA 1U28C 4RZXA 2JHPA 2B20A 2I1WA 5FUVA 5I3ZA 3DOJA 3FPAA 4C88A 1ORDA 2OCBA 4D43A 1RQXA 1Q19A 1T36B 1ABBA 1TIBA 1JJFA 1Z5WA 2X23A 2PHZA 2YVLA 4F2DA 5LDDC 4EHAA 4QU5A 4BNGA 4R54A 2NG1A 3RSQA 2JAXA 1Y7LA 3BAFA 4ZIRB 1Z06A 2PUVA 1CETA 1D2EA 1KEEB 3LQKA 5AXDA 3TS1A 3ZLUA 2PR7A 1XNHA 1J0CA 1VGQA 1L1FA 2IXBA 1XZCA 1US8A 3ZN2A 3G9TA 1KMHB 1H6DA 4KUEA 3OQ1A 4M1OA 2GEKA 3Q0IA 2D2XA 4KGXA 4DAOA 2QD3A 3BE8A 4ETNA 1QPBA 2EJBA 3RRYA 2XDWA 3AIIA 3M82A 3OPXA 1TT5B 3AF6A 3DM5A 2KQUA 1MNAA 2E5FA 4Y0NA 3UMGA 3NV9A 1NJSA 5TLSA 2PA3A 1XD8A 2D7CA 3PB3A 2XZDA 4Z1MA 5HFNA 1WHSA 1EFDN 1YHNA 1Z0SA 4FFDA 4QYWA 1BCSA 3FPEA 4HLNA 1VSVA 4GPEA 1FFWA 4BN5A 4JN6B 5T4FA 4HLUC 4NHEA 4HMQA 1L4BA 4E94A 1IN1A 2DVMA 1A8UA 4R1SA 1DC3A 3MCAA 1J9GA 2OVFA 4WCDA 4BWYA 1CYDA 4JYPA 5FPYA 2NYUA 2M6LA 3W5VA 4AQDA 2ZREA 2RHBA 1EFRA 3G5UA 4L8FA 4OMDA 1MW9X 4LXYA 2WAOA 3I4LA 4KN8A 4Q7MB 2W71A 3D3WA 3NOOA 5FOVA 4CQLA 3FMPB 3OU2A 4EQ6B 1P45A 2Y92A 4TYYA 3EGWA 3GGDA 4TL7A 4B4DA 4FQ8A 4RLQA 4AMGA 4N3GA 4B3BA 1UZLA 3ITEA 5CT5A 4CF6A 5A5GA 3HBMA 2A5DA 4YCMA 4KV9A 1CTQA 3OTHA 3NIGB 5KYXB 1OSNA 2DX7A 3LWNA 1NQOA 2FPKA 3VSBA 4LF5B 2A9FA 3IV9A 1KY4A 3GIWA 1KI3A 1RYMA 5KKCA 1KQFA 1OH6A 1XEXA 1QDEA 3I52A 2OWDA 1BQEA 1GEGA 4KXUA 4HWRA 3VR5D 3SF0A 4CT5A 2CDAA 2YJNA 1OUMA 2C4WA 1TM1E 2WKPA 3A6HA 5BUCA 1WMDA 3AETA 1KGDA 1YFJA 2JGFA 3DP9A 3EGXA 1A3CA 1XVUA 4PAGA 3KZMA 3RYIB 3BRWA 1FB5A 2CVFA 1Z4MA 2X14A 2ON6A 3AHEA 2YWJA 3Q5EA 4P4LA 1DLJA 3LTEA 2PGDA 1G5HA 4XIGS 5REQB 1NPDA 1EXVA 1L4GA 1Z7GA 5AW0A 4BBZA 1SC1A 5CT6A 3O0DA 4NWIA 4Z4CA 3QFTA 4YCNA 4IFBA 4FX2A 1T2FA 2P30A 4GI3A 1YR3A 2F3PA 5HFAA 2YNMC 2NO6A 3DDSA 4R0NA 4QXRA 4TV8B 5A3RA 4P8RA 5H81A 1EPUA 4C4XA 3OOHA 4D79A 1JDVA 1I4WA 3KQOA 4FM9A 1OI4A 2H07A 2DYKA 1TCUA 2VYFA 3S6JA 2PYDA 2XJ9A 1IN5A 1R6VA 1OJ7A 1WMAA 2YOHA 3CQ9A 3CMMA 3JWEA 1D0SA 3Q3EA 5B1YA 2C8KA 4IDAA 1S8NA 4JJEA 4EO4A 2QX6A 1UBTS 3O21A 1H22A 2G88A 4HYTA 4MIYA 3GEGA 2R47A 1U81A 2ZAOA 3M6VA 5ADHA 4ND3A 2JGMA 4BKOA 2EJUA 5AFSA 5KYWB 3PU6A 1Y8CA 2ZE7A 3CLTD 4HLQB 3HCEA 3A0RB 3BDVA 3FSGD 4PCAA 2XITA 3MTIA 3V1LA 4HNUA 3OKCA 3NASA 3FFTA 2MYUA 3B7PA 1K1EA 1SQ6A 2NZUG 1VCHA 2QTFA 2NU6A 3D5TA 3FKSA 1HMPA 4MICA 4MXDA 1SXIA 4M0MA 2EKQA 3V5NA 4I2NA 4MV1A 3U81A 3LC1O 4LZNA 2OA0A 1T35A 4BCDA 3WQQA 1AVTA 2QW1A 2O8CB 5EKSA 5AXAA 4MIKA 5CP8A 1BFDA 5F73A 4KGDA 1DIHA 1P3DA 2J5BA 3IQDB 4JLVA 1N32B 3DEJA 4XWKA 1IOLA 1PG0A 3EG9A 5KYWA 3HA7A 1HG0A 2W00A 1UPUA 4A6PA 1V11B 2AXEA 2FSSA 5AKXA 3CRZA 1XJWA 3CKLA 3L4BC 1VQ1A 2ZIFA 3DV0B 3PC3A 2XOEA 3MD9A 1YSCA 5SZIA 4UHKA 5ALLA 1CQPA 2VEDA 1RT9A 2XT0A 1ZD4A 1GGEA 1KZ9A 1A4UA 2BMEA 3R77A 4K6MA 3TM4A 5KTMA 1A4IA 3L1UA 1NZJA 2C98A 2AJBA 1V43A 2BGJA 2IZ5A 5E1DA 1R4AA 1YDGA 1TAHA 3KJZA 4JBHA 5DP2A 3ZXXA 1I32A 1FTNA 1QQ5A 4FDLA 2Q3LA 3CT6A 1EEXB 2OV2A 2Z2YA 1LQ2A 1VCMA 1ELOA 3PP8A 1ODKA 2DWOA 4TLLB 3KEGA 2QZSA 3BWBA 2QW8A 3BWDD 3GWZA 1S5PA 5JC1A 4C7VA 3VC7A 3N8NA 2NSDA 1P7VA 1CF2O 4DFDA 3QTBA 2YFYA 3TUIC 3NBXX 1NR1A 4I0WB 1DADA 1PT7A 5AVYA 2ZUFA 1M1NB 1N2GA 1THTA 1E9FA 1VPEA 2CDRA 1Q3HA 2QXYA 3VNBA 3KPJA 3KKNA 1N7GA 1ZRHA 5A0VA 4D9NA 4MWEA 1QUEA 3W1EA 3UMMA 1LK7A 2C5SA 1IUOA 5FYQA 1TEVA 5IJWA 4G1UC 4KQHA 1KZ6A 4KWHA 1WF3A 1AB5A 4JB3A 2I91A 5A0TA 4L0DA 3QRWA 1E5DA 1Q0RA 3HJNA 1GQSA 4IIHA 4L5YA 2HMWA 4MINA 3TK1A 4JL6A 1V11A 3GLRA 1BCSB 1XZEA 3LDAA 3UENA 3NONA 1XCPA 2DTXA 2ORYA 3CXUA 2CLHB 5C1IA 2H65A 4D97A 3DDCA 3IDSA 3GA0A 4ZCMA 3M1LA 4XLTA 2O52A 2ZI6A 3GJTA 3IBYA 4JQOA 4RFSA 1AMUA 4LFAB 1ZSVA 2J3JA 3PK0A 4NBVA 1NPYA 3L2OB 3C24A 2GHRA 5AJZA 1N2JA 2Q99A 4F6CA 1WX1A 1P4HA 5BV8A 2AYXA 3IQXA 3D6TB 2YTZA 4GR9A 5K8VA 4CV3A 4YJ3A 1GLNA 3IOEA 3BVPA 4EYOA 2ZSFA 3TO5A 3W6PA 4LF9B 3PUWA 2J5RA 2V45A 3IPYA 2FWNA 2PKQO 4OV6B 3GRYA 1O8BA 5KQLA 4MPPA 3ES9A 5F35A 3RREA 4CT0A 1JDTA 1T8YA 1VG1A 1DAKA 3IVCA 3SX2A 3UT5B 5I9SA 1Z6ZA 1JPUA 4L02A 5EWMB 2HADA 1PJ2A 3GPBA 2JNWA 1NJ1A 3NFRA 2OCDA 2QIOA 4LX8A 2G67A 1F06A 1F12A 3N3BC 4ZOBA 2JAQA 2YZNA 4BNKA 3SR3A 2OLEA 4WKOA 4WN9A 2IGTA 2X19A 3QVKA 5EXSA 4DQLA 1U2DA 4IZIA 4LC1A 5CFNA 3HN2A 1LB1B 4ZI3A 3DF9A 3NRCA 4IKEA 4CTOA 2ZPUA 1L7BA 2LGJA 1CDEA 1GNSA 3ANTA 2NAFA 2OSVA 2XCQA 1Z2EA 2OORA 2ZUBA 1L5MA 1PWYE 3HB0A 4IPTA 4QO8A 2YHSA 4BGDA 1UDAA 3GDHA 2ZKIA 3WIEA 3VPGA 2H85A 3H1GA 4LNUB 1PHRA 1DEAA 5BV2P 1QPZA 3MSCA 3UFXA 1CE8B 2AEEA 3T5GA 3MGAA 4C30A 3JRXA 4WEQA 4X7BA 1Z0JA 2MIIA 2HXSA 5J2UA 4BGVA 1UKAA 5A7HA 2P79A 4U0JA 1EM8A 3SQWA 1UK7A 4K9DA 3QNUA 4KBFA 2JEYA 4KQ2A 4C4PA 4KMRA 4LJSA 4U00A 2HH9A 1XZKA 2H9IA 4U2KA 3TTWA 3NS7A 2GXAA 2F8LA 1R6XA 3IOYA 4X6XA 2AFRA 3WK4A 1LK0A 3TXXA 3VVMA 1OLOA 3KR0A 3JCZA 4NDNE 4UNSA 4QQNA 2UXCB 3DV2A 4DG9A 1FP1D 3E7PA 8OHMA 5H5JA 5FRDA 1P2VA 4MDHA 3TGLA 2G9UA 1ONOA 1Z0ZA 4LMPA 1VJRA 2RJ3A 2O1EA 2P90A 4DR1B 3HBAA 3SHTA 4MLCA 4TRNA 3ROEA 1HQKA 4FMDB 3T1YB 2D74A 3VR0A 5A9SA 2NZ8A 3ZU6A 2O2XA 3H3JA 3Q4GA 4DXDA 4L51A 1TAUA 1SUCA 2OKCA 2WYHA 1N5JA 3QOFA 4HNVA 2JFQA 3SX0A 2RSLA 3L18A 1Q1QA 2V0NA 4NEHB 1FVOA 2YWBA 3DKVA 4DLNA 1BGVA 2Y1EA 4R8VA 4B84A 2H2AA 5BSEA 3H2JA 5LFAA 2WC1A 3OZIA 4G0OA 5J58A 4IM7A 2OLKA 4YRIA 3HXKA 2I03A 4F4IA 4X45A 3R7LA 4V3CA 2Z6UA 4FYWA 3IVMA 2OBLA 3EMVA 3HUDA 3MHTA 3EVDA 3P52A 4C14A 5B7NA 1MRNA 5JCOC 1ID8A 1B43A 1S3GA 5LYYA 5CR9A 2XKKA 4I5EA 3QQPA 2QKYA 1LCIA 1Y4SA 3H5VA 2YN2A 2YYYA 3ZE2B 5BSWA 4IIEA 2X1MA 1X77A 1Y3BE 3DBOB 2HB6A 5FIUA 2XMSA 1DCFA 4NNOA 4YEDA 1UAYA 3PTLA 4ZT6A 4XJXA 1XO1A 2NSJA 3TBHA 3ZE6A 1IM2A 1X74A 1J56A 2ZYWX 5COQA 3ZDRA 4F2WA 5FEUA 3NGMA 4HATA 1T8UA 2JCBA 1RM0A 2RIRA 4MPDA 4QPDA 4TYPA 3VDXA 3ZXSA 1AD2A 1KDPA 1CNFA 3WBKA 4ODIA 2OUIA 3R8CA 4A26A 3ZWYA 3RHFA 4I55B 2V7QD 5COAA 3MPOA 1FE8A 4WLEA 1V5FA 4Z7QB 4AO8A 1NW5A 2GVZC 4JUDX 4BQIA 3FPBA 4ENVA 1YC5A 3AVXA 3RIYA 3PV0A 3L0PA 1Y1PA 1VIDA 1ZH8A 1ONPA 3O4FA 3VDMA 3VDNB 3MRTA 5E1OA 3NHSA 2UDPA 4KPUB 2BP7B 2VNJA 1CQZA 2WF6A 1RI1A 2LIVA 3GJXC 3GZNA 5GV8A 3GARA 1EUCB 2J9FB 4B6RA 5KVSA 4HOYA 4X1OA 3KQTA 1O6ZA 3HP4A 3P7MA 3ZZ1A 1Y1SA 2HQSA 2QWXA 4XPZA 2PPLA 4MRMA 3UHFA 2Q4EA 4Y2YA 5JJCA 1A50B 1E99A 4TSRA 2A14A 1QHGA 3VKGA 4U2EA 3UB2A 1EVLA 5IM5A 2FW1A 3K32A 4EGJA 4LXGA 2PWAA 5E4FA 3HL4A 1Z2NX 5EXEA 1T6ZA 4URFA 1N6OA 5G4KA 2CKMA 4DLSA 2FPGA 3LRTA 1UBUS 4PAQA 4RVDA 1UK8A 3FUVA 5C5DA 2P75A 2UU9B 3BDAA 1F4PA 4LRWA 4PU0A 4TXJA 2N9UA 3RYCA 1OXTA 2J32A 3B1YA 3SR4A 5J1SB 3KKPA 4ZYYA 1FMTA 9ATCA 2AGVA 3AHGA 4MS3B 3VZPA 3RVQA 4KOAA 1NNEA 3STWA 4BMVA 1YE3A 4FFVA 4BVEA 3H0KA 1SUBA 2A1TR 2BFBA 2H08A 4RABA 4OEHA 3WIDA 1XZ8A 1EBBA 1W35A 3DFIA 3ACBA 1XRPA 2HNBA 4DQDA 1Q14A 4RFSB 4BU1A 5HQ3A 4NCBA 5BVGB 4II2A 2JZNA 4RLHA 4KAXA 4CR8A 4ZGGA 5CDUA 1IM5A 1ZGGA 4S12A 1R00A 1OZFA 3KTFA 5HF5A 2AI1A 2DH5A 2LRHA 1J39A 4UUQA 2H3EA 3IA2A 3TSYA 1ZESA 5ADUS 1JFSA 1U28A 2XWSA 3GLHE 2IV2X 2LKCA 2AB0A 3OSUA 2IXGA 4UFNA 4GPZA 3CPSA 1QWOA 2FMKA 3F78A 5FAXA 1WSBA 4Q3BA 5DMHA 4BNLA 4MPTA 1T2UA 5CFLA 3DEIA 1H9BA 1KJYA 1P5RA 2CN1A 4JA2A 3T4EA 5F76A 2P9ZA 3HKCB 3P2EA 1EJBA 2IYWA 3PC7A 4U6NA 4UAGA 3VOSA 1NA5A 4Y18A 1EDBA 4U2BA 3AVYA 3ISTA 1LEHA 4JLKA 5EJ2A 1SCQA 3ICCA 5A7GA 1JR2A 3HVRA 3DLPX 4OJTA 5LOVF 1URPA 4PPYA 3BGDA 5JQWA 1FSPA 3DAGA 1HX7A 2WSSA 2QI9F 2QZJA 3JQAA 1QJ4A 1VCOA 2NNLD 1RP7A 2J9YB 3CZMA 3E4CA 1WIWA 5HDBB 3N87A 3OEWA 3OJEA 1M1ZA 3D6MA 1GOTA 4IIDA 1XAGA 4HEA1 1IEVA 4JGIA 3FUWA 2QN7A 2RB4A 4K9SA 1DBRA 3QMWA 4P31A 1ODLA 1HE4A 2P2ZA 3IEIA 4G4GA 4QVGA 2WT9A 1HYHA 4ARZB 1UF9A 5K0FA 2F3TA 4K6CA 5KTTA 2QVLA 1VSQA 3NHLA 3QKWA 2NAPA 4HNTA 3A2LA 4HVTA 2BW0A 5IUKC 3SC4A 3IPAA 4JC0A 1K8ZB 1OWLA 2GXSA 3MINA 3O4GA 3PPVA 4G26A 3G5MA 5FP0A 4D2IA 2GLTA 3ADBA 2YIVX 3P4YA 2UYCA 1XZJA 1NRJB 4O2AF 1JAZA 3CNQS 4LWZA 4JLDA 1QHHB 1Z33A 3QU5A 4RMIA 4AMUA 3LD9A 1I9CA 4IO0A 3OKPA 3WGTA 4R83A 2F62A 1B6TA 1KJJA 2MHCA 1I3CA 5IK2A 4D3DA 1X8XA 4EKDA 4LDQA 2O4UX 3OA2A 3PC4A 4ZTBA 1SU6A 2M1XA 4GVLA 4FJ1A 1N5DA 4DLRA 5ENVA 3ZHVA 4Q12A 1P1RA 3WHLA 1NZDA 3RBVA 3WTCA 2IX3A 3KEFA 1AUOA 1TGVA 1P1IA 1E0KA 1W5SA 1R4NB 4L4UA 1OZHA 4TSKA 4TV9F 4CM8B 4FFRA 2EXXA 1MN6A 2B94A 2XA9A 3KHTA 4I14A 2HT1A 3F6CA 4JEMA 1BOOA 2X1VA 3CT4A 4HGYA 5EIHA 1TYEB 2Q9BA 5DHTA 4ECEA 3Q8KA 3QKSA 1KYXA 1UEIA 2VR1A 1GRNA 4HLDA 4PPQA 1JHUA 3UA3A 2EKPA 4FUQA 5KS2A 1BCRA 1Y81A 2DCMA 2EJTA 1PZFA 2ZIGA 1FDOA 1JWAB 2NU9B 1LVHA 2Z9DA 4WESA 2H54A 2W6OA 1T26A 2OQVA 4W9MC 4CLXA 1SU8A 4J1TA 3D5EA 1NVWQ 5C2JB 1QIJA 3U80A 4IH4A 4OQZA 2EKLA 2PRSA 1EGQA 3H86A 1E1CA 2RHRA 4TVOA 4DF3A 5CFMA 1GA6A 3TAHA 1Z4OA 2XIQA 2ZSDA 4RM2A 3FKJA 4G0PA 1TUEA 3I2FA 2NUAA 2REBA 4PRZA 1QVZA 5L6LB 1CRPA 3RW9A 3WK9A 1YE5A 4WRRA 3AJ8A 5CNJA 3SXUB 3KTDA 4BLVA 2LBPA 2NZWA 2WNIA 3I6YA 1GL7A 2Z6VA 1V6CA 2VYND 4NS4A 4PRKA 4X93A 5LYJA 3RS8A 1KEKA 1BHJA 1J5XA 1YFLA 5EJEA 3NQ41 5C31A 1JIVA 1X70A 3JRNA 4B43A 3GHYA 2IPOA 3A9VA 3GAAA 4H6XA 5CIWA 4ZVRA 4ED9A 1K9VF 4NYMQ 4HDMB 4PINA 2OFFA 3O4IA 3RE1A 1QC5A 4XQEA 3D8RA 3G8DA 1R37A 3NGLA 4XIIA 1FS5A 1G7TA 3M4NA 3RJ9A 3CHYA 1BSVA 2OBYA 3ND8A 4QAJA 4C06A 3RU7A 1DUSA 4OU5A 3AVVA 1QB7A 1XUOA 4EVQA 3SQXA 3UH1A 3M3PA 2AOUB 1KEPA 2D5IA 5H9WA 3ELBA 1J2YA 4LRYA 5KTPA 1Z47A 2JL1A 4MW9A 5CD1A 5GADl 3D02A 3AEUB 4V1CA 3DPIA 3MMSA 2BF7A 4G0NA 4MHTA 1R4MB 4RH0A 3FB1A 5CLHA 4ZU1X 4ACBA 4JUCA 5IBRA 1SWVA 4MWDA 2FZLA 4AUMA 3FMOB 1IZ9A 1EX7A 2FQ1A 5KREA 3VX4A 3DZHA 2ZUUA 3A14A 1NXTA 2FF7A 1WUJS 3WQHA 5EUMA 1JAXA 3RIMA 2VJDA 3EQZA 1ZEMA 1GHTA 1X7WB 2FB9A 2HGZA 2XGMA 3CWCA 3F4LA 4OFZA 4MGYR 5AKGA 1JLHA 1JFFB 1RLTA 4AO6A 2NUAB 1Z73A 3R6LA 1I1HA 2ANBA 2O2JA 3ZLTA 2GJSA 1Y5RA 2HQBA 3QE4A 1VBNA 4ZVNA 1E2HA 4IFEA 3IKTA 4RMGA 1ZNQO 1FXSA 3FCAA 2VJYA 3KKKA 1Y42X 3KYCA 4EIWA 1W29A 1Z68A 5EHZA 2PGJA 1QTIA 2ZIVB 3C8ZA 5TMDA 4BDTA 3R0VA 3G7NA 1V48A 3EXEA 1QG6A 1O58A 4JCCA 2GHQA 3DOUA 3KXPA 2ODEA 3NXKA 5J59A 3KE8A 4YRBA 4GPAA 4YI3A 5AW8A 4NRDA 4OMFG 1RYYA 2Q4OA 1Q44A 3AY3A 2OZKA 1M2NA 2WFAA 3PUYA 4H08A 4L7QA 2C00A 3LX8A 4O1IA 4RZ2A 4WJKB 4O2AB 4X7PA 2R4UA 5K0GA 5L7WA 1U63A 2PVPA 2CFOA 4ZVQA 1L5HB 2BEJA 1YKGA 1EVKA 5KYUB 2UUCB 4B6EA 4NZ9A 4RVFA 1UK6A 4A8HA 1ECPA 4I1RA 3ETNA 4UJ3A 3PEEA 4RLFA 4WERA 1I51A 1JIKA 5ALDA 2ID4A 2P9HA 2BTEA 3RSLA 1FYDA 1QP4A 3CLSC 2ZB3A 1U1GA 3JASB 4E4RA 2FW8A 1T9DA 1VE3A 4MEJA 3WTBA 2YBEA 3H8JA 2XMQA 3I1JA 4MWOA 3ETLA 1WLYA 3FFXA 3D8NA 5ULLA 3V1NA 5BNWA 1ICIA 2A5YB 2J5XA 2XYHA 3JWGA 4KAJA 2P9YA 4MAAA 5CK5A 6NULA 1FJXA 1EQ2A 2P78A 3C43A 4LVOA 4EMBA 2NTEA 3Q40A 3QK7A 3ZU4A 4PO3X 4BVFA 1LWNA 2VPPA 3CCBA 4IJWA 4CMCA 5IASA 1TMKA 3LPNA 3LQQA 2P0AA 2G77B 3FLAA 4P5EA 5M29A 1QKJA 1V4NA 2BZ0A 3IHKA 2HF8A 3JAWA 2TMDA 3C6XA 4NMHA 1DFIA 4OIFA 4BEWA 3L6OO 4BP3A 1NZFA 4JVLA 2Z4TA 5AJUA 3VSEA 4ARZA 2WSLA 2C83A 1IJEA 2F1OA 4QU9A 2VLBA 2VYQA 4C6RA 3ND9A 3R0JA 1SVSA 2LCQA 3UW3A 4JB0A 3V8EA 4EZEA 5HJ7A 4BQEA 3FDZA 4RPGA 2X6RA 3EMKA 3K0AB 1Q0QA 3MILA 1QS0A 4MVJF 1R6UA 2IYTA 4IIJF 4P53A 1XQ6A 3CN9A 2FQXA 4FIDA 3LCCA 4C04A 3DZKA 5B4UA 3BXEA 3B12A 2YC4C 5K03A 1UKYA 4B82A 2WUVA 1COWA 2XCLA 1ZNYA 2RKOA 1VC2A 2BHLA 2QQGA 3EQ7A 4WXYB 4Q18A 2NUPB 3G88A 3MT7A 4HYQA 1GJRA 4C87A 5E7JA 1E61A 2SICE 3FLMA 2IP4A 4XPIB 1H0RA 2J67A 2QJFA 1PG2A 4CLHA 2WK1A 3CX6A 4N0DA 4NBRA 4OHWA 2EARA 2ZKLA 2XGOA 1Z4IA 3IAHA 4LSWA 3SS9X 4D81A 2DSNA 2WU1A 2X6TA 1E98A 3HWWA 3NTVA 4M53A 4PGFA 3SIXA 3AV0B 4KPFC 5AM3A 1BD4A 2ZDGA 1GO2A 3TRJA 3N0WA 2MDTA 3IRVA 4UDNA 3KQSA 4ALKA 2ZWVA 2YCBA 3ADDA 1NUAA 3QE2A 4UBKA 4PC7A 3CA8A 2PL3A 4Q4JA 1U8CB 1Z08A 2OLJA 5GAJA 1GZ7A 2CKDA 4TGLA 4D56A 1NN1A 2EU8A 3MN1A 4Q93A 4FD3A 1IE3A 2V54A 2JJQA 1C7ZA 3PJEA 2FRVA 3GP3A 2DTDA 4EJMA 1BXZA 3RNLA 3L1VA 1Y1RA 2QY9A 5J4VA 1BD3A 2X42A 3FYDA 3KJQA 3C8HA 2O0KA 4N65A 4N54A 3SCZA 1J9ZA 3Q7RA 2O2ZA 3UM9A 4BX3A 1HR0B 3O3CA 3WGHA 5JSKA 3MWKA 4IRXA 3TXAA 1YUMA 2Z09A 3DZJA 4RY8A 4E5MA 3U4DA 3QVSA 5BW5A 4EKYA 3IAS1 4FGLA 4EW3A 5FTLA 2X9NA 1NIJA 2I78A 2VBFA 2A30A 4LF8B 4JYBA 4BB9A 1A7UA 3CGGA 4I81A 4CFYA 1QK3A 3ZKWB 4E5PA 3RLIA 4GWLA 3AFHA 2HCFA 3BBPA 3PS9A 3ZIAD 1JG6A 1IWPB 1XDZA 1XZNA 3F6RA 1UBNA 3FRIA 4B4WA 2GHTA 3G2QA 3HVUA 3LLMA 4JLPA 3RBZA 5IZCA 2VQ6A 4Z53A 4P4UA 5JD5A 1FQWA 3EIUA 4F56A 2HJWA 1C29B 4X00A 1JG4A 3Q9LA 1O2DA 4QO7A 3HCAA 5B30A 3AJAA 4I5DA 4OBEA 1KSFX 5KYKA 2HLDD 4AJIA 4F2HA 1AKRA 1VG9B 3KT6A 1JL3A 4N03A 4AIRA 5CITA 3GI1A 3ORFA 4KQ1A 3ZUGA 4IV0A 2JD0A 3B51X 2AWOA 1KNQA 2G6BA 2YINC 2XSZA 4IXNA 1MC1A 2QTVB 5DOVA 3UC9A 2RIPA 1SHUX 3VH2A 1ISSA 4CI0B 3LWDA 2G0TA 5HSGA 4KBYA 1C0IA 1OIVA 5BQFA 1YNOA 1UMBB 2PANA 4YPFA 5A3SA 1FVXA 1CUGA 1HGXA 1KMIY 2HO4A 2RI6A 4LBVA 4O2LA 3W2TA 3QU7A 1AS3A 2A3RA 4ARVA 3OZRA 1J1UA 4BATA 1N78A 2BKLA 2GYYA 2X8WA 3A9WA 3AEUA 3FCOA 1ZU5A 5FR1A 3THYB 1Z35A 2HA4A 3K2BA 3JR7A 3PQ2A 5EXPA 1CHNA 3EHDA 1BTOA 2H29A 4RZQA 1ESNA 1MO2A 1ZW1A 4CCYB 1ZOOA 2CMHA 4RVNA 3C7KA 2FUG6 2VNIA 5GJWC 5T6BA 4AN1A 4IMPA 5I7VA 1N8TA 2QJRA 3LNCA 3X1MA 3NNNA 2XCOA 2BI8A 2ASEA 3LS2A 5C5IA 2OC9A 4LZLA 4PO9A 4IW3B 4EJSC 5HK9A 1KI6B 1V9LA 2A58A 2KLBA 3VZRA 4HVCA 3U4QB 3H5AA 4JT2A 2ZZMA 1KAQA 1ZOSA 3AILA 3PNYA 1Q16A 4FZRA 5FOXA 4HDNB 4BRWA 3SOPA 2VDNB 2VL7A 4Z4QA 3OHMA 1TK9A 1V1JA 3Q8XB 4NP6A 2F9FA 1ZGCA 2OK8A 3IP7A 1CUUA 1X87A 4MJ7A 3HADA 3RC8A 2OD2A 1DI0A 1E0SA 4JT8A 1DRUA 3SIPA 2ZS7A 5BORA 3BE6A 2BSAA 2R79A 3L4KA 3F3KA 2HNAA 4RVCA 4UOQA 1CJUC 4RZUA 4D44A 3WICA 3EZ7A 3IXLA 3CFYA 3GFFA 2YS6A 2XWBF 2K7ZA 2IYAA 5E4TA 5KU1A 4PPGA 1UDBA 4EHJA 4MUBA 3JPWA 1GNVA 3L05A 4L1KA 1Y8RB 2ZWOA 5G1PA 2O48X 4FMDF 4KFSA 4LMAA 5TQ2A 2M6KA 2PR2A 1QHSA 1RXIA 1SRQA 3VGJA 4NV1A 4HZUB 1BS9A 1JN0A 4G9GA 3ZBTA 3UMYA 3LX6A 3R23A 2VP5A 1QRAA 3Q8WA 2FSPA 3UPDA 3QY0A 5K01A 5DP1A 2CZQA 1RYDA 2HMTA 2OZEA 2Q3FA 2JIMA 3S4YA 4FYMA 3R7WB 3DEHA 1FX0A 3SHQA 2XUFA 3GJ5A 5CYPA 1AHIA 2Q1WA 5F78A 1XZQA 4NYMR 2QV0A 2PM8A 3NVAA 3HEBA 4WFIA 3JYQA 3NBKA 2UZ3A 3PGA1 6REQA 4L3VA 1M2VA 3ZBUA 3HUUA 2HPAA 3JZFA 4GM0A 1LV8A 1FX1A 1QBKC 3X1YA 1IBMB 2QPAA 3IX7A 4HFRA 3NTRA 2WIJA 3OJOA 1BVYF 5DHPA 5A7FA 4PAMA 2Q3CA 1TJPB 4TXHA 4DJEC 2UYYA 1C8KA 3GJ0A 2WKRA 1H6CA 3BEDA 4IUCS 1ZKDA 4E07A 4NE2A 2HNKA 3V1YA 1Y3DE 5DM2A 1VXRA 2A1UB 3NX4A 1O0SA 5FI5A 1I2ZA 5K20A 3H9QA 3BERA 2SCUA 3MCTA 4CFZA 2CNKA 1P6XA 3EVCA 1TRKA 1G66A 3N2KA 2GK3A 4GD3Q 4UD6A 5C5EA 2QM8A 5K3BA 3ESDA 1D2AA 1DKMA 1Z8FA 1FTYA 3DE1X 2FN8A 3LC0A 2C5GA 2O3TA 3IPCA 2XNDA 2O7SA 1DO0A 3C4QA 3NALA 4CIBA 2HHCA 4FMPA 1KKUA 5J4YA 1RADA 3ZWQA 4FEYA 1L0BA 4A91A 5KVCA 1KWKA 3VR3A 3PGXA 1SUEA 3ER6A 3I42A 3KQUA 5K3SA 3L6UA 5JNLA 4XWTA 2DPGA 3A25A 1BKSB 3HUEA 1B3RA 4MP6A 4DR6B 2D0PB 2ZB2A 1ZOPA 1X7DA 3B3FA 4GYKA 3THXA 3GT0A 4UHEA 3WZ2A 4KDRA 2X40A 5CA1A 2PUAA 3GBPA 3FAKA 1U7DA 2Y05A 1SEPA 1UQUA 5TRTA 4ZYLA 1EWYA 2V7XA 2YFQA 1W6UA 5IG2A 4ZCLA 3WYGA 3G8BA 4GXTA 3UAYA 3HH8A 4KO8A 3VHXA 4CMGA 3ZD7A 4ZI7F 3T3EA 3AEQA 1YVRA 4E11A 1UQTA 5B6IA 1N6RA 1REQB 2EX1A 2PGXA 1HDYA 4J8PA 1QHEA 3FYTA 1WW2A 4FGZA 4HV4A 3BCUA 5KYYA 3EGDB 3CUKA 3Q9SA 1NC1A 1WKVA 2C4KA 3AGQA 4JB2A 3SYKA 2X9VA 1B0UA 3GLKA 1EFAA 4JDUA 1TXGA 4L7VA 5BWBA 4LI0A 5M34A 2BM8A 1IQRA 2GZDA 2GZSA 1JIQA 1N6HA 1Y98A 2P4HX 3H83A 4BHTA 3ZNQA 3P9ZA 3REQA 3DT9A 4MIOA 4QFCA 4ZEVA 1P6QA 4ND8B 2VHXA 2NPOA 3AUFA 4M36A 3HA3A 2AOVA 3ONVA 5JBQA 1XDUA 3U7HB 3DZIA 1NVMB 3NXSA 2WILA 2E4XA 4IO1A 4Q02A 4YAJA 3V48A 2I80A 3H5IA 1TT5A 1A95A 3COSA 2M98A 1LH0A 3HMKA 4BRSA 1TNDA 4S3MA 3GCXA 1ZVMA 1KYWA 2EHDA 1VE1A 1ESDA 4N3BA 4ALJA 2Z95A 4RKYA 4AXXA 1K6EA 1NBMD 1M0TA 4AICA 5I9LA 1ZIOA 4BEVA 3LO5A 4EG4A 2P3QA 3CSUA 1E1RA 1GSOA 3FH0A 4D46A 4CMEC 1XXHE 3N28A 1SOWA 4HH0A 3OT1A 2AN4A 4F5WA 2NVOA 1RPZA 2ZITA 3EPLA 3P9KA 2DFPA 5G4KB 3QA3E 4UARA 1VGRA 3C5CA 3EVEA 2KLHA 2TMKA 4Q1FA 4XA8A 1RLOA 2VP3A 4WFKA 3S1AA 1T8PA 2Q0XA 5JDIC 1IBLB 4WBSA 4FHGA 4JT9A 1A77A 2D13A 4P4SB 3DLHA 1TIKA 3K4QA 1ONBA 2HK6A 3EDCA 3RTGA 1KY5A 4NJOA 3IEVA 5CRIA 3ITNA 4F3TA 3X1XA 5A4FS 1KFCB 1JBKA 1YH3A 1ZWKA 2BEVA 1OV6A 2WHEA 4UEOA 2B8JA 3RFVA 2A5LA 4M7PA 4RK5A 1XFDA 5A3QA 3GNLA 4HZIA 4MZDA 4UEQA 4KXNA 3WL5A 4WNCA 3M2PA 1R3UA 1WXQA 4MUXA 2A57A 4P86A 4R1NA 5LBIA 1O6GA 5DF1A 3M89A 2I3GA 1LRJA 4PZEA 2C2GA 3L1KA 4PLTA 3W5IA 3FM9A 5CX4A 5CXSA 4FFOA 3QVGA 3KWLA 3R6GA 2VEOA 4YAOA 1DRWA 3AB8A 1E69A 2CXOA 4HUQA 2GJ8A 3ZWAA 2R11A 5H02A 3VXKA 4DREA 3RADC 1PGQA 4K9RA 2PJDA 4L0MA 1WTAA 3K9BA 3ZI0A 4GICA 4DCTA 4H3SA 2B69A 5KJFA 1R0ZA 2HBRA 3D6VA 2B36A 1MD9A 3HYLA 2B7LA 1C4OA 3W79A 4QPNA 1C1HA 4ZZ3A 2AMVA 3OEHA 3OC0A 1GXSB 3EQ8A 3BB4A 4TS9A 1RYFA 4TL8A 1IYZA 2ACKA 2QRUA 1JQ3A 5LZ8A 1A88A 4B5KA 1TJ3A 3DYIA 2HN9A 4CM1A 5A9SB 5B2FA 1CRWG 1Y3HA 4YCDA 4YAUA 3WGIA 3S0JA 2XWPA 3G02A 4P3YA 2BFNA 1TYCA 1Z6AA 2GK4A 4I3FA 2H2HA 1PFYA 1VI2A 4O2BA 1N0HA 3TIVA 3WIOA 3V00A 5K9ZA 5HWSA 1QRRA 4OSOA 3K7EA 2J7PD 4U6SA 3EISA 1W34A 2VVTA 4ZEOA 5I7EA 5B3KA 1KYQA 4FHEA 1U9CA 2CEAA 4YHHB 5CNKA 3OCZA 5B4VA 3B82A 3OLQA 5JVDA 1RKBA 2IU4A 1VL0A 2OBMA 2VUIB 5DTIA 2R60A 5ESXA 5GV7A 2VJLA 1JJ7A 3SJ7A 4DIMA 3GLGE 2O8DB 5JMPA 2P7IA 3TINA 1C1DA 1R8SA 2GBPA 2H6EA 3BXFA 3C3PA 5C52B 2XA2A 5LP6C 3B9RA 1QFYA 3FDIA 3K5PA 4M88A 4U2CA 4W82A 1BYIA 1S7CA 2HEGA 4Y2HA 3IV6A 2M6SA 4MYSA 4C2UA 3MS7A 1WU8A 1RJWA 2H1RA 3K31A 4ARCA 5AJVB 3O2SB 4GUAA 3WLQA 1TUGA 1YASA 2IE0A 4H7KA 1ULAA 3HI4A 2EJCA 3TLZA 1WS6A 3P94A 3GLUA 1FLAA 2AVNA 4G1EB 4RSMA 1QGOA 2IUEA 2JFPA 2QQFA 2KE5A 2UAGA 4J6EA 4GX2A 4XLLA 2VCEA 2GGSA 2ZEJA 3WGQA 4GOKA 1PLLA 1JEDA 3D0QA 2Z8YA 1B6RA 2J3IA 1GAQA 1MABB 4MLPA 4IQ8A 3D3QA 1U2GA 1ZEJA 4HGNA 4OKNA 2BFAA 1C1DB 1HZJA 4R2MA 2DFDA 4UHHA 3SC2A 2ZVDA 1Z2AA 3CZ9A 3I4FA 2L19A 4NEGA 1HLGA 2G4CA 4ZEWA 1YCHA 3EA4A 3KDAA 4O1MA 1TJNA 1EGVB 3HWRA 1P7YA 1ESEA 4OBWA 2AJDA 1P7ZA 1A2OA 1G41A 5JEDA 3MJFA 1N77A 4CEIB 4K6KA 4IMJB 2IX9A 3OETA 4YDSA 3IAS6 3VAYA 4UNQA 4OLHA 2EFEB 2ODAA 1GPLA 5EIEA 2PUCA 1VMDA 1NM5C 3K0KA 1U0LA 3DVQX 3BFPA 1WPXA 3NYWA 3QENA 4R69A 1LDMA 3WO0A 1AO0A 1DEHA 2VTKA 1XPOA 4ZVMA 1CZLA 5E7MA 5IVDA 1IG3A 3GGPA 3AKCA 5IBPA 4W1RA 2IIPA 3F5QA 2NU8B 4RTKA 1SCDA 4ZVTA 2CVPA 3M83A 2I3BA 5IARA 5HR5A 5EJ9A 5A05A 3OLCX 1AUQA 1DEOA 2WF8A 1KYVA 4IIGA 4OREX 4U9IS 5FUXA 2WICA 3IT3A 3OECA 2G63A 4FSDA 3U4CA 4IKOA 2YJZA 3AUAA 1VJDA 3SMVA 3VR3D 1VP9A 4C0XA 10MHA 2C9CA 2VF5X 2X4GA 4RD4A 3S81A 1WXDA 2JA1A 4RS4A 1UOOA 1PYGA 4PSCA 3BGVA 2CLLB 2QRVA 1KTVA 2ECKA 3CUVA 1CY6A 3MBIA 5AUQA 5H80A 3RVNA 3KYJB 4FHDA 5DWDA 3IOBA 1EIZA 2G5GX 5JALA 1GPJA 3DUWA 1P2TA 1X0XA 1VOTA 1MBZA 3HVKA 3KNZA 1AQYA 3LC7O 1CP3A 1W52X 4KAAA 4PBSA 3GJ3A 3OZFA 4NNJA 1JQAA 1NNUA 3RVOA 2A86A 1COZA 1FLVA 4MVXA 1R8JA 2ZJ2A 4AMZA 1I5EA 2FUKA 4LCJA 1NY5A 1E9AA 3AESA 3S2IA 4I7EA 2WIFA 1PW5A 3L7MA 2R7MA 5HF8A 2B30A 3GR6A 1P1FA 3WKAA 3QEMA 2ZJAA 5I7OA 2H2GA 1DX6A 3TTVA 4KUGA 3F2IA 1TEXA 3FLBA 1TKCA 2BT4A 3ZXIA 1I3NA 4D5EA 2P2GA 1C4KA 3GPLA 2A7QA 4B47A 4UATA 2XT6A 4XX0A 2AZMA 3MWGA 4I55A 2BJHA 3ZNPA 3K1AB 4NCJA 5E2AA 4AZ0B 1C30A 3MWDA 1QR6A 3LBFA 3DMTA 3ETDA 1V35A 2G0AA 4LCBA 3C74A 2KSQA 2QVBA 1EAYA 1RBZA 1XI2A 2CXPA 2X41A 1XZBA 2YIDA 3VYRB 4Y9DA 4JBXA 1OYYA 3ROXA 4TKLA 3WNDA 3UAGA 3A4LA 1S01A 1T4GA 3HCPA 4UHBA 2P4SA 3HKBA 5KYUA 4ZO6A 4U7JA 3I4CA 2VSOA 5BQPA 3SZGA 4YRTA 2ESRA 4ID3A 3EY9A 1H4SA 3HEAA 4AAYA 1SIUA 4EMTA 3AEXA 4PEVA 1BVHA 3KALA 1R9GA 4WY8A 1N34B 1JWBB 2XBMA 1U8YA 4GOXA 2WJ6A 2QU8A 3U7RA 5BVHB 3WSVA 1W46A 1ZCBA 2VNKA 2OZLA 1J90A 1ZCFA 3FYUB 3KWMA 4IL5A 4MA5A 5AQEA 3TX2A 3U60B 1QF9A 3HDTA 1X80B 3I01M 1Q1EA 1BHSA 1MJ5A 3GF4A 3M33A 4HMOA 4Q3NA 4M0EA 1R9MA 4LECA 1Y8QA 2BH9A 4UD2A 5FA8A 4MQMA 3DAYA 1AZSC 4DRXA 1UBMS 4XUDA 4OGWA 3EVZA 2R48A 2BFCB 2WTMA 3DFMA 4FOSA 4AJLA 1KAMA 3FPHA 3HMQA 2LCIA 3EWNA 3E58A 4ZAWA 5DM70 4EUKA 1WTCA 2YOFA 1MKYA 5IN4A 3CVVA 1D9ZA 3UB4A 2GTPA 1O96B 5KEIA 1V0JA 3RTAA 1IONA 1C3OA 3K1ZA 5KNBH 3VJRA 2PMWB 4U63A 1SBHA 2R66A 1P3JA 2ZUCA 1E3LA 4HRXA 2JGRA 2X7XA 1ZW6A 3TL6A 4JQYA 3SS8A 3BBLA 2ENWA 1DINA 4WK4B 1C1YA 1L5OA 1MHTA 4E7PA 1NP3A 4UOZA 5CDHA 2BV3A 3BRCA 1MORA 1ZO8A 3MCWA 3P2MA 3SIWA 3ZI4A 4RTQA 3CPJB 5C8YB 3AR4A 5JYDA 4MGHA 1M33A 1QFXA 3OX4A 1NLUA 3CRW1 2FLKA 4KREA 4NULA 1QGDA 5FPTA 4R2JA 1NMZA 2B4AA 2UZ1B 5KTKA 4C7OB 2PRJA 2V9ZA 3V3TA 3J7TA 3ZDYB 2W4QA 4NC9A 3BJMA 3EXIB 1G42A 2FGJA 3FNGA 1KPHA 4OUDB 3UCXA 5E0KB 1HO3A 4YB8A 4IIXA 2Y76A 4DHEA 1HQCA 2XXAB 1TLFA 4RBNA 2JJ1A 4TV8A 1G5RA 4W9RA 3ZVRA 2VG8A 1SHTX 2VHYA 3I37X 4RM3A 4YP0A 3QWFA 1G6Q1 2AR0A 4YASA 3EXHC 4ZT3A 1LW6E 5D5PA 3ZYCA 5KOJB 1YZYA 1Q6YA 1Q22A 3EY4A 1NJGA 2YQZA 3WJ7A 3EASA 1MOPA 4URYR 4TL9A 4A16A 1LTHR 1AKUA 2WWYA 5E9AA 4RVOA 2XUAA 2FUG1 3L0OA 1AKYA 2V3WA 2QGNA 2ECPA 3E9EA 3JWPA 2GCGA 1QZ3A 4ID9A 5JXHA 3P9XA 2Q2OA 1QCZA 1ZAKA 4X3PA 4DOMA 1K89A 2E4WA 3SBOA 5BWMA 3V1TC 1E1NA 3ELUA 4HEA6 1KR5A 2RGBA 2UVPB 4DPLA 1X1TA 3PTAA 4HBZA 1ICEA 3PFWO 4OO3A 5F4BA 1DT5A 1SQGA 3SKVA 1XD2B 1S7GA 2B0CA 4KXQA 1QFZA 3OLXA 3DTNA 4P3NA 1MR3F 2W8ZA 4POAA 2CLDX 3GGSA 1XTKA 2N0SA 1Q15A 3CX3A 3R3VA 4DEYA 1UJNA 4RSRA 1MVLA 1WLSA 3GJZA 4NZNA 2I1VB 1NXOA 4YV2A 5IVPA 1SG0A 1ML3A 4LOAA 3ILVA 4RTSA 1EYZA 4MRRA 1E2DA 2QJOA 4J7XA 4NU5A 3ABZA 4YALA 1DJMA 5CB4A 5JYCA 1P4JA 1DIBA 4EKNB 4R7GA 1VCNA 3D64A 3GEEA 3ZJ5A 1BN6A 2XF2A 4YJHB 1NTOA 4WFJA 2Q1UA 4RHUA 4CN8A 3R6WA 1NXXA 5LQKA 2EP5A 2HQOA 3OHSX 3LNTA 4UTVA 2CJWB 3N5KA 4I6JA 3L7BA 3FRHA 3O8BA 2OXTA 4LRQA 3VRHA 3WJ2A 1T5LA 3WLMA 4CYMA 4ES6A 8ADHA 5HM8A 2W6IA 3ZX4A 5LM3A 1PJ4A 3UK6A 2ACVA 2Y1CA 1G9TA 1JQEA 2OMKA 2QLFA 1JLLB 2IYRA 1BGWA 4RF3A 4B3IA 2OYSA 2ORWA 2JAUA 3ZHBA 1P75A 3UMFA 3NFYA 4PPNA 1STOA 7REQA 4BKUA 1E8MA 2NU7B 2WSBA 1O08A 1TK3A 2QP9X 2BMAA 2VLIA 4LVNA 4OHXA 1NP7A 3IQWA 1DTSA 4GPIB 1VIAA 1XLTC 1NSFA 1ZH0A 2FK7A 4WUTA 2PT7A 3OUUA 5F5XA 2XTMA 3NHJA 4EFKA 3NDPA 1RQNA 3O9MA 5KYTA 4DGSA 4ABTA 3BK2A 2RAPA 2TRSB 1V1MA 2OECA 5IKXA 1UJ4A 4F06A 4JP8A 4NBNA 4W7HA 3OO1A 3P32A 2DHEA 1XTIA 3X2FA 3P0HA 2R5WA 3G89A 4BX8A 1J49A 4X7RA 2Y67A 1IVNA 3GP5A 3R0QA 2RG1A 2QVYX 3LGSA 4NMMA 2IBMA 1JLSA 1PBTA 1H93A 5F9MA 4YCLA 3H8SA 2FZEA 2C96A 3M4ZA 5CH5A 4CQMD 1AGRA 2GETA 4IEEA 4QG7A 1S3SA 3IUNA 2GS9A 1NBIA 3DUFA 4WLUA 2FPOA 5IWCA 5EHIA 1J06A 2PGOA 1EU1A 3MB5A 3NG1A 1VRWA 3QVJA 1J6UA 2MWMA 1XEFA 3FDJA 4EHHA 1C3LA 4X44A 3L6RA 2QE6A 1RYNA 2FZKA 2JLXA 2FETA 2VSQA 4N8EA 2XODA 3EIFA 2XUGA 3HFGA 4D3ZA 1W5FA 1MAUA 2X2OA 4HH3C 1W88B 3I9KA 2XKJE 3FKQA 3KEQA 4Q9DA 1K8YB 3SYLA 4ESHA 2FW7A 2NT3A 3PT5A 4AKEA 1DT3A 3KQNA 3M34A 3ITDA 4GL2A 4LBYA 5CM9C 4DJAA 4M1KA 3WGUA 2VTBA 4DGQA 1WMEA 3PX2A 2EFYA 3VH4A 5TS2A 1ZPDA 1H2XA 3RSZA 4DKXA 2JAPA 2WQZA 4R6XA 4YXFA 3DE6X 3PI6A 5JARA 4ZQEA 5ALJA 1J0EA 5DN6A 3M3DA 3QUQA 1G60A 4LG1A 2R00C 5CG1A 1IIBA 4K6GA 4MPJA 5EZQA 5MN5A 2CNDA 3LDFA 1FS6A 2ERCA 3N2NA 1CZRA 3T12A 1EFCA 2Q4RA 1GKIA 5JROA 2IWHA 4GF5A 2E21A 2GYVA 1U65A 4RV4A 3QMVA 4POOA 3BUSA 1AU9A 1GAEO 3IEPA 3QWBA 4FWIB 4N5LA 4NYJR 3TSCA 2P9BA 1JMKC 1IZ8A 4FEEA 3ZGOA 1YBHA 2R9VA 3BKWA 2OZVA 3DEZA 3AZQA 3RU3A 5BSHA 2IXEA 5B4TA 2NMVA 5AVQA 4BO2A 2JLWA 1FOEB 1YJXA 2KS6A 1DO8A 5K6TA 3LIPA 3QXXA 4I9UA 4ZYXA 4WOCA 2GFIA 1UOEA 1DX4A 4QGGA 3ANXA 3KPVA 3E7DA 4X1KB 3T7AA 1PL7A 2GCPA 2BM9A 4JHXA 2R7NA 5K1ZA 4ZO8A 5EKUA 3PR3A 4PC3A 3VPFA 2VP9A 1P7PA 4N0EA 3PA6A 1X1CA 2R86A 1M2WA 4LOKA 3B6KA 3SZLA 3N8DA 4R2HA 3JV7A 3LXXA 1UM8A 4S1PA 1RXSA 4KIWA 1HA3A 5IS2A 4M7RA 3PI7A 3EXIA 4QXPA 5AMXA 3SZRA 2PUGA 3R1IA 1KRHA 2PBZA 3MF4A 4IDHA 1QAQA 3DE3X 3PZBA 4NEQA 4IJ5A 3L0ZA 4I36A 1ST2A 1YULA 5LP6B 4NENA 3NHFA 2XEDA 5L4NA 3WOHA 2BPOA 2PSDA 2ISQA 1Q7CA 1BU5A 1IY8A 3IH5A 2QMZA 1BU8A 5BN4B 2G9NA 2Z6AA 1QS0B 1QX3A 2A88A 2HJHA 2IXFA 1QV7A 4CKCA 3K9WA 1LPBB 4C3UA 2IS4A 2Y68A 3U62A 2VPTA 1A9RA 2OO7A 3OPVA 3QA9A 3QG5A 3RVDA 2XQJA 4TLEA 1BXGA 4AUKA 4RA9B 5D51S 1YIAA 3SAJA 2W11A 3HLYA 1T43A 3L92A 3MT0A 4NFSA 4QUJA 2GD0A 4LJ7A 4QHSA 2IYQA 1NXPA 3CURA 4H6PA 4HK4A 3CEJA 4K1XA 4US1R 1J8DA 2FPSA 3COZA 3LK6A 3PNOA 5EQJB 3VAZA 5A4MS 4GOLD 3OM9A 5K2MA 4R5HA 4QEDA 4A0GA 2GBFA 2V4MA 3NWPA 2Z2ZA 2Y0BA 3O31A 1XAIA 1SCUA 2OB1A 3KLOA 4O33A 4PHFA 5GONB 2X1HA 1K2WA 1FQJA 2XUJA 2EF1A 1XAHA 1Y37A 1YA4A 4HQLA 3TSAA 3ANYB 1CEXA 5CVDA 4CNQA 2WTXA 1GUYA 3CH5A 1OXVA 4N4AA 2W4IA 1NBMA 1TA9A 2H0QA 2R5NA 3UANA 1W9HA 4MZXA 5IAKA 3AVOA 1J2UA 2PKWA 1JVNA 3Q9NA 4FGWA 4JJFA 4L6IA 4DSUA 1UP6A 2BGWA 1DC7A 1T9GR 1LS1A 4CLEA 1AN9A 3LTNC 1IY0A 1F2TB 1NRIA 2RONA 3F3YA 2UYOA 3JARB 5FULA 3FKSD 5ALVA 1BMTA 4KRXA 4UBJA 3VMFA 4BBAA 4IMRA 3OQPA 1AK2A 2HTFA