2V9ZA

Structure of the rhodococcus haloalkane dehalogenase mutant with enhanced enantioselectivity
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Rational Engineering of Rhodococcus Haloalkane Dehalogenase with Enhanced Enantioselectivity
rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 94
structure length 302
sequence length 302
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v9zA00
5ISMA 5BOVA 3FVTA 4XIIA 2QKYA 5CXXA 2ROQA 5JATA 3FYTA 1QO7A 4HZGA 4DNQA 3DDUA 4MJ3A 4W63A 3IA2A 2WIGA 3HC7A 4AX4A 2XUJA 5LP1A 4BVKA 2WU3A 3I2GA 3MVEA 3E4DA 3BWXA 2X5XA 1W75A 4FKBA 5AHXA 2GZSA 3TJMA 2G63A 4K6GA 3N2ZB 4YK7A 3VXKA 4A16A 4Q34A 4UFPA 4OYYA 2XUFA 3PDCA 2HU8A 3HLKA 3V9AA 3C8HA 1K8QA 3FLAA 5JANA 1L7RA 2G5TA 2PM8A 4WDRA 3WA7A 3F98A 5AKEA 2H1IA 3STWA 4E11A 3I28A 1DX4A 4QDTA 4GWLA 1QE3A 4I19A 2I3DA 4WDQA 4U2BA 1JI3A 1R9MA 3KXPA 4ZREA 3EQ7A 4MWTA 2XLBA 2HM7A 2O2HA 4ZRDA 5AKJA 2WIJA 5HF6A 1SCKA 3STXA 1LPAB 4M0EA 4BDTA 4BATA 5EHZA 3V1KA 1EXWA 1W52X 3PF8A 4C4XA 4DNOA 3NWOA 5ALTA 4H7DA 4X85A 3DKKA 2LIPA 4LKOA 2HFJA 4UHDA 3R3UA 5LZ5A 4QWMA 1E66A 1SCIA 5ALVA 3WIOA 5IVHA 5AM5A 2ZJ6A 4KRXA 4Q1VA 3R3WA 4CIBA 3C6BA 4HRYA 1WPRA 1ZIYA 4G4IA 3GZJA 1BEZA 3QMVA 3UUFA 4FFWA 4N5HX 4WFJA 2QUBA 2D0DA 4E46A 5IH7A 5KREA 1P0IA 4PSDA 3ZLVA 1EDEA 5CT9A 1MTZA 4UFOA 2DCMA 4EA6A 3U1TA 1QIGA 1VXRA 3WZMA 1UFOA 4ROTA 2Z3ZA 1LPOA 3ANSA 1ACLA 4LYDA 1NU6A 3BXPA 5HKBA 1JFRA 3WKEA 4FMPA 4GEGA 1AQLA 1N1MA 4E15A 1K63A 4M0FA 2WG2A 1JKMA 3JW8A 3LLCA 1DTEA 2I03A 3K6KA 4V2IA 1CUIA 3D3NA 4B85A 3G0DA 3IUQA 5FUMA 1BROA 4C4YA 1XZDA 5AM1A 5CURA 3OTQA 3B5EA 5JASA 1XFDA 4GDMA 1AKNA 4J0HA 4KE8A 5SYMA 1FFDA 1IZ7A 3HZOA 4I4CA 1F8UA 1N8SA 1XZGA 3I2HA 3RM3A 3X3HA 1Y37A 1WB4A 4ZV9A 4P92A 2WQZA 1I6WA 3G02A 1C7IA 2X8BA 5AM4A 4C4ZA 3C5VA 4WFKA 3VVMA 4X95A 4H77A 3O95A 4IH4A 3EIOA 5IVIA 3D7RA 5AI9A 1CUFA 3GUUA 2GBFA 2VTVA 2HU7A 1VA5A 1XRLA 4HTAA 3PE6A 2DFPA 3EQ9A 1U8EA 2RONA 5FXMA 1UK7A 1A8UA 4LIPD 4DGQA 2ZYSA 5ALMA 3H04A 3QYJA 1QZ3A 1CUHA 1XZKA 4BCDA 2VEOA 4DTCA 4F5ZA 4IHAA 4W1PA 1XRPA 3IULA 3OURA 4RNCA 5JARA 5A7GA 1AURA 5AJHA 2CB9A 2YASA 3QPCA 3DCNA 2WKWA 3HACA 5CRIA 2ZSHA 4EBBA 4AO7A 1MJ5A 1XRMA 3QVMA 1MAHA 2E3JA 5AI4A 3R0VA 4Y2TA 2XMSA 2VSQA 5CMLA 2RHTA 3N0TA 3HEAA 2CJPA 1EDBA 2PBLA 1CUJA 1SFRA 1R4ZA 5A7HA 1H2ZA 3T4UA 1UOOA 3SC2A 1YB6A 3L1JA 1XRNA 4G8DA 5ALUA 3IIIA 4S0XA 2IIVA 2OGSA 5AKHA 3V48A 4OCZA 1CUBA 3WWPA 4BAZA 1LBSA 4GW3A 4UHEA 3PICA 2WTNA 4FNGA 1F6WA 4XVCA 2PSDA 4LXIA 5ALFA 5I8PA 1A8QA 1VLQA 3ESCA 3D4LA 4BE9A 3FWHA 5CT5A 1MNAA 2XLCA 1EHYA 3PUHA 1MX1A 4OB8A 4WFIA 2AXEA 2ZJ7A 1QIIA 3S2ZA 2OQIA 2C4HA 3V1NA 4TPKA 5DYWA 4OU4A 2WJ3A 1DU4A 2WHQA 5LKAA 1ETHA 3WL8A 4Y2QA 4B83A 4MQMA 4LXHA 2W22A 3ZPXA 5KWJA 3WYNA 2RAUA 3Q0TA 1ORWA 2OCLA 4RE6A 5LZ4A 4G4JA 4H35A 4Y9SA 2UZ0A 1WHSA 2J3QA 1RP1A 3IURA 3I2IA 2AJCA 2AJDA 1CFJA 2XMZA 3ZI7A 4H7JA 4Y7DA 4DMKA 1CUWA 1XZAA 2XUOA 5H3HA 2WFLB 5ALGA 4G9EA 3O9VA 5JAUA 5EIEA 3WQHA 3HYSA 6YASA 3CCBA 3VJLA 1F0NA 3LCRA 5A62A 3QMMA 4BRZA 5A7FA 1YASA 3H18A 2CUTA 5EHXA 3BE8A 1RYYA 2QZPA 3ILSA 2WUDA 5K3AA 2CMFA 4EZIA 3M81A 4CCWA 4AO8A 1R50A 2DHCA 3H2IA 2VQ6A 1SC9A 1UK8A 4QA9A 1C7JA 5AK6A 5FOQA 4MEAA 5IKXA 1WM1A 3V1MA 2VJAA 1YA8A 3WK4A 4FNMA 2O2IA 1A7UA 4U2EA 3KDAA 1ZICA 2HA7A 4DMFA 3DJYA 3TRDA 1VE7A 3PFBA 4FDMA 1HBJA 4K6KA 2EDCA 2XMDA 1ZD2P 1O6FA 2BUCA 4C88A 3OG9A 2PSEA 2J4FA 3L1IA 1GPNA 1TK3A 3R40A 2RGUA 5JD5A 1TKRA 3VJKA 5CXUA 5E2IA 5BV7A 1QIEA 1F0PA 1N5RA 5C8ZA 4QWWA 2P8SA 5HKAA 4UBOA 4FLFA 2WFLA 4BE4A 2C0PA 4JYMA 3WWEA 1GXSA 3WK9A 1QIFA 3STTA 5JD6A 5D6OA 1XLUA 3ZV7A 3BF7A 1USWA 2V97A 1XZBA 1ZD3A 4K5QA 1O6GA 5KWIA 4OU5A 4CFSA 2XQGA 4J0DA 4Y2VA 5LYYA 3FBWA 3AILA 3ANTA 1YA4A 1Z68A 1XLWA 5JZBA 3AINA 1CR6A 1EINA 4MQLA 3DOIA 2XT0A 5AI0A 4JYPA 5K5EA 3F96A 4WY5A 2JGMA 3WL6A 4DLNA 4RE5A 2PVSA 3BJMA 3UMJA 3W2TA 5DTIA 4QZVA 2XE4A 3WKDA 3QMWA 1UKAA 1CUXA 2H7YA 4CG3A 4AQDA 3BF8A 2XUKA 5JALA 3H1BA 4X7BA 1E5TA 4IH9A 2C5FA 1VKHA 2XMRA 1KEZA 1CUUA 1H2WA 1OCEA 1A88A 3WWCA 1UWCA 3FCYA 5ALSA 1YS2X 5JAHA 3ESBA 2BFNA 4NMWA 3DL4A 4W1QA 3GA7A 4UFNA 1XZHA 2XUAA 2XUDA 2VT6A 3KWJA 2AJLI 1E8MA 5CTAA 2PU7A 4FLMA 3WIBA 3HJUA 5AI8A 3A70A 4Y2YA 5T4EA 1XRQA 3QITA 1Q84A 4IO0A 2VF2A 2H9YA 2XUIA 2XQKA 5E4JA 3D59A 4FBLA 4JNCA 3CCCA 5AO9A 4QLOA 3M83A 1K5PA 4AMZA 5FV4A 5J3JA 1Q0ZA 1UKCA 3A2MA 1ACJA 1P0QA 3PFCA 4GHWA 1G42A 4ZV7A 4F0JA 1XLVA 1CUSA 4ZWNA 2C0QA 1CPYA 3DYVA 4GECA 1EDDA 4N8EA 3BIXA 4NS4A 3VISA 5C7YA 4HAIA 2ZYRA 5CT4A 2Z5GA 1GQSA 1CUAA 5BWCA 4UBJA 1J1IA 1WPXA 2BJHA 3C87A 1CUGA 4ZI5A 2ACKA 1ZOIA 5EHNA 5DNWA 3DOHA 1CQZA 2QUAA 2OXEA 1E8DA 3GFFA 1R3DA 1BS9A 1JJBA 4GLBA 4XX1A 5KBYA 3WJ1A 4BZZA 1IUOA 1DWQA 3W04A 5EGNA 3WK5A 4LXGA 2HA5A 1IZ8A 4J03A 1BCRA 5AKKA 1BN7A 1HKHA 5K3EA 3FYUC 1BU8A 3AIKA 1TCCA 3DLTA 1Y7IA 1TRHA 5AOCA 1GZ7A 2ZVDA 3SX4A 1HQDA 1GPKA 4C6HA 1TCAA 1XZEA 2HA6A 3IBTA 3D5EA 1DINA 4F21A 4BAGA 2QOEA 4CIAA 4QDXA 3NUZA 2GBGA 1QGED 4J0GA 3C8DA 2ES4A 1YR2A 5HF8A 4FLEA 4G8BA 4BYMA 1TQHA 1XZJA 1VE6A 2Y2UA 1GGVA 5AM2A 4KACA 4F60A 5CT6A 3C5WP 5EIAA 3G9TA 4WY8A 1OILA 4M0MA 4X90A 4KEAA 2D5LA 4UBIA 2GBIA 2YH2A 3H2GA 3R3YA 3WMRA 2QT9A 3KD2A 5AI5A 4FOLA 4Q82A 5JAOA 3LS2A 2HU5A 3G0GA 4CCYB 2XQFA 3PI6A 1JJFA 4H7IA 1EVQA 3S8YA 5HFAA 2WJ6A 4Y2UA 3AIOA 2JIDA 2OCGA 4H7EA 5AIBA 4J0IA 4QLAA 2J4CA 4UHFA 3ZLUA 4DMHA 3OPMA 4OYLA 4PO3X 3F67A 4LHEA 2B20A 1L7QA 2DR0A 1BRTA 3PUIA 1VZ3A 3UUEA 5A2GA 2XB6A 1EH5A 2C7BA 3A2LA 3H17A 1T2NA 2WUFA 3O4IA 3AZQA 1HL7A 1R1DA 1WOMA 3FCXA 4X92A 5CH8A 5ALJA 2BAGA 1J2EA 2GZRA 2BGRA 1YAHA 4KJXA 3W9BA 3O0DA 3NGMA 1T4MA 1YAJA 2GYVA 1AX9A 1XZFA 1JJIA 2ACEA 4W1SA 4OB6A 3W05A 4RGYA 4Q3LA 4UBNA 3H19A 1JMYA 3LIIA 2JGJA 2XMBA 4KAFA 5E4TA 4KAJA 5ALZA 1Y7HA 4Y2RA 4K2AA 1MX5A 2JEZA 3D2BA 4HS9A 2HA4A 5CW2A 2GYWA 4EY8A 3DKRA 4AZ0A 2WHRA 3VVLA 4INZA 3DS8A 4YASA 5AK5A 1MN6A 4PSUA 3STVA 1UZAA 1XQXA 1XQYA 1AUOA 3L1HA 2H7CA 2CBGA 3CXUA 1LPSA 2XI4A 2XDWA 3R41A 1UK6A 3DEAA 3HI4A 1DWOA 4BDSA 4MYDA 3WL5A 3KOOA 4MXDA 5AKGA 5DWDA 3WKBA 3BDVA 3ICWA 1QJ4A 5DNVA 4L0CA 4X00A 2PPLA 4RPCA 4BB0A 4A23A 1H23A 3KSRA 1XROA 5HK8A 1FFAA 5FRDA 3OM8A 1CEXA 3BIWA 4I3FA 2WSLA 5AKYA 4PSCA 2V98A 5C81A 1BN6A 4MWSA 4HVTA 3I1YA 1GPLA 2Z3WA 3A6ZA 2WJ4A 2DQYA 4X6UA 4YX9A 4EB0A 1ISPA 3F97A 2NW6A 4UPDA 2Q0XA 2K2QB 1H2XA 2Y1KA 2Z8ZA 1CIJA 5D3ZA 4P93A 3WKCA 4B80A 1WCYA 2Y2VA 2XMGA 3RARA 4FTWA 1FFBA 1PFQA 5EHQA 2QXTA 4UBLA 4DSZA 3W06A 1QFSA 3H2KA 3BL8A 1GT6A 4P9NA 1L7AA 3IDAA 4FHZA 2DHDA 4CG2A 4DIUA 3G8YA 5K3BA 2IX9A 3ZLTA 3R3ZA 1X2EA 1MNQA 1DQYA 3DNMA 1MPXA 1UOQA 1WB6A 2JGLA 1FFEA 3EF3A 1B41A 3ESDA 2G4LA 2WIFA 4X93A 2HRRA 4UHCA 3E0XA 2HA2A 4BP8A 4FWBA 1EA5A 5IVDA 1CLEA 3D2CA 1LLFA 4EY7A 1QOZA 2VAVA 4EHBA 2I78A 1IUNA 2OG1A 3I1IA 3H0CA 5T4FA 1UK9A 2QVBA 3WK6A 3WLAA 1CUEA 1SOMA 5LZ7A 2GYUA 4Y2XA 3VKFA 3GBSA 1HLGA 4DSAA 4J7AA 4OSEA 4KRYA 5AKXA 4J3JA 2BKLA 3E3AA 3QPDA 3FLEA 3W9UA 3C6XA 3EBLA 3ED1A 3V1LA 1C4XA 5FDFA 2HA3A 7YASA 1ZIXA 2DSNA 4KE7A 3F9CA 5ALQA 2B9VA 3G0BA 3WK7A 3QZUA 4B0PA 3C45A 3T52A 5IVKA 5AOAA 4C87A 3WYDA 4JEIA 5HQ3B 2QRUA 3Q8WA 5D3KA 2XMCA 5AKLA 4G1FA 2GBCA 1J06A 2XUGA 5LLSA 3WKAA 4FBMA 1Q0RA 4BC0A 2OCIA 4BRSA 2O2GA 4KE9A 5HFNA 4B9EA 2OCKA 4OD0A 1ZJ5A 3IUMA 3FAKA 5D7BA 5ALKA 2WLSA 3TGLA 1LPMA 4J0KA 1VOTA 1MO2A 1S8OA 5LKRA 3AZPA 3I2KA 3ESAA 5AIAA 4G8CA 4X97A 3VDXA 2Y6UA 5ALIA 3I6YA 2QTBA 2XQIA 3FYUB 2WG0A 3OOSA 4UHHA 1HPLA 2HRQA 5AM0A 1XZLA 2JGEA 3AUKA 1JT2A 5EIHA 2QXUA 4ARBA 2WHPB 4FFVA 5C8XA 4BBZA 1CQWA 2PSHA 5DLPA 2O7VA 3R3VA 5DYYA 1VA4A 2QJRA 4JH0A 1G5FA 1P0MA 5ESRA 5HZGA 4L3WA 5F4ZA 4QE3A 4QDUA 4UBMA 2VATA 4U2GA 1E3QA 4DMCA 2WFMA 3CN7A 1UOPA 5HQ3A 1BEEA 1TIBA 1MT3A 1XKTA 4BVLA 4DNFA 4DNPA 1ZD4A 4TGLA 5YASA 5CH3A 4QDZA 2V96A 4Q3OA 2WM2A 2WTMA 3YASA 4KE6A 4DYHA 4GBGA 3LP5A 1DT3A 1IVYA 3H2JA 1J07A 3P2MA 3E1GA 2Z8XA 4OUKX 4B7ZA 4B0OA 1CVLA 5JAPA 1LZKA 2HA0A 4JUIA 3I6ZA 1D07A 1WB5A 1LPBB 3QBJA 5HK9A 4AZ3A 3I2FA 4U2CA 5ALXA 5LZ9A 3G0IA 5AICA 1PJAA 3FYUA 1VJ5A 5LIPA 5ALHA 4P08A 1XRRA 4Q05A 2OGTA 1UKBA 4ZXFA 3G9XA 3WA6A 1LNSA 1ODCA 4QNNA 4EY5A 2PUHA 2ZSIA 2WHPA 2DQZA 1IMJA 2XMQA 3CN9A 4HXGA 5FPPA 5AK3A 1WHTA 2C58A 4N8SA 3HXKA 5ALEA 1CV2A 1N5MA 3U0VA 1THGA 1BE0A 1EB8A 1QTIA 4HRXA 1HDEA 1THTA 4PNZA 3O4HA 5JZ9A 1TCBA 3AIMA 3IUJA 1X70A 1LPNA 3I2JA 3IUNA 4KR0A 4WCVA 1EK2A 4BTLA 3WL7A 1U4NA 3GELA 4AN0A 1QIJA 1XQVA 2CZQA 4L72A 2HL6A 3SWWA 1EX9A 2HFKA 5DNUA 1AZWA 4CG1A 2FJPA 2H7XA 4OB7A 3TEJA 2RHWA 1K6EA 3AZOA 3FSGA 1M33A 3K9BA 5K3CA 1GQRA 1DWPA 3A2NA 1DQZA 2HIHA 1VXOA 1ZD5A 5HCUA 2JGKA 1W6RA 4UUQA 3FNBA 2X76A 5ALOA 3R3XA 4KYVA 4EUSA 3WWDA 4EY4A 4ARAA 1DX6A 5FP0A 1ZGCA 2YXPX 3WK8A 2XQJA 2V9ZA 5EFZA 3KWFA 4EY6A 2AJBA 2HADA 1AGYA 1W4LA 4MYSA 4U2FA 4BCCA 5K3FB 4BC1A 3JWEA 5SYNA 1GKKA 5I7UA 4B81A 2WFZA 2QMQA 2ZJFA 3HSSA 4BVJA 1GKLA 2PU5A 3WZLA 2XUHA 2JF0A 2WU4A 3VJMA 2RIPA 5JIBA 1XKLA 1FJ2A 5T4HA 4X6XA 4H7HA 2VAXA 2B4KA 2QM0A 5CT8A 3HABA 3STYA 4QEKA 2VJCA 3G9UA 2QR5A 3B3QA 2PX6A 3OC0A 4PQEA 1CUCA 1H22A 2FX5A 1EI9A 2HHAA 3GROA 3ZWQA 5JADA 2VT7A 5CBKA 5K3DA 2I3ZA 1NX9A 4G4GA 4AB1A 1K4YA 5HF9A 5AK4A 3B12A 4BTVA 4X94A 2WIDA 3O4JA 2QJWA 5ALYA 4Q3KA 3I6MA 4Z49A 2OAGA 1XZCA 3C70A 2QS9A 3BJRA 4B6GA 1Q83A 4G9GA 2JEYA 4PV7A 1NU8A 4XJVA 1QTRA 5HF5A 1E89A 2CEKA 5K3FA 4X71A 2W6CX 1ZI6A 1U2EA 2XUQA 1LZLA 5A71A 2AJ8A 1H2YA 4H7KA 2BUAA 4CI9A 5EI5A 2RI6A 2R8BA 5DTJA 2VJDA 3FVRA 4UHBA 4BCBA 2OAEA 2O7RA 4LYEA 2ZYHA 1DT5A 5AOBA 1ORVA 3SK0A 1BCSA 4CCYA 1KU6A 1R88A 5ALWA 4IQ4A 2PL5A 3LIPA 1MX9A 4B82A 5A6VA 3QPAA 3G7NA 4X3CA 4XWGA 2OGZA 1B6GA 3IVMA 5ALLA 2ORYA 2YYSA 3C43A 1CUZA 2CKMA 3G9ZA 1EVEA 5CH5A 1QO9A 1X2BA 4H18A 1MAAA 1MU0A 2B61A 4ETWA 1JU4A 4G5XA 2EEPA 2FUKA 1LBTA 2VJBA 3C6ZA 2HDWA 2WILA 4L9AA 3MGAA 2PKYX 2JGIA 2DHEA 3FLBA 4HXEB 5AKZA 4W9RA 2PSJA 5FKJA 3AFIA 4J0CA 1FSSA 2FJ0A 3RLIA 4MEBA 2WUGA 3H2HA 4H7FA 3D2AA 2OLEA 2WG1A 1U65A 5I9IA 4BAUA 3G0CA 4U2DA 5AM3A 3M3DA 4N8DA 1CUYA 3WJ2A 1ODTC 4PW0A 5DJ5A 4E14A 1PV1A 1A8SA 1SCQA 1TAHA 1ZGBA 5AH0A 1CUVA 1OXMA 1YB7A 4Y2JA 3ICVA 2PSFA 1QIKA 3DD5A 1ZI9A 1VZ2A 5DYTA 1ZJ4A 3M82A 1UXOA 4Y2SA 4C01A 1XZIA 4B9AA 1XQWA 2R11A 4YPVA 5LZ2A 4NVRA 2J3DA 4OPMA 5JD4A 4C89A 1XZMA 4B84A 1ODSA 4AO6A 3JYHA 1QLWA 1QIHA 3QH4A 5E4YA 5T4BA 4K6HA 3RKSA 3H1AA 5BWBA 3WWOA 4X91A 4N5IX 5ALRA 4NZZA 5FPQA 4D9JA 1JMKC 3QM1A 3EQ8A 4X6YA 2C5GA 4Y2PA 4ZGBA 2OQVA 2G5PA 3AJAA 3O9MA 2WUEA 3DL7A 2ONCA 4GXNA 5AKIA 3MUOA 2XUPA 3F8SA 1QIDA 2EDAA 1JU3A 1KU0A 1LGYA 2BCEA 1P0PA 2BUBA 4IH1A 4TVKA 4QDOA 3FSGD 2ECFA 4AMYA 4O08A 3DQZA 4GI1A 1E8NA 2JGFA 2IITA 1YS1X 3HRHA 4A5SA 4AN1A 1W76A 3PF9A 4PF1A 2PUJA 3NOXA 1QIMA 1QONA 3DYIA 5FLKA 1G66A 1UT6A 1LPPA 3MUNA 4H0CA 1FFCA 2ZYIA 2BGNA 4J0JA 4BZWA 2VA9A 3FOBA 5AP9A 2OPHA 1AMNA 3RK4A 4WJLA 4HXFB 3BDIA 1R9NA 4ITVA 4W1RA 3C6YA 5ALNA 5ALPA 3O4GA 3IB3A 1YCDA 1CRLA 5LZ8A 1W1IA 5ALDA 3WI7A 2WIKA 1RWQA 1QFMA 1G4HA 5JZSA 5JYCA 1EK1A 1IUPA 1EB9A 2Y6VA 2JBWA 5C8VA 1AC5A 3K2IA 5AI6A 1YSCA 3D0KA 4KAAA 1ZI8A 1CUDA 4DM7A 4AXBA 4UBKA 4BP9A 3STUA
chains in the Genus database with same CATH superfamily
5ISMA 4HL6A 4G0UA 2DFNA 3IX7A 3IR7A 4XIIA 3SEQA 1KOJA 2XSZA 1Q21A 1Z5WA 3JQ8B 5LQMA 1ZEJA 5IYZB 5JATA 3W4JA 1A5ZA 1QO7A 1PZMA 1PJ3A 2QL6A 3ND5A 2BGKA 1GCIA 2QDXA 4E33A 5L6MB 3OJ0A 4HZGA 3DDUA 4KRGA 3W3ZB 1M6YA 2VL7A 2QZ4A 5D6NA 3ZZ1A 3UJNA 4FYMA 3TAHA 2QRJA 2Q6LA 4JU9A 5LQUA 3CURA 2OD2A 2VK2A 4S24A 2XUJA 2D5CA 4BVKA 3VNAA 1K9SA 3D6AA 3MMPA 1E2PA 1BD4A 3BWXA 2ZBPA 3P2OA 1NVBA 2A59A 2QP4A 3OIVA 4DIKA 3EODA 3NHJA 4LRUA 4XIFA 2BR3A 1XEAA 2W37A 3AEQB 5KNLA 4K6GA 3N2ZB 5I3CA 4JYBA 2Y71A 5DM4A 2RAPA 5IM5A 5CB4F 2UYHA 2CUNA 2IUFA 3M34A 2EKDA 3FJOA 1K97A 1XMJA 1VTKA 3HLKA 1RWNA 4KSBA 3K92A 3EEFA 3E35A 1HQYE 4QREA 3JTEA 3V9AA 1SXJB 6CHYA 1P2TA 4WCDA 3E9RA 4QTTB 3SJUA 3RHSA 3OY2A 2VJNA 2Q6OA 2AR0A 3T4XA 3USZA 1ZO8A 1ZH2A 3ZWXA 4P4NA 1FQJA 2P9BA 4G1EB 4W5WA 1G9XA 1NYTA 3IEKA 1DDIA 1U3DA 4G89A 3CPEA 2H1IA 4WADA 4Y2HA 1CFZA 4B17A 5C1BA 3RUPA 1H4QA 3T3OA 3I28A 2OV8A 1DX4A 2UYYA 4AKGA 4KV9A 3D6HA 2W6ID 4QPDA 3GFVA 4AZSA 1QE3A 1XELA 3GMDA 1NJSA 3UHOA 1NUQA 1E4OA 1AGXA 2H48A 2X5JO 4XUCA 4DUPA 2E5FA 1XPJA 3B1ZA 2A0KA 3DP7A 3EQ7A 3HDJA 2HTEA 1NVWQ 4LWQA 3TW6A 5L3QB 3H0KA 1BW9A 2FK7A 3O26A 4E94A 4JB0A 4D74A 4XR4A 5CDHA 2B8TA 4HJRA 4ZRDA 4GMFA 4RAQA 1CS0B 3WTCA 5F2KA 1SCKA 1UBNA 2O3SA 2CHVA 2GD6A 5DTQA 4HDSB 4D8TA 4B8YA 3Q2KA 4B3IA 3STXA 5T6MA 3X1MA 1BFKA 2OGWA 2RHJA 2Y0BA 3K9HA 1RW4A 1PW5A 2GK4A 2R60A 3L02A 3GPIA 3TE7A 1OYOA 1SQGA 2D7CA 1IG0A 4FGZA 4P4SB 3ZNQA 1SB8A 3OQNA 5EHZA 1ZL0A 3MS4A 5EMHA 1JKXA 3V1UA 4BXOA 1EXWA 1JDSA 3L7YA 4IF4A 3V7FA 4GR4A 3VBEA 2FSVC 1RAEA 1Q3KA 2GETA 1I80A 3ZCUA 4H7DA 1MCZA 2Q3BA 5E2BA 5ADUS 4BEWA 1D9XA 3JASB 4HUQA 4X0EA 1SU7A 3R3UA 4CM5A 2CFSA 1FYWA 2P6NA 3LX5A 4K40A 1T3HA 3QA3E 1E66A 2EL7A 2J9XB 2FEPA 3BJZA 3E9MA 2HKIA 2CJWA 4L2IB 2YC2C 4PLFA 4Q3AA 5HUHA 4UM9B 2PUVA 1QHEA 4TT3D 5ALVA 5LU9A 4UZEA 2YX1A 3ZE0B 3LY5A 1J00A 3BH6A 3HU5A 3LKDA 3M3HA 3SBDA 5KSWB 2WMNB 5AM5A 2MWMA 4ZGGA 2PWAA 2YC4C 3PUXA 6ABPA 4LE0A 3LI2A 4UAJA 2CVQA 4Q1VA 3S4YA 1E5VA 3U49A 3WSWA 1EJBA 1QGOA 3D8NA 4ZZIA 4CIBA 1ADFA 2OFXA 1IXKA 4HRYA 5HBGA 3TLCA 4RPHA 4G4IA 1P1KA 1BEZA 5CPBA 5BYAA 4CQLA 1PWXA 1J0EA 1HDGO 2M1ZA 3E9YA 3N7AA 3QKIA 4YMSA 1ML3A 4FOOA 2Q7DA 1GT91 5CVUA 4MW6A 3T38A 1SD1A 5LA6A 3WVNA 1LJUA 2LUOA 2VDRB 4DJAA 4HC4A 4IDQA 3SX2A 1HF3A 3T1YB 3R9XB 3LWDA 1VMAA 3RRBA 3ZYCA 4E46A 5BO5A 2W2KB 2Q4BA 2XDQB 5FTJA 3LPMA 1CCWA 1DKRA 4UFOA 1T3ZA 2ZR9A 5B57C 1P5RA 2XRYA 2OWEA 1H9CA 3B8HA 3HCBA 1XMOB 1RRCA 5THQA 3WGHA 3V8EA 4PSKA 2PUDA 1FZQA 5EYPA 4XWKA 3KLNA 4IIJF 1XIVA 5JNWA 2QYSA 2IBMA 2J67A 2BVNA 1LPOA 3GLVA 2R7KA 4IUDS 3FYDA 4LYDA 4XGNA 3ZUGA 3PRYA 2YXNA 1ULTA 5HKBA 1JFRA 4P1ZA 1IHOA 1RC1A 4PLPA 3DDHA 3DBRB 3LM8A 2RK4A 3HP7A 3SYMA 4D9KA 1CD5A 3NEAA 4TKVA 2MSCB 3PQCA 4GI7A 4E15A 5J40A 3WGGA 3TRHA 2WG2A 1ATZA 1QRUA 2ZFUA 1EFDN 1K98A 2OHXA 2Q2WA 3N74A 3PGXA 1BXGB 2YUIA 4V2IA 3T0FA 3UKJA 4HFNA 2KMLA 3UMVA 1FP7A 2YNMA 3RE1A 3GLGB 3G0DA 1Z38A 4M1YA 4MGHA 1VLLA 5B7PA 1BROA 2HCTA 3MW8A 3T8YA 3SQMA 3ZY6A 1QS0A 1D2GA 4NCHA 1QHYA 4QKQA 1XPOA 4PAWA 4HDMA 3UTCA 1QAOA 1VHLA 2ZWOA 3I8OA 3OOHA 3LGXA 3OF2A 4PEVA 4GDMA 4NEHB 3NTUA 4INJA 1AKNA 4JJFA 5IAAA 4WX2B 5F5NA 1B6RA 1UBTS 2KW5A 4KHPB 1ADGA 1M2JA 1XCOA 1DG9A 2PDAA 3F7NA 3DVRX 3L7MA 4BFYA 3SE7A 3TXXA 5J59A 3EMVA 1GUZA 4M9QA 3T4PA 1Z0UA 4OFWA 4BNHA 3HZOA 3OJFA 4IDAA 3CO0S 3UQYS 3FOFC 3D4IA 1SUFA 1JJAA 3O8BA 4J4HA 4PWZA 1RCUA 4GZ5A 1UC8A 3S27A 4YAIA 4ER5A 1XZGA 3QKWA 2WDPA 1ZPDA 4FDLA 3I2HA 1ECFA 4Y6QA 3RM3A 4RLQA 2ZB7A 4XJTA 4A03A 4L4RA 3RAFC 3O3NB 4G0ZA 1X1SA 3EVCA 2J6CA 3N6VA 4DR1B 3CM0A 1K27A 4O0MA 2VQ3A 2WJIA 5C35A 1QFZA 1GYQA 1Q6ZA 5LCXA 1OXSC 1S02A 4EKNB 1E2MA 2H92A 1I6WA 5KNBA 3G02A 2IELA 4MLDA 3SAJA 4NPCA 5CVCA 2A5GA 5EQTA 3U09A 2D62A 4B1FA 1HDZA 1C7IA 2AYYA 1URPA 2G77B 4KYTA 4RQTA 5CM2Z 2EKLA 4CMHA 1YFZA 1ZU4A 1OI2A 1OI4A 1U7HA 2O06A 4AVYA 2PGXA 3SC2B 4FT2A 3EC7A 1A4UA 3KQWA 3WC4A 4FYPA 4F4HA 2WA1A 3D31A 4MUJA 5TARA 3ZPXA 2Z3VA 2M32A 3GP3A 4NYIQ 2FPXA 3L6RA 4F9EA 1JXAA 1YIDA 2IEGA 2VPPA 3D4NA 3MIZA 5J58A 1RE0A 3X1ZA 2P62A 4IFIA 4H77A 1G0OA 4IRXA 3QLEA 3O95A 4G56A 1TM3E 2O3JA 3EIOA 3ADDA 3IHKA 3KPYA 3W7BA 4DEVA 5A5DA 4PO1A 2Y76A 3OEHD 2BMDA 5BMVB 2KLHA 4FB4A 1H6CA 5A4JA 5JI3E 3QYAA 1GTL1 1UJ4A 2V55B 3AEXA 3EZ7A 2IPAB 1RU3A 2HU7A 3BFXA 4C0XA 1UBCA 4E5NA 4OJNA 2BF4A 3DFZA 5SZKB 3RDPA 1F8XA 3AR5A 2RI1A 2ZTHA 4ZAGA 2AOTA 4CODB 4HQNA 4LPSA 4YJ3A 2LR0A 2JFFA 5CLJA 4A1FA 4ZTZB 4HPJB 4GM0A 5BRJA 3L7CA 2OO5C 4AQ7A 2QAGB 1YS4A 3EPLA 4YP5A 2AYXA 2C7RA 2CUZA 2Y68A 3C4JA 3GLQA 4DADA 3QRWA 1U8UA 1AK1A 3GNSA 5AVXA 1TE2A 3LPAA 4RA6A 3WLKX 3AX6A 3KFLA 1Z62A 1QZ3A 1X19A 2ZRMA 4RMGA 2J3KA 3GFTA 1XZKA 3AY3A 3EJWA 4H6PA 4PZ9A 2JRCA 4NENB 3QLUA 4BCDA 2VNIA 5JMTA 2QNBA 2VEOA 3V9PA 2G17A 4IHAA 4ZD6A 4MHSA 4S05A 3Q6IA 1J56A 2QJOA 1FJXA 2GVNA 2LCIA 3AETA 3EHDA 4A8JC 5JARA 1EFRA 5A7GA 3WAJA 1KQ3A 1UF9A 1G20A 5GGXA 1K7FB 2CB9A 2FFRA 2ODPA 3LQYA 4QXQA 3V80A 1ZCFA 2WKWA 5ENVA 1ORTA 1UWLA 3B3FA 3KZXA 4B4OA 3NAMA 5HQTA 1MJ5A 3G7SA 3PVCA 3QVMA 5CDFE 2KHZA 1DUSA 3NAGA 3NTXA 2XOKD 5JC1A 1QR6A 3E3LA 1TRKA 2E3JA 2H65A 3RYCA 2VHCA 3L79A 1I2DA 2YRFA 3ET4A 3AY7A 1Z0DA 3L7NA 4RQUA 4Y2TA 4YMGA 1DC7A 2XMSA 2VSQA 4I1IA 4MA0A 5CMLA 1DX9A 1KMMA 5EE3A 2V59A 3CRVA 3TX2A 2BKAA 4UULA 2VPWA 4I9UA 2BTOA 4ZYUA 4DPLA 4YRQA 1EDBA 2PBLA 2O2SA 1I01A 3A28A 3QXGA 4IFTA 4YAWA 1II0A 1JTVA 2BI7A 1X7YB 1EAMA 2E4WA 5A7HA 2G82A 1PL8A 4A10A 1AKRA 5KOIA 4PBTA 5MGBA 2J09A 3VU3A 1UOOA 1QJCA 1FIUA 2R1TB 2VNAA 2VHXA 3MMZA 4PONA 3E8MA 4R3WA 1JIJA 3HXLA 4FD3A 5BQ5A 5BY2A 3VPXA 1D8AA 3JX9A 3L1JA 1PE0A 1XRNA 2IGTA 2Z56A 4G8DA 1W5BA 5K8JB 3DAPA 3OU6A 1ZVJA 5JG7A 1WZ2A 1RI3A 3IIIA 1B0PA 3A31A 4L5BA 3HSKA 4CIYA 1RT9A 4MRSA 2IIVA 4CT4B 3NHAA 3ZXSA 2BBTA 4PIVA 1Z7EA 4KQMA 5K0FA 1N2CE 2Z2JA 4PAQA 2IHUA 4YLEA 4L16A 5HGXA 4DCMA 3W4KA 5DTMA 2Y1EA 2P69A 4RBNA 4ZEWA 1KF0A 4N5NA 3UCXA 3U3RA 3A9UA 3GPCA 4AROA 3L0YA 5EZSA 3WHIA 5HRCA 4ZOEA 4ZCIA 4XQCA 2WSSA 2ESRA 2I3BA 4F7WA 1RACA 1IZYA 4NG4A 3M1YA 2VFAA 2PQ2A 1FFWA 3PL5A 5D86A 4WBNB 4LEIA 4R01A 1R3UA 3QFFA 4XVCA 1NDUA 4FNOA 4OAOA 2F3PA 1AE1A 3HWWA 1KZHA 3QVUA 3S5JA 3KOXA 1YIAA 2A5LA 5DRTA 1VLQA 4XVRA 5HMLA 3D4LA 4NBTA 3V5NA 1XN4A 2GZDA 1R4NB 4PYNA 1H3EA 3LDHA 3MWDB 5DX1A 1CQIA 3IP7A 3OFSA 4C0BA 3GEMA 3THWB 1EHYA 4MWZA 4UTXA 3HRIA 2FW1A 1MX1A 1QDLB 3AEYA 3PUHA 1WABA 2AXEA 2C1XA 2H1VA 2XSZD 1G63A 2IP4A 1G38A 1R00A 5H68A 2MSKA 3Q8MA 1TQ6A 2ZRQA 2WZCA 2E4XA 1P7ZA 4PYIA 3C74A 2Q1SA 3IYLW 1GNVA 3SLKA 4CQJA 3HDGA 1ZITA 2IXBA 3KLOA 1TJ5A 1OU0A 2DEUA 1LI7A 3NHRA 4IEFB 2PT5A 1IPEA 2ZI5A 4MH0R 2JJ2A 4LC9A 4OIMA 4R54A 4OU4A 2WJ3A 4C7OB 4E2XA 3JQEA 4Q93A 4BO3A 4EMTA 1OJ7A 4Y2QA 4B83A 1K2VN 4I5FA 2NT4A 2G72A 1FBTA 2H31A 1SHTX 3RO7A 4EQ6A 4L95C 1HORA 4PZ0A 2O0JA 4WZBA 1QHFA 4E22A 2J41A 1U0TA 5K2OA 4MV3A 1QWOA 4J2OA 2OCPA 2C97A 1GGEA 3B1FA 1EG7A 3DAGA 3JY6A 1ZHHA 1EXNA 3O1IC 4ZCLA 3A3PA 7ADHA 5IDWA 2IOQA 3SVLA 1IONA 3NM5A 3Q0TA 4UCWA 4LNUA 3FCAA 5AUQA 3KJQA 5EQFA 3RG8A 3NGXA 4YAFA 1X15A 2F90A 2OFPA 1OBFO 1KZ4A 2NX2A 2FZ4A 4KN8A 5FTWA 5I9MA 3W2GA 4JFAA 3HN7A 4RE6A 5HXAA 5BW4A 1FJGB 2BTQA 3FFTA 2D3TA 4G4JA 4Y9SA 4WKPA 3TXYA 5LZ4A 4KV7A 2QNIA 4DLZA 5AD1A 3ZD6A 3KJHA 4HXYA 1U2GA 3I2IA 4MCJA 4JLBA 4XDZA 1Y81A 3ZJUA 5DIZA 3DSRA 4M87A 4RF3A 5DSXA 1YI1A 1MW8X 1RI1A 1QC5A 1I3OA 3UH0A 4ZYVA 2IDJA 2JFUA 5A1JA 2ERXA 4YAUA 1ZQ9A 5CHEA 4DRZA 1I7PA 1Z0JA 3HDQA 5DNYB 3CYFA 3PPIA 5LP6C 3OFVA 5EIXA 3KDPA 4H7JA 2PLWA 1NASA 2CDNA 3I5YA 3AF2A 1Z2PX 2XE7A 3NI2A 2PKCA 4DMKA 5DLYA 1VLMA 1WMEA 2K6GA 4BP9A 3PUYA 2DCUA 4OQNA 7ABPA 4GNRA 5DRYA 1P5HA 3ZWBA 5IULC 4Z4QA 2OCDA 1M2GA 3HJTA 3IB6A 5HJ2A 4LNAA 3WQHA 3TECE 4MVJM 6YASA 1P74A 4NPHA 3A58B 4DWVA 1ZGZA 2MMCA 3VJLA 2JGDA 3PYMA 1GEEA 5MFZA 1I3LA 1OV6A 2YV3A 3SDZA 3DAFA 3FRHA 3OICA 1EBBA 1F0NA 1GNPA 1E63A 1LS6A 1T3LA 3C8ZA 3RK0A 6REQA 2FLKA 5A62A 2VP5A 4BU0A 3VH3A 2GPWA 3RS4A 5A7FA 1YASA 3H18A 1F4PA 1U31A 2JLQA 3SQXA 4Q12A 4WLUA 1HFEL 4YMVA 1QHHA 1LSJA 1SOAA 3PHIA 4BB9A 3ILVA 4U8GA 4JQOA 3BE8A 1RYYA 2IZZA 3MTGA 3W9SA 4AJ4A 3LWNA 9LDTA 1G8KA 1HFWA 5TF4A 3ZGNA 4HDRB 2A67A 5K3AA 3V4ZA 1F06A 1PL6A 1XAHA 1JA0A 1DAOA 3UGQA 1QH0A 1R50A 1JV2B 2DHCA 1II8A 4DJJA 1XU9A 4N7RA 2NUAA 1W30A 3GB9A 1SKMA 4B7CA 4RFLA 3DBHB 3SLGA 2IYTA 4F86A 3VR3D 1C9MA 1KMNA 5J4VA 5ADHA 2P41A 3BFPA 4MEAA 4N39A 2WKSA 1A9PA 5TXGA 1UXIA 1UBGA 1PBTA 2W48A 3WLEA 4EVSA 1A2OA 1L6RA 2I1VB 4UEKA 4C5CA 1XMQB 4ZQEA 2CJFA 1T0IA 3RQSA 2YWDA 1OX5A 1YA8A 4JBNA 1Y89A 4UUMA 3MN1A 1N6OA 2VHWA 1OTXA 4ALMA 1L7MA 4FNMA 1Y7PA 4UAVA 2ZE8A 3GF4A 1A7UA 1JQKA 3BL6A 4JSYA 4QUAA 4U2EA 1Z6YA 1NSFA 4MYHA 5H02A 1E2QA 3HU3A 2HA7A 3T9DA 1G5HA 4ZT7A 4DM4A 3VR5H 1VE7A 3PFBA 5F2NA 5LMCA 3KJGA 5F7JA 5CNJA 2PKRA 1HBJA 3O4FA 4BE7B 2M2IA 2ONZA 4EZBA 1O6FA 3IKMB 2QRMA 4NFSA 3AKZA 1BGWA 1YFJA 4EEXA 4GXRA 4MR9B 5CLQA 2OYCA 1GPNA 3H5LA 1E7RA 1TK3A 3LX6A 4RD6A 4ZMRA 3BZBA 4NMMA 3TLAA 4CLDA 1R5BA 4RKFA 3QI7A 4TSKA 2VJPA 5FB3A 2VDWB 3D8HA 1GRRA 1LRLA 1LK7A 2PXCA 5LIRA 1XTSA 4LE1A 4YQZA 4YCMA 1VGVA 2ZB3A 3VJKA 5JW6A 2VRBA 1E94E 1V5GA 5E2IA 3QPVA 2QRPA 3LUFA 2EFJA 1NVMB 3AU9A 1JEAA 2P4EA 3H99A 4OP1A 3TBHA 3NHPA 5AHWA 3ROKA 3JYLA 2CFTA 3MOGA 1VMKA 3GN1A 5ER9A 1AQNA 4BNDB 2BGWA 1CS4C 4IF6A 5EZYA 5TRTA 5HKAA 1KR5A 5FPTA 4PLHA 5HIAA 3HYRA 3TJZA 3CB4A 3ZS8A 5CFPA 4P4UA 4B4UA 4B76A 1OXTA 1TZJA 1AKMA 4RANA 2HK8A 2IYFA 1KQNA 5C4GB 1IC6A 1QIFA 1R6UA 3P5SA 4RKYA 4JR1A 1GCAA 4Q7KA 2UXCB 3DZ8A 1VP3A 4OQQA 2C03A 3KPVA 5JD6A 3FOAA 4C0LA 5CDSA 3FNIA 2NUPA 3F8TA 3F1LA 1T6ZA 2WWIA 1U8YA 3KOYA 4J2TA 1Z8NA 1G21E 4DT1A 1USWA 5DM60 5D1NA 2QVYX 4EL5A 4ZIRA 3A8TA 4TYWA 1KJNA 4NBRA 4JYZA 2I55A 1D8TA 2QTHA 1O6GA 1Q0PA 1XTUA 3K0KA 3M49A 5LMUB 4Z1MA 2ZGVA 3B38A 4BLPA 3UT0A 1XC7A 2W98A 3UZUA 4JLNA 1DO8A 2Z9BA 1B8PA 4MVJA 4LC1A 3DCJA 4BO2A 4Y6GB 4BP1A 4BO5A 3LPNA 1OW3B 1CR2A 3AILA 1OFUX 1QKJA 3ANTA 3IHWA 3ND6A 1YA4A 3T7KA 3W78A 5BT8A 1P18A 3D2LA 5JUWA 2J0QA 5JZBA 1TK9A 4D9CA 4CEJB 1F0KA 3M6IA 4R1PA 4AG5A 1Z5UA 3LOQA 3O8CA 2C4NA 2VTKA 4JYPA 4LHSA 5CAEA 4TL8A 1Q7EA 5K5EA 1N6LA 4NBUA 1R9GA 4O2BB 2YY7A 4MRAA 3RRYA 1QLJA 5KNBD 1PR2A 3SJAA 2PVSA 3BJMA 3W2TA 2QSYA 5BUZA 4QZVA 3CPJB 3QMWA 5DCYA 1J7JA 3TVTA 5JH7A 1CUXA 4Z2AA 4KFRA 2YV2A 4Q47A 1CRPA 4AQDA 3SBOA 4HN4B 4OGGA 4EGAA 1JLLB 3E1SA 1VKNA 1WHTB 1LSSA 4CFYA 2HJHA 3LECA 1FRQA 4X6LA 3OFKA 5EE1A 1E5TA 1DTSA 1D5WA 3D64A 4HLDA 4RVCA 5G0WA 2IBTA 2DMRA 2VF7A 3N0WA 2J9FA 2AMFA 1YOVB 3EWIA 3TI9A 4AULA 1TI7A 3EY9A 2XCQA 4WNYA 2XMRA 3GU3A 4RM2A 5JOQA 3SSMA 2Z4RA 3OIDA 3T9FA 3AEUA 3O73A 4B2IA 5T7BA 1FSZA 3HWRA 3EGCA 4GQAA 2GFHA 4XA8A 2QI9C 2DUJA 4UEOA 1RJWA 4M6WB 1A88A 4NWIA 3WWCA 1DKUA 4DXDA 1UWCA 3FCYA 3HB7A 3KQYA 2TSYB 5ALSA 5FI5A 3WB2A 1KY5A 3DO5A 1P8JA 3L7IA 4M37A 4O4JF 4GWGA 2OO7A 5JAHA 3ESBA 3K8QA 1P2VA 3AP1A 1K06A 2WHXA 2WZBA 1Y6ZA 1YDGA 3IHTA 4UMFA 2C84A 5DK6A 4YRNA 5B12A 1Z73A 2XUDA 1GPAA 1VFPA 1FMFA 2H0RA 2VT6A 3DFIA 4H0FA 3OZTA 2O07A 4KI7A 2BSQA 1PZEA 4TWJA 4CDGA 1YCFA 1P2UA 3CEMA 4MROA 4QXPA 4K9KA 1KE2A 1DG1G 2G40A 4FLMA 3KELA 2A9QA 1FUEA 3FHJA 5FJIA 3WXBA 3DM5A 3GDGA 3HJUA 1G55A 5BSMA 1LCIA 5FULA 5T4EA 2C82A 4DEYA 4F04A 2FZEA 4O1IA 3CLKA 5AVSA 1QP0A 1SU6A 2BKEA 3JZAA 1U0NA 2QRVA 4RNDB 4EUFA 4M7OA 3T3GA 1P4SA 3V00A 5DLQC 4RMHA 3KKKA 4H1WA 4M53A 2F67A 2EF1A 3PEUA 5FPSA 2ASVA 2R6FA 3W3AA 1PBNA 1KJWA 4WNIA 1U5AA 4G0MA 5D3MB 4L75A 5FT9A 1EFRD 1IJKA 1W25A 3WMFA 4YUWA 2ZB2A 1GPJA 5EUMA 3TDKA 3QWBA 4IIXA 2WWFA 3D59A 1PZFA 4FBLA 4G07A 4MTLA 5U9CA 1HNXB 3WAGA 1QXSA 1F5NA 3QTLA 3ZHQA 1R7RA 1XTPA 2A5FA 2GVZC 3FH0A 3TLJA 1HE8B 4OUDB 4B4KA 4EKDA 2UYCA 3L1VA 2WMDA 5A5VA 2IRWA 1ISFA 2YFHA 4A8TA 1L7PA 4I7EA 5J3JA 3CRMA 1F2UA 2MCFA 1KYVA 8OHMA 4OGWA 1NXXA 3UF0A 3M2PA 3IR6A 1LXCA 1FVOA 4RETA 1COZA 1QYCA 2D2VA 2FW9A 5FO1A 4G0PA 3QUCA 3CH4B 4JAVC 4UATA 4BASA 4NE7A 4M83A 4C05A 4JI2B 3M1AA 4MGEA 2E89A 5IYZA 4AK9A 3ZEIA 4OI2A 1MORA 2P2DA 1Z5GA 1JHUA 1IU9A 2CMGA 3HKDA 4E32A 2GAOA 1T26A 3GGJA 3LPCA 1XVVA 4IMIB 4PHCA 5CX1A 5ICCA 4G65A 1KP9A 1CPYA 1DAKA 2FP3A 2Q21A 4B31A 3TKLA 1WKBA 1Y98A 2I6FA 2BR4A 1Y8ZA 1KE1A 4B3BA 1KFKB 4TRJA 3OP1A 5FBHA 1VJ0A 4JMPA 4U7FA 5C7YA 4PRKA 3ZTWA 4WBNF 4ZAXA 4XD7A 4K1XA 3RSFA 3U4QA 3FHLA 1J4AA 2WT8A 3SDSA 2PYIA 5A04A 2P67A 3IVGA 2GF9A 3DTNA 2PWBA 3N28A 5KTNA 1N5LA 3C41J 1E1MA 3QVGB 3AM4A 3KEQA 1J1IA 1ZH4A 2Q5JA 2RARA 1JLMA 4MVXA 4BO4A 1WPXA 1TKCA 2EL9A 4J7CA 2BJHA 1O54A 5EWMB 2BGGA 3C87A 2PHZA 2PUGA 4XR9A 3RG2A 2ACKA 2XNJA 1CQPA 1K5DA 3L46A 2AFIA 3PNMA 1T2DA 1TFUA 2WSSD 2BDTA 1KI3A 3BXFA 2AYZA 4QFBA 2JBAA 5AJUA 5KVVA 1PQ4A 3DOHA 4HYTA 1LRJA 1IEXA 2QUAA 3IVRA 4Q6WA 1JDUA 4RKQA 4FEEA 3TZLA 3WGTA 3WRXC 4GLBA 3HLTA 3U4HA 1O4VA 2CMKA 4HP8A 3U31A 2J3LA 1F48A 5KBYA 1VL0A 1ZN9A 4ZAZA 1M66A 1Y80A 4IOMA 5KJCA 1WSDA 4F4IA 1E6CA 3NIWA 2ZU0C 3WGUA 5JYBA 4R84A 3W04A 1QDEA 2SECE 1WIWA 3K73O 1W581 2G88A 3EXG1 1BN7A 1M10A 5EIFA 1PW7A 1TTQB 3QEOA 4E2ZA 1KH3A 3CLUD 4QTZA 1BGVA 1PYDA 4X65B 1XBTA 4Q24A 1KYQA 3P19A 1GNSA 4O6VA 5TMBA 1TCCA 3W6ZA 1P9NA 2CLEB 1TGYA 1Y7IA 3E9QA 5DCUA 3SBXA 3L07A 3GVXA 4FD2A 2IA5A 4HDSA 5F73A 3HTXA 2JJ2D 1T9GS 5AOCA 1RSZA 2Q6TA 2PKQP 1OBCA 3R1IA 1WW3A 3TLZA 5I7VA 3NDIA 1AMUA 2ODNA 1XPUA 1PP4A 3I5UA 3INRA 1TCAA 1XZEA 3BCUA 3IBTA 3EZLA 1L8XA 3D5EA 2PGNA 4AWXA 4PQRA 5BNFA 4FJ2A 3SQNA 1JAZA 4ZAVA 3C7DB 1WXGA 5AJYA 4IVQA 5IC6A 3WQRA 1S0UA 4QQNA 2ZTLA 2Q3EA 4QRHA 4PHFA 5EHIA 4QHTA 3N5KA 3VNSA 1IK6A 2RAFA 4WWHA 1I9CA 1IMOA 4N18A 4QDXA 2FQQA 4BFUA 4BV9A 1FFXA 2GBGA 2XODA 4X62B 4NFLA 1NXVA 1W4AA 4J0GA 3OPNA 3WWZA 3CEAA 2PL1A 2RKOA 3C8DA 4RY2A 5CNMA 1YR2A 4LQLA 4RQAA 9GPBA 3KXKA 1A7AA 4OLAA 3BCSA 3KR1A 4WZAE 2V3CC 2PUTA 2W4MA 3LDUA 3ZU4A 5KYTA 1RLMA 5LDGA 1ATIA 5NLLA 4F4CA 3TFOA 2J1LA 4F60A 1EJ6A 5CT6A 2VKTA 4MK4A 3I61A 2QT0A 3DOEA 4ZICA 3OJEA 1YR6A 1WXFA 2PQMA 4NU5A 4REOA 4X90A 1JEOA 5PNTA 3FCCA 1F8YA 1EPUA 4UBIA 5TS2A 1G3IA 1RRKA 4DQDA 2QPAA 3EUWA 4YV2A 3PNYA 3L6UA 3OZBA 4ZYYA 1G16A 1GU0A 1HOXA 3OU2A 1V95A 3WMRA 3SNHA 3DMFA 5B58C 4FOLA 1RABA 3P4YA 3TCXB 1Y4UA 2WD7A 4NRDA 4BNGA 4DAOA 3QKUA 4P2GA 4A4DA 3O1HB 1PO7A 1NXOA 1Q15A 2CVFA 4FGUA 1UBRS 2IP2A 5IKPA 1WLSA 1OPRA 4M1OA 4O29A 3GDWA 5FYQA 4BB6A 4IGIA 4BUCA 1DC6A 2OXIA 2VSOA 1JN0A 3CW2A 4DKJA 1HC7A 1T8SA 1J7KA 2OV4A 2B2NA 3GUYA 4G5QA 3ZIUA 2HWKA 4F6CA 5F98A 1Q7BA 2XTNA 2H1RA 5FO0A 3KYDB 4EJSC 1AKEA 1E4EB 2JARA 3KKPA 1HEUA 2JIDA 3FUXA 3O74A 3OJLA 3RQIA 2GZ3A 3D5QA 1NVTA 3OHPA 2CF6A 4IJVA 2J4CA 1TQDA 1AZSC 1OWPA 2WD9A 4QLAA 4DMHA 1E2GA 1JPJA 3OPMA 1EX6A 3CZMA 5BV8A 1G3MA 4PR3A 5KTOA 2C3UA 1NHGA 1EVZA 2P7HA 3H16A 3IV6A 1ZUNA 4MPJA 1XP8A 2B20A 4DLAA 4DY6A 1BRTA 3M1IA 5KKNB 2VTBB 1US8B 1MLDA 4D41A 1VZ3A 5B2FA 1Y5NA 3VO1A 1PNTA 4JC8A 4HNRA 4QYTA 5ICSA 2H07A 2NSHA 5L9AA 3GLGA 3HWSA 2AC7A 3VSAA 3WHKA 1N4DA 3VJRA 5F33A 3NMUF 3DWIA 2A9OA 1YB1A 2IDMA 5F4BA 3CX4A 3AZQA 3CLVA 3X1JA 4DR7B 3PITA 1RDFA 4MUYA 5BN4B 2R7AA 1I4DD 1R1DA 3FCXA 1QH1A 3JQGB 1HDXA 3D0OA 4BWFB 4CR6A 4D46A 4F2PA 5GTDA 5E8RA 2YJ4A 5CH8A 1P7VA 2BAGA 2RK3A 4UDXX 1ECPA 1J2EA 3JR7A 3WLIA 1P4GA 3TNFA 3O0DA 5JSYA 1YRAA 1T4MA 1YAJA 2HF7A 4IKOA 2JJ1A 4E5KA 2C95A 3LLMA 3HVHA 3KAKA 3AB8A 3B85A 3VYVA 5LQRA 1UM8A 2R62A 2CLFB 1Z26A 1NP3A 4B6JA 1HT0A 1OX6A 1M1YE 3TLXA 2GM4A 1F1JA 5LN1A 1JJIA 4DIOA 1R8YA 3BMCA 4CFZA 2XUZA 4DLLA 1XJ5A 2DGDA 1AMOA 3W05A 3RVJA 1KAOA 1TJNA 3IR5A 1YONA 1QZUA 1A5BB 3LIIA 1KNXA 1EUZA 2JGJA 1C3VA 3DAOA 3HLYA 1GKYA 2I4NA 2XMBA 3KR9A 4WMLA 3S8MA 1RC8A 1YKGA 3FB4A 3PA8A 4L76A 1EFPB 1KXJA 1NW6A 1G3RA 3F6SA 3OOJA 5BPFA 2IY8A 1ANKA 1FTYA 1PJQA 3GPDG 3KXLA 6LDHA 2GCEA 4Z6KA 1TGVA 5EKSA 4EY3A 2XKKA 3Q6NA 2NXCA 4KFCA 1RRMA 1Z45A 2HA4A 2JLRA 2ODBA 4KR3A 4EY8A 2FI1A 1EGHA 1KIMA 2WDZA 3QXXA 1FLAA 1QF7A 2IHZA 4TOIA 2JFPA 1GFIA 4F2HA 4L74A 1DPFA 4C3UA 1VCIA 1CEQA 1NN3A 2VHVA 4WA7A 2YHSA 3IALA 3PQ3A 4XJSA 1WBBA 1MN6A 4IWYA 5F77A 1YQWA 3CTMA 3TPZA 3MINB 1V11A 3NPAA 5EJ4A 1RMYA 1XQYA 5IUJC 1QOPB 4HFJA 4DMLA 1O57A 4KQ2A 1A9RA 1NNSA 4QTUB 4WY2A 2H1OA 2H7CA 2ABWA 3HYTA 2PE5A 3DC2A 4KPEC 2CBGA 3L1KA 5BMVA 4GIBA 3N2GB 2P79A 3IDFA 4B3RB 1QNLA 5IJXA 4JVOA 3P4UA 5K1ZA 2QLTA 1I33A 2YVAA 2IU0A 3AF3A 3P5BA 3IUEA 4ND3A 3U7QA 3HJBA 4CQLB 1G5TA 4W8GA 1SD5A 3X1WA 3GQBA 2MT9A 4F1KA 3JD4A 2RCNA 4O2BF 4IDCA 4MYDA 1OYWA 1XVLA 2B92A 2J7PA 1VJ1A 2NO6A 3F47A 3FYCA 4MXDA 4G85A 2OAQ1 3ZVRA 2PXXA 4Z1MD 5ILOA 2W2TA 2GAFA 2IYPA 4F06A 1D6JA 4MVJD 3FFXA 3TW0A 1A97A 1PNRA 1T8PA 1O5TA 3VQTA 1U63A 5DYNA 2D74A 1ZH8A 2OZPA 4YRMA 5DNVA 1K88A 2R3SA 3GQVA 3NBAA 4L0CA 4X00A 5IT5A 1VB5A 2PPLA 4UPEA 2Z83A 4RPCA 3X44A 3DYBA 4A23A 4C4OA 1OH5A 5JFTA 3KSRA 1QB8A 1T35A 2XD9A 4H3SA 5EWJA 2IHBA 4B5LA 5J9FA 4DZRA 5J47A 3ND7A 1Z0AA 1AY0A 2OORC 4LYFA 5M5BA 1P0FA 1FW8A 3T7AA 1JG6A 2H0QA 2YYAA 4HATA 1TEHA 1U2DA 2VUIB 2WAXA 4NENA 4C5BA 4ZI3A 1KJIA 1CEXA 4UNSA 2HQRA 1XLTC 1KDVA 4JODA 2LV8A 1O0BA 2C2OA 4XM1A 2HWUA 4CTMA 3QPUA 4XASA 4LWPA 1BDBA 5HE9A 1FFHA 5EJ9A 2FRDC 2AN3A 3A6ZA 3I9LA 5LA6F 3ZE6A 3AERB 4PE5B 1QV6A 3ASVA 4IDNA 1N4AA 3L2OB 2IOFK 3V55A 4EB0A 3K70D 2N47A 4UD2A 4HGQA 1PQYA 3HVKA 4G09A 4RYLA 5DASA 4ZVQA 4ZVPA 3R0XA 1SQFA 1P6UA 3GR6A 4FU0A 2EZ9A 1EVKA 3HUTA 2HLHA 2O52A 1PV4A 2ZS7A 1HWYA 4NESA 1YZGA 5MDHA 4QUKA 2TECE 1UPAA 2CXPA 2PYDA 1NNI1 2Y99A 2ZIXB 5C31A 4MCHA 4ZCMA 4D0GA 1U3TA 4C4AA 2ODWA 3CLTD 1OZHA 1WCYA 2AA3A 1O6ZA 1G8PA 5EKUA 2XMGA 5ES3A 3THXA 3CTPA 2WNHA 4OM8A 2IW1A 4FTWA 4B4WA 1PFQA 1ISJA 1YRBA 3NM4A 2JGNA 4J94A 3H9EO 4OREX 1GL9B 1O1YA 4Q9LA 3FWNA 3ROEA 5EHQA 1GRQA 5HIKA 4MINA 1EJ0A 2R1TA 4NECA 4N0DA 5KX5A 3WLSA 2CV2A 2X0JA 1PSZA 4QULA 2ZREA 3PZRA 2LDXA 3VPBA 1Q74A 2V8BA 2DC1A 4U7DA 1QV9A 3I76A 2VIIA 1GT6A 3NP7A 4JLSA 4HGPA 4HN9A 4Q4AA 4YRKA 2C4VA 4I50A 4RY0A 3L4BA 4QYMA 3V7UA 4CG2A 3FPAA 1W36B 5LPNA 4ZJPA 3IMGA 5DTEA 5TJHA 4Y6LA 1TZKA 2PWYA 5E6RB 3LL7A 1H8EA 4G1BA 3EVDA 4LHZA 5F21A 1OGYA 2ZBFA 3OJOA 1U9CA 2JC3A 3M4NA 5MN4A 5IZCA 4IXTA 2C29D 3K0FB 4PSAA 1Z2CA 3NUGA 2YHIB 1WY5A 2O6LA 3FGZA 4KN5A 4S1PA 4HZIA 1MNQA 2X0FA 3T3PB 3U17A 1GKIA 3A1FA 1XWIA 4PANA 3W3AD 4AN4A 4BQEA 4XIGS 2I8CA 1YRHA 2OECA 3OI7A 5CA1B 1L5HA 3RVRA 3EXIA 3RC2A 2XZOA 4MV9A 4LTMA 2WPNA 4D8VA 3ESDA 2Z2ZA 3N5CA 1FX1A 3OX3A 4TTJA 4X93A 3AT1A 4PQFA 1Z35A 4OHFA 1Z5NA 3AO0B 1O89A 2XMPA 2ZYDA 2CMDA 3E0XA 3NV7A 4PGAA 1C1XB 5FLEX 2UYQA 1JDBB 1PDVA 3OLQA 4R1MA 1JTFA 1L7BA 3CR7A 2XNCA 1KBOA 1YGPA 2B3TA 1EFVA 2J46A 4YAJA 2EHDA 3K16A 4PAGA 4YHBA 4CU2A 4ENTA 1ZYUA 4QSHA 5IP5A 4EY7A 1N6RA 1QOZA 1SCBA 1UIMA 2VAVA 3DGFC 4QBFA 4ZQBA 2PL3A 2QTAA 4U2KA 4IYJA 5HMMA 5AVWA 3L7KA 4OLHA 3OD5A 3WGKA 3WK6A 3WLAA 3JQAB 4ZCSA 2QGZA 4JOCA 3RRXA 3T5AA 3KJZA 4EEZA 3G2KA 4DA4A 1PJBA 5LZ7A 4AJEA 2GILA 1NRWA 2DECA 3EDOA 3R0JA 2R68A 3HCCA 3BD9A 2C4WA 1ZOPA 1VKOA 1ZMTA 1IY2A 2B6NA 2X77A 2O8BB 2CDRA 4DSAA 4TQ9A 3BK2A 3S29A 3L8HA 3RJ9A 1N2SA 1TM2A 1XRSB 2EQ5A 1J2JA 1NSTA 1PEKE 2P11A 3NXKA 4XCQA 1MA3A 4IV0A 5CD9A 1HNWB 2C2BA 4XD7D 5AKXA 2YFYA 5EMLA 2W0SA 3CNQS 3E3AA 4DFDA 2FTKE 2OMKA 3A9CA 7REQA 1SUDA 4XB6B 3EBLA 2WWWA 2XITA 4TKLA 2VDMB 2B8WA 2QQ0A 3ANYB 3KM0A 3W2IA 4HPXB 4F9GA 3M6VA 3UHFA 2VBFA 4HGOA 3BRQA 4ND8A 3K1TA 5LWHA 3E22A 5BN5A 4KE7A 2IF2A 4F38A 1Y8AA 2XVXA 3EARA 5DBGA 1T0PA 3LT2A 5ALQA 4HAWA 4F6RB 3KZNA 1MVNA 1Z18A 4EG5A 2BHRA 1G17A 1DTWA 3FVQA 1Q7GA 3NWEA 4F1WA 3CJRA 3QZUA 4RK6A 4WACA 4Q3BA 3JV7A 2V7XA 4ND7A 3PFNA 4YRJA 1B2LA 3IE0A 4G0VA 1T3SA 2A30A 3C7TA 4RFSB 5TQ0A 1GD1O 1L1QA 2J0UA 3A11A 3LP6A 4C1BA 1PFVA 3QP9A 4ZVKA 2D7DA 3BXHA 1NW5A 5F1PA 1WXWA 1CP2A 3IDOA 3OC6A 3Q3EA 1LFDB 4J4BA 1TXGA 1OAAA 2IYYA 3WRYA 5KTSA 4JB3A 2Z09A 1JKIA 5AKLA 1FUUA 1I6MA 1ONBA 2GBCA 3BSYA 1Y5LA 3NBZC 4W8HA 4Y2GA 2F1OA 3ZE8A 2CNNA 1H69A 1UJ5A 3PS9A 4JCCA 3ZE7A 3EA4A 3LFUA 1T91A 2AGVA 4U7PB 4JGBA 1Q0RA 4MB2A 4I2NA 1E4VA 8ATCA 2OCIA 1EX1A 1OWMA 2APJA 2QD5A 3PFHA 3ISJA 3N2IA 3IS3A 4KE9A 5CYOA 5HFNA 1KKUA 3R6GA 2C7VA 2PLAA 1V1RA 2CNKA 3DKPA 3LLSA 4HWKA 3UUWA 1ZJ5A 4K6MA 1XNHA 2P65A 5E9WA 4EECA 2JA1A 3B9PA 2CXOA 1FZTA 3ELWA 2QZSA 1XXHA 1ZWKA 1TA0A 2YIMA 4BBJA 2DR3A 4AYXA 4GOKA 2GM5A 3GH1A 2WVJA 1VOTA 1S8OA 2AR9A 3FIUA 3KYCB 1Z29A 2JKVA 3AZPA 2H4HA 2PX0A 1XU7A 4K9DA 3LXMA 4M98A 3DAYA 4X1IA 3VH4A 2NTNA 2FSUA 4G8CA 4JJAA 4X97A 1FFYA 2SBTA 1OIXA 2GA9A 2KS6A 2Y6UA 4AZ3B 1WSAA 1Z7BA 2BE7A 3MJFA 4FNAA 3WYEA 1HOTA 1XD2A 1I10A 2PUBA 2X1LA 3QLVC 7MDHA 3GT7A 5IBCA 1R5NA 1HYEA 2QTBA 1YZQA 2XQIA 2WG0A 3OCUA 3OZUA 2G1PA 1YK0A 2YZGA 4G01B 2FG7C 5B1HA 4P6VF 4UM9D 4YRBA 1UAYA 2O7NA 5JU6A 2JIBA 3H3FA 5FBQB 5AM0A 2A14A 2B1RA 2JHGA 1OPXA 2OFWA 1ORRA 1OVMA 1DMSA 1XVTA 3G49A 3M9WA 4OQMA 4ER3A 2R6JA 5L3SB 2QXUA 4M54A 5H9WA 2WHPB 4TL6A 1ESEA 1K68A 4IDDA 4I55B 3U9TA 3M9XA 5LUBA 4XX0A 3SI7A 3JZIA 5CEEA 4QM6A 4LJLA 3N6XA 1EEXB 1X3LA 1YOBA 3IJPA 3AVYA 4JH0A 3UT6A 1P0MA 5HZGA 1X1AA 1ZAKA 3PFGA 1H0SA 2W6QA 3RV3A 1SBHA 3KU1A 1GGJA 3W8EA 3L49A 3K1ZA 3TR5A 4F91B 4LF5B 3X0DA 2VWHA 4PTZA 5K0EA 1NUPA 4CMJA 1XVAA 1T6XA 5GZ1A 1TUGA 4QUJA 3DZFA 3RIMA 3UO8B 1GRCA 5FR2A 1HTWA 4DMCA 2MDTA 2PGOA 3S44A 3IVCA 5BNIA 4AXXA 1B0ZA 2ZI4A 4I5GA 4TS3A 3SZUA 1TO6A 3I39X 2WQ7A 1TL7C 5KHOC 1BDMA 1MT3A 1IBRA 3UGJA 1BA3A 1L5FA 2QUIA 1U6JA 2VA8A 4MUHA 4BVLA 3QEJA 3DR3A 2I4TA 3ODPA 3TNLA 5FTLA 1D2NA 3U39A 2I1WA 3EMDA 4Z7OB 4JITA 2ZOSA 1YR8A 3W5CA 1JQAA 5CH3A 1IN6A 5IW8A 3I34X 5TEWA 2VHZA 4IYRA 4QDZA 5BWMA 1RHRA 3S1SA 4QRDA 1Y6GA 5HQJA 1UFQA 4LXQA 4CI0B 5F9HA 1MH1A 2HHCA 2OM6A 3U81A 2GPSA 4TV9A 1GDHA 1B16A 1FUKA 2VJYA 5M04A 1Z8DA 4ND2A 3VTAA 1BXRA 3MSCA 2FFAA 3VVBA 5LSAA 4GBGA 1E60A 4A36A 1NF8A 2YXBA 5IASA 2YHBA 1E3WB 2HZ7A 1WETA 4GR9A 2KYRA 3FDZA 1IVYA 3HXPA 5D8DA 1VSVA 4GPIB 1J07A 1IEVA 3PWZA 4MP6A 1CJTC 2ECPA 2Z8XA 1T9CA 4JD5A 4RA9B 4IGKA 4L5CA 2FB9A 4O25A 2WM3A 1KQPA 2RHMA 2Q4DA 4MYTA 2X13A 1T4DA 1R27A 1MC4A 1PEDA 2WM9B 3UYLA 4B6EA 2QMHA 1N7IA 3QBJA 3WGQA 1Y4SA 1JR4A 4CKBB 2QN8A 2XXJA 1I36A 4LTNA 2WTXA 4QGGA 3W5DA 3FMVA 4L02A 1VKJA 1Z83A 2PMEA 1NC1A 3F2IA 3G0IA 3LAWA 3QBVA 3E58A 3ROFA 1Z4OA 4A82A 2YCBA 3M6LA 3FYUA 1FLNA 5CLHA 5JISA 1M7HA 1VJ5A 1JFLA 1R0WA 2Q9AA 3I37X 4L4SA 4CEHB 1C0PA 1YS6A 2UYOA 4MV6A 5BWLA 1JAXA 2CXUA 1UKBA 2N1MA 1NI3A 5A9SB 4MSUA 2V4ZA 5KKCA 1ZMOA 3MRXA 2IVFA 1JLSA 2QTLA 4FGJA 3WA6A 3VPDA 1FS4A 3X1KA 3GBPA 1ODCA 4HOYA 4O2AA 1SOWA 2QX8A 1W73A 4QT4A 1EIWA 2CE2X 3IA7A 4IIFA 5EPEA 4OEHA 4N1AA 4XDHA 3SMVA 3R24A 1R18A 4JGGA 4Y67A 3VHXA 3CJQA 3F5DA 3WS7A 5HP4A 3ACDA 4DGSA 2R8ZA 1WHTA 1GR0A 1V3UA 2O2CA 3GDFA 3O75A 2J7KA 4II2A 3EVEA 2X40A 3D8RA 3KSZO 3HXKA 1B8UA 1CV2A 3QBEA 3NDBB 3P9RA 3VSBA 1NDHA 4I4TA 2IYAA 1THGA 4R81A 3U0VA 1YOVA 3O0TA 5BQOA 3W5HA 3KHSA 3UBTA 1BE0A 3UYKA 3QG5A 3STHA 1F8GA 3CSSA 1BIFA 3FY4A 1XQ9A 1TM5E 1QTIA 1EG2A 2IPNA 5K0NA 3PFFA 4A15A 2IS6A 5EESA 4OHXA 1THTA 4X66B 1ZCZA 2GR9A 2OZLB 4TZKA 4PNZA 2V6FA 3AIMA 4M6WA 1EE1A 3T12A 3I2JA 4XQGA 4AKIA 3IUNA 3ZQKA 3JQ6A 1O96A 3CEHA 4N7BA 3AKYA 4RVNA 4C2TA 1EK2A 4I1OA 2J7PD 3QX9A 1N34B 2X19A 1L4LA 4AUEA 1ODIA 4H1VA 4BNXA 3UHAA 4XQ0A 1U4NA 4TZ0A 4PGMA 1NONA 1WXEA 4HNHA 5IJ0B 4ERNA 3WX0A 1OUMA 1XQVA 2FZKA 3OPYA 4S12A 3HA5A 4B3GA 1NRIA 4IIBA 2IS4A 4R9SA 1D5CA 3JVUA 1UZUA 1FP1D 1GADO 1H1TA 3SKYA 2N75A 3OQIB 3ZDQA 3T34A 3H5NA 4OB7A 2X9GA 3AZOA 3N59A 2BBWA 4NNJA 4DANA 4ZO9A 3SSNA 4M4SA 5EIWA 5BN1A 5IK2A 3ENNA 1GQRA 3LT0A 1DWPA 1T36B 3IQEA 5F9MA 2G08A 2C4UA 3D3EA 2ANCA 4O3FA 5C7IO 2Q3DA 3DUFA 2FWMX 1QTQA 2VHUA 5D3MA 2EFCB 3EWSA 1OXUA 3MYYA 5EMKA 5IHXA 2JFBA 4QDKA 1E1CB 1S3SA 3ZHCA 1SVKA 1LBEA 4EGFA 1U9YA 3DQQA 5KKAA 3FUVA 2O5CA 3H6KA 1C4OA 5I9BA 3KCQA 2J32A 1CR4A 3GUCA 2G4CA 4DVGA 3FNBA 4J7XA 5FADA 4HADA 1T1IA 5THKA 4KYVA 2QE7A 4OUDA 1WNFA 2ZJ2A 1CJMA 4HAZA 4ZVLA 3F90A 3AHCA 4PPYA 1V1MA 1QVRA 1WG8A 4WXEA 2XH8A 3AM5A 1WL8A 1R0KA 3NWJA 1J2TA 4X3OA 2FQ1A 1U4OA 3QEMA 2Z8YM 4Q15A 4R0MA 2I9KA 1Y0BA 1RJGA 4NG5A 4LDZA 4AJHA 3GGSA 1X7ZA 4ARVA 1IJFA 3MRVA 2W58A 1MOZA 3K1YA 4TLCA 4EZEA 3R20A 3BMQA 3R3SA 1V45E 1PJCA 5C1PA 2HADA 3KKMA 3GRUA 2GTPA 3PNSA 4YMWA 3WIVA 4NYMR 1REQB 2IGBA 4U2FA 4EG6A 3PNPA 2GJ4A 5EE9A 1LVHA 3OQMA 4YP7A 1UL1X 1RI4A 1C0LA 2C9MA 3JS5A 3PPWA 1TVCA 1HE5A 3ES9A 1N2CA 4P98A 5KYWB 2G8LA 1AZTA 4G5SA 2BLLA 3RRFA 3EG9B 1TAQA 3KSDO 2J6IA 1L5ZA 1NBHA 2BBSA 2O20A 2Q1UA 2ZJFA 3BB4A 3I1JA 3K3PA 4NHEA 4O63O 1KH1A 2GFIA 3HSSA 3AI2A 2O9JA 3K9WA 4LJ6A 3WGJA 3RHZA 1RWXA 2JF0A 5IVHA 3L4JA 1F9AA 1H8ED 4YT8A 2EF0A 3VC7A 2H7VA 4G9BA 4KWCA 4RW0A 5JS8A 4H4DA 4MUEA 1XKLA 1QV7A 3FPCA 1VGRA 5JJIA 1QBGA 3E9EA 3DXZA 4Q00A 1YB4A 4EKGA 2I7XA 2EQBA 2Q4RA 4TLBA 2B4KA 3KB6A 3VI4B 2AOXA 2QM0A 2PBRA 3DF7A 3OT4A 4N54A 4QNMA 4QJ3A 5A06A 4RTSA 1JRLA 4KN6A 1SXJC 3WHPA 1M34B 1G5QA 3AFMA 3LHFA 4Y30A 1VFNA 3AM3A 3B3QA 3RADC 2BF7A 2HSEA 2R00A 3C1OA 3L8CA 2ZT5A 1D7OA 4R1LA 3ZR4B 1YGYA 4AJLA 3CXRA 4QO8A 4LVUA 5JY6A 1IM2A 3AL3A 4EX7A 3PJDA 1USIA 4J16C 5K09A 1KIAA 1TCVA 2FX5A 2GI4A 2R7NA 3DEHA 2HK6A 4IMJB 4EELA 4ZFNA 2YVUA 4QUEA 4HEQA 2BFCB 1BDJA 3A4TA 4CDNA 3L05A 3ZHBA 2DYKA 4UCXA 4CM7A 4RTQA 4DB2A 3R7FA 1KPGA 4C78A 3EGXA 5CBKA 1I3NA 4GMDA 4NR0A 2IEZA 1UJ2A 3GHYA 4WVFA 1CVIA 4OIFA 5K0BA 4D3FA 2I2WA 4BGUA 1NX9A 1QMPA 1UDRA 3BMNB 1KP2A 1KSGA 1K8ZB 1W4RA 1XG5A 4WRRA 1QVZA 3BUSA 3HU1A 4M0DA 3VYTB 4F4FA 1S01A 1K7CA 5JQGA 5CCXA 1INLA 5K4HA 3B12A 1KO4A 4MVJP 2ZYTX 4D8UA 3VTKA 5IJAA 2WIDA 1Z0KA 5ALYA 1RAAA 2YDXA 1X7DA 3I6MA 2NADA 1NOIA 4GL4A 1GDDA 3IQWA 4NV0A 4AAYA 5BVHB 5F2OA 5IAKA 2PVPA 3HXMA 1XZCA 1BWSA 1PEYA 2P6RA 3AKDA 1I32A 4CLRB 1BYUA 2QS9A 1ODFA 3ANLA 4QU8A 3SF0A 2H3HA 2X58A 4JEMA 4ID9A 3ZHZA 4YRAA 4N76A 1EFHA 2JGRA 3VV3A 1QYWA 3JQPA 5JCXA 1LDGA 2NU7A 3BXEA 3D1LA 4G9GA 4TWZA 1RKUA 1YBAA 3SS7X 4BMYA 2Z2KA 1RD4A 4PV7A 3UB3A 1Y8CA 2J3JA 3NT4A 4XJVA 1LTHR 4OQZA 1QU2A 4HH1A 5B30A 3L6DA 1GV0A 1GFWA 2CEKA 2OHFA 2R48A 4CQMA 5ELMA 3CF4A 3BN3A 4AP9A 2FMUA 3LBAA 3MWEA 1T1JA 1UEXC 4UAGA 4ZOLF 3CA8A 1DI0A 3N39C 1RADA 1H8HA 1SG9A 2AFHB 2Z8YA 1SAYA 2XB9A 2Q2NA 3KT6A 4Q3EA 5F7OA 3DMTA 2H4FA 1E9RA 3GGDA 4V1CI 5KZMB 2QRLA 1EXMA 3RIYA 4R0NA 4D9HA 1KL7A 3AFHA 6Q21A 1VSTA 1H2YA 1NT4A 3BTVA 1FBNA 4EENA 3G5LA 4M38A 1FXUA 2HBZA 4JT2A 3O9ZA 5AVZA 1ONNA 1PLLA 2BEJA 3EXAA 3LUKA 4P82A 5EGSA 5GPBA 3W6PA 5I7OA 3Q7QA 2QW0X 4E30A 4BCBA 1RJFA 3CG0A 3FOWA 2OAEA 5IH3A 5B6PA 1LLCA 1H94A 1P81A 5CFRA 3D3WB 1WCIB 4M8IA 5DHQA 2O7RA 3WBJA 5TPZA 4FFSA 4LYEA 5EOVA 3ZDDA 2I67A 4OHCA 2A4KA 4YECA 1ZJWA 1QHXA 3SK0A 4OJQA 4IOLA 4NOJA 2QMEA 2IZ7A 1NBEA 2B5VA 3AUXA 4IQ4A 1QYXA 1EVLA 3B1VA 3Q9UA 4QVKA 1VM6A 1LKZA 5E8JA 4DDWA 2HEIA 4MKHA 2HI0A 5KDDA 3AWDA 4BMOB 10MHA 1QQBA 3ITDA 1PYOA 4C06A 4XGIA 1C3XA 3G7NA 4P7GA 2FZ5A 2E7ZA 4QICA 5A3SA 3EOZA 4N47A 2ZWIA 3LXRA 3D0QA 1U3FA 4I55F 1U5BA 4MA5A 1E9BA 3AUJB 3IVMA 4KWEA 1QVWA 3AF0A 2BP7A 3ESQA 1C5KA 5ALLA 3KQKA 4BVAA 3KE9A 3DB2A 1XA0A 2DFKB 3C43A 3EMBA 3OJXA 4HCJA 5ECGC 2BFFA 4GBED 2XYVA 5E9AA 1GG9A 1LQ2A 2VTBA 3NVKI 1VL6A 2WJJA 3I8SA 4URVR 4GP6A 3UMBA 3HBNA 5IABA 2IY9A 1EVEA 1QOQB 2GKOA 4RK1A 2ODAA 1GU1A 3GJSA 4NBVA 5TJ9A 1AHHA 1SC1A 1HQCA 1SQSA 1X2BA 1XN1A 2K7ZA 2WAMA 1ACMA 3H2BA 1JL3A 4JSRA 4RHFA 3RBAA 3S28A 1MU0A 1H3FA 1XEWX 2GK6A 2PMBA 1BU5A 2XCUA 3P97A 2B61A 4KPUA 3UXEA 1T29A 2P2GA 3PEFA 2WB2A 4GVPA 1WXHA 3LVRE 4LYHA 1E0DA 1FYXA 3RH0A 4ZZ1A 1SBNE 2NZWA 3AG5A 1SKYE 2HPHA 1ODKA 2QM7A 4DSTA 1L7EA 2OCXA 1XMVA 4I4NA 2DFTA 4PBSA 3CLRD 3PNVA 1HKUA 3LC0A 4Y6SA 4OI1A 1LLQA 2NXWA 5M2QA 1KZ6A 4BO9A 4ZTBA 3V46A 2I22A 4XVUA 2ZJ4A 1FL9A 2P0YA 3IXLA 3MGAA 4YR9A 5J2TA 2Q1TA 4LXUA 2BHNA 2XE8A 3NNNA 5CYPA 3RFCA 2JGIA 3J81A 2BMWA 2PVCA 1BFDA 3E23A 1YB5A 4C5AA 2N3ZA 5HS4A 4UJ5A 4K81B 2CXTA 4ZT3A 5FKJA 2D5IA 2ZUFA 3IIMA 1CNFA 1KI8A 1O8BA 3W8RA 1MQAA 2FJ0A 2RHRA 1ZY2A 2I2AA 4K05A 3LCMA 3FM9A 3RLIA 2ZSKA 1Z7WA 3DQPA 3G9QA 2V0CA 2QR3A 2YWFA 2O8DB 3GGGA 2OLEA 1FXWA 1S2LA 3QLTA 2RIRA 1D6NA 1MFZA 5AQ1A 4IVNA 3DXFA 2X3FA 4MKRA 5FORA 1ZJJA 1ST3A 3MINA 4B4DA 1Y6QA 3BTUA 4KIJA 4C1NA 5B37A 3WDMA 4FYIA 4JUFA 1G21A 1FS6A 2RGWA 2CSUA 4PW0A 4QT0A 5JXGA 4BLSA 3SBEA 1NPDA 1B3BA 1OAOA 1NQXA 3MWFA 4IIEA 4C7BA 3JQBC 2ZSBA 3E5MA 3OIUA 2NQTA 2O8EA 1V8OA 1J5PA 1EFTA 1BHSA 1E1QA 1Y8QB 2JHPA 3GJ6A 1T0JB 3B2NA 3Q3CA 5B1YA 3DDZX 4XGRA 4LOJA 3N2KA 4BNFA 4C14A 1GLVA 2Q5HA 3GCGA 4AU1A 1IEWA 4UUBA 4C6SA 3C3JA 5J1SB 4BVHA 4S3MA 3LD9A 2IH4A 2XVYA 4KH0A 3RKUA 1V35A 1GNQA 4Y2JA 3LHIA 2CFOA 4D98A 3MD9A 1K89A 1LB1B 4DWJA 1VRVA 1BMFA 3CB2A 4FHGA 2DH5A 1OH7A 3DFFA 2NV0A 1HRDA 3ETJA 2X6TA 4IIYA 1ZJ4A 4KGZA 4M9UA 1UXOA 5EJFA 4CF6A 2CHEA 4J3FA 5K0LA 1T25A 4C01A 4B9AA 5EL0A 1O95A 1XQWA 4S0ZA 4YPVA 2JHFA 4KDFA 2QAGC 2ZJ0A 1AZLA 3S2SA 4HVLA 3E2IA 2VYQA 4P5PA 5HOQA 3H9UA 2J3DA 4UCQA 3TCKA 4OPMA 1M0EA 4E7PA 3A4VA 1L5GB 5JD4A 3VNVA 4ISBA 2QUJA 5G02A 4PAOA 3O1LA 4URYR 1O9HA 1NI4B 2MYUA 4OQFA 4TVOA 5IM4F 2NYUA 4X61A 1GTSA 4AO6A 1OHHD 4KREA 2PMWB 3JYHA 3G5AA 1DCMA 2FWPA 4CMIA 3OTHA 3F78A 3QH4A 4RSGA 5E4YA 1Z4NA 2ZJ5A 4H27A 3IP3A 2PZ8A 3ZWCA 1HDYA 2IP1A 5AVUA 1SVWA 2H16A 5A4AA 2NU9A 3AERA 3M1LA 1UWVA 4H6WA 4WINA 1ZUIA 1DV1A 2NGRA 4ND5A 5D51S 4RHTA 3UANA 4TS1A 3QVTA 4MVYA 4N5IX 3EDQA 3BGDA 2NNWB 5ALRA 4D9IA 4FXOA 1X86B 6NULA 5EP3A 2ZJBA 1YDMA 4YCLA 1M6VA 2RBEA 4NJEB 2JJYA 4PLWA 4D9JA 4F6LA 2P6PA 1BKDR 1H2RS 3TLGB 3ELDA 5BORA 5ABPA 2O1XA 1Z4KA 2DJIA 3DD1A 2E5LB 1Z08A 5FOTA 4CMEA 4X6YA 3E9DA 4RQBA 1KYXA 5AVOA 4ZC1A 2BD0A 5JH7F 2C9OA 1G8HA 3LX8A 2TYSB 5CFLA 4Y2PA 2ZRLA 1U8TA 3D8BA 4C2BA 1PR0A 2OBMA 4O4HB 3A1VA 3T7JA 4N6OA 5E38A 1KJJA 2X8AA 3ZWOA 2G5PA 2V7PA 3AJAA 1K75A 1CJBA 2AEEA 1Z56C 2Y3IA 4IKEA 3WRWA 3TSAA 2FQXA 4M9ZA 3GT0A 5FFFA 4RPIA 3CVYA 3UJ8A 3WAKA 1ZD8A 1BXKA 5KEIA 1E1NA 1POXA 4N0QA 3LFHA 4AJNA 4F11A 2OHJA 2VLBA 3RS0A 2JLXA 3MUOA 2JCBA 4U02A 2W0MA 4Y0NA 1ZGJA 5T8KC 1ZHOA 1LRKA 4TQUS 5KDOA 1QIDA 4KR2A 2XIJA 4EMBA 2EDAA 3ANNA 1DKOA 1Z82A 1E2DA 2VF4X 2BCEA 1LGYA 1Y3BE 2J48A 4RMNA 3T1NA 3OO1A 1OZGA 4LI3X 2BUBA 2ZUSA 4TVKA 4QDOA 5I7WA 1ESCA 1N2HA 4RH3A 2QRGA 1H2FA 1RYHA 2H3EA 5E6RA 3T99A 4O3MA 2ZBEA 2X41A 5IK2D 4R68A 2W42A 4AMYA 4K0KB 2C96A 3IAHA 3W1EA