2V9ZA

Structure of the rhodococcus haloalkane dehalogenase mutant with enhanced enantioselectivity
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
b'EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
molecule tags Hydrolase
source organism Rhodococcus rhodochrous
publication title Rational Engineering of Rhodococcus Haloalkane Dehalogenase with Enhanced Enantioselectivity
rcsb
total genus 94
structure length 302
sequence length 302
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v9zA00
2CZQA 1TCAA 3F98A 5LZ2A 5C8VA 1QJ4A 3K6KA 4UHBA 3BDVA 3ICWA 1PV1A 4X6UA 1UKCA 1QGED 4AO6A 5EIEA 4B9AA 2QJRA 3K2IA 4BCBA 4XJVA 4OD0A 5FKJA 2YYSA 1FFBA 5AJHA 1XZIA 4HRXA 2WSLA 4TGLA 4DMKA 7YASA 2XQGA 4Y2QA 3WWDA 1G4HA 1XLVA 4DTCA 1XZCA 4PF1A 3O0DA 3WWOA 4OB6A 4IH1A 4QDUA 1JMYA 1ODTC 2WHQA 2QZPA 2QKYA 1CUXA 4BZZA 5KBYA 2VSQA 1IUNA 1R4ZA 2EDCA 2HA7A 2BGNA 4EZIA 3DLTA 3CCCA 3KOOA 1E5TA 1Q0RA 5JARA 1XQYA 1UWCA 3WKDA 4ITVA 4MYSA 4EY5A 3FVRA 3DEAA 1TCBA 5LZ5A 4Y2JA 5ALWA 5I7UA 5IH7A 4I3FA 4C88A 5ISMA 4K5QA 2J3QA 1W75A 4IHAA 2XUDA 1ZI6A 3QVMA 1YCDA 1JJIA 1SFRA 2XUAA 1X2EA 4NZZA 3AZPA 1WB5A 3HXKA 4JH0A 1ZGBA 5CT5A 2XUIA 4X85A 3JW8A 3D5EA 3B5EA 4UBNA 5AH0A 4AN0A 2OAGA 4H7EA 4Y2TA 2YXPX 2XUGA 5D3ZA 1IUOA 4TVKA 3DDUA 1WM1A 1ZD2P 4N8SA 5AI5A 3KWFA 5CURA 3V1NA 1VA5A 4GLBA 4G9GA 4FWBA 1QIJA 2PVSA 4Z49A 1YA4A 3I1IA 1XROA 4I4CA 5AO9A 1O6FA 4X91A 1GXSA 3FYUC 5DNUA 5AHXA 3DOIA 2HU7A 1LZKA 4JYPA 2AXEA 3G7NA 1VLQA 5A2GA 1Q0ZA 3U0VA 4FTWA 4QDTA 1W52X 3PFBA 4ZREA 3MGAA 5EHXA 1G42A 3TRDA 4C4YA 1HQDA 2X8BA 3L1IA 1XQVA 4KJXA 3NGMA 4UHFA 3BJRA 3ZPXA 1UOOA 1K5PA 3W9BA 3WIBA 1P0IA 5AK5A 4BVJA 5ALYA 4C6HA 4Y2SA 2HA3A 2JEZA 5K3DA 4E15A 3FLBA 4UFPA 4J03A 4QZVA 4UBJA 3RARA 5LKRA 5SYMA 3QYJA 1MO2A 4WJLA 4Y2XA 3WMRA 4LYDA 1PJAA 1DINA 2PUJA 5AK3A 3BDIA 1JU3A 4QEKA 5LLSA 2GYVA 4BDTA 1QTRA 5BOVA 1BCSA 1ZJ4A 4DNFA 3WZMA 4W1SA 1Q84A 4MWTA 2XQKA 3ANSA 2VT7A 3ILSA 5A6VA 4FKBA 2HRRA 4Q05A 5AM1A 1VA4A 5HF5A 2QR5A 1XFDA 5H3HA 3LS2A 1NU6A 1VOTA 2JF0A 2WFLA 3H2KA 2Z3WA 3ZLUA 5DYTA 3V48A 3WJ1A 2YH2A 2OLEA 1MX1A 1R50A 3V9AA 1F6WA 4AMYA 4K2AA 2EEPA 2UZ0A 3G0CA 1ZIXA 1UKAA 5AKGA 4MYDA 4MEAA 5SYNA 3I2HA 4CCWA 6YASA 2G5PA 5EHZA 4BVKA 5C8XA 1CR6A 2WFMA 4B7ZA 5AM5A 1A8UA 1SC9A 4M0MA 4V2IA 5AI8A 4QE3A 1UK7A 4ZI5A 3ESBA 1LNSA 3NUZA 1XRQA 3I28A 4GDMA 2Y6UA 4H18A 5CW2A 5ALQA 3STVA 2XLCA 1MX5A 1XZJA 2OQIA 1ZD5A 3IUJA 4P9NA 4Y2VA 1UK8A 1C7IA 5AKJA 2I3ZA 2C5FA 5K5EA 5ALSA 2QS9A 2WLSA 3CCBA 2BGRA 1QZ3A 5AICA 4BC0A 1T4MA 5C7YA 4KEAA 1J07A 1H2YA 3FWHA 4ETWA 4XVCA 1E66A 3P2MA 2V96A 4FDMA 4EUSA 5JANA 2G63A 2AJ8A 2Z5GA 3R41A 1LPAB 3QPCA 4X93A 2H1IA 5HFNA 3C6XA 5FLKA 1XRLA 4G8BA 4KR0A 2H7CA 2YASA 3D2CA 4UUQA 4OYYA 5HQ3B 1XZDA 4OCZA 3AIOA 2ZVDA 4M0EA 4UBLA 1QIGA 2G5TA 5HKAA 2BCEA 5EGNA 4YX9A 2XMDA 1CUUA 2QTBA 2OG1A 2ROQA 4H77A 1W1IA 2QM0A 1K8QA 3H0CA 3PUHA 5ALJA 2GBFA 3F97A 2D5LA 1HBJA 3VVLA 1CUCA 2ZJ7A 3IUQA 5AI0A 4H7IA 4BE4A 4H7FA 4KRXA 3C8HA 4BAGA 1IZ8A 1SOMA 2RAUA 3AUKA 2LIPA 5JD6A 5DTJA 1P0QA 3HC7A 3CN7A 4L72A 4DIUA 4GW3A 4QDOA 3LCRA 5ALPA 3KDAA 1GT6A 5LP1A 4U2EA 4W9RA 3DKKA 2RIPA 1J1IA 1WCYA 1UXOA 5ALEA 3JWEA 1BEEA 5BV7A 1FFCA 1LLFA 1VKHA 1H2ZA 4ZRDA 1DWPA 1L7QA 2DQZA 1P0MA 4QDXA 5FP0A 3ANTA 2W6CX 1O6GA 4MQMA 2C0QA 4N8DA 5IKXA 1Y7HA 5ALDA 3FCYA 3IULA 1R9MA 4DSAA 1R1DA 3WL8A 4BB0A 4C4ZA 1XQXA 3D59A 3WKCA 1CUGA 5HCUA 3DYVA 4NVRA 4D9JA 3RK4A 2PM8A 5JYCA 2CBGA 1RWQA 4RGYA 1S8OA 4L9AA 3WK7A 3UMJA 3EQ9A 1YASA 2WQZA 4G4GA 4G9EA 4KE6A 2DSNA 1HDEA 2XUQA 5DYYA 3WLAA 2HA5A 3STYA 3I2KA 1PFQA 4DNQA 1QFMA 1XLWA 3TGLA 1LPOA 5HZGA 1EINA 4GBGA 3AILA 5DTIA 2C7BA 4U2CA 4X00A 1BU8A 1USWA 3PFCA 2CB9A 1YB6A 3SX4A 3ZLTA 4J3JA 2K2QB 2GYUA 4ARAA 5ALTA 1X2BA 1KU0A 4K6GA 1AKNA 3CXUA 4K6HA 5CXUA 3HJUA 4RPCA 1ZGCA 4QLAA 4G1FA 4H7KA 5KWIA 2OGZA 1QO9A 5BWCA 3E0XA 1DT3A 3WWEA 3OM8A 1CUEA 3DL4A 4UHDA 1MN6A 3ZI7A 1DU4A 3VISA 4X6XA 3A70A 2VF2A 2XB6A 4N5IX 3FBWA 3FYUB 2OAEA 5BWBA 4NMWA 5HFAA 2JGFA 2Z8ZA 4EBBA 2QT9A 3DD5A 3I2JA 3IBTA 4Y2UA 2PBLA 2PU5A 3WK6A 1RP1A 5AI9A 2B61A 3R3ZA 5EHQA 3MUOA 4Q34A 4G4IA 1GQRA 1CEXA 2VJAA 4FLMA 4MXDA 1MAAA 5ALFA 1ZD3A 5JAUA 5K3AA 2PSDA 2Y1KA 1ZI9A 2W22A 2WG1A 5E4TA 3HYSA 5KWJA 2QMQA 3QMWA 2VAXA 5KREA 4B85A 3WYDA 3BXPA 4B80A 4WFJA 4F21A 1U4NA 2CJPA 1FFDA 4HVTA 3CN9A 1YAJA 4G8CA 5CH8A 1QE3A 4EY8A 4WY8A 3GA7A 1DWOA 1CPYA 3FYTA 5AKZA 3R3YA 3HACA 1UK9A 5JADA 1MPXA 5C8ZA 2HA2A 3G02A 1EB8A 1N5MA 5JAPA 3RM3A 5EI5A 4PSUA 3AINA 3KXPA 5JD5A 2FX5A 1ODCA 2QJWA 3HLKA 3BJMA 4JUIA 4UBIA 3WA6A 1F8UA 3HABA 4MEBA 3WK9A 2VTVA 2GZRA 4AQDA 1W4LA 1KEZA 3F96A 2VT6A 4Q3LA 2CUTA 5JAHA 2OPHA 3A2MA 3OURA 4E14A 1EDBA 2XI4A 4ZXFA 2WG2A 1XRRA 3OG9A 1DT5A 3C6ZA 4F60A 2HA4A 2XUKA 3W9UA 3QM1A 1THTA 1A7UA 3QZUA 3STTA 5HF9A 2WIGA 5E4YA 3S2ZA 3VXKA 2ZYHA 1IUPA 1UFOA 1W76A 3C43A 4CG2A 3FAKA 5E2IA 2XMCA 5ALKA 2V97A 4ZV7A 5JZBA 2HHAA 1CUFA 2C58A 3WK4A 2O7RA 2WU4A 2OXEA 4JEIA 2PX6A 3V1MA 5F4ZA 3N2ZB 2OCIA 2XUFA 4WCVA 4CCYA 1VXRA 3EQ8A 4G4JA 1DQZA 1XKTA 4FNMA 1TAHA 1F0NA 1E89A 1AC5A 3ESAA 4G5XA 4B9EA 4LKOA 5AKYA 1N1MA 3AZQA 1W6RA 1ACJA 3H1BA 4PSDA 5CT4A 5LZ8A 3VJLA 4KRYA 3G9TA 3PDCA 4I19A 2HU5A 4LXHA 4C4XA 1F0PA 1E8NA 4CIBA 4OPMA 2XQIA 3EBLA 2BUAA 2IITA 3D4LA 3FLEA 5DJ5A 3WZLA 3C5WP 5CH5A 2JBWA 3E4DA 4OUKX 3IDAA 3F9CA 2HM7A 2X76A 2QUBA 1C7JA 4UFOA 4X90A 1EK1A 2WJ4A 2XUOA 1JJFA 3WK5A 1TQHA 2ONCA 4LYEA 2DFPA 4X92A 4BE9A 5CT9A 2VJCA 2WFZA 3G9XA 5CBKA 1XRNA 1AZWA 4CFSA 1JJBA 1MNQA 4UBKA 5T4EA 1EI9A 2GYWA 5LZ4A 3OTQA 1WPRA 3Q0TA 2ACEA 1MT3A 3I2IA 4H7DA 2WUFA 2DR0A 3SWWA 1DWQA 1I6WA 3R3XA 4GXNA 2ZYIA 2JGKA 4BP9A 3BIWA 3C6YA 2ZYRA 2BFNA 4B83A 2PPLA 2C4HA 3WJ2A 4L3WA 2BUCA 5LYYA 3G9UA 3VJMA 1R3DA 3FLAA 5AK6A 3E3AA 5K3FA 1CUBA 1QTIA 1YB7A 3D0KA 3OOSA 4A5SA 3M82A 3TJMA 5ALRA 5J3JA 1K63A 3R40A 1H23A 3C8DA 3VJKA 1MX9A 1SCKA 1YS2X 3O95A 3DS8A 1XZLA 3B3QA 1XQWA 2WJ3A 4BCCA 3DOHA 4QA9A 5FDFA 3WQHA 4C87A 5AK4A 1UOQA 5AM0A 4EY4A 1OILA 3DNMA 3PE6A 1YS1X 4UBMA 3RLIA 2XMRA 5ESRA 1CIJA 4Y9SA 1CUJA 1D07A 3N0TA 2HA6A 4PO3X 5FUMA 1MU0A 1GPKA 2EDAA 2AJBA 4QWMA 4AB1A 3C6BA 1XZHA 5HK8A 3PI6A 4GHWA 1LBSA 4J0CA 2OQVA 4AXBA 4DGQA 2IX9A 1WB6A 3DQZA 1E8MA 3PICA 2J4CA 2RHTA 3R3WA 3O4GA 1AGYA 4EY7A 2PUHA 3C87A 5K3CA 3X3HA 4Y2YA 4KE9A 3C70A 3V1LA 3QMVA 2I03A 4BYMA 2O7VA 3O4JA 1JMKC 3LIPA 2OCKA 3BE8A 3BWXA 1UZAA 4WFIA 3H17A 2Y6VA 4B82A 1UKBA 3LIIA 5AM2A 1HLGA 1IZ7A 5K3EA 3FOBA 2WHRA 2B9VA 4GECA 1BEZA 4LHEA 3ZV7A 3STWA 4RE5A 2JGEA 4UFNA 5JIBA 4EB0A 1NU8A 4JYMA 4E11A 1VXOA 3AIKA 3QBJA 1A8QA 4B6GA 1OCEA 3GFFA 1WB4A 2JGIA 2BJHA 1QIHA 4BCDA 2D0DA 3A2NA 1A88A 5HK9A 1K6EA 3G0GA 4YASA 1X70A 4UBOA 5T4BA 2HFJA 1QO7A 5K3BA 4HXGA 2PKYX 2WIFA 5AI6A 4A23A 3H2HA 3KWJA 1GKKA 4B0PA 5ALXA 1LPSA 4J7AA 4AO8A 3T52A 3LLCA 2V98A 2Y2UA 1ORVA 1R88A 2O2IA 3L1JA 3V1KA 1A8SA 3L1HA 4EHBA 4U2BA 1XZFA 2DHEA 3RKSA 1EDDA 3BF8A 5CMLA 1J2EA 3M3DA 5AP9A 3IUNA 2WHPA 4Y2RA 4AZ3A 3OC0A 4FFWA 5AKXA 3IA2A 2ES4A 2DQYA 3ESCA 1UK6A 1CUWA 2JGJA 3DJYA 5JALA 4N8EA 1BROA 1LBTA 3A6ZA 1IVYA 4QDZA 1TIBA 2WTNA 4X71A 1L7RA 5DLPA 5DNWA 3H2JA 2RGUA 4B84A 2VJBA 2VA9A 1QOZA 5IVDA 4Y2PA 4DMFA 1XZKA 4X94A 1BRTA 4W1RA 1VZ2A 2ZJFA 3G0IA 1TRHA 4IH4A 4J0KA 3BIXA 4HXFB 2CEKA 4IH9A 4BAUA 3WA7A 2B20A 4AZ0A 5CT6A 4L0CA 1LPNA 4Q1VA 1XLUA 4NS4A 1JI3A 3MUNA 1QFSA 1DQYA 1EK2A 1ZICA 3R3VA 2PSEA 3HEAA 4DNOA 2JGLA 4CI9A 3WL5A 4H7HA 4WY5A 1CFJA 3D3NA 5AKKA 3C5VA 4M0FA 4B81A 5IVHA 1FSSA 5EHNA 1EHYA 3WL7A 1EVEA 1Q83A 4PQEA 1EA5A 3O9MA 4KE8A 2WJ6A 2B4KA 2DCMA 2H9YA 3D2BA 3WKEA 4W1PA 4KE7A 2VQ6A 3H04A 4XIIA 2ZSIA 3FYUA 4PW0A 5LIPA 2PSHA 5ALHA 1T2NA 4KYVA 1K4YA 1IMJA 4CCYB 4H0CA 3BF7A 3PUIA 1JKMA 1C4XA 1CUHA 1VE7A 4BDSA 1TCCA 2AJDA 1XZMA 4BRZA 1ZOIA 1P0PA 2OCGA 1JT2A 5ALIA 4QWWA 3WL6A 2JEYA 2GBIA 2HIHA 4HZGA 1ACLA 1EDEA 5YASA 3ED1A 3UUFA 4AO7A 2QXTA 2Z3ZA 2RHWA 4UHCA 5D3KA 3G0BA 4KAFA 1AMNA 1E3QA 5HKBA 1U8EA 1WHTA 2G4LA 3H2GA 2GZSA 1XZEA 4OU5A 5AOBA 4HRYA 3I2FA 2J4FA 1U2EA 4Q3OA 5AM3A 4U2GA 3WK8A 4H35A 3QITA 2C0PA 4J0DA 3U1TA 2E3JA 3GELA 5EFZA 3W2TA 4E46A 5LKAA 2WKWA 1XZAA 1GPNA 3G8YA 3M83A 3DKRA 3TEJA 3IVMA 3LP5A 5AKIA 3GUUA 5AKEA 5AOAA 4DM7A 1ZJ5A 2PSFA 3BL8A 1WOMA 2FJ0A 5AM4A 3ZLVA 3DYIA 1AQLA 1WPXA 3W05A 4HXEB 1CUAA 1YR2A 4QNNA 2HRQA 4RE6A 1YAHA 1THGA 3SC2A 3ESDA 4RNCA 4X7BA 5A7GA 1LGYA 5HF6A 2QVBA 5ALLA 4Y7DA 4ZGBA 3QPDA 1EXWA 1XZGA 2BAGA 5LZ9A 1GQSA 1BCRA 1NX9A 2GBGA 4AN1A 3AJAA 3IURA 3F67A 4O08A 3R0VA 4YPVA 2XLBA 2Q0XA 3WWPA 4J0GA 4UPDA 1BS9A 1QIMA 4BAZA 2JIDA 2ZJ6A 5IVIA 2WTMA 5EIAA 3FCXA 3QH4A 4J0JA 4C01A 4DNPA 4MQLA 3NOXA 1CUDA 1DTEA 1HKHA 1H2XA 4LXGA 2FJPA 4BTLA 1N8SA 1DX6A 4LXIA 4MJ3A 4S0XA 1ZIYA 3G0DA 4J0HA 4BVLA 1BN6A 1CQWA 1CUZA 3VVMA 5D6OA 2PSJA 3O4HA 4QLOA 5C81A 1J06A 2O2HA 3B12A 5A7FA 1QIEA 3IIIA 4ZWNA 3PF8A 4FHZA 5HQ3A 3K9BA 2CKMA 4FOLA 4BATA 4U2DA 5FXMA 3HRHA 2I3DA 5ALZA 1N5RA 2HADA 2XMQA 4G8DA 3NWOA 3HZOA 2QRUA 4P93A 1EH5A 2R8BA 4X6YA 4F5ZA 1G5FA 1CUSA 5ALGA 4A16A 5FV4A 1H2WA 5D7BA 1HL7A 4DSZA 4LIPD 2RONA 1VJ5A 4JNCA 1L7AA 4K6KA 4GI1A 1UOPA 2ZSHA 4CG3A 3AZOA 4WDRA 2HFKA 2ZYSA 4FLEA 2VJDA 5JZSA 2JGMA 1MNAA 5K3FB 3STXA 5IVKA 1EVQA 4HTAA 3VKFA 4INZA 5A71A 2HU8A 5LZ7A 3AFIA 2V9ZA 4FNGA 2X5XA 5AIBA 4ZV9A 5ALMA 1QLWA 1LPBB 2WUEA 4H7JA 3H1AA 4GWLA 3IUMA 1B41A 3HSSA 2QUAA 2BUBA 5ALOA 3QMMA 1MTZA 4IO0A 2NW6A 4X3CA 4J0IA 1EX9A 5FPPA 5DWDA 1YA8A 4X95A 1CQZA 1OXMA 2VAVA 4EA6A 4AX4A 3WIOA 3R3UA 1FFEA 3QPAA 1GKLA 1XRPA 4EY6A 1G66A 1VZ3A 3Q8WA 4U2FA 4CIAA 4PNZA 3W06A 5FRDA 1FFAA 3GZJA 3KD2A 3DCNA 2PL5A 4UHEA 3FSGD 2WUGA 4N5HX 4Q82A 1QIDA 2IIVA 4HS9A 2XMSA 2AJCA 2OCLA 5FOQA 3VDXA 2XMBA 1U65A 1QONA 3O9VA 1Z68A 1LZLA 4YK7A 5JATA 1R9NA 4DMHA 2VATA 4AMZA 2WUDA 4OB8A 1CUVA 3EQ7A 4IQ4A 3STUA 5I9IA 2XMZA 1H22A 1SCIA 4HAIA 3EF3A 4Q3KA 5DYWA 4KAAA 4BP8A 3M81A 1AURA 4FBLA 3H19A 3FNBA 5A7HA 1UT6A 5I8PA 4BRSA 4WDQA 3JYHA 3D2AA 5CH3A 1TKRA 2CMFA 2OGTA 5EIHA 2DHDA 2XDWA 3UUEA 3ZWQA 2RI6A 2XMGA 3DL7A 1QIKA 4KAJA 1MAHA 2AJLI 1FJ2A 4FMPA 5CTAA 5T4HA 1JU4A 3I6ZA 3W04A 2ACKA 4OU4A 2R11A 1ODSA 2WHPB 3FSGA 2QXUA 5JAOA 4X97A 2XT0A 3I6MA 1B6GA 2I78A 2OGSA 4W1QA 3HI4A 1Y7IA 4PSCA 3EIOA 5DNVA 2C5GA 5JASA 5ALVA 1GZ7A 4P92A 2WFLB 3O4IA 2BKLA 4FLFA 2DHCA 2Y2VA 2WIJA 3G9ZA 2O2GA 3WYNA 2ORYA 4CG1A 4DLNA 3C45A 3I2GA 2HDWA 3D7RA 4ROTA 1CRLA 4C89A 4BZWA 5JD4A 3S8YA 4BBZA 3KSRA 5HF8A 1QIFA 1LPPA 2HL6A 3H18A 4BC1A 2FUKA 2WIKA 1BE0A 4BTVA 2XUJA 4XWGA 1ORWA 5CRIA 1CUIA 3OPMA 1VE6A 1AUOA 2QOEA 2VEOA 2XUPA 4TPKA 5CT8A 2WG0A 4OYLA 5CXXA 1XKLA 4KACA 3AIMA 4XX1A 3IB3A 4WFKA 5T4FA 1ZI8A 1TK3A 5AOCA 2Z8XA 4FBMA 3WKAA 1GGVA 3I6YA 4B0OA 1XRMA 3YASA 3F8SA 3T4UA 1ETHA 1E8DA 1AX9A 4UHHA 1KU6A 2H7YA 1CVLA 3MVEA 1WHSA 3GBSA 1ISPA 1GPLA 5AI4A 1ZD4A 2P8SA 1JFRA 2WM2A 2XE4A 4FFVA 2J3DA 1YSCA 5ALNA 1MJ5A 2GBCA 4OSEA 1RYYA 1LPMA 1QIIA 4P08A 1CV2A 5ALUA 1BN7A 1CUYA 3WWCA 1EB9A 1DX4A 5E4JA 3FVTA 3WI7A 4DYHA 3PF9A 4GEGA 1HPLA 2H7XA 2WU3A 3I1YA 1CLEA 4ARBA 2XUHA 5AIAA 1XZBA 2WIDA 3GROA 3A2LA 5AKLA 5JZ9A 1SCQA 5A62A 4PV7A 3WKBA 4F0JA 2WILA 2PU7A 4W63A 2HA0A 1M33A 2XQFA 5FPQA 3ICVA 1Y37A 2XQJA 4DMCA 5AKHA 4MWSA 3E1GA 2ECFA 4OB7A 3SK0A 3H2IA
chains in the Genus database with same CATH superfamily
3KAKA 3VTFA 1X8XA 4HYQA 3KXDA 3UPDA 2BVNA 3M2PA 3HO1A 1N0WA 2PZKA 5CEEA 2XBUA 2GFHA 1AO3A 2W2LD 2WHYA 4JLPA 2TMDA 4D9KA 3EUAA 2ZB3A 4PHTA 4BMVA 4CLOB 1YVPA 4M1MA 4Q00A 4U8HA 3UAWA 5C8VA 4NENA 5I5EA 3CUYA 1JR3E 3K6KA 4JL6A 1GHTA 1PJLA 1UXKA 2N9UA 4OOFA 2B2NA 3BDVA 3ICWA 4QASA 1EX7A 3CB2A 4IZIA 4ESVA 3FUTA 5EP1A 1OTHA 5ESWA 3OE1A 3EVBA 3SP1A 4H59A 3EZFA 3COVA 3L49A 3UTCA 2C97A 3FZEA 4IXMA 4QBGB 3A4TA 3FOFC 2LKDA 4DLVA 2HCRA 9LDTA 1ULHA 1E1DA 3FLMA 1G8PA 5A0TA 3FZNA 4ZMBA 3GLSA 1JDBB 2BM9A 5KHOC 2X0JA 2P6MA 2XYVA 3UYLA 3D3JA 2ZRNA 5AJHA 4RMJA 4TQAA 1HA3A 1T9BA 3UGTA 1UFQA 4NC9A 5CB4F 1FE8A 5BN3A 3EPKA 2Z98A 2QRJA 2YVAA 3ISJA 2IW1A 5DHAA 3V7NA 1I4OA 1WNFA 3LCVB 1DAOA 2BIFA 3ML1A 4AZWA 3WWDA 4WGGA 2EGGA 5JZMA 1RFLA 2HJSA 1O9HA 4HEQA 5ADVA 4DTCA 1OYWA 1XZCA 2YIJA 1AY0A 1HT1E 3HP4A 6LDHA 3CUUA 3WWOA 3TO5A 4ND8A 3QLVC 4EKGA 2PWBA 4ZHQA 5FBKA 4C7JA 2D13A 4M1KA 4DAEA 4ZTZB 3A3PA 2JFVA 3NHFA 3FR7A 4GMHA 3QNUA 4IH1A 3VC7A 3W79A 4J7UA 3BXHA 2Y99A 3DEFA 4PX2A 1ODTC 4YV2A 1QYVA 2WHQA 4JEUA 1PTKA 3KQYA 4BNDB 3FF1A 2WWVD 3AB7A 5BW4A 3DV0A 5C4MA 2QZPA 3KIPA 2WINI 7GPBA 3B2QA 4GMGA 1CUXA 3DEYX 2GZMA 3EH2A 1KI6B 5DMXA 1TAQA 5DCLA 4E2ZA 2ZJYA 1CB7A 3PC2A 1B74A 4FEYA 4H4EA 3FHCB 2G4VA 4WACA 2QM8A 2F8MA 2OD7A 2WB4A 1I51A 5JS1A 1R4ZA 1H1LB 2ORED 4MI3A 3CSSA 4MP8A 4F9TA 3FTPA 3PWSA 1Q11A 3K1AB 2ID7A 4C4RA 4EFNA 1N33B 2FWJA 3B3GA 1JXAA 3CCCA 3FFTA 1GSAA 4Q3DA 4ZDIA 1QRRA 2OHHA 5BWMA 3Q0EA 3TF5A 1H5QA 1VKOA 1G8GA 1UKVY 1HFWA 3PPWA 4ER5A 4TROA 3SQMA 3L7LA 2B94A 1V1JA 3ZU5A 2RFLA 1TU4A 2GXUA 3AKCA 1B8PA 3PGKA 2RGNC 3G5TA 5E7JA 4J1NA 2NXJA 2XCTB 4RV9A 3FVRA 4I4LA 1LNZA 3DEAA 1M34B 5EP4A 2J31A 4ZA2A 4O4LB 1QDEA 4ENQA 1PNTA 3OZFA 4IYRA 3RVNA 2YN0A 3E82A 4DLKA 1G9XA 2R68A 3GRAA 3INTA 3KEOA 4BPBA 1MH1A 3P26A 4DLZA 2AZMA 3I4LA 3RF6A 5ANRB 4NOJA 2JJQA 2VSFA 3ZDYB 5LMUB 2H1SA 3PE4A 3QVMA 2OD9A 1V7ZA 1WBBA 1B3RA 1W30A 3AVUA 3RVMA 3AV3A 1C7QA 1GEEA 2NZVG 3SNHA 1DTWA 4M6WB 5FOWA 3GF4A 4BWGA 1E3DA 3OQHA 4P4NA 1KDRA 1KEVA 1I0IA 1PZMA 2C4TA 2EVWX 3EF1A 3EGDA 3SBEA 4ZKDA 2HQSA 4GP6A 3EZ2A 5B6IA 5IRCD 4XQ0A 5EL0A 2RGWA 2XUIA 4QOEA 3CLTC 5IYZF 1TK9A 1NSYA 4X85A 3NBAA 4TYYA 1XEFA 1V16B 5DRYA 1TM4E 1JFFA 5AH0A 4AN0A 3IR6A 4IXWA 1EVKA 1VCHA 1CE8A 3OWOA 4ARCA 2YXPX 3NM4A 4BEBA 4JQYA 2XUGA 2W90A 4JGGA 4UU1A 2TS1A 1E3TA 3EK2A 3PEFA 2G0TA 3KL2A 4JQZA 4N8SA 3ZQUA 2DUUA 3ZJ4A 1LSUA 2FUCA 4YUZA 1QF7A 3HDVA 4ZGGA 5AI5A 1JHUA 3GNTA 1L5MA 1P45A 4JVNA 3RE1A 3RIMA 4C2AA 5CURA 3U4IA 2X0RA 1L5YA 3ZJYA 2XWQA 3RAPR 1Y42X 4H3HB 1X7WA 2NVUB 1D2CA 1UH5A 1GRQA 2GEDA 2G9VA 1T36B 3D3WB 5TQVA 2YDYA 3JZDA 4RJTA 4IDHA 2QQFA 3N5KA 3UKJA 1WNTA 2UUOA 3VSBA 4B73A 1XROA 4CLEA 3CRNA 1G4UR 4KPUA 5JI3E 3BRWD 2Q9BA 4PLHA 1SXGA 3TECE 3HYRA 5AO9A 1OXXK 3MAJA 3KEQA 4KPUB 4Q9NA 1J8FA 5GADl 2IEDA 4KO4S 4YIHA 1RWMA 4X91A 2QBYB 4LF8B 3FYUC 1OZFA 4N7BA 2R87A 3TVTA 1E2IA 1W4CA 1XU7A 3PXBA 4MQUA 4RSMA 5BR1A 5LQJA 3DOIA 2AK2A 4D82A 1ID8A 1CY0A 1KI8A 1LZKA 3G7NA 1E9DA 4G8JA 1VLQA 2GM3A 4DOMA 4MMYB 3IVGA 3W3ZB 2B8EA 3SKVA 4NYMR 3A27A 2BFMA 3NT5A 3WJ7A 4C0WA 3U0VA 3ZGOA 1GU0A 1M76A 1TZCA 2ARKA 2L0XA 1E1CA 3GRRA 3ORHA 2E85A 4WXHA 2F1RA 3F2VA 5I9LA 3WNQA 1T1JA 2QEQA 4L8WB 2X8BA 3TLJA 3D6HA 4YQZA 1Z75A 2A5YB 4G2NA 3SG0A 2UUCB 3LHDA 4CV1A 1CZUA 4GH5A 1PEYA 1C8KA 1RYDA 3NGMA 4FNOA 2XT9A 1W36B 1P1JA 3K2BA 2Q8PA 4HH4A 3UMYA 3VBCA 2CLMB 1K5PA 1KARA 1NLFA 5J9FA 3CUVA 2V45A 3V3TA 1T2AA 3ZQKA 4B4KA 4C6HA 3FSRA 4NZ9A 5TQ2B 1M6EX 4QUGA 3DKIA 4WNAB 3WFZA 4EMTA 1CRQA 2C5LA 1IYZA 2OHGA 2QGFA 3NCTA 3EW7A 1OYYA 1ILEA 2HA3A 2EWVA 2WDZA 1KF0A 3DHWC 2X42A 4JFAA 3PIRA 2H07A 1PTJC 3FLBA 2OECA 3L0CA 2POQX 5JH7B 3EFBA 1R8XA 1LLCA 4J03A 4MZDA 1G8YA 1PWHA 3ROKA 4DCJA 3P9KA 1NL3A 5I6DA 2O2CA 3ELBA 4Y2XA 1MIHA 1JKJB 4OXKA 2Y1WA 1N7HA 3KQVA 3UV7A 4MUKA 4YRKA 5L7WA 4B3RB 5BXYA 1FRZA 2DULA 2VPXA 3WDMA 2PUJA 3PDWA 4C20A 2SKCA 4P4UA 4EVQA 4F2HA 4ARIA 1KC3A 4ZU6X 2PMBA 2R4QA 3PT9A 4QBTA 1AMOA 5CM2Z 2OBNA 3DLPX 3BDIA 5AK3A 1G7RA 1SIOA 1V5WA 2ODBA 2P4QA 3DA8A 5EKSA 5LQCA 2JA1A 3ZY5A 2R1VA 4FEAA 4BMOB 5BOVA 1BCSA 3UTDA 1BQ4A 3T7CA 5CB4A 2HSGA 3RGWS 1ZJ4A 2YWFA 5J1TB 3SYKA 4YUVA 2XKBA 2IHJA 3DFUA 5DXFA 1HDYA 2Z8YM 3LGXA 4R0MA 4LRTB 2ODQA 5DWQA 1RCFA 2XQKA 3ANSA 3UV3A 3UV6A 4E7OA 1FRQA 1J9ZA 1O0SA 3N2KB 4M7PA 4P3NA 4CL8A 4TLBA 4FKBA 1TUGA 3K5IA 1TKCA 2HLPA 1RHMA 4NIMA 1U1DA 4HATA 4V0MA 1VKNA 1N4AA 1D03A 1ABFA 1XFDA 2W2KB 3PA8A 1LDNA 2FLWA 4F85A 3IERA 3VPHA 3VZSA 3DMRA 1Z83A 4CL0A 5JFGA 3KQWA 3ENWA 2HHHB 2WFLA 2P9JA 3B2EA 4OHWA 3V48A 4P4SB 4CEHA 1VDMA 5M2QA 1R50A 2ZZMA 2X22A 3OF5A 3IC5A 3E9NA 1W2HA 4QYWA 4LYAA 4TT8A 5AUOB 3PWKA 2PYZA 2F3RA 3F5FA 2IUUA 4JU8A 1UKAA 2EYQA 3ZUGA 1NC3A 1GUDA 1Q7TA 4YPOA 1LD3A 2ZYUX 3LKDA 1O6ZA 2QL7A 3KWLA 5K8IA 4E3WA 1KEEA 3FGPA 3TZ6A 1RT9A 1JLLA 1RYZA 3PVSA 4QQRA 1T2CA 4OGLA 5IEBA 4DUPA 2PR7A 4J9VA 1X8LA 1YOVA 1CR6A 2WFMA 3KZMA 4B7ZA 3LLSA 3PNMA 1OKKD 2IF0A 1C0KA 4WLNA 1MJGA 1XMJA 2JFUA 2QN1A 4M9SA 3PCRB 1TZ2A 3JALB 3DBIA 5K0SA 5HIIA 1NBIA 4HD8A 4PG6A 4NBTA 4J90A 1LLUA 1IIRA 2CK3D 2PL1A 2YXEA 4BFSA 5I7VA 1LNSA 1JEDA 3AH8A 1QGUA 3R5TA 4UM9B 3NUZA 4G6ZA 1KQGA 4UDNA 1ICIA 1OGIA 4KYUA 2Y6UA 1M2KA 3P9YA 1JHZA 3KCQA 4KOAA 3ZWAA 1NVEA 4DRXB 1KFEB 4WNIA 2NTJA 2W4MA 1CEEA 2RB5A 2QN2A 4NWIA 2FI1A 2YOHA 3HKBB 4A5OA 3UJPA 4CLOA 3J81k 4D3YA 4OV6B 1FSFA 4DM3A 2DPHA 2DVMA 3AKDA 5HE9A 1KDYA 2A9PA 4UQLA 1HNNA 1O8BA 3HWRA 5IHPA 2K5UA 3C6QA 3U4AA 2C5FA 1UBUS 2OR3A 5B3AA 5LBUA 5ALSA 5CFRA 5CEFA 5K5EA 4M8SA 4PPFA 3RHSA 3LVQE 3I0NA 1E6EA 3LXXA 3U2QA 4FM9A 3A1WA 4J1QA 1JSZA 1PDWA 1VI5A 1WAMA 2HW8A 4POAA 3I62A 4ZZ0A 1QZ3A 2HCJB 4GPD1 4UNPA 1T4MA 1T9AA 3O75A 5EP2A 5C7YA 1Y6JA 3FZYA 5IASA 1KHHA 1KEUA 1E58A 5DH9A 7MDHA 3ZCTA 5HS6A 3B3JA 1V3TA 2OC4A 2OORC 2PJUA 2OQ2A 3FWHA 4F84A 2AZDA 1INLA 1UFKA 1XDWA 5HRUA 2P5YA 3GN1A 1EE9A 1U7PA 1ORDA 3P2MA 4JP3A 3SFVA 1IVSA 5FR1A 1G9TA 1N8TA 4FDMA 5LB2A 2JJ1D 1P7WA 1Q17A 3BTUA 3IILA 5K3BA 3T35A 5E1MA 5BWNA 4DV4B 1A97A 3ZVNA 4OGWA 5FUYA 1KY3A 5D51S 1UJNA 3JQ7B 3SVLA 4RY8A 3JVDA 4AJHA 5JPCA 1RPTA 3B36A 3L79A 1EFLA 3R41A 4HZUB 5CHEA 4OA8A 4A4DA 3ND5A 3ESRA 4LXTA 4GBED 3QPCA 2H1IA 3DLCA 3C6XA 4WKPA 2ZIXB 5TNXA 3ROEA 5KTYA 1CZHA 3NRCA 1PL7A 4LFCB 1RXYA 2W6OA 1NRIA 4KR0A 2H7CA 4GRDA 3RIHA 2WV7A 3C3YA 3IOEA 1D2AA 3BTSA 3CWCA 3EG5A 3B52X 3UFBA 2CSUA 1YJXA 2KPOA 2JLVA 1QH8A 2BEWB 3KXLA 4QPCA 5I7RA 4MCIA 3M49A 4DILA 4CPDA 4K6OA 4WT7A 2XMDA 1CUUA 2X8WA 1P31A 4DMRA 4YX9A 4Z54A 4QPPA 3CPEA 4H77A 3CISA 4XH9B 4CLDA 2FAXA 4KBYA 4ND5A 3ZKAA 4I4TB 1K8QA 3RC7A 2EJVA 1T1EA 4LVUA 3RG2A 5BMVF 4C7BA 3L4EA 1KXZA 4N9QA 4KUGA 5ALJA 2O8FB 2XYGA 1FYEA 2Y1CA 3C48A 3L0IB 4F9FA 5JDIA 3ZW8A 3ZY4A 1ELOA 4HDQB 5FEMA 3ICPA 2VPYA 3LX5A 1GTMA 4QU0A 3HL0A 4K8RB 1CUCA 1T0UA 1Y8QA 2QAGA 2I2CA 1YZQA 2ZJ7A 4GEKA 2IIPA 3P20A 4MOWA 4YHBA 1SXIA 1Z0DA 4O1HA 5AI0A 4EPVA 2Q41A 4IHJB 3MOSA 3PNPA 5EUQB 3CG4A 2N3ZA 3AJDA 3C8HA 2VBCA 1H65A 2J1LA 1IZ8A 2RH8A 4KUHA 1KE1A 1ZVVA 1C80A 2DB3A 1AK1A 1D09A 4KO8A 2Q07A 4EEKA 1U8CB 1SCNE 2JFQA 3QOYA 4PG5A 1ZWLA 3FDZB 1N6LA 1V1RB 4N7JA 1P0QA 3H5NA 3REQA 6ADHA 2GPAA 3CN7A 4LGMA 3WV5A 4NLLA 1ZH2A 2GKSA 3C3DA 4LVOA 1T1RA 4E6PA 3VGPA 2WKPA 1PLJA 3QYAA 2C83A 4O0LA 4PCUA 4Q3CA 4AYWA 1K3TA 2Z30A 2OCDA 1Z06A 1Y1LA 3TMAA 4V02A 2OO5C 3ICOA 3VKVA 4EL0A 4QTUB 3QF4A 4U2EA 5LP1A 3CEHA 1SXQA 5EINA 3HKDA 3DKKA 5DX0A 4UTPA 3K9LA 3JZIA 1FJGB 2D62A 3W7VA 2XRYA 4RH1A 5GZ6A 1GKIA 1IMOA 1DAPA 2Y9MB 3QU4A 3A36A 4W5OA 3ZBTA 4HQ0A 1SQ6A 3T9AA 1ESEA 1EXMA 4YMGA 2AH5A 2JCBA 1OZ0A 4X8MA 2RGDA 3MELA 2BDUA 1S3FA 2RI1A 3PXXA 4P0QB 2R7KA 1BXRB 1NKTA 1DO0A 2DTXA 3AG5A 3OEED 1W96A 1Z35A 3DMTA 5CM9C 5REQA 3RASA 3KSAC 1Y1TA 2MYUA 4MA5A 5IKMA 2XEDA 2GK6A 4Q6BA 1QE5A 3ANTA 1Q15A 5A3JA 2JFXA 2W6CX 4YCLA 2H3HA 2A58A 4MUYA 1EM8A 3ABZA 4YFVA 2P40A 3BA6A 3D6TB 2KWIA 2HK6A 4PVDA 1EXDA 1H6DA 3PKIA 1QZTA 2IYPA 3TD9A 2NUTA 4N8DA 4F1WA 4REOA 4CM9A 1YCHA 3IHTA 2AUNA 1RYHA 1R9MA 1UF9A 3C41J 1ORHA 4LHZA 3LKZA 3KSMA 4UTXA 2P4UA 1EEHA 3K2EA 3ZN2A 1V7QA 1IBKB 2UZ1A 3PKJA 4JBNA 4F1JA 2YFYA 3FCAA 3MCZA 5GIPE 1H8HA 5ECDA 2ZIXA 4MR7B 3CRRA 1ONOA 2VLIA 2CFSA 1PX2A 3GT0A 2NO7A 1FU8A 4FHCA 2RMKA 5CCXA 3K0AB 1R5JA 2Y67A 3AI1A 3FBTA 2IZZA 4M7WA 3WO1A 3U1VA 5FI3A 4KNVA 3SHOA 1KYTA 3CVOA 1EK0A 2CBGA 3F6BX 3PQ7A 4FIZA 5JYCA 4K9SA 1JTEA 2IZ5A 1EJ2A 2EBUA 3UANA 3VRHA 3SXPA 4L08A 3H5AA 5CIWA 4H7PA 2HWUA 5PGMA 3MWFA 2JGAA 2WSSA 1B23P 1XA3A 3DC2A 3G1TA 1Z74A 3KR9A 4OL9A 3INNA 1DIBA 1HDEA 5KSOA 2WVGA 5C1DA 1M2VA 4KI0A 5KOYA 2O59A 5DYYA 3TZHA 3UMBA 2CNDA 1FDTA 1QP8A 2DP4E 3I2KA 2Z2ZA 4GC9A 3MLBA 5HOQA 3ROGA 4RS3A 1AF7A 2QAGB 1P3JA 2AVNA 3AR3A 1RTTA 4PZ0A 4ZVNA 3T99A 1U7XA 3GK3A 3DL2A 5CYPA 2QNRA 5BV8A 1RIFA 2QTMA 1KI7A 1PFVA 4QC2A 4U2CA 2HHJA 1II8A 5JFTA 1BU8A 1N2CE 1USWA 2YIVX 1DB3A 1MXHA 2CB9A 5BW5A 2ZM6B 1DE0A 2B9EA 3GP5A 3M4XA 1H8EA 2FEWB 3WRXA 2DAPA 1Q91A 3L8DA 4JWKA 5BURA 2NN3C 4YQYA 5FHQA 4DIEA 1GO2A 3IPAA 4OK5A 5BOSB 3S1LA 4QG7A 2K2QB 1B0ZA 4AURA 4Q1FA 2ORIA 1JIXA 5KTPA 2KYRA 1C7FA 2FUEA 5ES3A 3TJRA 1G20A 5C53B 1CF9A 2CLDX 4YJDA 2IHVA 5C37A 2D8AA 3AY3A 2II6A 1T9HA 3NFYA 1A2KC 2CGEA 2CHGA 3G23A 3D4NA 3K7EA 1ADJA 4DS3A 2ZTUA 4LNUA 3CXUA 1KXJA 5C8YF 1RJDA 2OMKA 3CR7A 3CTMA 2QENA 4EGAA 1HYGA 3LT1A 4U02A 1O5TA 2DT8A 2FF5A 3V4PB 5TX7A 1RR6A 1N2SA 2RC6A 3F78A 1DI0A 1XVAA 2B5VA 4Z53A 3KEFA 3QEMB 2YWEA 2FSUA 1P4GA 4J49A 5KWIA 2I8LA 4JLDA 1HE8B 4WFQA 4K6CA 2Z6QA 2NVBA 4LVNA 3ROQA 2ZRPA 3RW9A 4R69A 5SV2A 4L27A 4CM8B 1NUUA 1U1CA 4MUIA 1AKMA 1CUEA 1ZUWA 3GRUA 1CP2A 4TS4A 3VSDA 1C7RA 1OROA 2FQXA 4MVJP 1DU4A 2C9MA 1Z6ZA 1X86B 3U56A 1P62B 2R2AA 2YOGA 4TN1A 2CD7A 3A70A 4DV3B 1PJ4A 4EKEA 4PAOA 1K6IA 1J25A 1GPMA 4IRXA 2BPOA 4QGHA 3UPUA 1E2GA 3ZOKA 3FBWA 4Q3AA 3OU2A 5ELLA 1Q44A 4M7OA 1G8FA 1QAQA 4ZU3A 4MPTA 1E1NA 1IE3A 3WRWA 3B48A 5KTRA 1SR8A 2HOQA 1OH7A 1T34A 2H63A 4O2AF 1YT5A 3SZUA 1DXQA 4C7KA 3WRYC 2PHZA 1F8YA 3PUKA 4L4SA 3HKBA 1JFVA 4XAQA 5DO9A 4HLUC 4AKSA 4DIKA 4A1OA 5T41A 2ZSBA 4NL4H 3ZHRA 1D9XA 1GWNA 3TNLA 1D0VA 5I7OA 4MGZR 1YA6A 3ENZA 4ARSA 5AI9A 1LW7A 5H3LA 5AVZA 2GEKA 4XGRA 2BBSA 2YNMD 5EHQA 1NGSA 4Q7QA 2FX2A 1QYWA 2VDWB 4KN5A 3KQTA 4Q34A 3U3KA 4TRJA 4ZVPA 1A9TA 4NAUA 3W4JA 3H9UA 4DY6A 1GQRA 1CEXA 1R0BA 3HU3A 4DCTA 4FFNA 4CMKA 4FLMA 4MXDA 3OCWA 1TQ8A 4OIFA 4RORA 4RZ2A 5EWMB 2Y9PB 3B85A 5JAUA 1FCJA 2OC9A 2PSDA 3OZAA 2Y1KA 5LFAA 1HZZA 5MDHA 3RS5A 2FGKA 4Q24A 5TS2A 1X1TA 3MS4A 4R1QA 2IYLD 5EUMA 1KAOA 1N9ZA 1ORRA 2C2XA 3G8DA 5KWJA 2OYSA 3Q41A 4QULA 2SCUA 1AKUA 3T3EA 3V00A 3BXPA 2OOKA 4B80A 4OYRA 4UZEA 3D54D 4F21A 3KB1A 5EIWA 1U4NA 2CJPA 2A6PA 1FFDA 4MQEA 4YJHB 4BECA 3IOMA 4DLLA 4V1CI 4HVTA 4YC7A 4G8CA 1GZHB 1TADA 3D3WA 1MOSA 2VDOB 4PGGA 1Y1QA 3VVCA 2O0KA 1TVEA 4DSUA 4EQZA 4WLEA 1U81A 1JHOA 1Z0FA 1S8FA 5I4BA 5AKZA 3R3YA 1Y33E 3EAFA 4GGOA 1MC1A 2FWRA 3VMFA 3O8RA 1BFKA 1UK9A 1VJ0A 4FSDA 4PY2A 4QHTA 4QUKA 4BBPA 1PLKA 3UVEA 5GTDA 3CUWA 1C4WA 3HA5A 3JWGA 3KXIA 3GFTA 3IJRA 1M2WA 3KUCA 5DCUA 4IIHA 4QUHA 1MVNA 2JIZA 4CNQA 3U4QB 9GPBA 3KJHA 4DDHA 2W5UA 2ZBRA 2C9BA 4BRUA 3LJKA 5EI5A 4EH1A 4QL3A 3U3MA 1H0RA 5AVQA 1QLHA 2RAVA 2GCOB 2X6TA 3FKJA 1YZGA 4LY3A 4UDXX 3G2MA 4BEJA 4LZOA 5HG0A 1M73E 4RKRA 3HLKA 3IS3A 1L0BA 3P9NA 1QUEA 2QL9A 2J45A 1Z88A 1IBCA 1B7GO 3BBPA 3DOUA 1PFGA 2FDRA 3AU8A 1YOBA 1K92A 1T5IA 1H94A 4U9HS 1KSJA 2ODTX 1JE0A 4YMSA 1AG9A 1YMVA 3R5FA 4TTIA 4WOKA 3H65A 5E6RB 1SZCA 4BNDA 3RK1A 4I7EA 3VA7A 4B6PA 3SKYA 3DOOA 4MW9A 5P8WA 1NQUA 3COZA 4GBJA 1HWYA 1YQTA 3QPVA 4KB5A 4PNHA 1FUUA 1NF8A 1NYLA 4GXRA 1T91A 2B78A 2OTCA 2XNSA 3HVIA 4M8IA 1U1GA 2OPHA 3NIGB 1OLSA 3FCCA 1IXZA 3WGZA 2ZPTX 2H65A 1WZNA 4CEJB 2KLHA 3UMVA 1PR0A 1PV4A 4CF6A 1Y1RA 1X15A 4G5RA 2XI4A 5ESDA 4LOLA 5TS3A 4UM7A 1J0BA 2FMKA 2IYNA 3L1KA 3DPIA 2P7HA 2V54A 3D1VA 2PGAA 4LC9A 1U7WA 4TZTA 3V33A 1Z56C 2HA4A 2XUKA 3P96A 3EQ6A 1KO5A 1Q74A 3QM1A 4M0PA 3HMKA 4QFBA 1QG2A 3GT3A 1FU4A 1A50B 3Q2OA 4GYWA 4XB1A 1GY8A 4UMVA 4F4DA 3NDBB 3AUFA 3LD9A 3H11A 3MYRA 2J0QA 4I9FA 2ZYHA 1JG1A 1ZESA 1IUPA 1FYVA 3AW9A 1UFOA 3NDJA 3QX9A 3CGGA 2G80A 2WU8A 2XIQA 1WMDA 3DFKA 4Y9DA 5BY2A 1OYOA 5B3LA 4PX9A 4UVHA 3BK7A 5DM4A 3C74A 4MV8A 5TVKA 3JZFA 4CG2A 3RUEA 3DO6A 1HDXA 1ZEMA 5E2IA 4OI2A 2VRBA 2MINB 3MS7A 4IOJA 3UT5A 3ED5A 5BMVA 1KI6A 1R8YA 2HHAA 1GGHA 1A27A 3AM5A 2EJCA 1N5OX 3W78A 3B1FA 1JLSA 2HDNB 3DE3X 4CU5A 1T2UA 3WK4A 2O7RA 2GCEA 721PA 4QUAA 4GFDA 1U2SA 4F91B 4ND6A 3NBKA 1BHQ1 1DNPA 2X7HA 5FOTA 4FXPA 4IV5A 1NOIA 1FDSA 3PC3A 2JJ2A 3V1MA 1RD4A 5EQTA 1IVNA 3AOGA 4BV9A 4ZKEA 1QHIA 1WZUA 2OCIA 5KDDA 4MUHA 1FB5A 3GLIB 1AJEA 3TXXA 1E1RD 3NPMA 1X94A 1J0AA 3WGNA 2PH1A 5FFMA 4KWCA 4AS3A 2V74B 1RXCA 4A10A 2JDIA 1ZUHA 3F9RA 3L8EA 3ZXIA 4TQUS 1E1RA 3VDMA 4O3MA 4A3SA 3AEKB 3HEBA 3RREA 4QDJA 3LO8A 4JI2B 2YJ3A 2YHSA 4HDKA 4XGQA 1QPBA 4DHEA 3W2EA 3FUWA 3W3AA 4FOOA 2JIPA 4UMDA 1W6RA 1XDGA 1OYVA 4XFDA 4BB9A 4BLRA 5DSXA 3HTXA 1NW6A 2IDJA 3D0OA 4QTTB 4E2YA 1JDVA 1PRYA 2H5JA 3C3MA 1QR6A 1OLXA 3LCCA 4MRMA 5JBNA 3T7EA 1BMFD 2BFWA 1TEVA 4QBFA 4Z3OA 3KOZA 3MXOA 3PDCA 2FZWA 2VC2B 3HJNA 4HGPA 3RKRA 1KZYC 3VMMA 4F3RA 3QBTA 2GSDA 3EGXA 4I19A 4R01A 3CX4A 2AMJA 2HU5A 3DPUA 4OMDA 4B3HA 4N40A 3G0OA 4JASB 1ECGA 1OBVA 2JFGA 2QYHA 1E8NA 3UXMA 2RJNA 3Q9NA 1TLFA 3K30A 3WNCA 5AVUA 2BHTA 4G1EB 4JB8A 4MQFB 2C42A 3H4VA 4OKNA 4ZO8A 4AS1A 1JIVA 3RSSA 1PLLA 2NMVA 2VQDA 2IITA 2X7JA 2QRQA 4EPTA 4HMOA 2V5VA 1Y4DE 2F9FA 3VU8A 1K7EB 4S12A 3ZDFA 4KQXA 2IPAB 3H9EO 5LQKA 3UJNA 5DI3A 5DJ5A 4RIEA 4B6EA 3SQXA 3UK2A 3IBGA 3AERB 3OSUA 3D8NA 4LYHA 1S9HA 3SF8B 3PX3A 5CB8A 3E4DA 2H2GA 1MAVA 1QZXA 2QV7A 3EFOB 4OHXA 5EHXA 1VP3A 3PDIB 2BKAA 3KX2A 4LRSB 3ZX5A 1U7OA 2C4MA 4MJLA 1U3WA 2QUBA 4YAUA 1XU9A 2JCYA 3RJ9A 2Z4TA 2VH2A 4PSVA 1ZUNB 2O3RA 4QGGA 1BX3A 3AJ9A 4X90A 1GZ4A 5ER9A 2IHYA 3HCFA 4Q4HA 4XE5A 1B14A 2VRCA 1JJFA 2XUOA 3OPNA 5P21A 1WXIA 3WK5A 2E5WA 1PW5A 3AM4A 3LQFA 3W5IA 4LYEA 3WS7A 2DG2A 1M67A 3GMIA 1RTKA 4GUAA 4X92A 2QGZA 3HBNA 4LMBA 3DD1A 4KJZA 4BE9A 4LN1A 1UP6A 4MA0A 2RKWA 1LK0A 1PI3A 3GQBA 4MR9B 2WFZA 4RM2A 4TLEA 5CBKA 1M8JA 3VH4A 7REQB 4MW1A 4PZDA 4J3NA 1YUMA 5JSQA 4WNYA 2DFNA 4Q4AB 3U7JA 5JNTA 1XMOB 4JI5B 2ZJOA 4F5WA 3ZHUA 2DKNA 1XYVA 2VK4A 3DV0B 4P5DA 4NNOA 1NP3A 2JHGA 1EFVA 3H13A 1SBHA 3DCIA 4Z4FA 1TNDA 2IGBA 1JEQA 2Q0SA 2QW0X 2P27A 5LZ4A 3OTQA 1ZJZA 1ZITA 4YV0A 5KKCA 4BMYA 4D46A 1YMQA 5D5PA 1GFWA 3KKZA 4WJZA 3UK0A 4D9BA 4LJ4A 2ACEA 3I2IA 3JS5A 4YV1A 3QEMA 1Z4LA 3SWWA 3LC7O 2VZLA 1PJBA 1I6WA 4BB6A 1HETA 2FMXA 2O7SA 4ZRNA 1UIMA 2J7KA 1IC6A 5F33A 2JZNA 2QTLA 4KXWA 2CNOA 4HLQB 2PSSA 2YS7A 3DUWA 5BVGB 4AWBA 4MYHA 4ND2A 4BV2A 4RDXA 3NTXA 2QTGA 1DKMA 1V2HE 4QJBA 1MJNA 4QQNA 1IJFA 1JYFA 1GTL1 1T9GS 4LXYA 2H7VA 4Q93A 2POCA 2QI9F 4ZC8A 5MHTA 3F5SA 4MB0A 4MWOA 3W8DA 1I30A 4NBUA 5A04A 4EYGA 2WQ7A 4QJIA 2W7TA 3O38A 2H59A 3WJ2A 3FDZA 1BYIA 3K32A 4I1RA 2BH9A 3QY0A 1TL7C 2GKOA 2ISQA 3GC6A 3P0EA 4MDHA 4OHFA 1PDVA 4JEHA 5TV2A 4EG0A 1SXJB 3CNLA 4DV5B 1K7YA 3L6OO 3VJMA 4C2UA 3OFSA 3BEDA 4P36A 4WUVA 4D57A 1XEXA 2P6UA 3DHEA 1CUBA 3FUCA 5CNMA 4W5QA 1YB7A 2QTNA 1E0DA 1NWHA 1IPHA 1FX1A 2HCFA 4BFZA 3IP3A 3OOSA 4R2IA 3GIDA 3DZGA 2JGRA 1HTTA 5COQA 1G0NA 2WYWA 3PC8A 1RFGE 3V4FA 1TGVA 3QSGA 2BL4A 3LCMA 1U2GC 1VIYA 2ZQ5A 1GPH1 3EXFB 3HDJA 3JQ7A 3R40A 3QHQA 4J4BA 3MSXA 4Y98A 1YDEA 3LVFO 3BBLA 1BJTA 1R15A 3EIQA 4KXUA 3FGOA 2I4RA 3ZY6A 3EZGA 2ETXA 2C1XA 2D7CA 4R8VA 1MX9A 1ZMRA 1DJLA 4DRYA 1POWA 1Z6GA 3I5UA 4J1TA 3SYMA 1WZEA 3KO8A 2C7QA 3M6AA 4GL2A 1V35A 4TVSA 4XD7D 2AFHB 4C7VA 4EB6B 3OY2A 4W6ZA 4D43A 1EE1A 4E31A 1DOHA 4B3FX 4XVRA 1K0FA 1QCZA 3DOHA 5KQLA 1OV4A 4C76A 1WE2A 2Q5LA 3E3MA 3MBKA 3GQVA 4AC9A 1RQ7A 2VH1A 5AK4A 4IX9A 2C2GA 5TT1A 4UUBA 3ZE7A 5AM0A 3ROTA 4EY4A 1KK3A 4I50A 4TXHA 1V5EA 4C43A 5L3SB 5LP6A 5KSZA 1OFIA 2YWGA 4ZOLA 1MP0A 4IRMA 4OAQA 4UBMA 1CETA 1NDQA 2XMRA 2YV1A 2FWMX 5HILA 1Z5WA 1CIJA 1P1FA 1SU7A 1SH7A 2YX1A 1U8XX 4GI5A 4GL4A 5JQGF 2JVIA 1HXHA 2BFCA 1DKLA 2GNAA 5BUZA 4CE6A 3RC8A 3SJCA 5KOHA 4MJXA 4XEHA 4YT4A 1NPDA 1OOEA 3BD8A 3DZCA 2BE7A 2AJBA 3E3LA 2MSEB 2Z09A 3O3OB 1VG8A 4M0CA 1ISRA 2D1RA 5KQMA 1EGAA 4R68A 3RVQA 5K99A 2VYNA 3C6BA 4TSKA 3MMSA 1OT5A 4M9UA 2IRWA 1DMRA 3PI6A 1YBFA 4GHWA 2YQ5A 2CCKA 2FW1A 3OFVA 1KDZA 5LM3A 3Q10A 3IMGA 2JHFA 1YWGO 4EAQA 2NV2B 4Q1DA 3W5HA 3PIIA 3AVTA 1CF4A 4X41A 2XXBA 2JLBA 2QVXX 1PK9A 3QVOA 5BO5A 4WBNB 2VYND 2IX9A 3D31A 3O8QB 3RHFA 2I66A 4L4UA 3DQZA 1E8MA 3PICA 4RYDA 1RM3A 3TSAA 5BXQC 1H3EA 2Z83A 4RK6A 1P1CA 1LW6E 3SZOA 1C1DA 1R7RA 3O4GA 1AGYA 3IAM6 4M9XA 4Q7MB 1NHWA 4OP2A 1JQBA 4AZ0B 2OYRA 1EAMA 2VAPA 2IBSA 4DDVA 4KE9A 5BSEA 4KK4A 3T54A 1HDCA 3MTBA 2E21A 4TM7A 3BCHA 3EXFA 4KUEA 4EX6A 4Q19A 4YGYA 2H2DA 3Q7PA 5K8JB 1KDTA 1EHIA 1CNEA 1OHHD 5DPMA 3CX7A 4BZQA 5I5GA 2OCKA 1AA9A 5ITWA 2X4LA 3OCXA 1AQNA 2HQOA 1WW2A 4BNZA 1PJRA 1AMUA 1HLGA 1TPZA 2BHRA 1WV0A 5CVJA 5F98A 2DR3A 1BWPA 2P4SA 3X1YA 2B9VA 4D26A 2XDQA 2MR5A 5HQTA 2D00A 5CA0A 1OH5A 3LDAA 2HBRA 2NQ8A 3GBVA 3GJYA 3I09A 4KO3S 5HJ5A 3JALA 4RE5A 2K2WA 2AK3A 2JGEA 5LP6B 3REQB 3FG9A 4A73A 1NU8A 3JQFA 2KI5A 1UXHA 4JYMA 1Q1EA 3EODA 1OIXA 1VXOA 3AIKA 4NJEB 3UMFA 1A8QA 5AQ1A 1R0RE 2WWGA 5FF9A 2WTEA 4DCPA 1IEQA 1Z2OX 1JNXX 1MOPA 1VL2A 4BMXA 1LDYA 3QPWA 1FNNA 2C2KA 3ZQJA 4MTCA 1QIHA 4G9BA 1N3IA 1M0EA 3WO0A 4HWSA 4LEIA 3L8FA 4N7RA 3N39C 4EUHA 4P1ZA 3EGCA 3CQ9A 5GGYA 2O6HA 4PZAA 1JEQB 2J85A 5F35A 1I36A 4PGAA 1QG4A 2C2ZA 5C35A 3IUBA 3CUEF 3KE9A 4H31A 5TGTA 2FG6C 1XMPA 3NKLA 4BO4A 3ER9A 3SZGA 1WABA 4DDMA 4EHJA 2FPXA 2XKKA 1P7VA 3DB2A 3H2HA 4G07A 1EE2A 3FHLA 1EDZA 2OCAA 2XA2A 4EENA 1C29B 1D4OA 4UBIA 3QP9A 3IMFA 4UU0A 4B0PA 2PUDA 1I0ZA 3DP7A 4ZT3A 4BASA 5JROA 3T3PB 4J7AA 3TNFA 2EHDA 4GPTA 2ORWA 2NO6A 4DE5A 1UINA 1UWVA 1V9LA 4XQGA 1P4RA 2XNJA 3GJSA 4L3OA 3T52A 3Q3EA 4COKA 3IAXA 2C99A 3KAPA 4BYGA 2BF7A 4DR5B 5C9ZA 1C0LA 3NAZA 4AG6A 3U60B 3LLCA 1FNDA 1VKRA 4IEFB 2J9ZB 1WUHS 2R6GA 5FPSA 1O03A 2ZYGA 5CIYA 1UC4B 3FPGA 2CFIA 2DLDA 1JJAA 3SVZA 4FCVA 4TL9A 3PFIA 4NBVA 3OQIA 3W5SA 5HKKD 3L1JA 4MQBA 2EWWA 1WXXA 1ISJA 2COEA 3K09A 5TJ9A 1F8GA 4AJEA 4WE3A 3EFOA 1X7YA 3DSRA 1BC5A 4A7PA 1Y0BA 2XNHA 3W8NA 3UYKA 3VUFA 1RQRA 4C2TA 1QU3A 4RTJA 4TYMA 4EHLA 1EDDA 4J0QA 3W1VA 3HM9A 5DF1A 2B8NA 1NQOA 3QVSA 2W4QA 3DBLA 3J81A 3LP6A 4QYMA 3BF8A 2GA8A 3D1JA 4WXYB 5LU8A 4QOFA 2AN3A 5A4KA 1PJ8A 4A8JB 3FOAA 4DV1B 1G55A 2V3WA 3OOJA 1J2EA 2V7EA 2QD4A 1NVBA 3SC3A 4CUKA 2BI4A 5AP9A 5HJ2A 3WGUA 5JS8A 3IUNA 3HBJA 5I8ZA 5JDCA 4JVOA 2Q3LA 4JLMA 1U94A 3PQ3A 5AKXA 3TYXA 4GD3Q 3G79A 3R2JA 2NU9B 3TVDA 3OA2A 4GM4A 3F6CA 4OBWA 3NC4A 1XMSA 4M37A 1P4HA 2JGJA 3KLOA 4Y9UA 4A91A 1H2EA 3NHPA 3C7DB 4N8EA 3UG6A 1U2PA 4HGRA 1NN3A 4R1LA 1FNBA 1SB9A 1J5PA 1WG8A 2NYRA 3RSFA 3N07A 1ES9A 4HO1X 4JN6B 4PZPA 2LCFA 4R7ZA 5DLPA 3H2JA 2BFCB 1EKXA 1UPCA 2IGTA 1P4SA 4TQGA 3OPYB 1ZNYA 3TL2A 1R5BA 4FGWA 1CS4C 1RE1A 3E84A 4JT4A 3OH8A 1RJ9B 3FBGA 1KC1A 3GOQA 4BIIA 4I8XA 2AXNA 3OJLA 4E1AA 5J2TB 3QXCA 5H5JA 3VPFA 5F7ZA 1VZ2A 3UMRA 3G0IA 4EITA 4BJ5A 2ATXA 4IH4A 2PX3A 1Z0IA 1K9VF 2VTDA 3FNHA 3C14C 3GEMA 3R20A 5CT6A 2BEVA 4L0CA 2DEUA 3W8FA 3ZS9A 1EUQA 2W2QA 2QD2A 3FD8A 3JQFC 4PR3A 4PZYA 5BNTA 5FPKA 1JI3A 1JAXA 5DXAA 1K9SA 4CV2A 2CZGA 3HJCA 4EGJA 1P61B 3TDNA 2PSEA 4DNOA 5J59A 2IYWA 1SUCA 3CE9A 2W2MA 1JBEA 3P0IA 1A5ZA 4E5VA 4DCNA 4C6TA 1X92A 3FUUA 4AJJA 5CBPA 4H7HA 5I7HA 5JT1A 1UJMA 1EUZA 3W3AD 1JIJA 4N82A 2UZIR 5LU9A 3TZCA 2LRHA 2REOA 1CFJA 1NVGA 4LRYA 4YDQA 2Q9AA 2H8KA 5FX2A 2CMHA 4M0FA 4PONA 5FI1B 4ENRA 2HK8A 2VT2A 5IVHA 2M6KA 4LGYA 1WLSA 1PV2A 1QH9A 4K6FA 2P69A 4F71A 1PKEA 1JA1A 2FPIA 5EQJB 3EEQA 1Z6TA 2C2OA 3OLVA 1N9GA 1SQ5A 3TAXA 3ZDEA 5FNZA 2RGRA 1SEVA 3O9MA 3ZKWB 2OCPA 3N6RA 2AHRA 1KSFX 1JFLA 1JPVA 1B00A 1KVTA 2B4KA 3HCAA 3OT5A 5E0KB 5IN4A 1KMMA 2JH3A 1HYEA 3VNRA 3WKEA 3AK4A 3MCAA 5D3MB 5GPBA 2HMAA 3I12A 1XWIA 2QVZX 4D0SA 1U1IA 4FB5A 3TLBA 1OAAA 2IIBA 1MC5A 3UBMA 4C04A 1SZJG 2PJRA 4XIIA 5BWLA 4NE7A 4I5FA 4PW0A 1Y4ZA 3SBDA 4DG9A 4WCFA 2L42A 4JSRA 2CLIB 2YN2A 5B36A 1M8GA 3L4JA 1K4YA 2Z9CA 3Q4GA 4WN9A 3ZK7A 2P3OA 2X8AA 1U7DA 4CCYB 1JZSA 2MSWA 3E7WA 2JEOA 4PYMA 5LJIA 1J8YF 1AKRA 5JTTA 1E18A 4P7BA 2HWKA 3I23A 5TMPA 3ZYZA 5HUHA 3KUXA 1C4XA 1J22A 5H80A 1STOA 2CVPA 2G9QA 3E35A 3W5AA 1ZOIA 4P80A 3VR6D 2J9RA 2VDJA 3OX3A 1ZPDA 3LSTA 1ONNA 4ROSA 5ALIA 1I5RA 2AXPA 5AR1A 5KKAA 3WL6A 3E9EA 5JAMA 3MMNA 5H4HA 1HNZB 3ZXXA 2GBIA 5IEJA 1HQCA 3HYLA 1AGRA 1BO6A 2QZ4A 3LK6A 1H4TA 1H8ED 3AM1A 4URXR 3KQNA 2JFHA 4HUQA 4E5DA 4G0QA 2BTOA 2ADFA 1ORTA 1U8UA 1E64A 5YASA 1QWSA 4RV5A 3RD5A 4XB6B 2IY8A 4N5NA 1MBZA 1PR6A 3BWVA 1N0UA 2GUGA 4GR5A 1Z8HA 4LE0A 4WNAA 5DCWA 4F3TA 2XECA 1XJWA 2Y1DA 1XTJA 3LX6A 3T5BA 1G3QA 1GAEO 1G8SA 1WLYA 4UJ5A 4ZYWA 1LQTA 2V7XA 1TT7A 3BH6A 4GOLD 5JBIA 2BP7A 2ZZNA 1S6YA 1U7TA 4LDPA 3G0BA 1NJ5A 3N1UA 1JE1A 2J59A 3JCZA 2C4KA 2B3DA 1E3QA 2HJWA 3EVEA 1U8EA 3EJ6A 5HKBA 1RAHA 4MQ4A 4NONA 4DQDA 1U2DC 4O2BB 1JLRA 1L7DA 2NAFA 3OLYA 3T5DA 1XZEA 3M3HA 4OU5A 4YDSA 6NULA 2EBFX 1AKTA 3N8IA 2WPNA 3GGJA 4NDZA 2GAOA 2D8MA 3RI3A 4EJSA 3I2FA 2PLFA 2ZB2A 3Q98A 1V11A 4DCVA 1A9RA 2NT4A 2ZAGA 2ZT6A 3FNEA 4HJXA 4QG3A 3PUWA 2C57A 4JUFA 1KY5A 2P65A 4OX9Y 2HBYA 4FS8A 3I64A 4OH7A 2WKQA 4RELA 4U2GA 4YLYA 1TJ5A 1RLJA 3WIVA 3QITA 2C0PA 1WCWA 3S44A 4URZR 3U49A 3U1TA 1FS4A 2AV6A 1CT9A 3RSZA 4RDHA 1UBOS 4LK3A 4I55A 5KYWA 1Z18A 2Q4OA 3HN7A 4RQTA 4RZHA 3X2SA 3ACBA 1HFKA 4D99A 1BIFA 4M3NA 2R6ZA 1GA6A 3PD7A 1HX7A 4ITRC 1PW7A 4P81A 4E46A 3IQEA 3R7NA 2QIOA 4HADA 3IAM1 3LL4A 1VBMA 1XNGA 3CVWA 1EPUA 2HZ7A 3UJHA 4I08A 1GLGA 2EAUA 3CZ5A 4M1SA 1JKFA 1QVRA 1TW2A 1UPXA 3LX4A 3G8YA 2QMEA 4W5HA 4WOPA 4WV3A 5TPZD 3WE7A 2Z4SA 4YAKA 3DKRA 1AS2A 5CYGA 2AOXA 4GWGA 3MAAC 3TEJA 3V8BA 1W5AA 3U16A 3L8CA 1GJRA 3BJIC 2JCVA 5JCZA 3NRBA 5BSTA 5AKIA 1GQOA 5JNUA 4IDPA 5JWRA 3TW6A 4P86A 1FP7A 3T7IA 1H0HA 3ZEIA 4S24A 1F4LA 1ENZA 2LV8A 4DM7A 1RABA 3O4FA 3I6QA 4FDUA 3U6KA 2PSFA 3FMIA 4EG1A 1CYDA 5KQSA 1XYGA 1U5BB 1USIA 3I34X 1WVMA 3BL8A 3DE0X 4FOPA 3CVVA 1WOMA 1XWWA 3OEEA 3R9XA 2VYQA 1VCIA 4YRNA 1X7DA 1BE1A 1Y4SA 3AV0B 4LDQA 1GNRA 1E77A 3VU9B 3QRWA 3RTAA 4DYDA 4BUJA 4I1UA 3EIFA 1T5HX 4RO0A 1G59A 4OQQA 3ESYA 3AY6A 3TTYA 5F76A 4FVTA 3LPMA 1T2VA 4CTKA 4KDEA 1W4ZA 3DCJA 2N0SA 1YAHA 2WIBA 4NKRA 3BIFA 1C9EA 1EVYA 1KJWA 3KU1A 3CMMA 1SUBA 2AJTA 3GEHA 1LGYA 3GNQA 3O73A 2QDXA 4O2AB 4I4NA 3ZS8A 2M2IA 4PQYA 5IM4A 3DWFA 3EWIA 1HE5A 4QOSA 5DP2A 1XVLA 3GUYA 1T5DX 2PY6A 3GRVA 1P9OA 1FQOA 4J6EA 1QP0A 2GFQA 2G1AA 3OLXA 2O7QA 4ZGBA 3OJOA 4C0QC 1LX7A 4V0OA 1E59A 1N34B 4D8XA 3QVXA 4AF7A 1EXWA 4GX0A 4FPXA 2A78A 3E5MA 5C18A 3P71T 4IKOA 3AL0C 1NSTA 3OZWA 2KW5A 5LZ9A 4XWWA 4IJKA 1I2MA 3L8GA 1WQ3A 1TTTA 4WK0B 3AF5A 1BCRA 1OX4A 3BERA 1E3WB 1MC4A 3WGVA 5HUQA 4DEXA 3AVYA 3GT4A 2YJ4A 4G0YA 1I1QB 3RFXA 1EK6A 3OM1A 2X3FA 4AXXA 4HVAA 5AVWA 3T95A 3GRKA 1JHQA 2VYVD 2WE8A 3AJAA 4AJLA 3G8BA 1XTVA 3F67A 3HKDB 4MKHA 1DRJA 4HQ6A 3R0VA 1F9AA 1P2TA 3GUCA 4H2DA 2QLTA 3L7YA 4O08A 4QAJA 4BU0A 2EX1A 4L8VA 2H2FA 1CJKC 2C8JA 1ZSYA 3IO3A 3FTQA 4HWPA 4YONB 3Q7EA 3ZC3A 4AUMA 3A4NA 3CONA 3HZHA 5A6SB 1MB9A 1Q0SA 1XD9A 4AAYA 1K6JA 5IVIA 4RTMA 1CJMA 1DBQA 2H1LA 2WAYA 2VDNB 2XYRA 3FCXA 3QH4A 1BSVA 1FVHA 3L0PA 1I9GA 1I7PA 3HB5X 4RFLA 4RMHA 4BQPA 3V8EA 4DNPA 5AVVA 1M2JA 1N3YA 3NOXA 2LNDA 3GMTA 4Q3BA 1HKHA 1RADA 4JYBA 5FB3A 2F9MA 4G89A 1DO8A 5LNK1 3ZE9A 1PYOA 4H1TA 1WMFA 4Q21A 2KS6A 3GL9A 5CX1B 3ONWA 4DSOA 2Z3VA 2JH8A 1IHPA 1EEXB 3I73A 5FPHA 3GJ4A 1QE0A 1HE3A 4L6AA 4LCJA 3LYUA 4YDRA 2LZ0A 3G0DA 3PLRA 3LP8A 1PIWA 3ZWWA 2Q3BA 1UZNA 3P0RA 4INJA 1JAIA 4IGFA 2I34A 1RZVA 5L6LB 4U9UA 1CUZA 1AQYA 3KQQA 3TQFA 1H42A 3Q5DA 1RW4A 1WJGA 4REQA 3AY0A 2NSLA 4KZPA 3PRKE 3TB4A 3LHSA 4BX0A 3Q1KA 2IEAA 2PZBA 1X19A 2C2BA 2FETA 4O3FA 2HDOA 4WZBE 1BX0A 2X1MA 4RV4A 3GCZA 5A7FA 1O94D 1Q0UA 1SG0A 3ZGNA 1QPZA 1DQNA 1EFKA 5CFQA 3EZYA 1LTHR 2FPPB 3Q9SA 2GD2A 3PF8A 3FPLA 1R27A 3BGSA 4FHZA 1I80A 3EFHA 2FJUA 4GT1A 5TC4A 1E7YA 1LDGA 2AQKA 4LMAA 2CKMA 3SYTA 5EJ4A 2FKAA 2GEVA 3GEGA 5AHOA 2WHXA 3OEHD 4QEZA 2Y0BA 4L5BA 4QXRA 1KAQA 2PXHA 4BATA 3UWOA 1XLTC 2NQ2C 3DVSX 5LIRA 5I48A 4ZO4A 3HEMA 1JBKA 5FXMA 2OZLB 5GV8A 5GJVC 4FI3F 3RG8A 5A2QA 1E5QA 2W43A 5IX8A 2Y1EA 1V8BA 4XGKA 2XMQA 5ALZA 2FPOA 3OMLA 3W7AA 3CYFA 3BMOA 1YR7A 2IDMA 3H2BA 3R6GA 4HAWA 5IARA 4BFWA 4W4TA 3D7LA 3UENA 2J9GA 3L82B 4P93A 1EH5A 4AKEA 4FYXA 2ODEA 2FTKE 1NBOA 3WBKA 4ECEA 2C7PA 4RH3A 5HA5A 4WKBA 4I50B 4K3UA 2Q8NA 3T3NA 4OYHA 2ONKA 4PAGA 1FMFA 4OFWA 1F2TA 1JJ7A 1P77A 1RWKA 3I3SR 4IRUB 1DBSA 2B4YA 1U6KA 2WF5A 3NHRA 4CKCB 4X8OA 3PRHA 5E6SB 5DHSA 3W6NA 5DLDA 5CG1A 2RGBA 1F1JA 4A16A 4CKCA 3TQOA 5A02A 3GV0A 1H2WA 4PQRA 3IKMB 4L76A 3RF7A 3DF9A 5EWJB 5D7BA 4L7VA 3MERA 4B17A 2VO1A 3ONFA 4M2LA 4PX5A 1BE8A 1DRVA 1VJ5A 4YROA 4ZCPA 1EUYA 3QA9A 1NBMA 5DWVA 2QPAA 4GI1A 1FP1D 1UOPA 4KQIA 1CYEA 3JD1A 2Q6VA 3K0AA 3A3OA 4JL8A 3FNRA 1NFRA 3GCXA 2WYUA 4BLPA 1NVKA 2H1RA 4DUGA 4MVJH 5EJ2A 2QPLA 2M9MA 4Y1RB 2LDBA 4FLEA 3WB9A 3N6XA 2I3BA 4DBZA 2PGDA 3RIGA 3TXAA 5JZSA 1E96A 1FOEB 1T8TA 1MNAA 4FFBB 4ZT2A 3RV4A 4C21A 1OIVA 2E4AA 5K3FB 3V1YA 1DJMA 2CLSA 1L5HA 2IE0A 1Y1PA 1YRHA 3VU1A 4INZA 1C41A 2Y1LA 1GKUB 1F6DA 1X1RA 5T64A 5KU1A 4ZU1X 1GZ5A 2QQ5A 3N2YA 2EW2A 3AFIA 3M6UA 4X63A 1MVLA 1P5ZB 2NUTB 4LZLA 4KXFB 2GKGA 2V9ZA 5FBLB 3VO2A 2X5XA 4AIRA 4G01B 2ZYAA 3HV2A 2YY7A 5LYJF 3HP1A 4Z1OA 4LF9B 3L8ZA 1SVWA 2VHYA 4NX2A 4ZXPA 1WF3A 5B2FA 5E0OA 1U2ZA 1XVIA 2W2VA 5JRDS 1ZEJA 4LX0A 4QICA 4UQPA 4D97A 3N53A 1OVGA 4FKZA 2C1ZA 3PHHA 2EU8A 4LE1A 3HXLA 2W0MA 5AWFC 3TE6A 2GN8A 5GJCA 1AO0A 2JNWA 3DR3A 2RHRA 2AQHA 4PQFA 2IZOA 2O4UX 5AJZA 5A1JA 2HKIA 4HNQA 3LF1A 1LDBA 5FUXA 4ZO9A 4BO2A 4CR8A 2HT6A 4BQIA 5KTNA 4RGBA 4P0TA 4DQVA 5K0EA 5MFPA 4R1PA 2QUAA 4YH1A 2YHAA 3O8NA 1EGHA 3MQFA 4K81B 1GNVA 2BUBA 1FPMA 5JSZB 4XQCA 3Q12A 5ALOA 2Q3EA 4E5KA 4PLYA 1RPJA 1JR6A 2PCJA 3Q6IA 3N05A 3E3NA 3NXSA 2WABA 2HSEA 3OE5A 2FEKA 3NHWA 1IH8A 4HFJA 3R5HA 1IZZA 4D9MA 4E3ZA 4PXSA 4J16A 5CDTA 4I1VA 2UYOA 3EA0A 4B7UA 3RAFC 5F4BA 2ZR8A 5FPPA 5HP4A 4B6OA 1BMTA 1NW4A 1OXMA 4E0BA 2PH7A 4EA6A 2ZZKA 1URPA 1DCTA 3RHZA 3RYHA 1IM2A 1EFTA 1CY1A 1M1ZA 3HS3A 3N2KA 1MVOA 4FZ3A 3CIOA 1FFEA 2Z2JA 3SC4A 3QPAA 1MRNA 5K6AA 2Q4DA 4NABA 3KKLA 1VZ3A 1PT8A 2PDAA 5DXJA 5KPDA 3Q8WA 4IXTA 4CIAA 5SY6A 1VLMA 2Q3DA 1OMOA 2YJ5A 3TM4A 3RQIA 2EATA 1TFUA 3W06A 1P3DA 3KFLA 3EG9B 1EWQA 1NI5A 4FMBB 3GZJA 3W5VA 2F1HA 2PL5A 2J30A 2ZE6A 3GJ0A 3LQYA 4IQGA 2LCQA 5A5GA 2Y77A 2HT1A 3FSGD 3HUEA 3SJUA 3SHFA 3KQUA 3K16A 3UAGA 4KU4A 4N5HX 4WXRA 2WK1A 2OOSA 3RUDA 3BIOA 1QIDA 4QYTA 2OGUA 5AXAA 1ZJWA 3MWYW 1TT5B 1L7XA 2F55A 4QBKA 3WLOA 1AGXA 4IIVA 1QONA 3O9VA 4L4XA 4MVJF 4TMXA 5B55A 1M75A 1CVRA 1C2YA 3W77A 3KKQA 3MBIA 4G1BA 2VATA 1GEGA 5JE8A 4AY3A 2WJPA 3RFFA 2WU1A 4AMZA 2ZSUA 1YQUA 4OB8A 4MICA 1GAWA 4R1NA 4PZUA 4BNGA 3STUA 4E5PA 1M66A 4EP1A 4LJ5A 3ADCA 1B26A 1PD0A 3HG7A 1I7DA 4W7HA 1T4GA 1NT4A 1M83A 1SCBA 2VDKB 4IIJB 1TM5E 4ZZ2A 4ZEMA 4YIKA 3GY0A 2R1VB 4BP8A 4QTYA 4WKNA 1Z7YA 2ISSD 4BMDA 1IWBB 1HOXA 1QTQA 3NDIA 2WZDA 3DHVA 1Q50A 2L19A 4RKEA 3R3JA 4JI7B 1LI7A 2FN3A 4IICA 5I8PA 2D1QA 3ETJA 1FTWA 3MTQA 1ZJ6A 3R9XB 4OHOA 3JYHA 4WDQA 1MQAA 5CH3A 1TJYA 4IIJF 2XT6A 2PD3A 3UAZA 2OGTA 5JO0A 4TV8A 2Y66A 4KH1A 4MK4A 3R5SA 3ZWQA 4AQYB 2ETVA 2H4WA 3HY3A 4YR7A 4LZJA 4KAJA 1MAHA 1P81A 2QPOA 3MCVA 4FMPA 4YYZA 1PQYA 3UQYS 3T1TA 3E18A 2VAWA 4JLJA 4YUWA 1FS6A 1ARZA 1GKYA 2A3RA 3N76A 3U39A 3CA8A 3DAOA 1JU4A 3I6ZA 3W04A 4PYOA 4OU4A 2EARA 1ODSA 2WHPB 4UNQA 1SQGA 2CYAA 2FPSA 5JCPA 4PLWA 3THOA 4QYSA 1E1LA 2FMFA 5K3OA 2WNIA 3QVTA 1F2TB 3MWDA 3QEJA 4HAOA 1N4DA 1VG0B 2W6ZA 3A31A 4PIMA 5TR9A 4FE7A 3AESA 3QELB 5IAGA 3N8HA 4CQLB 4W1QA 5JRZA 2C98A 1QJCA 1PEDA 4D02A 5DNVA 4DJEC 1L3IA 1Y8RB 4NPHA 1OLXB 2Q3FA 5I7EA 3V34A 4I0WB 3ZEAA 3FPKA 5JR3A 1ADBA 2BGLA 1KFKB 1TU3A 1NATA 1WMAA 2MYTA 2XAUA 3P2JA 4MLPA 5GJBA 4QGBA 1VJDA 1P18A 3NVDA 1UUFA 4AD8A 1T43A 4FLFA 4BXOA 1CR1A 3H86A 2DHCA 4IYJA 4RXMA 2IOHA 3HM2A 4UE3S 3SXUA 1R4NB 2WWWA 3AY7A 2VNAA 3DZDA 4YPFA 5H59A 4CG1A 4DLNA 1YDWA 1G3RA 1ZJJA 2OE2A 3C45A 3GMDA 1W73A 3UAOA 1NHGA 1JR3A 2FN4A 4LS3A 3RSHA 3UC5A 4W9MC 1GP2A 2RHMA 1QANA 1BVUA 1XTRA 2EERA 4HZIA 5JD4A 2JDID 4N3CA 1C2TA 2R8PA 3DE4X 1FUYB 4BBZA 5IF3A 5HF8A 4PFSA 2O1WA 3QFCA 3RFVA 1T6ZA 3MJCA 4WXMA 1WR8A 2QL5A 4GGMX 2D2EA 1NNEA 1KERA 2FUKA 4XASA 5A5FA 1BE0A 1Z2EA 3L84A 2XUJA 3KB6A 5ESXA 4JP5A 1X7WB 1A9PA 5EEHA 4G24A 1JA0A 2EKBA 2Z2IA 3O03A 2G08A 4KWHA 3ZI0A 4CMAA 1B0PA 1LVUA 1P5HA 1VE6A 2QOEA 1ECJA 3AHHA 3BM5A 3P9SA 1CJSA 3TTWA 3MAGA 1F3OA 1CEYA 2CJWB 3NC1C 5AW4A 4ZALA 4KXMA 1I5OA 4XWTA 4MPDA 2RHCA 1XKLA 1PKXA 4KACA 4ZAZA 5BNIA 1U8FO 1NC1A 3OKAA 4GQBA 4JITA 4CGYA 3TI9A 2FY8A 3IB3A 4TMFA 3MBOA 4X6LA 1BAPA 3KLMX 1T8YA 1F3LA 4MHSA 4ZT4A 4BVBA 3DC7A 2F8SA 4PO9A 5T8KA 1M0WA 2CJFA 4RVCA 3WLEA 1KP2A 3NH9A 2A57A 1PL8A 2P6PA 3P7MA 2I2DA 2FZLA 2ZCVA 1L5VA 3WGLA 2Q7OE 3C5CA 1M0TA 1GA1A 5KOIA 4DL9A 5BQOA 5E1OA 2O4CA 2AKAB 2JH9A 1CQJA 1Y9DA 3LU1A 2BF4A 3IHLA 3N58A 4FBMA 4QRDA 5G53C 3WKAA 4K40A 2VLBA 4IJWA 2WMYA 1TYZA 4R1TA 2VQSA 1XRMA 1G41A 1ZSVA 1QYDA 2QN9A 2OK7A 3ITKA 1TCUA 2P1DA 3M1LA 3YASA 2Q8QA 3SDSA 3FPBA 3UUGA 3R7FA 5M29A 1GQQA 1PHPA 2XHZA 3F8SA 4HSEA 5B3KA 1YF3A 1JRLA 3K2QA 3SZ3A 1AX9A 4BQNA 1XF9A 2BEJA 1KU6A 1Z4OA 3BFVA 4MVXA 3BL5A 3KOMA 4W8OA 3GBSA 1KTIA 4ZRMA 4AULA 1EFUA 3COYA 3ZWMA 1JQLB 2HBQA 1R6TA 1MB0A 1CCWA 1FX0A 1ZJYA 4YP7A 5AUPB 2G70A 3ETGA 4BL5A 3FA2A 2MSDB 4BFLA 4XWKA 2PKCA 1D04A 1XEAA 1YKFA 3HWSA 4GIBA 3GLFB 1YZKA 5TRTA 2H0RA 1ZD4A 4RAOA 3FNFA 4TYQA 3EW9A 5LP6F 2XE4A 2IU0A 4KR6A 4I50F 1J5XA 1LK5A 5A6SA 2VPQA 3PFNA 1FBNA 5HMLA 4MKFA 4FUQA 2VI5A 3UJDA 2XF8A 4OBBA 5ALNA 3ZHOA 2MYNA 3QTLA 1IZ0A 2M6RA 4NG4A 2GFIA 4L07A 5K03A 2CNBA 5E3IA 5DT9A 4OSEA 4RLSA 5FUWA 1Y3CE 2YINC 3BWBA 5KI6A 1LPMA 5DI9A 1FMTA 3CWQA 3V32A 2IU6A 4P08A 2PV0A 1BN7A 3R09A 3WWCA 2GF2A 3JYLA 5L45A 1M54A 4MLZA 4HAVA 4JOBA 5KX5A 1G38A 4MDFA 2H9AA 4DYHA 3QKUA 3PF9A 1HPLA 2I67A 2ZBVA