2VABA

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1994-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vabA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2vabA01
2HFEB 4X4MA 4DQOH 3PXJA 3RKDD 2CXGA 1PX3A 3IU4L 3WE6A 3PL6D 1UKTA 1I8KA 5CEZL 1A1NB 1NGYA 5GGVL 2KQMA 2JJWA 1IGYB 3ARBC 1I1RA 2DQIL 4PJIF 1R3LA 4YFEA 3FB8A 3LKSB 3BQUC 4KRPC 4NCC2 1V3MA 2V7NB 5KJRH 1YEIH 5FF6A 1MFDL 3T2OA 4QHNB 1QSZA 1YC7A 1YNLH 4NQXA 5IV2A 1Y18A 4U0RB 5D7IF 4XPTH 1BQUA 3D85D 1RJYB 5DJZB 4PJCF 2K7PA 3QT2A 4Q6IB 2J4WH 4YK4C 3PGCA 3MRIB 5DSCA 4OGAC 5I1IL 5HDQL 2GITB 3MV7E 4RNRB 4MHHG 4P5MA 3UJJH 1JGDB 3HI5H 5B38B 2H32A 4I0PD 3U48A 1CICC 5TF1H 3QPQC 4LLDA 2VAJA 1R5IA 1GC1H 4TUKH 2HJKB 2ZNWA 5D1XA 4E5XA 5HYJD 3FMGL 1DN0A 2L7UA 3QEGH 3T0VA 4AYFA 1EUTA 1X6NA 1S9VA 4NRYA 1A7RL 2AEQL 4HX1B 1EO8L 1SJHB 3K3QA 3IB4A 3MV8E 4ZUUA 5K9QI 2ORBL 2VJXA 2QKIB 3BWAB 4HGWB 4JRYE 1K6QL 3EOBB 4IRSC 2ESVD 3WDHA 3VRIA 2IEPA 3GMRA 4GUPB 4R4ND 3X3GH 5FGRA 1OD7A 1BD2E 4TNVF 3VXSB 4LSSH 1JPGB 3C5ZB 4X99B 3F7RA 4Y4FB 5C0BE 4Y16B 4M48H 3E1F1 4XNXL 4JG0L 3EHBD 4HF5H 3ZL4L 2QADD 4HC1A 4ZYKB 3B9KD 2NZ9D 3EFDH 4ZTPH 1NSNL 2HVJB 3MRLA 3AMKA 2J8OA 4OIIL 1TTFA 5BVPH 3LMJL 1CR9H 2R23A 5LCVH 3KJ6H 1T80A 3U7WH 1A6WH 1SBBA 2FHBA 2E8ZA 5JIKA 5ID1A 2EC8A 4PG9A 1J88A 3GBLA 4DGIL 3TESA 2I07B 1FH5H 3H9SB 1YMMB 2LU3A 2DQUH 4XP5H 5I8EB 4PRBA 3VGDA 1ZV5A 3TNMB 2D0GA 2WMPA 4PJBF 4GAJH 4X83A 1ORSA 4LCWB 2IADA 4MA3B 3LKPA 3LIZL 2Q8AL 1BFOA 5H94B 4OB5L 5I66B 3O3BB 3OXRB 3IDMA 1PG7X 4M00A 3C8KB 1QOKA 3U82B 2Q86B 5IEKB 2D7MA 4JY5L 2J2ZA 4MX7B 3BKJH 2ATKB 4K7PH 1BEYL 2Q3ZA 3I2CL 1I7UB 2HLFD 2O5XH 4NZRL 5E4IA 4YC2B 3I75A 4HZLB 5F7UA 4HGMA 1JF6A 1QNZL 4UBDC 3TP4A 3W2DL 2VZSA 2UUDH 2NY7L 2V7HA 5FO7A 4JY6B 1KG0A 2CLVA 5EO0B 5EO1A 5D1XD 3VFGH 4LRIA 1J86A 3U30B 3VFNA 1IAIL 4XP1L 4TSAL 2YD8A 2XZCH 3QI9C 1OP5K 5HY9B 3T0EA 3H3KA 1NAMH 1ZA6B 4OZFH 3L5IA 5IG7B 4WW1B 3GIZH 3RY5A 4X6BA 3DJ9A 3LKNB 1FFNB 5EBWB 1BOGA 2NY2C 3FQWB 4XMKH 1DLFH 1OWWA 1PYWA 4LSVL 4P2QD 4KZDH 4NGHH 4PGDA 3HG1B 3PWNA 3LN5B 3B2VL 1JGEB 4G3YH 2C3HA 4U6VH 4Y5VA 3T77A 4YDIL 4EIZC 2ZG3A 1SM3H 1QO3B 4FQ2L 2BVQB 4RWYL 2QR0A 1YNTB 3KXFA 3V5HA 3AS0A 1SEQH 2XN9E 1NMCC 3AM8A 4LNVA 1NGPL 3TBYB 1CF8L 1BVKB 4MYWB 1IKFL 1A7OH 5F6IC 1OT2A 3DMMB 1G84A 2VZ1A 3FN9A 2AK4A 4Y5XA 1G0DA 4XCFH 3TA3B 1IRAY 3FRPG 1IGMH 3LPGA 4LIQL 4F7CA 1KELH 5IVXE 2PYEA 2VUYA 3GI8H 4F7EB 3PWUB 4QWWC 3KNBB 3FFCD 4EBQH 4PJHE 4HGKC 4MGXA 3W9DA 4XNUH 5B8CC 1A6TB 2MPAL 5L2JA 2P49B 1HSAB 3KPTA 1UENA 1N26A 2BCKB 1LK3L 4PLNC 4O02H 2GSIA 1OP9A 5IK3B 2Z4QB 1IL1A 4HV8B 2OJZH 1XF3A 4GXUM 5E2VH 4LRNH 2DQDH 4HWZA 1YN6B 5DJ8A 4KGJA 3S34L 1WBXB 4M6OH 2AGJH 2XRAH 5F7NC 3VWJB 4X4YB 4OFDA 3GSUB 2DQGH 1NLDL 5F3HB 2FATL 4GMTL 1ZT7A 2L0DA 3VGGA 1LEIA 1K8IB 5BZDB 3KPMA 4TVPE 1R24A 4WU5A 5T1MA 2BSRB 3T3MF 2NY0D 1OM3L 3HKFA 2BRRH 4NP4H 4XAKD 5K59E 4KVNL 1BBDL 2FSEB 2OM5A 2X9YA 2AABL 4DZ8A 3CFBB 5JPNB 1LO5A 1UXWB 5GZNC 3IFNL 4ODBD 4M7LL 3SJVA 3VXPA 4JFQA 1UACH 4B41A 1SYVA 4GW5B 1UM4H 4LPWA 3SDXE 4QXGL 1DQQA 4OZ4B 5K9KB 2R0KH 3LD8B 5I1KH 3T0ED 4M7JL 1RURH 2D7PA 2C7UB 4G6ML 4KROB 1WBZA 3TVMB 4AH2A 5GHWL 2Y72A 3L5WB 4EI5D 3FN3A 4L4TE 3BUYA 4GRWF 5MP6L 4N5EC 1D5ZA 4GMSH 1QFOA 5FO9A 5JOFA 4LP4A 4ZTOH 3TPKA 2DAVA 4NKMA 4OKDA 4OLWH 1JI1A 1YPZE 3HRZA 1IZKA 5AWNL 4FQQB 1XF5B 2A1WH 4MMXC 4M8QB 4KXZI 1RMFH 1Q0XL 2WUBL 3RAJL 2DB8A 3KXFD 1N59B 4L1HA 2D2OA 4RISL 3ETBF 2D3VA 5CIPB 2BY3A 5C07E 1P84K 4MXQC 4LSPH 2AK4D 4OCMC 1MCWM 2O93L 3QG6A 2NX5E 5FGBC 4LHJB 3ARRA 4RBPH 2V17H 2PYED 1I7RA 1F4HA 1U8JB 3SE9H 1QEWB 1ETZA 1CLZH 1NFIA 4QRQA 4ZNEE 2XKUA 3QULA 2R8SL 4PREB 5DFTA 3AREC 3L7EA 5FKAB 2AJZB 4O2FA 3FJTA 4MQTB 1JZ3A 5SWSA 1FHGA 4I18B 1NCBH 4I48B 3IGAB 1JI2A 3KR3L 4MS8A 1DLHA 1MQ8A 5DJ2B 3RNKA 4WI6A 3QDMB 4KI5F 3V0VB 1J0HA 1T7XA 1YC8A 5DT1L 3CSYA 3SE3A 2AQ1A 2VXTL 3RWJB 3BDYH 2N1KA 2H8PB 2AJXL 1G9MH 3OSKA 4NBZB 3VDCA 1Z0MA 3O41B 1ZMYA 3DRTA 1XF4B 4KRMB 4ISVB 1IM3B 1MQKL 4OD2B 5EOTB 5C0EB 3BRDA 4HPYH 5HI5C 4G7YL 3BIKB 1LQVA 3T4AA 2OJEA 3FT4B 4G8FA 3P9MB 3QP3A 3SJVD 1NUGA 3H7BB 2G60L 2VLKB 5IROC 1RY7B 2Y7QB 1JV5A 2EICA 3ZTNH 2MQ0A 4YEEA 1DSFL 1VESA 5CILH 1ZVYA 1N5AB 4AIZB 3P0GB 4DGVL 5KVFH 3NCEB 3DX6B 1YN7A 1IILE 1JPFA 2P7TB 2QSTA 6CGTA 4L4VE 2BHUA 3UPAA 2MMXA 3GRWA 4YO0A 4JVUA 5C0CA 1T3FA 2NLJB 4MAYA 4K23H 4NSKB 1LO4L 1C16B 1FGNH 4UNVA 4L9LC 1MFCH 4H1LG 1NFDF 1NEZG 4G43B 1CXKA 3UDWA 1KBGH 2FJFA 2OK0L 5ESQA 4M1CC 1F8TL 3B83A 1DQTA 3L3DA 1A8JH 4EQ3A 4MNGB 4YHPB 5C0ND 4RMQA 3N1MC 1GGTA 1OAUL 1XFPA 4HBCL 3D3VA 2DMBA 2W0PA 3ZT7A 4QTHB 2H32H 1CFNB 4RMUA 3UTTA 3SOBL 3TCXA 4JZOB 1OTUC 1CGSL 2MOVA 1NCNA 5FGCE 1G9NC 4PLJD 4YHOH 4LLMA 1ZLUK 4JM4H 25C8L 1E6JH 2Y36L 1IGIH 5SWSD 4JDZB 2X9XA 1X5LA 3BJLA 1CFSB 4IOFC 4D0CA 3OHXB 4MS8D 4M61B 4OCRL 3PJSA 4KKLD 2PW1B 1U3YA 2VKXA 3QUYB 1NH6A 3UCRA 1CVSC 1XCQB 3TBSB 3JV0A 4F3FB 4ZPTB 4XH2A 4R4FH 5F88B 5CP7B 3A67L 2IG2H 2HFFA 4XVTH 5IW6A 3J8F7 3ILQD 1FAIH 4XVSH 4OZGE 2JJVA 3IDYB 4LCWE 5L9DH 5IP4A 4NNXB 3QWOB 3JTTA 2Y1VA 5EU6E 3P4MA 1XF2B 1DDHA 3UYPA 4NQVB 2KPNA 5DJ6B 4HG4J 3MLVH 3SDAB 1VGKB 2HWZH 2R1WA 3RVWD 5C7XL 1M71A 2GHWB 2FH8A 4CMHB 4NQEE 1S9XB 1MY5A 3GSWA 1O0VA 5A2LH 2EDTA 2GFBA 3IJYB 4J3VA 4EVNB 3Q1SH 4KMTH 3QG7L 2WV3A 3CFCL 3UX9B 2XWJB 1X7QA 5FK9B 4JREC 1HXMA 5C0CD 4YXLH 5CS7A 1U3HC 3RVXD 3S35H 3IKCB 5KANG 1UJ3A 3MLUL 4F58H 4P57B 1TITA 3NMEA 4Q0XH 1UB6A 1QR1A 2QQKL 3TO2A 3E6FB 1HI6B 4ZFZB 4P2OC 1K3ZA 1BBJA 2EH7L 2IGFH 5F7EH 2YUZA 4HDIB 1N6QL 1R3KA 1KEMH 1TETL 3QHTC 5D71H 3D3VD 3QBTB 1WFNA 1FPTL 3TBVB 5I76A 3NGBB 3UTTD 3FFDB 4HH9B 5DQJA 3NN8A 2A38A 5H35A 5DYOB 3RVUC 1F3RB 1PEZA 2FH6A 4OFPA 4OI7A 2RFXB 5IGXH 2QSQA 4WEBH 5DF0A 2CKBH 5J12C 4NC1E 3K2MC 5D4QA 5KJRL 1BQHB 3O9WC 1NBZA 1YEIL 4X7TB 3RDTA 5IB5A 1MLBB 4FQXC 4XCYB 2LU7A 5D6DC 1YNLL 5CEYB 1GAFH 1A22B 1UZ8A 1WCQA 1RUQL 2CDEB 5H2BB 4MA1C 1A6AA 4Y5YC 5AD0A 1OD9A 2J4WL 2DICA 4PJ5A 4EUPH 5C9KA 1NAMB 2R0LH 5GGTH 2FHFA 4OZFB 3TN0C 5ABDE 3FT2A 2YEZB 2YD3A 3UJJL 3IDJB 5ESAA 1QSFA 3BI9X 4FZEH 4GLRI 3HI5L 2LE9A 3O3EB 1CBVH 1JF1B 3DI2B 4KV5F 1C5BL 2G5BB 3G6JA 5AAMA 3N0PB 1GC1L 4X4ZA 4TUKL 3QDJE 5I1HL 3EW3B 1MY7A 2GTZB 4ODXA 4QRPB 3BPOB 3OPZH 2X9WA 3QEGL 4JVPA 1X4XA 3MJ7B 2V2WA 1U8LB 1DANT 2W60B 5HBBA 3NIGE 3IF1B 1NCWL 3C8DA 1WBYB 3ARBB 3D0LB 4UV7H 2Z8WC 3DROA 5MENA 1HQ4A 4C59B 3IDNA 5F9OH 3QRGH 3TPUB 3WNNA 3QWRA 4OCWL 5L0QB 4GSDL 4JM2F 5BZWB 2RJMA 3WN5A 3FRUB 2WW8A 1HSBA 1QSEE 1RIUH 1YJDL 5TH2A 4LAQL 3TIEB 2ZWLT 3X3GL 4LDEB 4LPCA 1AD9A 1YMHA 3CDYA 3AGVA 1JZ7A 4APQB 1HH9B 1CDYA 4M48L 2LU4A 3QDHA 5GSVA 4ZTPL 5HHNA 3FT3A 5BQ7A 5BVPL 3ES6A 4JPVL 3NFSL 5F1NB 1CR9L 2UZIH 5LCVL 3KJ6L 3U7WL 1VKXB 3D18A 1WF5A 5IBUG 1J05A 4LCCA 4LLVB 5IB1A 4L3EE 2NMSA 5DMYA 3L7FA 4IOIB 1YEHH 2AKRB 4HW6A 1ZWIA 2R2BB 4KUZH 3X12A 1FH5L 4FQCH 2DQUL 4XP5L 3DETC 1Y0LA 3S7GA 1LNUB 1OAYL 3RDTD 2H9GB 4GAJL 4OM1H 4LLYA 5I1AA 4HUNB 5ADPL 3G04A 3HE6A 1FZJB 5EBLB 4J1UB 2DTMH 1I7TA 5E8PA 3FRPA 4D9QD 4R7DA 4IRSB 2PXYA 1PLGH 1U0QA 1AR1C 1M7DB 1HQRA 3BZEB 1F42A 5LVEA 4PJ5D 4CNIA 5C0AE 4U1LB 2UWEA 5EU3B 1EGJA 3BKJL 3JWNC 1KCGC 4DOHE 4PP1C 4RFNB 1UCTA 3HNVH 3MMEA 3OAZH 1QSFD 3JVGC 3N1GC 4X6DB 3QQ3A 1XF1A 2YRZA 2EDWA 4BK5A 4YFLI 2CSPA 1Z2KA 1F90H 4NM4H 5HYQA 3NA4A 1CE6B 2AQ3A 2BNRB 5IMLB 1IGCH 5KVEH 3JWOC 3N06B 4Y2DC 4JKPH 4ZOBA 4F33B 4CVXA 3RU8L 2XZCL 4M43H 1P4IL 4DEPB 3HC3L 4NIKB 5MEND 3FOMB 4HD9A 1NAML 3PNWA 3MRPA 3QWRD 2IANB 3VFSB 3PWLA 2VISA 5I1EH 5E2JA 5C8JA 1P1ZB 3GIZL 5C0IA 5HI4C 3ZZ1A 1OPGH 2XQYG 5I1CL 1UWEH 4XMKL 1MCWW 4EN3C 2GCYA 2E9BA 1UT9A 2IPKA 4XPHL 4KZDL 4NGHL 1TVBA 4NQDE 1NDGA 4RGNB 3N9GH 1INDH 4G3YL 5AG8A 4U6VL 5DFWH 5GS2D 4U49A 2YK1H 1SM3L 5IMMA 4CMMA 4JFFB 4OLZL 4JZJC 1QSVA 1SEQL 3MRCA 4KMQA 3FTGB 4GT7A 4PY7B 1G6VK 2ID5A 4LLAA 5DMJB 3EJZC 1A7OL 1NJ9A 4V2CB 2VDKH 1RIHH 2C3XA 4U3CA 2WBJA 3QCTH 4XCFL 5HHVH 1IGML 1A47A 3DV6B 4AIXA 2YPLE 1KELL 1NUFA 4R3SA 4XC3H 5C0GA 1S7UB 1ZLVK 3D9AH 3NA9H 3CDCA 4EBQL 1ADQA 4JAMA 4PRPE 4XNUL 4YHKH 5ANME 1FNSH 2F53E 1MRCH 1KTDA 3HE6D 4N0UE 3KYKL 2OJZL 1J8HB 3SE4C 1KULA 3LKOA 4PLOB 2YOCA 4Z7VF 4LRNL 2DQDL 2PXYD 5ICYA 1BFTA 4AEIH 4EI6B 5IFJB 4CBPA 2ZJSL 1IAOA 1N6VA 2BX5A 2AGJL 2XRAL 4MQXC 4J3OC 2CK2A 3UZQA 5LJYH 2DD8H 1I1FB 2DQGL 1WVZA 1GJIA 3MXWH 2NQCA 3DRQA 4D94A 4HFWB 1JL8A 2ICWJ 4Z7NE 7FABH 4XNYH 5EWIH 1EBPA 3QXVA 3Q6FA 3RGVA 5HGHB 2BRRL 1V3LA 4NP4L 3IS0X 1F4XL 3VA6A 5HSFA 4N0CA 2HT4C 5F6IB 3L3IB 4GRLD 1T89A 3E8UH 1OP5H 3VFTA 3NFNA 4OFKA 2FD6H 4OUOA 5KG9B 1HKLH 5JPMB 1UACL 3MRDB 1UM4L 1HEZB 1YYMH 3OJVC 3MBEB 1PJ9A 2R0KL 2HRPH 2E6JA 1K8DA 5I1KL 5D2LE 1RURL 2E7LA 3ZO0A 1MUJA 4JFYA 2A2QT 2DKUA 4RMTA 1B90A 1MCJA 1MWAH 4OGZA 1PZUB 4GMSL 1KB9J 4AJ0A 4ZTOL 1S5IH 4KJYA 5EB9A 5DJAA 4WUKH 2XTLA 3VXUB 3H9HA 1LK2B 2VLRB 4OLWL 3B9DA 1T83C 5I6XC 5L8JB 1KYOK 1ZT4B 3TWCH 4LGSB 3CSBA 4Z7UB 1RMFL 2B20A 4AENA 5CZXC 2CR6A 3KPNA 1J8KA 4FFYH 1CFBA 5BRZA 2FGWL 1J1OL 3MXVH 1U8QB 2M8XA 4P9HC 4BSWA 3VFPB 4LSPL 3OX8B 4HJJL 2C1OB 2WBJD 5E1AB 1UM5L 4OQ1A 1BQLL 1RZ8B 2V17L 4X0KA 5JLZB 3BDXA 4H1LA 1NPUA 2GT9A 1NEZA 2WM0A 4LSQH 4P2QB 5EC1A 5J89A 3H42H 3ZSTA 1G0YR 2X4TA 3SO3B 2OP4L 3B43A 4PJ8C 3FQUB 1ZHNA 4XI5D 3VGFA 3W82A 2EDQA 2X4RB 5L7XH 1TZIB 3CX2A 4Y4KA 2R23B 1SBSH 5E94B 4Z7QE 3CD4A 2V9TA 1EV2E 3MA7A 2NY1C 5ID1B 1QRKA 4EQ2A 2H26A 3FFCB 4WW2A 1OHQA 2FYYA 1E4WL 3I3BA 4K94C 1G9ML 4NN7B 2IAMC 1KIQA 2QQQA 1YJDC 3RGVD 4DJMA 5ISZA 4NFCA 3SBWC 3QUXB 2VITB 4N0CD 2CJUH 5IM7A 1E0OB 4HPYL 5MEQA 1KT2A 4BM7A 4QY8A 4HWBH 4H88H 4PJGE 5D2NA 2X4NB 3HI1B 3IFOB 1M7IB 5F1IB 1GGUA 4P23C 3SGDI 2X4QA 5DWUH 2X7LB 1HHKA 1QR4A 5I1GH 3FB7A 3VFVB 2FRGP 5KVFL 1A02N 1CZ8H 4TRPH 5I8CA 3EOAA 2NY0B 1SY6A 4LL9A 3F58L 3VXMB 5HD8D 3MRJB 4LFHG 5IFAL 4K23L 2J3SA 1IC7H 1K5NA 4XCNA 2CQVA 1FGNL 4K71C 1A4JA 3C5JA 3UJIL 4HKZA 1AJ7L 5D72H 2CKBB 5M7QA 4K9EH 5EFIB 5ETUA 1KBGL 2AXFB 5E9DA 5D8JH 4RDQG 1UKQA 5BRZD 1FYHB 5DI8B 4Z78B 1Z0NA 5GRYA 1JFQH 2GJZA 4PRNA 5BS0E 3LDBB 4JHBA 4V1DA 3TT1H 3GHEH 4JJ5B 4MNQE 2ZUYA 4EI5B 5F97E 3RUGA 3G6DH 4ODSH 5HGBB 2X1QA 4HS3B 5J1SC 5ERWA 1AGFB 5I74B 3SN6N 1LEGA 1OP3K 4EUPB 2ADIA 3HLAB 4U6HB 4YHOL 5ALCH 4PRIB 4JM4L 5SWZB 3V4UL 5KVGH 1IGIL 4JPKH 1YEKL 2APWA 4HUXB 4ZDHB 4HWEH 3MRBB 4Y4KD 3EOTH 2COQA 4NC0B 2ARWA 4AEFA 2AK4B 1F3DJ 1DR9A 3Q0HA 3X13B 3B9VA 1IBGH 1LO2L 2OL3A 4NQSA 1WSST 3UTQA 3MUY1 2A6DB 4Z7OE 2GAZB 4JRXB 2OMBA 1UFUA 2FECI 1BIHA 5ITFB 2OI9A 2YUXA 3GFUA 2YD7A 3CCHA 1D9KC 1FAIL 2H3NA 2NXYC 3FONB 4GKZA 5J8OA 5EOCL 1K85A 3T3PE 4RAVA 4MDIB 5ISZD 2A73A 5T5NG 4JM2C 4S1DD 2NW3A 4PRHA 2XFXB 4JQIH 5EU7C 2QQLH 5L9DL 1NGXB 4PJEA 3RX8A 1WQVT 2OTWA 4E41E 3RPIB 4HC1L 4KQ4H 5FYKE 5AUMB 2VDQH 3TJHA 1FZKB 3MLVL 1JWSB 4H0GA 4ETQB 4QGYA 4DUVA 1OGTA 1FL3B 2HWZL 2WWMC 1X3DA 1RI8A 5C09E 2AI0H 4JFHD 4TULH 3ZE0E 3ROLB 4XNQA 1FG2A 4JFEA 5K9OB 3R4DA 2AP2A 2X41A 3QJHB 2XTJC 4P4KA 5ACMA 4QHUB 2BC4A 1UADC 4F7TB 5DRWA 3P11H 4YXLL 5AEAA 4KJWD 3S35L 1KXTB 4FQIH 4X8JA 3BEVA 3SJVB 1PBYA 3VE0B 4ENED 4D9RD 1W72A 5E9DD 5A16A 1T66D 4ZUSA 4PP2A 3PWPE 3S3SA 2F19H 1KGCD 2WP3T 1HCVA 5FM8A 4V1DD 5F7EL 2FX9H 1KEML 1C5CH 5D71L 3HUJA 1ZLUH 3HI6H 1E4XI 4BELD 3SDDC 4K8RH 4K7FA 1E27B 4OT1L 4OF5A 5SV3A 5A2IH 4UNTA 1PKOA 1G7IB 4I4WA 4OZHE 1H8OA 5ADOH 4KDTA 1P2CB 2NY6C 3DIFB 5IGXL 2XNAA 4WEBL 3VXRA 4U1HB 2GJ6A 3C09C 3O2WH 3BYYA 4UV4H 2AV7B 1VSCA 4O58H 4L29B 1GAFL 3QRFM 4BA8A 4NBXB 1KLGA 3EYOB 4HKXB 1W0WA 3RKDC 4LKCB 3PL6C 1IAMA 1PZ5B 9CGTA 3ZE1F 2VDOH 1YQ2A 2AERT 3QULB 3E0GA 3GI9H 1T7WA 1I1AB 2R0LL 3RY6C 5I75B 4P2OB 4PRHD 1CN4A 3HR5B 3V0WH 3AFLA 5HHQA 5J9PA 4O9HH 1FYTA 3HAEA 1F11A 4OM0H 1XGYH 4FZEL 3QEQB 3D2UA 3TJHD 2PW2B 5A40E 1XGRB 5F7LB 3C60A 3KPPA 3MLSH 3RI5F 3HPJB 3MREB 1LDPH 3OB8A 5TDNA 4HUMB 4JFED 3NCMA 3TEUA 1GOHA 2QLVB 4WUUA 4X9BA 3B5GA 1HINH 1JNJA 4OBRA 3K81A 4P4KD 4U1MB 4DVBB 4UV7L 4W70A 5FFLA 2CO6B 1DBKH 4MQ7B 4OLYH 2FIKB 3QDGB 4I0PC 5F9OL 3QRGL 5FA3B 4QHMA 4U1GB 4U33A 5CSBA 5DA4A 3TGXA 4Q9RH 4YBQD 5DEFA 3RRQA 4FQXB 3NIDF 1EEUA 4OF6A 1RIUL 4KHTH 4OCSH 4XCCL 2IPTH 1T20A 4U7MA 4FQJH 4WENB 1TZHB 4G8GE 3S5LG 4Y5YB 1UCBH 4RA0C 1YY8B 4F9LA 1A7BA 1U58A 4J7RA 1EEZB 2WANA 4X6EB 5EUKA 1MCBA 1IMHC 2PKDA 1QA9B 4UT7H 1JPSH 3LH2H 5EZOH 1OGAB 4DVRH 4MXWL 1U8IB 1OCWH 4R4NC 3ULSB 1I8MA 4DAGH 1TLKA 1EX0A 1X5GA 5E00A 3MV9E 5IJKA 4FFEX 1YEHL 3SKMA 4JE4B 5TF0A 3DURB 5CSZB 3EHBC 4Y19B 3VXRD 3WLWD 2QADC 3B9KC 1KENH 2NZ9C 3LSOB 1QFWI 2FHCA 2GJ6D 3OJMB 4F2MA 5HI3D 1Z5LA 4OM1L 5CZVH 1H5BC 3H2WA 4ELME 3PQYE 4LSDA 3RHWF 3B2UC 5D7LB 1KB5H 1PLGL 3MJ9A 3MRFA 4MA7H 3QFDA 2AJ3A 5HHOE 1F97A 1JWUA 2C1PB 2LQRA 3ZYIA 2BNQB 1P7KA 3MR9A 1FYTD 4EXPX 2Q76B 4CN4A 3V6OA 1MWAB 1YEEH 2X1OA 1IARB 3D2UD 3BP7A 3C60D 4P2RB 4K2UH 4Z9KB 1YUHA 5EOQL 4PV9A 1VADB 3K8MA 4G42A 1F90L 4NM4L 5DC4B 3QUZB 1MCCA 3ALXA 5KVEL 1N5YH 3UBXG 3QIUC 3PGDA 5CZKA 4WO4B 3OG6B 4CW1B 3WXVH 4JKPL 4WUUD 2IBZX 2YN3A 3QUKB 2HLFC 4IMKA 4M43L 3D25B 1U8PB 3HRPA 3BXNA 3MRHB 3WFEH 4WGWB 1D7FA 3U4EB 5I1EL 1NAKH 3T65B 1OPGL 5GS1A 4GRMA 5D1XC 2BMKA 4GBXA 1EBAA 1UWEL 5E8OA 2F74B 3MRNB 1U36A 2EYTA 1M71B 4D9LL 2A9NH 3N9GL 1INDL 2EKJA 2VDPH 2YK1L 3QQ9D 2ZOLA 1HILA 3X3FH 3BH8A 1WAAE 2A77L 2AAVA 1I85A 4OZIA 3AUVA 4XVUD 4PTUB 2VDKL 3QCTL 4OIBA 3AY4A 4XC3L 1LHZA 1WWCA 2FO4A 3GJEA 3NA9L 2APTA 3KYMB 4YHZH 4NN6B 1A6ZA 2I26N 3RA7H 4YHKL 3DTXB 4WFED 5KOVC 1FNSL 4JG1H 4ODUA 2ZUQC 4E0RB 1VGEH 3MV01 4GQ9H 3ME0A 4U6XB 5CAYB 3DUSA 1MF2H 1UQSA 3K2UL 5F9AC 4R9HA 4NDMB 5C08B 3CIQA 4AEIL 1CD1B 1B0RA 1AQKL 3QO1A 3F5WB 4PJ9A 1ULVA 1AGDB 2H1PH 1LP9E 2BOBB 2VNCA 1MJJB 1PG7W 4PJAB 3HMXA 4XNZC 4ZUWB 2VSDA 7FABL 4XNYL 5EWIL 5ESVB 4HKJA 1EFQA 3EO1B 5I2IB 1JWMA 3KLHD 1WIOA 3ROOB 4N0FA 4FFZL 4Q74A 5SV4A 3E8UL 3T0XA 5DQ9A 4S1RH 4ZO8A 4M7ZC 2WINA 4I1NB 5I17B 5JZ7C 3WIHA 2PF6A 2FD6L 5J1AB 3GSQB 1HKLL 4KXZH 2EC9T 5K93A 1YYML 3P4NA 3OGCA 4PJIE 4GXUN 1S7QA 4UZGA 5CGMA 3CDGB 3DXAA 3REWA 1TJGH 1XR8A 3GB7B 5D7IE 1S7WB 3I6GA 4X5WA 4R90H 1KLUB 5A2KH 4GG6B 5C2BH 3QQ4B 5FKPA 2A83A 4L9DA 4PJCE 4GBXD 4LRIC 1S5IL 3R8BB 2DLIA 2JB5L 4AT6A 3TWCL 2OL3H 3F12B 4KY1H 2RQ8A 3T0EC 3I6KA 4NO5A 4PJ7A 4FFYL 3CH1A 3MXVL 2P8MB 3P4OA 1B3JA 4P99A 4OCXL 1ZLVH 3IDNB 3H7LA 3MODH 3JBG7 5DURB 5F6HI 1IT9H 2BK8A 3UTSB 4N8CH 5TH2B 4X6CA 4DN4L 1DUZB 4FXGB 4KFZC 4Y5VC 3G6JF 2NY5L 4JFDA 1AD9B 4KKBD 5KN5B 3LQAH 3BP5B 5B38G 3X11B 4YDVA 3NVQA 3TBWA 3FO1B 4XBEH 1GL4B 2F8OA 3AM8C 5IEHA 4MD0A 3UROR 2B1HH 2VLLB 3AROA 3OR7B 5FHAH 3VRLF 5GSVB 4Y5XC 1KJVA 3O4LB 5E6IC 5IW3A 5C0JA 5L7XL 2GJJA 3ULUH 2ZCKH 1SBSL 4M9OA 4YDLB 4PJ9D 4UTBH 5DD3L 3MO1A 1F3JA 5JHDA 1DFBH 5C0RH 4XRCA 5IB1B 2VZOA 3VCLA 3RNQB 2FBOJ 1XH3A 1NC4B 3O6LH 3QIBA 4P2CG 3KPRA 5J6HA 2NY4D 2CJUL 4YHNB 4I9WD 4LIQE 2AXJA 1XAUA 1KPUB 4QO1A 1F4YH 4H88L 3WDIA 5E8DH 3D48R 1RJZA 3L1OH 3CMOH 4MD5B 3MRRA 5FB8A 4JLRA 5ENWA 3VH8B 3QNYA 2EYSA 2UWEB 1GZPA 5EIVA 4MJIB 3SCMA 5D6CB 3QH3B 4PJBE 3DXAD 1NL0H 3A6CL 5I1GL 4HWUA 1CZ8L 5ICZA 1MI5B 1XIWD 3W39B 4N9OB 3VWKC 3OKNA 4LMQE 5TDPA 4XBPA 4GRLB 5ID0A 1IC7L 4LLUA 4WFHD 3GIVB 1FNLA 2NY1B 4K9EL 4YIQA 3BIAX 3E2HB 5D8JL 1HNFA 1MH5B 1LDSA 2VERN 5KAQG 5KSBA 1JFQL 3WS3B 1PW3A 1NMBL 1WK0A 4HMEA 4LFHD 3HAEH 3EDDA 3MV7A 2NY3D 4EDXA 5J57B 3G6DL 4ODSL 3WNPA 4JFDD 2GCYB 1EJ6A 5IBTH 3FN0H 5JW3H 4Y7MA 1JHTA 4L8CB 4Z7WA 3MCLL 2BVPA 1PKQA 5ALCL 4C56A 3GSNA 5EOCJ 3P0VH 3CLEH 5D5MA 3BZFA 1ODAA 1QRNB 3ARDA 3CH8A 5IF0B 3VD3A 5C0NC 1MIMH 2WBWB 3ULVD 1NJ9B 3EOTL 4J3WA 1ZHKB 4X5XB 1XGUA 3AU1A 5GJSH 5JHDD 5TDOB 4F9PA 1IBGL 3QFJB 4AY0A 1MEXH 4ZQKB 2DMKA 3CNKA 4PLJC 4K71B 4QRRE 4RWHA 4Z77A 5C9JB 1P4LB 4ACPA 4RMRA 1LD9B 2VLME 5GRVK 5HJ3A 3DHJA 3WSQH 4MS8C 3QIBD 3KPRD 1H0DA 2HMID 2HN7A 2OCFD 2QQLL 2ZCLH 3MOBH 1JIBA 3GZKA 3O8XB 2OQJB 3WV0A 4PJFB 3RWFA 4KQ4L 2J6EA 2E7MA 12E8H 2VDQL 4KKAD 2K1MA 4U6YB 3SE3C 5IR1A 5ILTH 4NT6B 4YXKH 5J0BA 2VQ1A 5JDSA 3GNMH 4RMSA 2AI0L 1TCRA 1H9VA 5GISH 3GMMB 3SCMD 5IMKB 3PDGA 4FNLH 3RZCB 3VXTA 2ADFL 2DJ4A 1TMCB 1QVOA 1ZGLP 4NHUE 5IB2A 1V8HA 3P11L 1QLRB 3MACH 4KTDH 1S9YA 5KS9B 1WISA 4FQIL 3PWJA 3RVWC 2Z93B 5HYFA 1WCBB 1OTTD 3ZKXB 3F7YB 1IQDA 4R96B 2IBBA 2M2DA 5FOJA 2P8LA 1QPPA 2AXGA 1A3LH 1KFAH 3BPNB 3GKWH 2F5BH 4WIQA 3T3ME 2F19L 4QHKI 1CGUA 1CGVA 2NXYB 4M4PA 4F7PB 1EGJL 2Q87A 3A6BH 4QNPF 1OP3H 1N2RA 1F00I 2FX9L 5KVDL 3NCYP 4X80H 1KB5B 4W4OC 3MV7D 4MAYC 3RVXC 3U0WH 3HI6L 5F3BB 2HVKA 5EO9A 3ESVF 5HHXL 4P5KA 5DHYB 3TCLB 3UDWC 2B39A 4C83A 3S5LA 5ADOL 5ITBH 4YBLB 5DD6B 3S4SA 4PRAA 3LEVL 4NPYA 4C56D 3GMOA 4Y8DC 4OAWA 4ERSH 1NGZA 3CJJA 4UDTB 2XIDA 3IXAA 3K4AA 3ARDD 1RJCA 1XGPA 3BW9A 4ODTH 1KPRB 2YPVH 4GRWE 3S96A 3O2WL 4GLRH 1MOEA 4JN2A 4UV4L 4O58L 5B22A 3QJFB 2IH3B 3O3UN 4X7CC 1HWHB 4IIQA 2YUVA 3MRMB 4QOKA 3C6LB 2VDOL 3QIWB 2VIRA 4XVJH 1UB5B 3U7YH 1FBIH 4PJXA 2HT3D 2LVCA 4O9HL 2R15A 4G7VH 1JZ2A 1EHXA 1T04B 1AHWA 4MNHA 4QRTB 5L6YH 4OM0L 2VYRE 1XGYL 4MAUH 3UC0H 4ZFGH 3AS2A 2J1KA 2CGRH 3MLSL 4LVHB 4R26L 2ARJA 3ALWA 4LCUA 2VQTA 5EBGA 2VXUH 2FX8H 1LDPL 1U3JA 2R56H 3MA7B 3MLYH 5FYLD 1AO7E 2DOCA 3FQRA 5GZOD 1U8KA 1CGTA 5KSAA 5HHME 4WWKA 2JCCA 4XPFH 1HINL 1Q72H 3O4OB 3EO9H 1AIFA 1OF2A 3WHXA 3PWVB 5HGDB 3VGEA 5FUCC 4HIHB 1E6OH 3GMQB 5I1DA 4AL8H 1FLRH 5DJYB 3STZA 4KI5E 1PSKH 4PB0H 4X7SH 3N1FC 2YZ1A 2R9HD 3UBXA 4KHTL 1LQSR 3S98A 3HC4L 3G5VA 4OCSL 3FB5B 1ZLSH 2EEDA 4G9FB 3P0YH 3OR6A 5IB3A 3THML 4KJQC 2FL5A 1UCBL 2QQNH 4PJDB 2YWYA 3RWGB 4LF3A 4WW2F 3DARA 5ACZB 3VFOB 3KJ4B 1AI1H 4RCAA 3O3AA 1W0VB 5C3TA 4UT7L 1LO3L 2FX7H 1FE8H 3LH2L 5EZOL 1HXYA 5AYQA 3ECBA 3W0WB 4YR6A 1OVZA 4DVRL 3F7VA 1UJ3C 4GW4B 1OCWL 3HB3D 4GO6B 2YXFA 3VD9A 3ERYA 1U8OB 4XCNB 4DZBA 4FP8L 5HPOA 4ORGA 2ZG1A 1ZVHA 4EKXA 5JW4M 1QZ1A 4HS8H 1KENL 4WI2A 1KJMA 3QPXH 3TYGH 5CZVL 4RQQA 4NO2B 4N8VB 5EUOB 1UVQB 4RFEA 1KB5L 1WT5C 5JMRA 3GGWA 4JY4B 2W1NA 4I3RH 4QOKD 3T0WA 2N4IA 2FWOA 4WNQB 3RZWA 1NFDE 3PE9A 2W65A 3P77A 4HHAA 2V2TA 4Y1AB 2ED9A 1I1YB 3DVGB 3NCBB 3C6SA 4H25A 4HUWB 1M7XA 4WU7B 2IBGA 1CDJA 1ND0B 4S2SB 3RDTC 3L9RB 1VFAB 1B0GB 2WZPD 1HNGA 1Q94B 1UYWH 3SGKA 1HZHH 5HGAA 2VO5A 4JO1H 4K2UL 4UAOC 4JANA 1LEKB 3RUGF 5T3ZD 3KDMA 3GJFA 3B5HA 3ALPA 2OL3B 3PABA 1N5YL 2P8PA 5F9JB 4G8IB 5KSAD 1IC1A 5CEZD 4WWKD 3KYOB 4HPOH 3WXVL 4RZCA 4QYOB 3PHOA 5DD0H 5E0QA 2DLGA 4X9FA 5JA8B 5B3JF 1IC4H 4H20H 3OKOA 5FDWA 4I2XE 4MJ2A 2SEBA 3IRPX 4MSWB 5L2KB 1YEGH 2FEEI 4LSTL 2D31A 5HYIA 2DBJA 2XZQH 2VDPL 3O2VL 2HFEA 4UTAL 3ZDZF 3B8SA 2EDYA 4U3HA 1A1NA 3X3FL 1WEJH 1N64H 1JTPA 3VA2C 1IGYA 4U0QB 3K80A 1MHHB 2XI9A 4PJEF 5DRWB 3LKSA 4DGYH 5EZJB 2V7NA 2E3VA 1FVEB 4KPHH 4QHNA 3T1FB 4WV1B 1RJYA 3V6FB 3QIUB 5DJZA 4YHZL 3CU7A 4L5FH 3RA7L 5KBNC 2VDMH 1ZLWK 4HJ0D 4JG1L 4LVNC 4PP8C 3MRIA 3VFRB 4GQ9L 1MF2L 2OTUB 3ARTA 4LCCC 3HE7C 4RNRA 4WDIB 3WL9B 4HS6A 4GS7C 4HK3N 3LVEA 4G59A 4J8RB 3EYFB 3CPLB 1VHPA 2PUQT 1U93B 1JGDA 3HMWH 5B38A 1X5IA 1T2QH 2ZOKB 3DYOA 2H1PL 2O5YH 5D96C 2C26A 3C8HA 3RVVD 3R0NA 4XTRD 2HJKA 5FYJE 3VXRB 2K7QA 4A2MA 2ICCA 1MJ7L 3HE6C 4TN9A 4OV6F 4HX1A 1SJHA 2F54B 2BHZA 3HUJF 4HGWA 2QKIA 4FXLA 1H3VA 3JZ7A 1O7VA 1U8MB 2DF3A 3EOBA 5T1LB 4L3CB 4KK9D 1CLYH 4CDHA 4GUPA 1A4KB 1G9EA 4JDTL 1FSKB 3VXSA 5I73B 4NQCE 1JPGA 3C5ZA 4S1SH 4X99A 1ES0A 2E27L 4Y4FA 4Y16A 1TJGL 3QA3A 4ZOEA 1JPTL 3F7QA 4R90L 1VPOH 1TQBB 5C2BL 3KPPB 4ZYKA 2HVJA 1U8NB 1MCFA 3OAUH 2PTTB 1KTLB 2PYFB 1A1MB 2BHYA 1CQYA 1JNNH 3BKML 2OL3L 1S7XB 4OF8A 2DQCH 3F8UB 1KPVB 3BP4B 5HDOA 2I07A 1A7QH 1EH9A 3H9SA 1YMMA 1CS6A 1Z9LA 4YGVB 1SVZA 5I8EA 3SDCB 1BQSA 3MGAA 2ERJC 3AAZB 3MODL 4P2YA 5TQ0H 4KV5E 3RIFF 3GMPB 2JJUA 5F9WB 4LCWA 1RFDH 4N8CL 2XWTB 1KN4L 1UWXK 1WWAX 3IJHB 1LO0H 2LAGB 4BKLB 4D3CL 4QKXB 4MA3A 3LQAL 1FL5B 5H94A 1M6OB 5I66A 2C9AA 4XBEL 3O3BA 3OXRA 3EDEA 4XHQA 3C8KA 2B1HL 2Q86A 5IEKA 5HTSA 1ROWA 1F6FB 5FHAL 3U9PH 4BUGA 3MOAL 4MX7A 2DQTH 2WBJC 2ATKA 5EU7E 4GJTB 1G7QB 3QWQB 1D5XB 5DTFB 1I7UA 5I15H 4HZLA 1BF8A 3IJSB 1DFBL 4LPVA 5C0RL 1T7ZA 4F8TA 5EPMB 4P9MH 3FKUS 4JY6A 2DBLH 4HIEB 5EO0A 2EE3A 1F13A 4G6KH 1I3RB 3P2TA 1XGTB 4FTVB 4XI5C 3O6LL 1Q9OB 1BFVH 2I9LB 3IKKA 4X9GA 4TPRH 2GI7A 2XTJE 2OZ4H 5HY9A 1ZA6A 3P9LB 4XPBL 1MFNA 4MJ5B 1JN6B 4BFGA 3IDUA 3FQXA 1JCKA 1N0LA 3SO5A 3JTSB 3VJ6B 5IG7A 4WW1A 1EFXB 2PO6B 3L1OL 3CMOL 1FFNA 3LKNA 5EBWA 2AJ3B 3I50H 1ZHLB 4ZPVB 1RZKH 3VXSD 3RGVC 1MIEH 3C5ZD 3LN5A 4OGYL 1F6AB 1JGEA 1NL0L 3VD4A 4Y4FD 4Y16D 4R7NB 1IEBB 3HZVB 1QO3A 2BVQA 1T89C 1YNTA 5GXBB 3VG0L 5LGKA 3OKMB 3MLTB 3CX5J 5EZLB 3TBYA 1BVKA 3L3OB 3MZGB 3EZJB 3DMMA 1UM6H 1U41A 4U1NB 3TA3A 2E7LC 2Q7YA 1PQZB 5D7JC 3S36H 5C0FB 3MV11 4F7EA 3SY0A 3PWUA 3KNBA 4JGUA 3UYRH 3H9SD 1YMMD 4L8SB 1A6TA 4JR9L 4M5YL 3IAGC 2WIIB 4Y4HB 1I4FB 1HSAA 5HD8C 4GW1B 2BCKA 4LCWD 5BOPA 4LDLB 5IK3A 2Z4QA 4HV8A 4MB5A 3M1BB 4Q6YA 5CINH 2G2RB 5CP3A 1YN6A 5IBTL 3ZKMD 4R0LC 1WBXA 2J8UB 3DVFA 1H3PH 3VWJA 4X4YA 1HILB 3P0VL 5FXCH 2X89A 3GSUA 5F3HA 4TNWK 3W11D 3WEXB 3CFEB 1A9EB 5E56A 1K8IA 5BZDA 3MLRH 3ARFB 3U0TA 2YBRB 2H45A 3D39B 2X09A 2BSRA 3ELAT 1MFAL 2X40A 3KWWB 2XXCB 5J56B 2CLZB 2FSEA 1MEXL 2QSCL 3WKML 5JA9A 1BJ1J 3CFBA 4PFEA 5JPNA 1GCFA 1UXWA 2VLJB 2F9BT 1FV1A 1GHFH 2BOCB 4GW5A 1R3JA 3WSQL 4ODUB 4OZ4A 5K9KA 4Y4KC 1QHOA 4PG2A 3C9NB 3RL2B 2ZCLL 3MOBL 4OZIF 2C7UA 1OAXH 2EEBA 3TVMA 4DFHA 12E8L 5JR1L 4TVPH 3INUH 3LRGA 5DUBA 3L5WA 4JO3H 3WFCH 5DHXB 2EIBA 5ILTL 4WW2C 4MQSB 2HA1A 4YXKL 4UINH 4CU7A 3GNML 2P47B 5HYJE 1BX2B 2IBZY 4R2GB 1FVDB 4FNLL 3T0BA 4S1DC 1KTKE 4FQQA 4M8QA 2VL4A 3SQOH 1P6AB 4Z7VE 1TVDA 1N59A 1ZVSB 5IKCB 4OQTA 3TH3T 3A0OA 4U1JB 4YNYB 5D2NC 4B53A 1E4XH 2ESVE 5CIPA 3FQNB 1C08B 3MACL 1INQB 4KTDL 5T1DH 2MNUA 3DMMD 1OOAA 1OB1B 1TXKA 2EZ0C 2P5EB 2N56A 2R2EB 3NPSC 3TA3D 1CE1H 2R2CA 3DVNB 5IFHH 1REIA 1A3LL 1KFAL 1U8JA 4U2ZA 1RVFH 4I0KA 1CLOH 1N0XH 5J3HD 1QEWA 5F8QC 3RIAK 4OV5B 5LGJB 3ZKND 4PREA 2EYRB 2BY1A 4X80L 4KJWC 2AJZA 4F37K 4ZUVB 1XIWB 4KI1A 5DR5H 3U0WL 2EXYD 4I18A 4I48A 3IGAA 1MPAH 4ZS7H 4X4ME 4ENEC 2FGZA 2DYPB 2VDRL 3HFML 5DJ2A 5ITBL 3QDMA 1ZANH 2E7HA 3V0VA 3VWJD 1IE5A 2X89D 4NO5B 3CH1B 1Q9LB 3RWJA 1G7JB 3D1MC 2LFGA 4ODTL 4K7PX 2YPVL 2H8PA 3SKUD 2DDQH 1FGVL 3O41A 1XF4A 2HJLB 2NYYD 4ISVA 3WFZA 1H3XA 1IM3A 2F15A 1JNHB 1TQCB 4N0YH 4OD2A 4R97B 5EOTA 4CADB 3BIKA 5IB4B 3DO3A 3FT4A 3QXAB 5HHPB 3P9MA 4XVJL 3H7BA 3U7YL 2EKSB 2VLKA 2X6MA 3Q48A 4PJ7F 4O5LH 3HNSH 2Y7QA 4M6NH 5C6TL 4KKCD 4NC1C 3G5ZB 4G7VL 2LABA 3FO9B 3NCCB 1N5AA 5L6YL 4KROD 5MEOB 3TVMD 2QV2A 5I71C 4MAUL 3UC0L 3DX6A 4ZFGL 2MCG1 2CGRL 3FB6B 3R1GL 2P7TA 1MCPL 4X6CF 2OI9C 1JMZA 2VXUL 2FX8L 1QKZH 2R56L 3V5DB 3ZE2F 1I8IB 2NLJA 3VCLB 4NSKA 5J06A 4RDQF 2DMCA 3EYSH 2FB4L 2WSKA 1P4BH 2J5LC 3BP6B 1A64A 2WWKO 1JHKH 3EO9L 4G43A 1ZT1B 3B6SB 4WTWA 2OYPA 4AL8L 4PB0L 1FORH 3ULVF 5IOPB 1SEBB 5DMKB 3I6LD 5IW1B 4MNGA 4YHPA 1ZLSL 1BLNB 3RTQC 1QBML 5T3XD 1XMWA 5ENWB 2YD5A 1OSPH 4YX2H 4QTHA 2QQNL 3CZJA 3BVNB 1CFNA 5DUML 4LASL 4JZOA 1QFWH 1AI1L 2V6HA 4NN5C 3RBSA 1WTGT 4LHUB 2OSLB 4KWUA 3ILPB 3HMXL 4ZSOE 1FC1A 2FX7L 2E7BA 4ZXBB 4JDZA 4NZUH 1CFSA 1HOCB 3OHXA 1S7TA 4M61A 2HP4A 5E6ZA 4D0BB 5ID0B 3O0RH 4PGJA 2PW1A 3QDMD 1XCQA 4I3SL 4HAGA 3TBSA 5CD3B 4F3FA 4ZPTA 3JSSA 5E7BA 2H6PB 2AEIT 2GUOB 4LMQI 4HS8L 5CP7A 5F88A 2H2SD 5T5NF 1HH6B 1EEYB 2BY0A 3WNLA 1MRFH 3C2SA 5LWYH 3QPXL 3TYGL 4XNMB 2ADGB 2ZSWB 1NDMB 4J4PA 4BFBD 4QRSB 4KDTC 4NNXA 3QWOA 4I3RL 2XZAL 1XF2A 3DYMA 2KDGA 4HQQH 3RX7A 3AB0B 3GO1L 1RIVH 2GTWB 4NQVA 5DJ6A 2X2YA 1I3GH 3SDAA 1RJLB 1MCDA 1MFBH 1VGKA 5A1AA 3PP3K 3WLWC 3L3JB 2VLKD 4K3DH 1EVUA 3MFGB 5HI3C 4TTDD 1U2HA 3T04D 1S9XA 5J13C 5KSBF 3V95A 1UYWL 2ICWI 4POYA 1S5HB 3IJYA 4QHLB 4XAKE 1QFHA 4EVNA 4JQVA 3MV8B 4JO1L 2GQHA 3I02B 4JRYB 2XWJA 5FK9A 3BD4A 2O26U 2I5YH 3CGTA 1PX4A 2ICES 3IKCA 5FHBH 1E28B 4XX1E 4Z7WF 3AC0A 4P57A 1KJ2H 1BD2B 5FDYA 3SPVB 3T0EE 1GGYA 4EUPG 2MQCA 5D5MF 1HI6A 4ZFZA 5C0BB 3C60C 4FQHB 1IC4L 4H20L 4X6FB 1U42A 4ZUTB 5L8KB 1IC5L 4R8WH 3OG4B 3W5MA 4HDIA 1YEGL 5SWQA 3ULVL 3GSXB 3WD5H 2JJTC 2XZQL 4FXKB 4PB9H 5CJQH 2M26A 3TBVA 3WLBB 3FFDA 3FO0H 4HH9A 5GRXG 3KXFE 1A6UL 5DYOA 4HLZH 1WIPA 1WEJL 3NFPB 4HXBH 1N64L 2RFXA 3NCYS 1KCRH 2GKIA 1S7RB 4DGYL 4XWGH 5CHNB 4OF3A 1BQHA 4R6UA 4X7TA 1MCNA 4UAOB 3ARGC 3O6KL 1MLBA 2JF1A 3JV5A 3PWJB 3DX9B 2PYEE 4OF0A 4OJFH 4XCYA 5CEYA 4F9LC 5L88H 4PUBL 1N8ZB 2BNUA 4HXAH 3NABH 3QQ9C 1CDHA 2CDEA 3QEHB 5H2BA 2IFGA 3BT2H 1U91B 4X4XB 4YE4H 5F21B 2VDML 2KZWA 1CGYA 1FFOB 4ONFH 4QXWA 4MVBA 3DUUB 1T0PB 4MJ4A 1NAMA 1NKOA 4XVUC 5FM5M 4J4PD 4OZFA 3EGSB 4H26B 3UPRB 5IJKC 2YEZA 4WTXA 1GIGH 1S3KH 3IDJA 5EULV 3EKCA 4XWOD 2X4UB 3HMWL 8CGTA 4ESKA 4HUKB 3SDAD 3O3EA 3R06B 3WCYA 4NPYB 2G5BA 1HHHB 4F57H 2W9LA 5DS8B 2GTZA 4QRPA 1Y6MR 3BOVA 4HG4K 4NWUH 3MJ7A 1U8LA 4XXCA 5E2WH 2W60A 5C0DB 1T7YA 3IF1A 1WBYA 3ARBA 3D0LA 3WUWB 5MI0C 1U9KA 4ONGL 2OR8A 5BZWA 3FRUA 5D93C 1CLYL 5CP3H 3TIEA 1J9CT 4IRZH 2C4FU 1EAPB 4APQA 1IAIM 1HH9A 4WCYH 1BREA 2Y6SD 3KLHC 2XN9B 3E6HB 1VPOL 1MFEH 2EE6A 2ED8A 3BPLC 3ZE1E 4KAQH 3HE7B 1P7QB 3WJLA 4YAQB 4KKNA 3OAUL 1FZOB 5F1NA 1DE4B 5D7KE 1KXVC 4ZAKC 3RL1B 1GYAA 1DBMH 1JNNL 3CZFB 1CGXA 1NC2B 1VKXA 3BN3B 4IMKC 4LLVA 5DZLA 2IC2A 4TOYH 5I9QB 5IVXB 2DQCL 4IOIA 2AKRA 4PJXF 4PJHB 1VCAA 1CFQA 2R2BA 1A7QL 4YHIB 43C9B 1H3TA 4KJPD 4RIRB 1CGWA 1ZXQA 3LHPH 1EJOL 5GS1C 1GRWA 4AQ1B 3TBTB 3S37H 4GBXC 4U31A 4WHYH 1LNUA 5TQ0L 2NTSP 2H9GA 5IVNA 2VN4A 4YEFA 1TPXC 1RFDL 4LARH 1ZLWH 2G9HB 2J6EL 2APBA 2R2HB 1CXLA 1FZJA 1VFMA 5EBLA 4J1UA 3GMLB 1OTSD 4IRSA 3U36B 1V3KA 2HT2D 1UKSA 3MUZ1 2FO1A 1CDBA 1M7DA 5JHLH 3BZEA 1I85C 2JCCF 5SWSE 4MVBD 1JE6A 4ONOA 4U1LA 5HVGB 5EU3A 5CUSH 3U9PL 2DQTL 1I9JH 4H8WC 4G8EB 3NIDE 5SX4H 5DMGD 5JUEH 4JB9L 3AY4C 5I15L 5JTWA 3MZTA 4KKBC 6FABH 1H15B 3NIFF 3B9EA 2R69L 3TNNB 4NQTA 4NJ9H 1CE6A 1UZ6F 2BNRA 5IMLA 1TZGH 2DBLL 5I18H 4Q58C 3EOYG 2APFA 4KQ3H 4QRPD 1NKRA 2FJHB 4NO3B 4G6KL 3SDXB 5C92A 2BY2A 4F33A 1BFVL 2UYLA 4U6TA 3ARBD 2OZ4L 3D87B 3FOMA 5J6GB 5JXAH 2IANA 3VFSA 4L4TB 2HJFB 2YMXH 2ZNXA 4ZFFB 3S35X 1P1ZA 4U1IB 3V4PL 5ECJE 3I50L 4IRJB 3KS0J 1VDGA 3BGFB 5E7FA 1R3HB 1YPZB 4APQD 5DEGB 3HCVA 3RWIB 5CD5D 5BO1H 2VABB 3BAEH 3QYCA 4JFFA 4P4RA 5C07B 5C0CE 3FTGA 4DK3A 1T6WA 4PY7A 3EZ8A 3PIQB 2DLHA 1UM6L 4YPGB 1WC7B 2AQ2A 2NX5B 1YQVH 4ZNCD 4FHBD 3DV6A 4OLXH 3S36L 1S7UA 5DHVH 3MCKB 3UYRL 3A6OA 3L5HA 3VGAC 2YRLA 4XAWH 3D3VE 2SEBB 4LP5A 3AVEA 2XACC 5IJVB 1J8HA 3UTTE 2F5AH 4IRSD 3VGHA 3JV6B 4EI6A 5IFJA 3QQNA 3OAYK 2FECL 1T0NB 3VDAA 1GPOH 1ITCA 2YC1B 3QNZB 4NKDB 2R4RL 3KYAA 1H3PL 2X1WL 1BM3H 1I1FA 2XY2A 2IQAB 1ZKAA 3W9EB 1JGVH 4HFWA 2NY3C 3MLRL 2VAAB 4YHLH 2R4SH 1VACB 5HGHA 3OKDB 4PGEB 4XZUB 3WFDH 3VXOB 3L3IA 2BNRD 4P49A 4LVOC 1O5DT 3G08B 5A3IC 3O11B 1CDIA 2HG5B 3MROB 3ZTJH 5KG9A 1GHFL 5JPMA 3MRDA 1CI5A 3JWDC 1HEZA 4MLSA 5IHUH 1CXHA 1TVHB 4GAGH 3MBEA 1FVCB 1BGXL 4XGZB 2VDLL 5BW7C 2B4CH 5FUCE 2IAND 3NH7L 3VG9C 2VR9A 1AE6H 4HS6B 4UB0H 4TVPL 2JB6B 3DBXB 3INUL 1GZQB 3CFDB 3QCVH 4TNVK 3WFCL 4L4VB 1MJ8L 3UTZB 3DYPA 4UINL 3UAJD 3FO2B 3SGEH 4WHDA 1Q0YH 1FIEA 3VXUA 3QIBC 1LK2A 2VLRA 2EDEA 4RGND 2YA0A 3OAZK 2HMIC 1JRHI 3JV4B 1ZT4A 4I5BB 4Z7UA 4JFFD 1K2DB 3F6IA 3QAZC 1EERB 1FRGH 2Y07L 2E8YA 4KKAC 1RZ7H 2QHRL 1D5BB 1E4XL 1U8QA 3CU1A 4DKDC 5T1DL 5DRXB 1QLFB 3VFPA 5I8OH 3PQYA 3OX8A 1A3QA 4MCZB 2C1OA 5E1AA 3SCMC 1CE1L 2XA8L 1JZ6A 5IFHL 1RZ8A 1RV6X 3M17B 3M45A 4RGMB 5JLZA 4PV8B 1CLOL 1N0XL 4HIJB 2X4OB 4P2QA 4Z8FH 3O3DB 1ES0B 5FGCB 1RZJH 4HULB 4MXVF 3QA3B 2KQNA 3T0DA 3TO4B 3OKYA 3FQUA 1RD6A 1L6XA 1VFBB 4N90E 1DANU 1J8HD 1QBBA 5HYSB 2X4RA 5CLWA 5BV7C 4H8WH 1K3IA 1TZIA 1BIIB 1UXSB 3RWHA 3L95B 5E94A 4N5EA 3OXSB 1T1YB 1ZANL 3BPCB 5I1LB 1CLCA 3FFCA 2X4PB 3V7MA 1IGTB 1B6UA 3OJDA 4IDJH 5SX5K 3V7AG 4OZGB 2DDQL 4D9QE 3J7HA 2WK2A 3QUXA 3SKJL 2VITA 5EU6B 3V6ZB 5D1QB 4K07A 5EN2B 3IRZA 4PJ5E 3IFPA 1KJ2B 3IFLH 3NPSB 1RK0B 2X4NA 3HI1A 3ARDC 4JGJA 2OMNA 3MBED 3IFOA 2CUMA 1GVIA 4NQEB 1M7IA 2FLBT 5F1IA 4M6NL 4WHTB 1G0XA 1QSFE 2X7LA 4YHYC 3VFVA 4F9PC 4JQXA 4H0IA 3G6JE 3O2DH 4EOWH 1JK8B 2RAMA 3LEXB 1WZMA 1QKZL 3VXMA 5GS0H 1H3GA 3MRJA 1HWGB 1JMXA 3WO3B 3F65A 3VXUD 1D6VH 2VLRD 3EYSL 3KPQB 1P4BL 1T1XB 3VW3H 2HT3C 5KAQF 3OKEA 3X14B 3VRLE 1JHKL 2CKBA 1KB9K 5EFIA 5MENE 2AXFA 3WIIH 3WKNA 5DI8A 4NHCH 4Z78A 4OCNC 1FORL 1RHHB 3PQYD 4FABH 4JJ5A 2VZVA 3FQXB 4EI5A 4LPXA 5GZOC 2E6PA 5TE6H 5TFSH 4MJ6B 5HGBA 4HS3A 1Q8MA 1OSPL 1DBJH 4YX2L 5IQ9B 3FHAA 1AGFA 1EK3A 2G75B 4EUPA 2NR6D 1TDQA 1QFWL 4JEGB 5DJXB 5GGTA 3QDAA 3HLAA 4U6HA 4PRIA 1MAML 5SWZA 2Z31B 4LQ1A 4HUXA 4ZDHA 1QBLH 2HFGH 2R9HC 4NRZB 1KCSH 3F6LA 3MRBA 5I71B 3C2AH 2WWKT 5ALBH 4NUJB 4N5ED 2IH1B 1DVFB 3X13A 2Q7YB 1WV7T 2A6DA 3SY0B 2GAZA 3MYJB 4JRXA 1MRFL 5LWYL 5ITFA 4M5ZL 3WUZA 5JNYB 2BSTB 3FONA 4MDIA 5E08H 4PLKD 3FQTB 4ZOAA 3QUXD 3CLFH 2XFXA 4UIMB 3Q6GH 1NGXA 5D7IA 3RPIA 4Z6AT 3O6FB 1EVTC 2C3GA 4HQQL 3QZWB 5AUMA 1RIVL 1T4KB 4MD4B 1L7TH 1FZKA 1JWSA 1I3GL 4ETQA 3RTQB 4XCEB 1MLCB 1FL3A 3QDJB 1HCFX 1RZGB 5GGUB 5FO8B 2DIJA 4CVZB 5IVZB 4OLVH 3ROLA 5K9OA 4Q7DA 4HIIB 4CKVX 3QUMH 3L3HB 3U0TB 4IIQC 3QJHA 5IESH 2P46B 5JW4N 3BH9B 3IDGB 1TTUA 2YD6A 4QHUA 3VXMD 4F7TA 2CPCA 4NOFA 3Q2CA 2BVYA 4P59H 3EBAA 1DUYB 2I5YL 2K9UA 1QSEB 5FYKH 4YFDB 1CU4H 1FV1B 2Z35B 3KLSA 3IS1X 3VE0A 4UU9B 1KJ2L 4HEPG 4L8DB 1R3JB 1AHWC 1QFUL 5DJDB 1SHMA 3GBMH 1QG3A 1UH4A 3MTRA 2HTKD 2MHAB 3ZDYF 5K9QG 4W4NA 4R8WL 5DUBB 3WD5L 5KSAC 1NCUA 4WWKC 2Z92B 4MZ3A 1E27A 4L1DA 4M1DH 4PB9L 2EH8H 1G7IA 4M4RA 3LN4B 2F8VA 4L3EB 4LLQB 3OKKB 1P2CA 2PCPB 2V5YA 4XB7A 3DIFA 4PRID 5SWZD 4HXBL 1S9WB 1RUMH 5TE7L 1TJHH 3L6FB 4DKFH 4XWGL 4HUVB 4U1HA 2B5IB 2D03H 2B8OT 1AXTH 1V3JA 2CLRB 4XC1H 3TF7A 2AV7A 1JHLH 3H0TB 2GK0B 1KCUH 4L29A 1II4E 1NGQH 3BGMB 3EYOA 3NABL 4HKXA 4HXAL 4LKCA 1PZ5A 5JW5A 4JRXD 4YE4L 1F2QA 1T0MA 5C0AB 1J11A 3K1KC 3G5YB 5FAAA 1I1AA 1DP0A 4MDJA 1MHPL 4PJBA 1J10A 4P2OA 3PP3H 4DOHB 3HR5A 4G5ZL 1K4DB 2HLAB 1GIGL 3MRQB 4HFUH 3QEQA 3SKOB 2Z8RA 2PW2A 1XGRA 2C4FT 4Q2ZB 1WICA 4MB3A 4Y88A 3MRGB 2EE9A 1JBJA 2D7QA 3HPJA 4F57L 3MREA 1S7VB 4HJ0C 4QNPE 5CBAB 5HVHB 3RWDB 4NWUL 1U6AL 3RY4A 5E2WL 4FMFA 4U1MA 4P46B 4DVBA 4MQ7A 4P5TB 2FIKA 2HYMA 3QDGA 1FFPB 5FA3A 5I19L 4O2EB 1WFOA 1R5WB 3ARGB 2E7CA 4FQXA 2YHGA 4NO0B 2H2PD 1T1ZB 5DHVB 4XTRC 3RVVC 5GRWA 4IRZL 3VMOA 1N6UA 3C87A 3SGKC 1A3RH 1ITBB 2E7LE 4NQDB 3FCTB 1TZHA 3HC0B 4Y5YA 1YY8A 4WCYL 1EEZA 4X6EA 4XP4L 1QA9A 1R3IH 1MREH 3IXTB 5DJCB 4N1CA 3BHBB 4LU5H 1OGAA 5DGQA 4KK9C 3LZFH 1U8IA 3ULSA 2ZP0T 3DSFH 4QRUB 1GH7A 5LGHH 1W0YT 2YPLB 3P9WB 4TOYL 1PFCA 5B39B 1U8HB 2ZKHL 3L5XH 3LCYA 1T03L 4PRPB 3DV4B 3DURA 2BP3A 2CIKB 4Y19A 5CSZA 5EU5B 3LHPL 2NNAA 4M93C 5ANMB 4IM8A 5FCSH 3LSOA 2FEDD 2CRMA 2F53B 3P3YA 4HK0B 1IGJB 4IJ3C 1JZ4A 1N4XH 4LAJH 4N0UB 5ELIA 3BESR 4A6YH 5CJBA 5D7LA 5MI0B 5FGSA 4LVEA 5FCUL 2BJMH 4KUCD 5DRZB 5JHLL 1URLA 2VN7A 4G6JH 3NACH 1HIMH 1I1AD 4K7PY 4N68A 2C1PA 2BNQA 4P2OD 5CUSL 4NKIH 5EDXA 4LPUA 4PD4J 3F62A 4BK4A 1JP5A 3QCUH 2Q76A 3IT8D 4U0RC 4OQTL 1S7TB 1MWAA 1MCIA 3QEQD 1I8LA 1B4RA 3RPKA 1QBAA 3V0AC 4P2RA 4K3EH 4TSCH 2P43B 1VADA 1MCRA 4NJ9L 4ZAKB 4Q6IC 3QUZA 5I18L 1B0WA 3MNZA 3K4DA 4KQ3L 3MA9H 4WFFD 4KRNA 2AEPL 4O4YH 5T3XL 4WO4A 5ISZE 1MCHA 2R1XA 4CW1A 2Q8BH 5D2LB 3QUKA 3D25A 1U8PA 4OI9A 3QDGD 5JXAL 2BXYA 5D2NE 3MRHA 5IQ7H 2DIAA 2EO1A 3UJTL 3U4EA 4FQXD 3T65A 2WP3O 3NCFB 4JFHE 35C8H 2F74A 2APVA 3MRNA 1UA6H 4J3TA 1A7PL 2FDBP 5BO1L 3BAEL 2DQIH 1XZ0B 5DD5L 2IALB 4CU6A 5D1ZB 5HDLA 1MFDH 1OGAD 1AGEB 3LB6D 1OQXA 4PTUA 4N8VG 4D9RE 2EDFA 1VENA 5E9DE 3C5ZC 3U4BL 4Y4FC 4Y16C 1KGCE 4Y19D 3GSVB 4V1DE 3KYMA 1T6VN 5HDQH 4NM8L 3O45B 2C4XA 3RUGE 3ARVA 3DTXA 3P40A 4E0RA 2AW2A 4U1SB 4U6XA 4X98B 1GGIL 4HWBA 5D7LD 5SWQB 4NDMA 5C08A 3TYFB 1A0QH 5CJ8A 1CD1A 3S3PA 2EDHA 1IJ9A 3F5WA 4V3DB 2DN7A 4DQOL 5B3JE 1AGDA 1ZHBB 1BM3L 1RUKH 2BOBA 3ARWA 5GGRB 2BNQD 3RFZC 1SJVA 2AEQH 2GY5A 5DVMA 1MJJA 1FQ9C 3LY6A 4PJAA 4YDJB 2NPLX 4ZUWA 1J0ZA 4K3HA 4YHLL 2R4SL 2EIDA 1K6QH 4CN6A 1NBVH 3LS5H 4P2RD 5ESVA 4RSVA 1ZAGA 2KZ1B 2E9IA 3EO1A 5I2IA 2JKXA 1A2YB 2A6IB 3ROOA 5E5RB 4XPTL 2BNUB 4OTXH 3QUZD 2RCSH 3ZDZE 4PJGB 3BJ91 3QISA 1MHCB 3SKNB 5I17A 5J1AA 1MHEB 4WO4D 3GSQA 1B4JH 3W11C 4PRHE 5IHUL 1T5XB 4I13B 4PJEE 2HTLD 3TV3H 3ZL4H 3VGAB 4YC2C 3CDGA 1D5IH 2B4CL 3DI3B 4UB0L 4OIIH 3QCVL 3GB7A 5F8RC 1S7WA 3Q5TA 3TFKC 2DS4A 1KLUA 5E4EB 4GG6A 3QQ4A 5TF1L 3IDXH 1VA9A 3BD3A 4JFEE 3U30C 1Q0YL 5DZOA 4G80B 1Z9OA 2NTFB 4DGIH 2LVEA 4YUEH 3F12A 2KH2B 4YZFF 2CR3A 3TZVC 1FRGL 2DKSA 4O51B 5EU4B 5IMOB 3H3BC 2P8MA 4FN0A 5BS0B 4PP1D 4Z76B 2MQ3A 2D7NA 3BQUB 4KRPB 1LGVA 4MNQB 5I8OL 3LIZH 1VEPA 2Q8AH 1NBQA 4F37F 3UTSA 1M05B 3TH2T 1DUZA 4FXGA 4XBGB 1B6DA 5KN5A 3BP5A 5E70A 4Z8FL 3X11A 3QXWA 4LSSL 1NANI 3VFUB 4U2YA 3FO1A 3IVKB 2X70A 3OBAA 5D7SH 4YK4B 3UTOA 1HHJB 3OAYH 5K33A 4CVUA 3HUJE 3WDJA 2VLLA 4HF5L 3VXQB 1TNNA 3DMMC 3OR7A 1G9NH 1BF2A 1QNZH 3EFDL 3KYNB 3T8XB 5C08D 2CXKA 3O4LA 3TA3C 4LCYB 3U9UB 5FIEA 5INDB 4CVWA 1A6WL 1CICB 3CFKB 3KVQA 3ZKNC 2AK1H 3PV7A 4TUJA 1CFQB 1T83A 3EO0B 3QUMB 2GJ6E 3RNQA 1AQDB 2VE6B 2DJSA 4IDJL 2EXYC 8FABB 4ZFOB 2Y5TB 4NFDA 1NC4A 3U46B 4U7KA 4E41B 3HAEG 4YHNA 4I2XA 4PBWD 1KPUA 3VXNB 2CUHA 4LSVH 2BZDA 2I27N 3ORJA 3IFLL 2NW2B 4LPTA 1EHNA 4MD5A 2FJGB 5C09B 3VH8A 1FYTE 4FQ2H 4RWYH 4UDUB 5FOBA 4MJIA 5D6CA 3QH3A 2NYYC 1B88A 4K7PL 3MUGB 2PNDA 2O5XL 1MCKA 3O2DL 1MI5A 1YEJH 4MB4A 3W39A 4KZEH 4KTEH 1S8DA 3LRSB 4GKOA 3EIFA 4ONHB 5GS0L 2EDLA 3DX7B 4LIQH 2F58H 1PEWA 4GRLA 4WUUE 3UPCA 3VW3L 4MCYB 4PG2C 4MQXD 3VFGL 3GIVA 3LD8C 4KKCC 2MPAH 3P30H 4N5UA 2W0FB 3EUUA 3TVMC 3E2HA 2UYLB 1MH5A 1U3ZA 3PWPB 4BH8B 4NHCL 3ZMRA 5CSGA 1LK3H 5F7FA 3WS3A 3I3EA 4ODVH 5DURD 1FN4B 1RAMA 3V5KB 3OL2A 3UTSD 4DFIA 1FFQA 4X6DF 5TFSL 4E9LA 4GFTB 4GKNB 1DBJL 4L3AA 4OZHB 1DLFL 1NLDH 1IEHA 3HCVB 4PY8J 4L8CA 4PPTA 1EA9C 4P4RB 4B7IA 5BVJB 1QBLL 4D0DB 1RK1B 2HFGL 1QRNA 5IF0A 3U0PB 1KCSL 2V5RA 3BMWA 3V52H 3O4LD 1CG9B 4KI5C 5B21A 3SGJA 1ZHKA 4X5XA 5ALBL 5SX5H 1G7PB 3IFNH 1YEFH 1KJ3H 4WVRA 5TDOA 3QFJA 3DOSA 3GI8L 3G6AB 4JFPB 4ZQKA 2J12B 4FFWD 4WFEE 2XKNB 5C9JA 1P4LA 2DQFA 4I18C 5IVOA 1J0YA 4XMPH 1LD9A 3MGTB 3V8CA 1NC4D 1I3UA 5E08L 2W38A 3QI9B 4O02L 1LVEA 4BUHA 4Z95H 2Y25A 3Q6GL 3O8XA 1IM9B 2OQJA 4O2CB 5E2VL 1VFOA 3ESUF 2XY1A 3BN9D 4PJFA 4QT5B 5L8LB 3FOLB 1HKFA 5F7DB 4U6YA 1MSPA 2H2SC 4M6OL 5AWNH 4NT6A 2NY2B 1DQJB 2DI8A 1O7SA 4EZMA 2WUBH 4OLVL 5DQDH 1C12A 3GMMA 4MJID 3V6OE 4RISH 1JTOA 5IMKA 3RZCA 3QUML 2NXZC 1DN2A 3GMNB 1MI5D 1TMCA 1NMCB 4ZFOL 1ZS8B 4K8RD 1R5VB 2FEEL 2AJSH 3RBGA 2Z91B 4CJ0A 1QLRA 1X9QA 5KS9A 5FYKL 4D2NA 2YD4A 2Z93A 1CU4L 1WCBA 4TTDC 3F7YA 1EEQA 2NY1D 4R96A 4G8GB 1OW0A 2VXSH 4HCRH 1TJIH 3GBML 3EYQD 1PDKA 5B8CB 3K1DA 2WUCH 4F7PA 1RU9H 4A6YB 5IUSA 1FAKT 3H9YA 1BFSA 4TSBH 3EFFB 2YA2A 2JLLA 1KB5A 2R0ZH 4OUUB 2CD0A 4G6FB 5F3BA 1FNHA 4HEME 3DLQR 4M1DL 2EH8L 2QL1A 1JPST 1T21B 2RB8A 5DHYA 3TCLA 3MV9B 3VI4F 2VXTH 4OIAA 4PIRF 5CLTA 3VFMB 5DD6A 2A1WL 2ICEB 3KPSB 4FZ8H 1RPQA 4UT6H 5GGSY 4UDTA 4OZIE 1RUML 2EC9U 4QXTB 1QRND 5T33H 4QEGA 4TTGA 1ZGLB 1KPRA 4MHHI 1AXTL 2A74B 2X42A 4ELMB 4B7LA 3PQYB 4RMWA 4XC1L 5CEXB 1JHLL 1VERA 2NZIA 1KCUL 3QJFA 2IH3A 3T4YB 2Y06H 3BE1H 3BKCH 1NGQL 3QFJD 1FJ1B 3MRMA 3C6LA 2YPKB 3SE9L 3DO7B 1CLZL 3QIWA 5HHOB 4JPWH 4CAGA 1UB5A 4M1GH 2N7AA 4Z7UF 3S9DB 3HZMB 4LSRH 5F1SA 1BZ9B 2ZSVB 2N7BA 5D9SB 1N3NB 5B4MC 3O8XD 3QUYC 1NCBL 1GC1C 1T04A 4QRTA 1BOYA 1ZA3B 4GRWH 3RQ3A 2MWCA 3RWHB 1LO4H 3SDDA 4GG8B 3PG2A 3QNXB 4IS6A 5F96H 4PGBB 1YEDB 3B3IB 3RZCD 1L8JA 4J4PC 3BDYL 3IDYC 3JWOH 3OF6A 3OJDB 4I9WE 5DUPH 4UMGA 3PWVA 5HGDA 5J1TC 4HIHA 3GMQA 3UXFA 5DJYA 3SDAC 4HBCH 3WFHA 2AJVH 1BHGA 4EEEA 3FZUD 3IFPB 3S97C 4CMHC 3FB5A 4FG6C 1CGSH 4G9FA 1A3RL 3MLPA 3LPWA 5HPMB 3DXAE 5C6WH 2FCBA 1A7NH 4JQVC 4PJDA 1IGFH 2CO7B 3RWGA 3ZTNL 5DRNB 2NXYD 5CILL 5ACZA 3VFOA 3AREB 3RY6A 1W0VA 1R3IL 1MREL 4LU5L 2QSVA 2O61B 3W0WA 5KZCB 4WFHE 2FR4A 3LZFL 3BISA 4GW4A 3DSFL 2OBGA 5LGHL 1U8OA 1L0QA 3A67H 4K3JH 4PJ7E 5A2FA 1G7LB 3OKEB 2WWMD 1MFCL 4FA8A 3L5XL 4P48A 2Y6SC 3KPOB 1A6PA 4ZO7A 3UZVB 5GGSB 3D0VB 5LQBH 1EHAA 4X6CE 5EC2B 3AXLB 2IPUK 4NO2A 1KEGH 4A6YL 3NGBC 4JFDE 4N8VA 1F3DH 3ZE2E 1AGBA 2EDXA 5EUOA 1UVQA 1LE5A 3LQZB 1G6RH 4JY4A 3C6LD 4WNQA 2BJML 1BVLB 3QIWD 4C55A 3CAFA 2YD1A 4OKVB 4RMVA 1LP9B 4KJPC 4Y1AA 4G6JL 1I1YA 3DVGA 2VL5A 3RWCB 2R39A 4X9HA 1HIML 4HUWA 5IWLA 4WU7A 2JIXB 1ND0A 4S2SA 2AJYH 2W9DH 1E6JL 2YR3A 1AY1H 1FNEB 3ULVE 3L9RA 4JCMA 1VFAA 2VXQH 1B0GA 3WMSA 3OKLA 4BSVB 4KU1A 3CFCH 3QCUL 1Q94A 3E3QA 5JHDE 1OTSC 3Q3GB 1QYGH 5JW4R 4TSCL 3WFBH 1LEKA 3SDDD 1MAKA 1G7HB 2EDOA 2YZ8A 5CGYD 2VR5A 3DNKA 4R4FL 3MA9L 5E8NB 5F9JA 4KHXH 4G8IA 2IG2L 2W9EH 3KYOA 4L9LB 1CTOA 3KPRE 4XVTL 3OF6D 4JDVB 3GHBH 4PJIB 2EH7H 4QYOA 2Q8BL 1IEAB 4XVSL 5DMGC 1F2XK 2MCPH 1FIGH 4Z5RB 1I75A 3BIBX 2IF7A 3ZYZA 3HR6A 4LHUG 5IQ7L 4FQ1H 1KXQE 2DM4A 5D7IB 3UTPE 4E42B 5AZEH 5JO5B 2MTPA 1NBYB 4MSWA 4PJCB 4M6MH 5BMFH 1HYRC 5L2KA 2A6KB 3BPOC 43CAB 35C8L 1EAJA 4G9FD 1PGRB 4XXCC 1UA6L 5DJ0B 1MCOH 5EZIH 3RWEB 3MLZH 1NEUA 1RZIB 5L0QC 3Q1SL 5M94B 4KMTL 3EJYD 4WTZG 3TM6A 3W0WD 1S78D 1MHHA 3LS4H 3M07A 5EZJA 4PBVC 1RUQH 4P9HH 1FVEA 4APQC 2I9TB 5JXEC 2Z8VC 3LOWA 5CD5C 4F58L 4XHJD 3T1FA 4WV1A 2EO9A 1X4YA 4Q0XL 5KSBE 3V6FA 1SJEB 2Y9RT 2VSCA 3QIUA 3HZKB 5FUOH 4TQEH 1C1EH 5HXMA 2YSSB 2IGFL 3WJLC 3SE8H 3VFRA 4DTGH 3GSRB 2ZPKH 5T5FH 2OTUA 3V6BR 3WIFB 4WY7H 1I7ZB 1A0QL 4WDIA 3WL9A 1C5BH 4XP6H 4J8RA 3EYFA 3LQMA 3CPLA 4Z7WE 1A6VH 2CDGB 1PKQE 1U93A 4UI2A 4C56E 4WI5A 3TH4T 3GSOB 5I1HH 4NJAH 4Y1AD 2ZOKA 3H8NA 5D5ME 4YDKH 1RUKL 2EIEA 1K4CA 4M6AA 1NCWH 3ZKQD 3DGGB 2CKBL 1HYSD 3RI5K 1AP2B 1V7MH 1PD6A 3CXHJ 2A6JB 1NBVL 4OCWH 4GSDH 1C5DB 3LS5L 4K94H 3LKQB 2F54A 3SQBA 1YJDH 4LAQH 4JREB 4OTXL 2RCSL 1U8MA 5T1LA 2VC2H 1U3HB 4L3CA 5CCKH 5JW5B 1JRHH 5AG9A 4XT1C 4JHWH 4QHKJ 1B4JL 2DWEB 1A4KA 1EO7A 3JUZA 1T0MB 4UQ2B 4RFNC 3TV3L 3MQIA 4MDJB 1G1CA 4PJBB 5FA4B 5GGTL 1D5IL 4POZD 5FYJH 4ZSOA 4HLJA 4JPVH 4LEOB 3NFSH 4ZODA 1YDPB 3B2UD 4C54A 5L2KD 1CBVL 1S7SB 5FYLE 3IDXL 1U8NA 2PTTA 1KTLA 2PYFA 1A1MA 3G5XB 4RFOH 4KUCF 1U95B 4YUEL 3OPZL 1S7XA 4DEPC 4Y89A 4JFOB 1F4AA 4RRPA 1OAYH 1KPVA 1G7MB 3BP4A 1HDMB 3ULUD 3T2NH 5J12B 5ADPH 1L7IH 5CWSB 3SDYH 3SDCA 4YGVA 4NYLB 2VZUA 3AAZA 3UAJC 2DL2A 3O9WB 3GMPA 2XWBB 4OD3H 2X4SB 2XWTA 4RGNC 4BH7B 3IJHA 2IFFH 1XCTB 4RA3A 4BKLA 3MJ8B 2ICWB 1FL5A 3QIUD 5BXFA 1M6OA 4MA1B 3EDKA 3RHWK 5BOZG 3S4SG 4HJGB 5D7SL 4Y0GA 3TN0B 1G9NL 1D6EB 4N1EA 3ET9F 1G7QA 2UZIL 5MEPB 4S0TD 1D5XA 5DTFA 4S0SD 2CDFB 3U2SB 4LQFH 1G9MC 4NZDA 3IJSA 3WUWG 2AK1L 3PDOB 5EPMA 4BFIB 5JDJA 4QRRB 3KPSE 2MJWA 4KUZL 3RU8H 3QEUB 4HIEA 5JQ6H 4FQCL 1P4IH 2NNAB 3HC3H 3MFFB 4LHQB 1I3RA 4MWFB 1XGTA 4FTVA 3TZVB 4JPIB 1C8PA 1Q9OA 2Z0BA 2F54D 2I9LA 4QOKE 2DKMA 2DTML 4ALAH 3P9LA 1KNOB 4MJ5A 5T1LD 4DW2H 5I1CH 1IAKB 1JN6A 3V9FA 3HN3A 4N0RA 4XPHH 1L4IA 3JTSA 4PJXE 3VJ6A 1EFXA 2PO6A 4FOMA 3TIDB 1OAQH 2CK0H 1ZHLA 2EIZB 4ZPVA 4OLZH 2ATPB 4LOUD 5CJ5A 2RIKA 5DDHB 2YKLH 3T09A 1F6AA 4R7NA 1IEBA 2E9WA 3HZVA 5T3ZE 3HNVL 2AV1B 1YEJL 4NHUB 1WZKA 4KTEL 4KZEL 2ITCB 1D3CA 3OKMA 4NQUA 1EZVX 4N8PA 2Z8SA 3MLTA 5E6IA 5EZLA 4Q9CA 4HKBB 5CBEB 1CVRA 2F58L 3L3OA 5CEZE 1FO0H 3MBEC 2JCCE 1IGCL 3MNZB 2HKHH 4LNRB 4U1NA 4UQ3B 3P30L 2R1XB 4EJ1C 1EO5A 1PQZA 5C2UB 2P5WE 5C0FA 3BO8B 1Q9KA 2YRPA 3WXWH 4NUGH 4L8SA 3GDBA 3SDCD 3KYKH 4ODVL 3NIFE 2C3VA 5F93C 3VMNA 2WIIA 4Y4HA 1AD0B 1I4FA 3K8KA 4GW1A 2ENYA 2VZ3A 2ZJSH 5JORA 2NCMA 4X5LA 1UZ6E 3M1BA 1KSRA 1KCLA 2G2RA 3DSNA 1WZLA 5JZ7D 2ZG2A 3L3KB 5DZNA 1D5MB 2WQ8A 2J8UA 4PTTB 4J3UA 1ZSDB 5F1OB 3PDDA 4OCYH 1WLHA 3WEXA 3CFEA 4GRWB 1A9EA 3V52L 1F4XH 2XA3A 3RKPA 3ARFA 3FHQA 4C4KO 2YBRA 3D39A 5C3LD 1RIHL 5IT2H 1YEFL 5I0ZA 3VWKA 5HHVL 2NR6C 1KJ3L 3KWWA 5FECB 2CLZA 5J7CC 4YBHA 3SO3C 3D9AL 2E9JA 1AGCB 2VLJA 5DVOA 2WNGA 1I9RH 4XMPL 2BOCA 1KIUA 1I9IH 4Y2DB 3ZYOA 4DCQB 4FTVD 5I1JH 1MRCL 3C9NA 1KIPB 5JIHA 3RL2A 4Z95L 4U7SA 5HYEA 3BEWB 1CK0H 1SYSB 1FZMB 4AZ8A 5BJTB 1ZEAH 3ARZA 4LBEB 1EFXD 2PO6D 3BMVA 4WFGD 2DWDB 3HTLX 5KANI 5DK2B 1X5JA 2DD8L 32C2B 4NN7C 1AO7B 4EN3B 3CK0H 3DX8B 5DQDL 1BX2A 5HHMB 3MXWL 2UZXB 4PLKC 1FVDA 3ZHKA 3QUXC 2FGWH 4CN1A 1J1OH 1Q1JH 5I30H 5A43C 2BVTA 1MCQA 4JZJB 4HJJH 1ZVSA 2J7LA 5IKCA 1MCSA 2AJSL 5GIRB 4U1JA 4YNYA 5E6ID 1NLBH 3FQNA 1UM5H 1C08A 3U6RB 4IHOB 1INQA 1BQLH 1YNKH 2PETA 4NNPH 1OB1A 1AKJB 2P5EA 4ELKB 4F7MB 2R2EA 1T5WB 1U92B 3DVNA 3DGCR 3PHQB 3CX5K 2VXSL 4HCRL 1TJIL 4JQXC 2HRPL 1SMOA 2OP4H 1G1YA 4OV5A 5LGJA 2NY0C 2WUCL 4PJAF 1RU9L 2EYRA 4Y4HD 1DQMH 4TSBL 1G6RB 2R0ZL 4ZUVA 1CTNA 1XIWA 2GY7B 2J88H 1MWAL 1QPXA 3HS0B 3L3GB 2DYPA 4W81A 4WUKL 1E4WH 5A2JH 4FZ8L 2HTKC 2RR3A 4UT6L 3LDBC 4IMLB 1XR9B 1VFUA 1Q9LA 2EDKA 3CSGA 5T33L 1G7JA 4EI5C 1BZ7B 2NXZB 1AFVH 3ARFD 2YD2A 3D39D 4D8PB 5I74C 3ZLQC 2Y4SA 2HJLA 2Y06L 4DKEH 4GG6F 3VWKD 3BE1L 3BKCL 4MMZC 1JNHA 4CADA 5DK0B 1NFDB 3DECA 5IB4A 4LSQL 2VLJD 3WO4C 4JPWL 3QXAA 5HHPA 3H42L 2X70B 4M1GL 2EKSA 4LSRL