2VABA

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
molecule tags Complex (mhc i/peptide)
source organism Mus musculus
publication title Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb.
pubmed rcsb
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1994-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vabA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2vabA01
1UYWL 3I6LD 3MLZL 3NPSB 3Q1SH 1RMFH 3IGAA 5IEKB 3HMWH 3ILPB 5J13C 4Z95L 1UWEH 4X6FA 3PG2A 5FUCE 4M7KL 1T2QH 3QHZL 2AJXH 3BSZL 5HYJD 2BNQE 4HGKC 1QYGL 3ALXA 4Z0BL 4LEXH 1JE6A 1I9IH 4PJ7E 1RUKH 3DYOA 4M4RA 5BZDB 1DFBH 5D9SA 5CP3H 5C0GB 1HYSD 3HAEG 4TSCH 1AQDA 3P0VL 2FDBP 4ETQA 2DDQL 2ORBL 1B0GA 4HGMA 3PP4H 1KIPA 3IU3B 3BGMB 4WHYH 2P8LA 4LCCC 4G9DA 3MRGA 3DHMA 1HOCA 3D0VB 4PP8C 4JFOB 3S88L 1UJTA 2X7LA 2Z92B 1BQLH 5CS7A 3TP4A 4H1LA 1N64L 1ZT4A 2ZCKH 3GMOA 5D5MA 5E03A 4DW2H 3BRFA 1VACB 3PWLB 5DEGB 2W9DH 4LCIH 3GK8L 2V2XB 5C0GA 3BHBA 4LK4A 1FV1A 2PXYD 3U9PL 3B9KC 5FYJE 3MRCA 3O3EB 2A9NL 3QO0A 2J12B 1IM9A 1AC0A 2B20A 5D70H 4Z76B 5JPMB 4PJBB 2P8LB 1INDL 1DQDL 3W0WD 5T1DL 3VGBA 3RWJA 3WNPA 2NNAA 2YPVH 5BV7B 3P4MB 2R69H 1OP3K 1N0LA 1CN4A 3EYVA 3VDCA 3NFPB 5I75C 4R90H 2WP3T 4B7LA 2VITB 4U1SA 1R5WB 1LMKA 2QLVB 4JQXC 1LP9F 4AG4H 3PXJA 2W60B 2APVA 2A2QT 2IAMA 5KVDL 3I75B 4PJ8A 1QKZH 3KJ4B 1CVRA 4ZFZB 1DSFH 2X1PA 1CR9L 2XWBB 1RZJC 5BMFL 1X5IA 1BQHG 1VPOH 4UQ2B 5E9DE 2AAVA 3OKMA 5HPMB 2R0WL 1ED3B 1T0MA 4FG6C 4CDGC 1PKQA 4XXCA 5CD3B 2DLEA 2I26N 3TN0B 5IB2B 4HUKB 3P9WB 3D3VA 2LQRA 4PJ8C 4PB9L 4Z7NF 5I1HL 1R5WA 4HIEA 1OGAB 1PYWB 4OFPA 4X6BA 4Y5YA 5DUBA 1NDGB 4JQIH 5MHSD 5GGRY 4FFWD 4WGWB 4Y8AA 3ZHDA 4CN4A 4R2GC 1KYOJ 1QYGH 1YPZB 3SDAB 4RRPA 3GIVA 1B88A 3MRRB 1BECA 3BZDA 1PKQB 4XPAL 4JO1L 2DM2A 3TJHD 1OY3B 4OLZL 5E4IA 1JZ7A 1EX0A 3ARED 2BVQA 5GS1B 4FNLH 4M7ZC 1E28A 4PJFA 1KNOB 1U9KA 5CGTA 1GHFH 4H0GA 2AJVH 5JW5B 5C92A 2OTWB 3MRKA 4KTDL 1F13A 5MEQB 2ZSWA 3SJVE 5IV2B 2WK2A 3CXHJ 4L3ED 1OAQH 4LLQB 1H3PH 3CFCL 4N0CD 2V5YA 5E9DA 5FDYA 3ZDYE 3CH8A 5C7XL 4HULB 2VZTA 3L1OL 2G2RA 2EYSB 1BD2A 5D1QC 3WFBL 4X98A 4G8FA 1JGVL 4OUUA 4AEHH 2BXYA 1NCWH 5IT2L 5ELIA 3DUSA 1IBGL 5DJ8B 5CKAA 2NY7H 2QBWA 1J8HA 2VXUH 5MEQA 3UTQA 3DX9A 4GRWF 1EO5A 1P9MC 2PXYB 3O4LA 3VI4F 2Y07H 4EI5B 5ICXB 5ITFA 2VL4A 2MKWA 2BNQA 3KPSE 1BGXL 1RZKC 1A1MB 4BELD 1C7TA 3QIWA 1WLHA 1V7ML 5C6WH 2UUDH 1CLOL 3S35L 4CW1A 1NANH 3QPXL 5CWSA 3JVGC 3W9EA 2DTSA 4PYHA 4NDMB 5JA9A 1N5AB 5C3LD 4JRYD 5C2UB 1J8HB 1MQKH 1OT1A 3GKWH 2JELH 3MRBA 4DQOH 1A7PL 1RVFL 1JGLH 1S7WB 5TQ0L 5ITFB 5T33H 3V4VH 3GMMB 2Q7YA 5CZKA 3T0AA 1I3GH 1MH5A 3C60A 5C9KA 5JXAL 3A67L 4JAMB 4X80L 1S9VA 3CFBA 5E2TL 4M00A 4R7NA 4H88H 1E4WL 1ZHBB 2R29H 5CBEA 3R4DA 4HUWA 4PJ9D 3MZGB 5CLTA 4BK5A 2XY1A 4YHLL 5E95B 2EDRA 5HYFA 5K9KB 3S5LB 1UZ6F 2OM5A 2P43B 3QWRA 1IKNA 2VDOH 3QH3A 3Q6FA 3TVMD 3O4LE 2DJUA 3BKML 2R9HD 2W65B 1MCQA 4IMKA 5A16A 5J1AA 5CHNB 4Z7VE 3AFLA 3SDCD 2EDTA 3DMMA 3HNTL 2VZSA 2KZ1B 1MUJB 1IEAA 3ARGA 2JK5A 1EAPB 3CXDH 3RZCC 2XKNB 4M7ZB 4RFNB 5TE6H 5C0JB 3W5NA 4MSWA 4H25B 4O5LH 3NZ8B 3SO5A 3HR6A 3G6JE 3S5LA 1OD9A 3T0EA 4Z9KB 5FCSH 4AZ8A 4DCQB 4MXQD 3G6AB 4GAGH 5E00B 3HPLB 4C56D 3SQOL 3UJTL 2VDPH 4Y16D 4WO4C 5A16B 3NAAH 5D1XA 1TPXB 5HGDA 1LE9B 1NGPH 3EYQC 5D1QB 3DX6A 3TZVA 4J23A 3N50A 5T3ZH 1BBJA 2K3TA 3RY6C 4U31A 4M6AA 5H2BA 2P8PA 1LDPL 4F2MB 1G9NH 3R1GL 4HGWB 4ONOA 1BFOA 3TYGH 1P6FA 5CILH 3SPVA 5DI8A 2NW2B 4PRPE 2XG4A 1TNMA 3QDHA 3TBSB 5I6XB 3TNMA 1RK1B 2Z91B 5CSGA 3UJTH 4UQ3B 4FTVB 1EZVX 4XMPL 3MRQB 1CD0A 1CL7I 5ID1A 3PQYE 3UTPD 2WLZA 5E1AA 4OM1L 3MRMA 2DM7A 3TESA 3SY0B 2P24B 4XXDB 5EU5B 3ALPA 3GSNA 3ZKMD 3ULVC 1HZHH 1A9BA 5EBLB 1LO5B 1M71A 3OPZH 1J0JA 1JF5A 3HRZB 4HXBH 5L9DH 2FR4A 4OCLC 3D69A 1KIQA 5D8JL 4IMKC 4LVNC 3B9KA 3DVGA 4PLKD 2Z91A 3MLVH 4XPTL 5K33A 4JRWA 1QEWB 2WBJA 1Y18A 1N6QH 3RWHA 5GRJH 4O5LL 4X4YA 1RUPH 3NPZB 4XC3L 2BC4A 4WFED 1T04A 3HA0A 1Z2KA 4ZUWA 4EKXA 3WNOA 3HNTH 4FQXB 3DSNA 4F15B 1OGTA 5EU4B 2EXYD 4Z77B 4ZO9A 3HRZA 3MLXL 1I1AB 5J13B 1QD0A 5GRJL 1GH7A 3WJLA 1WQVT 4HD9A 2JIXD 5KSBA 5E5MB 5JMOC 3TF7A 5M95B 4N8PA 3HPJA 3M17A 1C8PA 5EO0B 2NY3D 5D8JH 4QRPA 2HFEA 5C07E 5HY9A 3O6LH 4V1DD 3VFUB 2FIKA 4WI4A 2ZUSA 3W0WB 4KJPD 4WJ5B 1AQKL 1YEJH 4RGND 2QADD 2X42A 5HYJA 3ESVF 4OZHE 3FMGH 3NAAL 4HG4K 3GRWH 4KKAD 4J3SA 4XC3H 1NFIB 3QDMA 1BQUA 1CGSH 4FQXA 3VXPA 1P7QB 5D2LB 5EZOH 2IFGA 3PL6D 3LY6A 1X4YA 4MAYD 3T04D 3ZYJA 3OGOE 4XNYH 4XNZC 4Q9QH 4PGDA 5EUOB 1MCNA 3HNSH 2DD8L 4KTEL 1QSVA 3HLAA 3EFFA 4PREB 3E2HC 4MQXC 4OD3L 5CBAB 5EU6B 1EXUB 5HHME 1TJHL 2IPUK 4PG2A 4X99B 4LRNH 4L8BB 2NQCA 4HCRA 5H35B 4LHUD 2AQ3A 1NBYA 2P42B 3GIZL 3I9GL 4JFFA 5C0BB 4I18C 2PKDA 1OGAD 3GJFA 1UVQA 3HZMA 4OLWL 4XBPA 3BMVA 1MNUL 1JFQH 5EUOA 4WCYL 5F1NB 5DWUH 1UB6A 1R3JB 4QHLB 4TNWK 1DQJA 2EE9A 1S5HB 2VIRA 3WCYA 3MRLA 3PGCA 2UVEA 4KI5F 3U4BH 3U7AA 3WKNA 2X4OB 1EEZB 1N4XH 5IG7A 5CEYB 4TUKL 2MQCA 3WYRA 2VSDA 5EBWA 4LNRB 1MAJA 2E9BA 2BMKA 3UP1A 2IQ9L 3E3QE 5H35A 4LSQH 1FAIH 2XTJD 5IFAH 3MREA 1WUNT 5EN2B 3LKRA 1CICC 4IOIB 3D48R 2Q8BH 3PHSA 2V7NB 2JB5L 5T1KB 4UMGA 4YGVB 1F90H 5INCB 4PJ8D 4M7JL 1S78D 2LVCA 3MTRA 5C08A 3E8UL 2K7PA 3EDKA 4JN2B 1U6AL 1AR1D 1NKOA 4HF5H 2ZG3A 1VEPA 2BVOA 4Y4HD 4YPGB 3QDGB 3VXMB 1M7XA 3ZKXC 1X9QA 4P4RB 1I1FB 3MREB 3SJVD 3A6BH 3LKRB 1AIFA 1PSKL 2DLHA 1U3JA 3O6FD 5T1KA 5I18L 5F6IC 3EUUA 3MV9D 3MLWL 2EH7H 3MMEA 3NABL 2A9MH 5EUOE 4LQFL 3QP3A 2CRZA 4NQCD 3VFNB 5HHQA 4XX1G 6FABH 1YY9D 4AIOA 5C6TL 2XZCH 4LSUH 4AYFA 1OARL 1MWAL 2DQTL 1Q72H 2NY3B 3MO1B 2AJYL 1UKTA 1WWCA 2NCMA 5JDSB 4U0QB 1BQLL 1BVZA 1T5WB 2NX5E 4WENB 4XCEB 1DEDA 3L1OH 1PX4A 3RBGA 3H42L 3QDGA 3STZA 1QFWL 5I73C 1RURH 1ZHLB 5DEFB 4HJJH 4U1KB 4RGNB 3WFCH 3KYMB 1DQDH 2G9HA 1LO0H 1EHLL 3QEUB 1DLFL 3I02A 1P7QD 5EDXA 4YXLH 2VQTA 1MOEA 4R7DA 1N7ML 1G6RH 2AP2A 2VXUL 3MLRL 2I9LA 2F5BH 1CGYA 4RQQA 3PWVB 1FC1A 5GSRA 4NWTL 1TNNA 2OP4L 1ZSDB 2IPTL 4OCYH 5DVLA 4CGTA 1O0VA 2BCKA 4D0BB 3X13B 3P0VH 4KHXH 3M1BA 1YN6A 2FZ3A 3T3PF 3ULUC 2BVTA 4JZNB 4OZIE 4UU9B 1DSFL 3PHOB 4XP5L 1I7TB 3QEQA 2WWKT 4YR6A 1GZQA 2BXZA 3MLRH 4ELME 1W8NA 5KG9A 1S7VA 1INEL 4ZUVB 3VGDA 5D96B 3IF1A 3L6FA 1U6AH 1T0NB 3MV8B 1ZHKA 1KTRL 5C07A 4WEBL 2WMPA 3O4LD 3IFNH 5B8CB 4HK3J 4RMUA 1NLBH 5DD1H 3DROA 3ARBB 4NQEE 2XWJB 4Y2DD 5GJSL 1KXQE 3MJGX 4PJ7B 5D7KD 1Q9WA 2EE3A 2VLRB 3PWUB 4OFYA 4YR6B 5BO1L 1Y6KR 2EH8L 3QI9B 3MFFB 3V5KA 4O2FA 2ENSA 3HB3D 1CICB 2EH7L 4S2SA 2OL3A 3N1QC 2W60A 3BAEH 4JN1L 5DUMH 4ZXBD 1MJUH 4KVNH 2CSPA 2VAAB 2CIKB 4HK0A 1FVEB 2AJUL 1G9EA 2PCPB 2ZUUA 5D7SL 1CU4H 2WM0A 5IB1A 1D5ZB 3OKKB 2DYPB 4RDQG 3QXAA 3B5TA 1WBZA 4X5XA 3I2CL 2YUXA 4N9GB 4PB9H 4XPAH 4FQJH 4G3YL 3HAEH 3BP4A 2VDQL 4U1IA 5D1ZD 4JDVA 4ODSH 5E0QA 1S78C 2DQUH 5KVEL 4UV7L 1I1CA 4D94A 4Z0XB 3ZDXF 3RWCA 1YQVL 1JZ5A 3REVB 3GSVA 3X3GH 3NABH 1IL1B 3CC5B 1T2QL 2MQ0A 5GRUL 4PJAF 4N5EA 1PEWA 2FYYA 4XNMB 4PG9B 5FGCB 1EO8H 5DT1H 4Q6IC 4UT7H 2GK2A 2DWDA 2OXGA 3WUWA 4X7SH 2LFGA 1ORSA 4LLYA 4NN7B 1WTLA 3TIDA 4OAWA 5DO2D 1D6VL 2ATKA 3IAQA 1JVKA 4ZQKB 3RVXC 4FQQB 4LSPH 4P5TB 3VWJA 4OGXH 1IGYB 1R3HB 1CE1L 2YEZA 3NGBC 1J0IA 4AH2A 5J1TC 2XA8L 1ROWA 3EO9L 4XRCA 4NFCA 5IFJB 3U4AA 3UPCA 2EDQA 4KKNA 3VRJB 5LGJA 4ZDHA 1I7UA 1K4CB 4MNGE 5GRUH 1KCGC 1BOYA 4Y8DC 4NNYA 5J6HA 1RJLB 4LLYB 1IQWH 1MCJA 3TIDB 4R90L 2CRIA 4I3SH 1BOGA 3V4UL 4CMHB 1FLRL 4P3WA 5IJKA 1CXKA 4KQ4L 1P1ZB 2XNAA 2R0LL 1CS6A 4ZTPL 4PY7A 1INDH 2GJZA 1IFHH 1U36A 3QQ4B 5EBMA 3RWEB 1J1PH 1I1AD 5JHLH 5IBTL 3C8KA 5CLWA 1NBZA 4Y0GA 2Q86B 3L3DB 4LHUG 5I75B 2H9GA 3L95B 1Q8MA 3MLVL 4XPTH 3NN8A 1XH3A 3QUZD 1UM4H 2QTEA 5FF6B 5I8EA 3KPOA 1IAKA 3VFTB 1FNSL 1UKQA 2QEJA 3KYNB 3UBXB 3V8OA 4DEPB 1P1ZA 2XNAB 2YRLA 1UB5A 3LSOA 3AREB 3TGXA 3O6KL 4NDMA 1MI5E 3V0WL 4PY7B 3V52H 3HR5B 1YUHB 2PO6A 5GS1C 2AJ3A 4EUPB 3MRBB 4GQ9H 4I4WB 1SEQL 5KZCD 2NY6B 5SWSD 3FB8B 4FXGB 3TPUA 4Y1AD 4JY5L 5L88L 2DQDH 4YDIH 1WAAA 2Q86A 2R15A 4KK8C 4OKVA 1ND0B 4GS7B 3DVFA 1YMHA 4P2OA 3FQRB 1OWRM 1WEJL 4JAMA 3W9DA 1TTGA 3B6SA 5DVOA 4F9PC 4PJIB 4JKPH 4NPYA 2FJFB 2YRZA 5F71A 3ZL4H 1G7IA 5FM5O 3NZHH 3HR5A 3K80A 4Z7OF 1FFNB 1W0WB 4YHZL 3VE0B 4APQB 2QR0B 1CL7L 4LBEA 5HBBA 4BQ6A 1W72A 3V0AC 1Q0YH 4OT1L 4EI5C 4QHNA 4KI1A 1EAPA 4Y1AE 1I8MA 1HSBA 4Y4KC 4EUPH 2EYRB 3S3JA 43CAB 1QFWM 4NPYB 3V6ZA 3FO2B 3EDFA 1TTFA 3O11A 1J88A 2Q6WB 4FQHB 3MJ7B 4ZAKA 1JRHL 4HS8H 5EB9A 5TE6L 1X7QA 1J0HA 2Q3AA 4LMQE 4JPWL 3UPAA 2APBA 4R0LB 4JRYB 3THMH 1FLTX 2FRGP 1E27B 4WW2C 3GMRA 1CD8A 5TFSH 4YFEA 2VDKH 1MCSA 3RL2A 5KW9L 2AJZA 3C09B 4LRIA 3N1FC 1CDYA 1P7KB 1D5BA 2IG2L 2R2BA 4KROC 4O2CB 2X4SA 3FO2A 3MJ7A 4FQHA 3IDXH 3F7RA 1XGYL 4K9EH 4O4YL 4QOKD 4PBXA 4XBGB 3PJSB 1YNKH 5E8DH 5L2KB 2VABA 2W0FB 5SV4A 2Z31B 3LN9A 3NPSC 3LS4H 2R2EA 4O9HL 5TDOB 3RL2B 4F58H 5D9SB 4XNUH 4W6WB 5IVXE 5DK0B 4ZNEA 1C08B 4DQOL 2R2BB 3RVTD 4OTXH 5FOJA 3T0EE 2N1KA 3CLFH 3OPZL 2A6JB 2X4SB 3EDDA 3ZHLA 3BGMA 1A7QL 1B3JA 1S7UB 1NC2B 3KG5A 4PJEA 4EN3D 4YHPB 1OHQA 3HNVH 1F3RB 4WEUD 1BMGA 1R3IL 3DRQA 4QRRA 2UWEA 4V2CB 2FIRT 5KSVA 3EYUL 5I15H 1KJ2H 1X5KA 1C12B 1HILB 4C56B 4G9FD 1ZANH 5IBLC 1DQLH 1FFRA 3MGOA 4PRHB 1X5YA 2F8XC 4KJYB 4LLWA 1ZLVK 1ACZA 4ORGA 1A0QL 5IF0B 2Z4QA 3KPSA 5I2IB 4U1GC 4WWKD 4YHKL 3ZLQC 1GGCH 3REWB 3RIAF 4Y16C 1EBPA 4JO3H 4PJEB 3BO8A 2WSKA 2X4UB 3O6ML 3ZYZA 2H32A 2E3VA 3WHXA 2MQ3A 4ZODA 1PY9A 5L8JB 2YZ1A 3O2WL 3RNQA 5EO0A 5HGHA 1KELH 1JHLH 2HFEB 3ARFC 4K2UH 3VFWA 1DVFB 2F53A 3VFUA 5BQ7B 5FGSA 3S96A 5FGBC 3FAXA 4GAGL 1F3DH 4UTBH 5IKCB 4YBLC 4YHNA 2WP3O 2VXQL 3OKMB 1YNKL 2QHLA 4RWHA 1VKXA 2VYRE 3QZWG 4AM0B 4HWEL 5I1KL 1GVIA 5CD3A 1X5FA 4YHML 3RWGA 5ALBL 3MRDA 5IB4B 1T89A 4OLYL 2A6DB 4GAJH 4KY1H 3VJ6B 3L3HB 1SMOA 4YE4H 5JOEA 2RBLA 1AI1H 3VFWB 1YA5A 3CVHA 5EOCH 3U7YL 1KG0B 2ADFL 4EDWL 3AC0A 1T20B 2R4SH 1CD1B 4PJXB 1OWWA 1I7RA 5TDNA 4L8BA 4F8QA 1XZ0B 3JTTB 1H3VA 5IEHB 2D9CA 4NP4H 1VPOL 4HKZB 1SY6A 2APWA 2R29L 1NQBA 4QEGA 5IBUB 3FT3B 2IALA 4LPUA 3BP7B 2QSQA 3CX2A 1MPAH 1A7OL 5KS9F 4LFHG 3KJ6L 3MODL 4U3HA 5L0QC 1SEBA 3WNLA 1DCLA 2X4OA 2RAMA 1U8MA 4K3JL 3L5XL 2D7MA 3CVHB 2QQKL 1QSEA 4PJXA 3PWNA 1WFNA 3DECA 5D5MF 1UT9A 4OTXL 3PABB 2ZNXA 4QY8A 4UILL 5FYLD 3IKKA 2CLZB 4LLQA 5TF1H 3QUYA 2NMSA 4FMFA 1I8KB 3VXRE 4G8FB 2IALB 1H15A 3MCG1 3KPQA 5BS0D 4ONFL 3RJDA 1H8NA 4WDIB 4IHOA 3DSFH 4JN2A 2GJ6B 2VLKE 4KQ3L 3HI1A 5F7EH 1SBSL 1UM6H 1WZ1L 2DQEL 1CGTA 1GGBL 4PFEA 4UT7L 1JWMB 1MCBA 4EQ2A 4YX2L 4BJLA 3DO7A 4XMLH 5FYJU 3WS3B 1YYLH 3AVEA 3PABA 1FZKB 4TTGA 4P4RA 1JHTB 4KK6C 4P4KA 1RZFL 3WD5L 5E2UL 1EAJA 3HG1D 2CR3A 2CKNA 2DIAA 2IF7A 1LDPH 3HTLX 4JPVH 1N7MH 4NHUE 3S36L 2MJWA 1LP9E 3UZEA 3WDHA 2E6JA 1IGJB 3L3JA 3QFDB 4RAUA 3TNNB 3G5XB 1QLRA 1OPGL 1QSZA 3L5WA 1DBAL 4KWUA 5DJ2A 4HKXA 3HS0A 4K8RD 3FRUA 4KK9C 1B90A 5E2UH 2VC2L 1MWAH 3B2UC 3GMPA 1H8SA 3V7MA 1CDJA 2X44D 1B6DA 3SKNB 4P4KB 2IANA 5DHVA 5DRNB 2RQ8A 3FFDA 2HJKA 4PJIF 1RMFL 3K1DA 4GRWH 4HWUA 3TCXA 1TJHH 2NY6D 1TETL 1BIHA 3UDWC 5C2BL 3OF6A 4WNQB 1G6RL 2EDYA 2QSCL 1QQDB 3VGFA 1YN6B 2FZ3B 2NX5B 1G84A 1YEIH 3L7FB 2AJUH 1QSFB 4YEFA 5BO1H 2ZUYA 3VD4A 5C0AD 1QP1A 4XMKL 5T1MA 1IFHL 1LK2B 5C70A 2ZZUT 4GAYA 4LSRH 3LQZB 2FO4A 2GSIA 3QIBD 3HUJA 3QWOB 3IF1B 4E41A 3U4EB 4R26H 5I1JL 4WHYG 1ZEAL 3C6LA 2JK5B 6FABL 5AEAA 1ZHKB 3J7HA 1EFXA 3HZYB 5C0EB 4ACPA 3DARA 1F45A 4NQUA 2C1PA 3BKCH 2GT9B 3X12B 3ARBA 1FAIL 3QDGE 2OQJA 4K3DH 4NQCB 3VA2C 1WIPA 1NL0L 5ALCL 1R5IB 5AZ2L 3ZDYF 5C0IA 4KMTL 4U1LA 1QLEL 3BW9A 3OBAA 3RKDC 4O2FB 4I13B 4XVUD 3VFOB 4UILH 2VLKD 1IGFL 4HAFA 1KN2L 5CCKL 4P49A 1UJ3B 1EDQA 4HMEA 1HSAA 3DX6B 3TZVB 1Q9KB 2HWZH 1EFXB 4V2BA 1V3JA 3Q0HA 1I75A 4NKMA 4KJQD 3GSOB 1B4JH 4EI6B 4R26L 5I1JH 4G6FB 2V5SA 5LCVL 4FHBD 1QLEH 5T1DH 5IB1B 4JFFD 5F7EL 3UTSD 4OZ4B 1BHGA 1Q94A 3GFUA 4Q0XH 3KDMA 1EVTC 4U1IB 1EV2E 2HT4C 3QJFB 3BW9B 3I2CH 3BX7C 3VI3E 4OV5A 5D7IB 1T7ZA 1WBXA 1DE4B 4ODTH 1HXMA 1LGVA 4LLVA 5E8EA 4YBQD 1LNUB 5EUKA 2Z35A 3C5ZB 4UV7H 4V3EB 2AV7A 3VD5A 5LVEA 4JY6B 3QCVH 4PJDA 1NCCH 1G7PB 2BSTA 2OMNA 3T0VA 2P24A 4OLWH 4OF0A 3IFOA 3K8LA 3ZKMC 2A73A 3GMLA 4Z7UE 4F57L 2FSEA 3KPRE 4YNYB 4Y2DB 1EPFA 3NFSH 1YMMA 1LO5A 4OFDA 2DQFA 4RMWA 5FYLH 2VC2H 3MRJB 2E7CA 3CH1B 4KKLD 3MYJA 4K07A 3BQUB 5KVMC 4E0RB 3QI9D 1G7QB 3PWPA 1YEIL 3IDNA 3B83A 4D0DB 4HEME 2QADB 2ARJB 4MNHA 2Z35B 2KZWA 3L3GB 2H6PB 1SYVA 1NCDL 3PDDA 5IFAL 1BLNA 5MENE 4OGYH 1T04B 5CAYB 2BSTB 2EKSB 3NACL 2FEEL 4PGEA 4JZJA 5GGRA 2HLAA 1I7UB 1K4CA 5F7DA 5F93C 5BVJA 4NNYB 3CU7A 2FJGA 5LXGH 1MCCA 1F58L 4R97B 12E8H 1PX3A 3T4YB 4DZ8B 5C0ND 3HMWL 2FBOJ 3MUJA 4M43L 3CLFL 1VESA 5KS9E 4XTRD 2PR4L 3IDNB 1FCGA 3OZ9H 3SGKC 4HKBB 4JRXE 2FIKB 1P2CB 4D0CA 5BV7L 4O9HH 3W0WA 1IM3A 5AG8A 1A7NL 2W07A 3TPKA 5HYJB 3ARWA 2JTDA 5C0CB 2B2XL 2IQAA 5IQ7L 4R4FL 3F7VB 3PIQB 3WL9B 2OYPA 4N8CH 5CJXA 1HHKA 4JM2A 2FJGB 5C0RH 2FBJL 3DSFL 3SE9L 3SDDD 1T7YA 5T5FH 4CMMA 5HGGS 5FGBA 4HHAB 3WFEH 1TJGH 1RUML 1U95B 4YJZL 3GBNL 1VGKA 2VRAA 2AJ3B 5I1GL 1KCKA 2FJHB 4KV5F 3QEHA 5IM7A 1YDPA 4WV1C 1QG3A 2CIIA 4FXGA 5C86A 4CRPA 3N06B 2N4IA 4DKEH 4RMSA 4JHBA 3RKDD 5JZ7C 4P5TC 3ZE1F 1IAOB 4Y89A 5D6DA 4HEPG 5DRZB 4JFFB 1KJ3H 3MLUH 1T6VN 2CKBB 2PUQT 1OSPL 5ISZB 3GRWL 1ZGLP 2HJLA 5GGTL 3GJFB 2IH3B 3IXTA 1KGCE 4P23A 3X3FH 4DGIL 1HHIA 5F1NA 1YEDB 3LV3A 1N2RA 3EJJX 2OCFD 4ETYA 1KEML 3MRLB 3PGCB 4DGYH 5EU7E 2HFFB 4P2QE 4D9RE 4XMPH 4NZRH 3IDJB 1G7IB 4PJHA 3BGFC 4S0UC 1FFOB 4CMHC 3QFJA 4MD4A 4YWGL 3SJVB 1IGCL 3DETD 2X4PA 2FGWH 1BX2B 1YJDH 3HE6A 4JG1H 1DVFC 4KHTL 3P4LA 2ED7A 3OAUH 4YHZH 1W72B 5C0FA 4K71B 5D72L 2B4CL 5T1LA 2E7MA 2XQYG 1YY8B 1JRHH 1I8LC 1PDKA 2IPKB 4U6XA 4OM1H 3FFCE 2FGWL 1AY1L 3MV9E 4RFOH 2ADGB 5HDOA 2MTPA 2VWEE 3LQMA 4KY1L 3ZT7A 2DKMA 3GDBA 4YPGA 1DJSA 3VXTA 2WUCH 3JTSA 1S9WB 1AIFB 5IB5A 2XQBL 1RZKH 3MBED 1GPOL 4FXKB 1A7NH 1YY8A 1RD6A 4X7EC 4XPFH 3LPFA 4PJ5A 3FO9B 3ZL4L 3QUZA 4NNPH 3QSKB 5TE4L 5IQ7H 4O2CA 3ZKXB 2COQA 4PTTA 5J12C 4UT6L 5E8NA 4N1CA 1KBGL 3MRGB 2R8SH 4X9FA 1QPPA 4QHUB 2M8XA 4I48B 3C9NA 1KF9B 3WO4B 5DEFA 4M7LH 5FO7A 3I85A 2CDEA 4PRIB 3MV8D 3JTSB 4XVSL 1C5CL 4Y1AA 3PWLA 1CF8L 3O8XC 4NIKB 4JO3L 5DEGA 1FNHA 3BHBB 1MQ8A 2D31B 2LAGB 4M5ZH 4NN5C 2O5YL 3GI9L 4XNUL 3O3EA 1X5XA 4Q9RL 1GCFA 3PNWB 4PTTB 1CFSA 2I07B 5A3ID 1TITA 1WZLA 4GRWE 3H0TB 4M61B 1FJ1A 4FQIL 1ZANL 1MCEA 4JQXA 4M6NL 1A14L 4HZLA 4G6JH 3MCKB 1QBLH 4WUKL 4OBRA 5DJAB 4CDHA 4R0LC 1OAZL 4BSVB 4LVHC 4YH6A 4XAWL 4LAJH 3RL1B 5DMKB 1HI6A 1CWVA 4LRNL 1F8TL 1U8JA 3BZEB 2FD6H 1WV7T 5D1ZB 1G0XA 1GAFH 3RIAK 4ISVA 3D3VD 2I60L 2DIJA 4PD4J 1R3KB 2BRQA 4TNVK 3T2NH 1P9MA 1U3ZA 3BO8B 4ZPVA 1TQBB 5FXCH 3ARGD 4LHQB 3V9FA 4HZLB 4G8EB 3MFFA 1R0AH 4J6RL 5K93A 1R3LB 2H32B 4S1SL 2NXZB 3EOTH 1QHPA 2OTUA 4JG1L 4AEFA 5SWSE 4S2SB 5DJAA 3BH9B 4J3OC 4Y5YB 3MROB 1RY7B 2VXTL 3W11D 5IBTH 5BQ7A 4M02A 2NXYC 2VDLL 5JUEL 3QPXH 5BS0E 5BVPL 3QG6A 4LSRL 2H8PB 5GS3A 3HMXH 3AM8C 2DN7A 4NJAH 1ZMYA 5D7LD 4UOW1 4AM0A 4XNXL 3BP4B 4HAGA 4QHMA 4ZSOA 4JFHD 1YPZE 4NM4H 4OB5H 4RA0C 1XAUA 3HFML 1H3GA 5EUOF 1A1OA 1J0YA 1KNOA 4S1RH 3VJ6A 1NAKL 3NMEA 5DQDH 5HDBF 4K9EL 4BFBD 5ICYA 1MFCH 2ZSWB 1S7RA 3SOBL 4BUHA 1XEDA 3BDYH 2E8YA 1G6VK 1T66C 2O5XL 2GW5A 3LOWA 1EGJA 5DD5H 2NY2D 2GTZB 1UXSA 3M8OL 1XF5A 2CRYA 4MWFB 5CJ8A 1N8ZA 3S4SA 5T3XH 4FQJL 4OUUB 4KUCD 4KH2A 1I4FA 1OP5H 4XBEL 1OCWH 4GRLC 2E6QA 3OAYH 5KOMC 1QFWI 4ODSL 1AJ7L 1NGZA 3P11L 3MGAA 3QXVA 2Y25A 3CPLB 4PGCA 2D4DA 2P5WD 3U2SB 3ARDA 2FH8A 4F37F 3RTQC 3MA9L 5D1QD 3IJYB 4M6ML 2VLJA 1MI5D 2B1HH 5FB8A 1GGBH 1HEZB 3MLSL 4J7RA 1I4FB 4F8TA 1QNZL 4O00A 3DV4B 4KVCH 4TNWF 1H3XA 1DBAH 5F1IB 2CKBL 4IRJD 3X14A 2GJZB 3QQ4A 4QNPF 2VDML 4QXUL 3RWEA 4P2RA 3VDAA 3GGWA 4HX1B 4XNXH 3IJHB 4DOHE 3U2SA 3H42H 32C2A 3RZWA 4PJ9A 2VLJB 5FB8B 4QTHB 1V7NL 5FF6A 2NXZC 3IFNL 2OS7A 3L3JB 4I2XE 1NJ9A 3VFTA 2GIYA 2WINA 4RAVA 3QUZC 3UBXA 3NACH 3GJEB 4ODUA 5BW7C 4YDLB 4GKNA 2HVKA 5K9KA 2HRPH 4KQ4H 2O5XH 4G9FE 3VXQB 4NKOB 4OB5L 1PSKH 4P2RB 1JPSL 2EECA 3GKWL 1M05A 2HJFA 3VXRA 3AMKA 1UWXH 4ZS6D 5ALCH 2R69L 5J1AB 1OVZA 2DBLL 5DDHB 5MI0B 1CE6A 3BZ4A 3PP4L 4WWID 2NTFB 4MB4A 2EC8A 4J2XA 5CCKH 5HHVH 3ERYA 3T8XB 2BY1A 1ZTXL 3GJEA 4LGPB 4ODUB 5BS0B 3NOIA 4UBDC 4KRPC 4ZO7A 3P9LA 4GUPA 3CJJA 4YO0A 5H94B 4OD1H 5T1MB 2HRPL 1GGUA 3BEVB 4DAGH 1ORQA 4LP5A 5DFVD 2WWKO 3P0GB 3QIUD 4HIHA 1F11A 3HUJB 2F53D 3QCTL 4PGBA 2R1YB 4K3JH 4WU7A 2E8ZA 2NTFA 1RHHB 4LQFH 2EYRA 4M1CD 1OOAA 1QA9B 4JN1H 2NY0D 5DUML 2IPUG 1KLFA 5BS0A 5FO9B 3CFCH 1VGEH 3LRGA 4OGXL 4XCNB 5HHVL 3OKLA 3ES6A 3NIDE 4JM2D 3U9PH 3C8HA 1RUKL 4JFZL 1PG7L 1Q9LA 3I3DA 1IAIM 1MAML 5HI5D 2XACC 4M8QB 4BFIB 2MFNA 5HPOA 1F11B 4S1DD 5BV7C 4NO0A 3LKPB 3U82B 2ZG2A 1P4LA 1KXTB 1PQZB 5E6IA 2IFFL 2Y06L 3I3BA 3MXVL 3QCUL 1CGWA 2V2TA 3WIHH 1JPTL 1FH5H 3NCMA 5J3HD 1HNGA 1MJJA 4PBWD 3I6GB 1DBKH 5DHYA 1J86A 4QGTA 1CK0L 4OBSA 2ORBH 1RZFH 4XCNA 2AK4B 5L2KE 2G5BA 2VDRH 4WCYH 4L8DB 3OB8A 2IGFH 4G8GA 4LCWA 3QDME 5E99H 4ZFOL 3QJFA 4NQED 5GGQL 2I9TA 4PRHD 2QSVA 1FN4A 2Y36H 1MF2H 5DURD 3VXOB 1PLGL 5IVXB 5L6YL 1WBXB 5JXEA 1CXHA 3QUYC 4IS6A 3WFBH 2Y5TA 2C5DC 4IRSB 3U0WH 1L0QA 4ZD3H 2IPTH 4OCYL 4FFYH 1AO7D 3M45A 5DJ6B 1Y18B 3SKJL 1W72H 4H0HB 3LMJH 5F3HA 2FECI 4LGSB 1LEGA 1OGAE 1V8HA 4Z95H 2HKHL 5F6HJ 3HE6D 3MJ9L 5C0BD 4MX7B 1JNHA 2XIDA 5CGYD 3OR7A 1KCSH 2UV3A 2A73B 4DK6A 1HINH 1Q1JL 4YHPA 4QRTA 1IQDB 5D7JD 5F7FA 3WV0A 3F8UB 2IAMD 4Z7NE 3BJ91 3BQUA 4PJCE 5F1SA 2FHBA 4LASH 3PV7A 4XAKD 5ESQA 3GSUA 4JO1H 1WCBA 4LGRB 4DZBA 1ITCA 1KFAL 3MGOB 1EEYB 2QQLL 4NSKA 4H1LG 4LLWB 1SYVB 5CEZH 3LEXA 3EYFA 2X1XR 1NAMH 5DUPH 3OR7B 2FLBT 4KRPB 3VXPB 1IC4H 4CU6A 3OJMB 4OCWL 5IB3A 1CDGA 5MEOA 1IAIH 4XVTL 5J12B 4D2NA 5C07D 4RMQA 5C0BE 3BVNB 1KLUB 3T4YA 5AAWA 3WHXB 4JZOB 1MVUB 3AXLB 3D5OF 1SJEA 3F6IA 3H9SE 4W4OC 3WN5B 5GS2H 1K8DB 5SWQB 1XIWD 3WE6B 1JRHI 4G6AC 1QBMH 4YC2B 4UOW0 3NTCL 2AGJH 2KDGA 3RY5A 4W6YB 4RWYH 2F54E 4WTZA 4G6JL 2VKXA 3WFDL 2YD4A 5C0CA 1GOHA 2OR7A 3L5HA 3GMQB 1AGCB 2XWTB 5HI4D 3DXAE 3PDOA 5FM4A 3H9HB 4U1MA 1ZLVH 4QXTA 2JLLA 2DJ4A 2ICWJ 1O7SA 4ZXBA 4FABH 1SYSA 4OLVH 4D9LL 3DX8B 3CGTA 3DI3B 1OAUL 4OD2A 5F9JA 5LWYH 3GO1L 5DD6B 4L3EA 1NGWA 1T0PB 4HDIB 1D9KD 3D87B 4YWGH 1WWWX 4XAWH 3NGBB 4GBXA 4LVOC 3THML 5CZVH 4R3SA 4MCZB 1JZ3A 3GI8L 4PLJC 2DQIL 3JTTA 4HMCA 3T0EC 1AO7E 1RJYB 4L8SA 3SN6N 2XN9D 5J11C 3MRFB 2AK4D 2IH3A 3IXTB 3QXWA 4WU5A 2DICA 2D7OA 3LD8B 1N5YH 1AGEB 1YMMD 4X7TB 3NFNB 3W0WE 2R56H 1E4XH 5IMMA 1OL0A 4K94L 3QXDB 1RK0B 1G7MA 2BNQD 4YFLI 4NNPL 5DJXA 3S6CA 3VXMA 3KPMA 3IKCB 3MLTB 1TDQA 4QY8B 3ZYOA 1CICD 5GZOC 4JRXD 3WJJA 4I5BA 4X4ZA 4TTDC 4G6MH 1BZ9B 4APQD 2AABH 3BPLC 5EG6C 1I8KA 1S9KC 4AJ0A 1H15B 4OSUH 1UZ8A 5IMKB 3LKSA 1KJ2L 4IHOB 3VFNA 1WT5A 1J18A 3IRZA 4P2OD 2ESVB 3CFKB 3QISA 3K7UA 4GKZB 4HPOH 1U58A 5D71L 3WXWL 4CAGA 2HTLC 5B21A 2EYTB 3CVHH 4GQ9L 4UIKH 5DVKA 5IHBA 3KPMB 1TZIA 5TPWH 4U6TA 3T77B 2Y7QB 5L88H 2RCSL 4YZFE 1VFAB 4HW6A 2NY5L 2VXVH 4OI7A 5EO9A 3FN3A 3SQOH 3OKEA 5KVFH 4NCC2 1AQKH 4LPYA 3HE7D 4OF6A 3PWVA 2YR3A 4FFWC 3KXFA 7FABH 3FOMB 2ICEB 2X4RA 4GOSA 3OR6A 4MQ7A 4NRZA 4X6FB 1A7RL 5D1XC 3RGVB 5J6GA 3GSWB 4GRLB 1QR4A 4IDLA 4S11A 1XCQB 4I9WD 3MACH 1TZIB 1GZPB 4D9RD 2APTA 1J1XH 1I1YB 3FQUA 1HQRB 4DVRH 4HS8L 1CI5A 3L9RB 1KJVB 5DRNA 4L8CA 2XI9A 4A6YA 3L6FB 3I6KA 5E2VL 4YHYB 1ZLWK 3H3BC 4HIJA 1CGUA 4P0DA 2GSGA 3RTQB 1AGBA 4ZXBC 3PNWA 1GYAA 2D4FA 1LILA 3FOMA 2XWJA 4Y5XB 5I1LB 1N26A 2NX5A 2DAVA 4PJ7A 3U36B 2Z92A 5J6GB 3V4VL 5IJVB 4MD0B 3X3FL 4DGIH 4FA8A 3G6DH 4BM7A 1FLRH 5E6ZA 3EO9H 4P59L 5D5MB 5IHUL 3HZVA 4WO4A 2XRAL 4XH2A 3OG4B 4N0CC 5CEZE 3O2DA 1IEBB 3QJHB 4M7LT 4KZDL 1A7PH 3HZYA 1JGDA 1JV5B 4GO6B 2M26A 3BZEA 2CLVA 4KROB 1XF4A 5DJCB 2DF3A 5EA0L 1D5ZA 3TO4C 1A2YB 3K1KC 4X9BA 4E42B 3DIFB 1UEYA 5IW6B 1FO0H 4M1GH 3RWJB 1G0DA 4GMTL 1FBIL 3FQXA 3HI5H 3ME0A 1Q0XL 3BFOA 3C5ZD 1CXEA 3HZVB 3OZ9L 1DUYB 3F62A 4P5MB 1T5XB 2BVEA 4NQDE 3V52L 5MEND 4JQIL 3WO3B 4J1UA 2VXSH 5HDQL 1BM3H 3D6GA 4UT9L 4N5ED 1IEBA 3MROA 3QJHA 4UINH 1PBYA 5DUPL 1FL3A 3QB7C 4J3WA 1ONQB 3AY4C 5EORL 5MI0C 1DLHA 5KANG 1K8IA 1WBYB 1ED3A 1T0MB 1AXTL 4AIZB 5GGVY 3NA9H 2YKLH 5T5FL 5F9WC 4QHMB 2KUTA 4OV5B 4HXAH 1VEOA 1X6LA 3TO2B 4HWNA 1UKSA 1EO7A 2CDFA 2KKQA 4TOYL 2VOTA 2ZWLT 1Z5LA 4MDJB 1WC7A 3FT4B 2AV7B 1AXTH 4RBPK 4P2CG 2CDGB 2LTQC 1ZLWH 1QR1A 3MXWL 5J1SC 5I16A 2NY1B 2X9XA 3HE7B 5DD0L 3ET9F 4PTUB 1P84J 1B0RA 4ZDHB 2EDKA 4RAHA 3FO1B 5AAMA 3STBA 4Z7WF 1OT2A 3AAZB 5DGRA 2WQRA 5DFTA 3O4OB 3BKYH 4A2MA 1BOGB 5DO2C 4X4MA 4AL8L 4FQCL 3VCLA 1G7LA 5DJZA 4NQDA 4D0DA 4NOFA 1NGZB 4MZ3A 3SQBA 1CK0H 3FT4A 1OF2A 1L0XA 4RZCB 3MRKB 4RISL 4WV1A 2AS5M 5KBNC 1K3IA 5GSVB 3QCUH 3U30B 3SDCA 4PTUA 2H2SD 2H9GB 3OB0K 5F7DB 2NY5C 3ULVD 4RDQF 4NWUL 2HG5B 4ODVL 4YGAB 4G8IA 1BEYH 3MV01 2IADA 1T7WA 3DV4A 1KOAA 4GAJL 4LKCA 1JGEA 1DN0B 3VXNA 1Z9MA 5K9QI 2ZPKH 1OF2B 4QWWD 1QO3A 5I17B 4BQBA 1OW0C 1JZ2A 1YC8A 1JYWA 4QTIH 1CFBA 5GSVA 4ERSL 3BXNB 1FPTH 1MEXH 3JV6B 3LHPL 2BFVL 2Z8RA 5DRXA 4BKLB 1HCVA 3B9DA 1A1MA 3FB6B 2F19H 4KXZI 2JJSC 5E9DD 5JOFA 3EKCA 3EHBD 4OZGE 4TUKH 1A6VL 2AXGB 3B6SB 3O3UN 2UZYB 4CW1B 4HHAA 4PJIA 2OK0H 1CLZH 1DN0A 1AXSB 2C3VB 4U1JA 3PL6B 1KFAH 5I1CH 3VG0H 1QO3B 2QSCH 1B4JL 1FFNA 3QEHB 4PYGA 1INQA 2G75A 1BFTA 3ZDZE 2DLGA 2WBWB 4YFDB 4KI5D 1SVZA 3VXRB 4LPVA 3VI3F 5D7SH 4MXQC 1CXFA 3E8UH 2J8OA 3BPOC 2B0SH 3UZVB 1T4KB 5KJRH 2ZCKL 1I8MB 1UWEL 2AXGA 1UM5H 3O3AA 3P77B 2BOBA 3D2UD 3F7QA 5B39A 2F19L 1B6UA 4Y4HA 4NBZB 3CCHA 1OCWL 5DMIL 1T7VA 4LHUB 3U1SL 3S36H 4MDIA 3DLQR 4PJHB 2UYLB 4RIRA 5ECJE 2NY4C 4PJGA 1U42A 3DETC 2XN9B 4HIIB 3O6FA 5CJXC 3Q6FB 1WAAE 3IB4A 4R0LA 1HWHB 4AL8H 5F6IB 1WCQA 2OI9C 3EYOB 3DYMA 4JQVA 4WUUD 4WFFD 1I9RH 4EI5D 1HK6A 1HQ4B 1A5FH 2F8VA 5D2NC 3ZHKA 1II4E 5T1LB 2H3NA 4WU7B 5ITBL 5BZWA 1GGYA 5HGAA 3WXVH 2VH5H 1FYTD 3K4ZA 4AEIH 2JJUA 5F70A 1S3KH 4OF3A 1U8PA 3T3PE 5JOPE 3Q5TA 1CQYA 4DCQA 4HT1H 4I0PD 3VMOA 1OLZA 3V5HB 4YDLC 3VRLE 3MLSH 3FQTA 4P2RD 2Z31A 1NANI 5B3JF 5DTFA 3TBWA 2WBKA 1HH6B 2L4OA 5FKPA 1PQZA 3QUMH 1T1XB 1NGQH 1V7NH 1BBJB 2X1OA 5KSAA 2AEPH 3KS0J 3BP6B 3TLRA 2A6IA 2DI8A 4U7KA 2ICWA 4HGWA 5F6HI 5J11B 2JCCF 1SM3H 5GRZA 4PJDF 5FHBL 2MPAH 1DN2A 1CIDA 5HHNA 1NC2A 1FZJB 4GKOA 1QFUL 4N8VA 3U7WL 1XR9A 3BPNB 3BT2L 1FN4B 4Z7WB 1C16B 4HS6A 5KSVB 1I8LA 3ZE0E 5I18H 4M5YL 3WNKA 3MUZ1 2ZOLB 1AXIB 1ZAGA 1JF1A 2BK8A 4HC1L 4L4TB 4LSUL 3RGVD 3CSYA 3FQNB 4YDJB 1GIGH 3DWTA 4XWGL 3BWAB 5FKAB 4RMVA 2HT3C 4XCFH 4G7YL 4KC3B 4KRMB 3MRHA 1JK8A 2FECL 1DQQA 2KPNA 5FCUH 5IK3B 5T5NG 1N6UA 4QYOA 5EIIB 1FZJA 1A9BB 5FYJH 3EGSA 4M7KH 1MCDA 1XR9B 4Q9BA 1C16A 1AJ7H 2A77L 5D2LE 3RDTA 4F9PA 3JWOL 4JGMA 4NKIL 3TZVC 5I1EL 4YIQA 3QUMB 3TYFB 2DDQH 4PJAE 3D2UB 2APFA 5C6TH 5IROC 3UYRH 3GI9H 3TN0D 1MIEH 2V5TA 1JK8B 2NYYC 2V2WB 3ULUD 1Q0YL 1EJ6A 2QJDA 4IM8A 5HI5C 5KZCB 3PHQB 5MEOB 3GNML 3VXSE 4G8EA 2D7TL 1A9EB 5C08E 3O6MH 3RDTB 4IRZL 4JANB 2FBJH 4XPHL 1SJEB 2ADJA 4B7IA 5CEXA 2ARJQ 1XF2A 1B0WA 3DGGA 1O7VA 3ARUA 4L3CB 3RUGB 4K2UL 4P99A 3W11C 1KB9K 4N0UA 4NHCL 2A6KB 3LH2L 2BHYA 1MNUH 4K94H 2HT2C 1AGCA 2XWTA 4IRZH 3MFGB 3BIKB 4GQPH 4Y19B 4M9PA 1J11A 4Z7VA 4ZXBB 4ZSOB 1IILE 1MCOL 1BBDH 1HYSC 1A9EA 3T09A 4YHMH 1R5VA 3QCVL 4ZFFA 4K3GA 1AY1H 4M6OL 4WHCA 4L4VE 2PTTB 5D6CB 1CDCA 2JIXA 1K6QH 1TVHA 4N0FA 4IIQB 4JFYB 1FNGA 4YXKH 5GISL 1CDBA 4LOUC 4MHHG 5D7LA 5IMLB 3KPNA 3VDBA 3PWNB 2E7HA 1FYTE 1LE5B 1MI5B 3MOAH 3VRIB 4MS8A 2AEWA 2D03H 3QNYA 1T03L 4MCZA 3QIUA 5DSCB 5C0BA 2XFXB 3BIKA 1M7IA 4NKDA 4HUUA 4LARH 4AT6A 4FG6D 4Z7VB 5DD3H 2NR6D 1JZ4A 1GIGL 5FYKL 3MUGB 2OSLA 4QLRA 1QTYT 2Z0BA 4LLUA 4WDIA 3BIBX 4OF5A 5CJQL 3KPPA 2VXVL 5E94B 1KBGH 1KC5H 2A74A 5IG7B 1HHJB 1QACA 1JWMA 1F4WL 4QHKJ 1MVFA 4L4TD 4HFUL 5FO8B 2DTMH 3BKMH 1XGYH 1BAFH 1LEKB 3OG6B 4P2YA 5FYKH 3ZDZF 5TQ2L 1ZWIA 3P0YL 4YC2C 4IOIA 1ETZA 3F5WA 1KN4L 2XZAH 2OJEA 3AREC 3TO4A 4ZNCD 3EJZC 1HEZA 3D0LA 4B0MM 1S8DA 5EOCJ 2IWGA 5C08B 1MIEL 3E1F1 3TNNA 3MPCA 2DTML 3WFEL 1A3RL 5TH2A 4JPWH 3CFKA 3E6HB 1CIUA 1U58B 2OTPA 5E7BA 2YPLD 4P46A 3QPQC 4GLRI 5EBGA 2BVOB 1KEMH 4DGYL 2YPKB 43C9B 3S3PA 5HHXH 5LCVH 2R8SL 3GMPB 4RRPG 1DDHA 3ZT6A 4DVRL 1VFAA 2E9JA 3TT1H 4DN3H 1KCRH 3T2QA 4WFEE 1TJGL 4L29B 2ADIB 4G6FD 5HYSB 3OKEB 4YQXH 4JREC 4N5UA 1FQ9C 4ETQB 4QXWA 4RAVB 2NZIA 4Y4FC 4G9FB 4F7PA 4LDOB 5TH2B 4ZS7L 4X6DA 1X5GA 3LD8C 3OB0H 4X8JA 3F12B 2Y23A 3O4OC 3OR6B 1GGIL 3L7FA 2X9WA 2FWOB 1FSKB 1EEQA 5L7XH 4URTB 1KULA 4M6OH 1ZT4B 3CLEL 4LARL 4WWKB 4FFYL 5GGSB 4MCYA 1YPZF 1A14H 3L9RA 5FAAA 5FHAH 4R6UA 5B3JE 3NIFF 5LWYL 1RUQH 2V2XA 4HXBL 1NCUA 2EIZA 5DD1L 5HYSA 5E6IC 4HPOL 2MPAL 2C1PB 5C1MB 1YECL 4PS4L 5JR1L 4D0BA 1K6QL 3VXRD 1RULH 2DQDL 4XB7A 3L3OA 1QRKA 3PWJB 4JZNA 2ZUWA 4J12A 4UU9A 8CGTA 5H94A 1FNSH 3NCJH 2X40A 1ORQB 1QRNB 1MJUL 3BDBA 4XH2B 2VLME 4HC1H 2MHAB 5FUCC 3SE8L 4YHOL 1Q9KA 4LFHD 5B4MC 1JGDB 2VL5B 5E2TH 2B1AL 5B38B 2X89A 4ZFZA 1AFVL 5HHMA 5I9QB 2XWBA 1LO3H 3WBDA 1A2YA 4WHTA 1OSZB 3MRPB 4MNGA 1JNLL 2YK1L 3L3OB 2AI0L 5EIQA 2VLRA 4ELKB 1FG9C 4FP8L 3KDMB 4NJ9H 3I50L 4TUJB 5T1LD 4S1QL 4R2GB 3C08H 3X11B 3WO4C 2E9IA 3ABZA 5D7IA 4POZC 1J8KA 3RGHA 1DUYA 1DE4A 3UXFA 1LHZA 1I9EA 1TLKA 2R0ZL 2DWEB 5DC4B 5LBSL 4MJIE 2YD2A 1EK3A 4NC2B 1OP9A 1NDGA 5C09E 3DV6A 3BD4A 1EEUA 5JIHA 1WFOA 2CGRH 3IU4H 4WI5A 4JFPB 5CSZA 1FL5A 3C2SA 5C08D 1RAMA 3H7BB 3I6GA 4S10A 3H3PH 1HNFA 5A40E 1OSZA 4MNGB 3SOBH 2AK4A 4X4XA 5FYJD 3OKYA 4OCXH 2J6EL 4TQEL 3KAAA 3EJYC 4CVWA 1EBAA 2NW3A 4Q0XL 1PKQE 2ZSVB 3ZE2F 3LRSA 2CDFB 1UEMA 3BGAA 4CNIB 4BZYA 5I8KH 5IR1B 3K2MC 3L5IA 3SDXB 3CD4A 3GSVB 5F3HB 3SCMB 4BZ2H 3VGHA 1BJ8A 3WXVL 5LKNA 4WFHE 1LD9B 3P30H 4XZUA 5GGRB 4J3VA 1DBML 2YD6A 4HG4J 1QSED 3QO1B 3RNKA 2PNDA 3HZKB 4ODVH 1J1OL 2G2RB 4PUBH 4QRUB 5ADOH 5J0BA 3VWJC 1M7DB 1DQTA 2X4QA 2YOCA 1XR8A 3GJFH 4OAWB 3U4BL 3OHXA 4P3CH 3QQ9C 5HYJE 4NSKB 4HKJA 3LEYL 2ERJB 1EFQA 3D39D 3VFMA 3QUML 2NZ9C 4P23C 3L3KB 1ZHNA 4KUCF 1TETH 1S7QA 1LD9A 3VFGL 1FNLA 5LJYH 5ACLA 3WEXA 4KPHH 5C0NC 2RJMA 4YDKH 5TE7H 3A6BL 3MZTA 4XTRC 4X0KA 4CMMB 4Z0BH 3K8KA 2DM4A 3RUGF 5JIKA 4OM0H 1N5AA 4P3CL 4KVNL 3NIDF 5DMIH 4X9GA 3S5LG 2XPGA 3QHZH 4Z5RA 5K9JL 5K9QG 1MRFH 2R2HB 3L3DA 5IHZA 1ERNA 1UCTA 2CKBA 3GMQA 3OV6A 4M5ZL 2B0SL 3IXAB 5BRZE 1LEIB 4YAQB 3FB6A 3LHPH 3QA3B 5KN5B 2YWYA 5I8KL 3T65A 1IAKB 3DX8A 2IAND 3KYNA 5CBEB 3U1SH 1EHNA 2ED8A 3DRTA 1RZ8A 3EOBB 5AYUL 4EUPA 3WSQL 1PFCA 3OF6D 4MJIB 4CJ0A 2XPGB 1QUNA 4JFEE 5AYQA 3O2WH 3UTTA 4P46C 3VXUB 3IDMA 4OKVB 4YXLL 4I3GA 4UOJA 1AHWC 4JO2H 4M03A 1LEIA 4XP5H 3QUXD 4P2OB 3AS1A 3DBXA 3MA7B 1KIRA 5SWZE 2J8UF 3U83A 5DS8A 1NPUA 2VNCA 1C5DA 3K8MA 2DKSA 3K46A 4XB8A 4RNRA 1XGRA 4F7EA 2FX8L 3NZ8A 4EQ3A 4I0KA 5IMMB 2R1XA 1W0YT 3T0EB 3B9VA 1KV3A 1ZVHA 2XN9A 2XZCL 1UZ6E 2VLRE 3HPLA 3IKCA 1KB5B 4B50A 3ORJA 3VXTB 1N59A 1U0QA 4DK3A 4TTDD 1L7IL 1CG9A 2XV6B 4HJJL 4NO3A 5GZOD 1VFBB 3PV6A 2J1KA 2H26A 2H3NB 5BZWB 4LP4A 2J4WH 3G5VB 1E0OB 5C09A 5JQ6L 3QUZB 2CK0L 1E4XI 3MOQA 1XGRB 3U30C 5CJ5A 4F7TA 3OJVC 4NWTH 3VFVB 1X7QB 3KVQA 3VGGA 4TYUA 3RX7A 2VUOA 1KN2H 3C9NB 3FONA 2AJSL 3QNZB 2IQ9H 3CIQA 4P9HL 1E27A 5AZ2H 1YEFL 1ZS8A 5BZDA 1VFBA 4MJ6A 5HVWA 4OGZA 4IRJA 4M7JH 4P5KA 3LPWA 1N3NB 1FDLH 4LVNB 3P4NB 2OL3H 1P6AB 4JPKH 5AWNH 2I07A 4NZDA 3PQYB 4N8VG 4XBGA 1K4DB 1A4JB 1F3DJ 1T66D 4H1LB 1T1ZB 2CMRH 4Y5VC 5GGSY 3BSZH 3FQUB 3Q1SL 2BSSB 1KJVA 3WDIA 1ZS8B 4L8CB 3GBMH 4EBQL 2BY3A 2P7TA 4KMQA 3K2UH 4AENB 4UI2A 2W59A 3TH4T 1FV1B 4L3AA 2D7QA 5DMKA 1KB9J 4LPWA 5F44A 4PRBA 1GGCL 4NO0D 4XBEH 5JW4Q 2VAJA 4PR5A 5CMAA 1BQHB 4PRIE 2SEBA 4X6EA 5F7MC 4QNPE 3MRHB 3PQYA 4MNQA 4PRNA 1K4DA 2FB4L 1SQ2N 4XAKE 4NO2B 4MD0A 3DGCR 3C5SA 4JKWA 4Z7QF 1U93B 3RWDA 2ZJSH 3WLWC 4CU8A 1NBVL 5DC9B 4FZEH 2VZ1A 4G8GD 4LCWD 5EC1B 4ZOEA 2P7TB 5F96H 5ESAA 3BH9A 4OIBA 2P5WB 4UTAL 4CN6A 3JWOH 4C56E 1UENA 4I3SL 2EO1A 1MLCA 4I2XA 1JNNL 4IJ3C 2W0KA 5I1EH 2OZ4L 4OFIA 3CMOL 4J4PD 3G5ZA 1MCWW 4QOKB 1DEEB 1IGCH 4GXUN 3V6BR 1NLDH 2X1WL 4NQSB 3HLAB 3IYLW 4IRSC 1A1OB 3QUKB 4PREA 4J1UB 1SY6H 2NY1D 4GFTB 1DP0A 1EXUA 3RY6A 3FB7A 5ICYB 4XCFL 3SDDA 4F57H 4H88L 5IOPA 5F9OL 1MHPH 4FOMA 4Y2DC 3SGDI 4U3CA 5I74C 3MR9A 5DR5H 1KCVL 4XP1L 3UTTE 4U7SA 3CK0H 1UG9A 1FGNL 3G5ZB 4HFUH 4KHTH 3KLHD 3HAEB 3HCVB 1UB6B 3WNMA 4NQSA 1DQJB 4NM8L 5F7KC 4PJFB 2YD9A 3X3GL 3HB3C 3KYAA 3L3HA 1TVHB 4WFHD 5D71H 5SX4I 3WXWH 1IAIL 5JW5A 1WC7B 4U05A 4UV4L 1K85A 3RUGE 1BVKA 1ACYH 1UC6A 1XGQB 3MGTA 4LNRA 4MYWB 3ZSSA 5TJWK 5LGHH 2FB4H 4UIMA 5CP7A 4OKDA 1XGTA 1RUMH 2NY2C 5TGBA 3ROOA 5C7XH 1NCBH 4O2EB 1NBVH 3QFJD 3IJYA 2O26U 4X6CE 3C2AL 5HD8D 4OJFL 3KHOA 1K5NA 1I9JL 4LCUB 2OSLB 5BV7H 1F4WH 3SO3B 3HKFA 3VCLB 4PDCE 2ICCA 1SEBB 3KPPB 4QKXB 3QDAA 3EYUH 1H5BB 3FO0H 3ARFA 3TVMB 1ZOXA 1OAXL 4KV5E 1QFHA 5JHDA 1OTSC 4Z8FL 3R1GH 2OR9H 2VTFA 4MXWH 1D9KA 1EERB 3GGWB 1IGTB 3SE9H 1I1FA 3GUTA 3BQUD 5A43C 4JY5H 1T21B 3F5WB 4KDTC 4Y19E 3RWFB 5T3ZL 4GG6A 1AGFB 4LCCA 1F5WA 3D0LB 3QIWB 4X7DC 3LKNB 5CZVL 4DOHB 1HKFA 5IMOB 2WINB 3RRQA 3TH2T 1XF3B 4KJQC 5GRXG 3VXNB 2K1MA 1KLGA 5E99L 1OM3L 3SDXE 2D03L 1GGTA 2NY7L 4AQ1B 2MWCA 1TPXC 3WS3A 43C9A 1CQKA 3AB0C 1RUAL 4KFZC 1IGTA 3BXNA 4TN9A 2OR8A 3V5DB 4DN4L 1GPOH 3KYMA 5T5NF 4IMLA 3G6JB 1OD7A 3OKNA 3GJFK 5DRXB 4TULH 3VXMD 3AS0A 3ZKQD 2J4WL 4GG6B 2DQGH 2UZIH 3BZ4B 4N90E 1HIMH 2WUCL 3LKNA 3R06A 1U8OA 3QFDA 5I19L 3GBLA 4RQQB 3S34L 4HUWB 4PP1C 4QOKE 1UWXK 4OUOA 3RJQB 4AG4L 4X6DB 3EIFA 5GRVK 4NQEB 1DL7H 3V95A 4JB9L 2QHRH 4QRSA 3BN9D 5HHPB 5I0DA 3V5DA 1JYVA 4YHLH 4NHUB 4FTVD 2IANB 2WLYA 1AKJA 4U49A 4OZGB 4HS3A 3LDBC 5ESVB 3A67H 3QAZB 1RHHA 5E5RB 4M93C 5J9PB 4S1DC 5EU3A 3E2HA 3L3IA 1PGRB 1VENA 5T33L 2QQLH 4Z7UA 1NUGA 4WW1A 5J3HC 1MFAL 1KJ3L 2WV3A 3MLUL 4Q7DA 1XGUB 2NY4D 1EZVY 4K23H 3O45B 4ZO6A 4BFIA 3PWPE 4XVJL 4OCMC 4WVRA 1LE9A 2J6EH 4TQEH 3IETA 4A6YL 2VERN 5T3ZD 1WEJH 3QG7L 5DA4A 1T1WA 4N0UE 1MHEA 4UB0L 2PCPA 4TSCL 4PJ9C 2GT9A 4L1DA 3E2HB 2H2PC 4W4NA 4LLMA 1I1AC 4U1GB 2OQJB 4RMRA 5GPRA 4Z7UB 3MRPA 1KPVB 3JV0A 1I3RA 2PYEA 2EDWA 1IC7L 4TUJA 1X5AA 2R1WB 4P46D 2FEEI 4LHJB 4F37K 5ABDE 5IVXA 4IS6B 5D93B 1JIBA 2DQCL 3LVEA 1REIA 3GMNB 1RK1A 1MREL 1SHMA 5D7LE 3VG9B 3WFCL 4LIQH 4ZFOA 2IH1B 2ZNWA 3CSGA 4MB5A 4OCSL 2H32H 3QIWC 4XPGL 2A0LC 5GGUB 4TOYH 3LIZH 5DC0A 3WUWG 3DVIA 3DXAD 3MOBL 4PJXE 2AEQH 4JFPA 1U2CA 4LLMB 1FVDB 3MLYH 4ZPTA 4EIGB 5IQ9B 3EZJB 4AK1A 1I3RB 4EDWH 4B53A 2CLRA 1ORSB 1CLYH 4JHZA 5JQHC 3EDJA 4Z7WA 2V17H 3MRIB 4OLYH 4L4TE 4MLIA 4PRDA 1J0KA 4P4KD 4EDXB 5E8EB 3LN5A 1CYGA 4K7PX 2VLKA 5JDJA 3C5ZA 3T3MF 3CDGA 1CFVL 4TRPL 2EDXA 3S7GA 3RU8H 2NLJB 3U6RA 3ULSB 1U91B 5JR1H 1FPTL 4ZUWB 5KSUA 4L5FL 1PG7W 4KJWD 3MJ9H 3TBYA 5C8JB 3GMLB 1F58H 1RUQL 2DQFB 3WFZA 3QQNA 2W0LA 4UUJA 4YDKL 1FGVH 4PRAB 4C83A 1LWRA 2C4XA 3B9EA 3BVNA 1YNTB 3ARDD 4OQTL 4JZOA 3SE4C 3KYOB 4HH8A 1BEYL 3LN5B 1ZA3A 4J3XA 5HY9B 4LKXA 4R8WL 5DQ9B 5E4EB 2XTJB 4LDEB 3QUMA 3TYFA 1KT2B 2GHWB 1N4XL 2GK0B 1RZJH 3BP5A 4LCYA 1U91A 5JTWA 5KSAB 4ELMB 3EAKA 1NFIA 1UYWH 4HFWA 4JZJB 3B8YA 2JF1A 1YEGH 3N9GH 1D5XB 5B39G 3H9HA 4P57B 3WEXB 2DQCH 1NMCC 5E2JA 1FO0B 5ENWA 5C0AA 2BY2A 4E5XB 5I15L 2ADJB 4OZIA 1ZA3B 2DQUL 4HDIA 2W38A 1SBSH 1WZ1H 2DQEH 5KVEH 1A7OH 3BIAX 3OKDA 2OK0L 2KQMA 3PWPD 4BK4A 4JFZH 3PGDA 1T3FA 3ARRA 2HVJA 4UB0H 4XT1C 2E7LA 4ZYKB 1G1YA 3VRLF 1LO0L 1EHLH 3PIQA 1ND0A 1V3KA 1FG2B 4P57A 2Y72A 4JPVL 3VD3A 1U8LB 3QXTA 1Z9SA 4U6HA 4Z78A 5ENWB 3M8OH 1RIUH 1OTUC 4MGXA 5E08H 3IU4L 1XF1A 2CGRL 5F3BA 2ILLA 4NZUL 5D96C 4HWBL 2BERA 2FL5A 4DW2L 2W9LA 4BA8A 4V3DB 5D7LB 4ERSH 5DJ0A 3IDGA 2FJHA 4M8VA 3R0NA 5GGTA 1F6AA 1W0WA 4APQA 1MI5A 2VR9A 1F4YL 3T0XA 4ZYKA 3IT8D 3GSQA 5EZJA 1FGVL 2VXQH 1MFDH 5GXBB 4NKDB 1N64H 1OPGH 1F42A 1MWAA 4P23B 3AROA 5INCA 3DBXB 2X09A 4NZTH 1UZ8B 2YPVL 1HXYA 5C2BH 3BH8A 43CAA 2JB5H 4MS8D 2UVFA 3ILPA 4F7EB 4PLNC 1HZHL 1P5VA 2A9NH 3QFJB 4Z7OE 2O61B 1F6AB 4ODBD 1ZVSB 1KB5A 3EO1A 4ZAKD 5BRZA 5EA0H 3WUZA 5T3XL 3FN9A 4Q6IA 3C6LD 3D85B 3GMRB 1QFPA 4NO3B 4HJ0D 1MWAB 4GBXC 2F8OA 4M1GL 2YN5A 3ARBD 5C9JA 1YYMH 3G5VA 2Y6SC 1CU4L 5CFHA 2KQNA 4JJHA 1VFUA 3EO0A 5BJTB 2I24N 1NCBL 2VE6A 3MO1A 1GL4B 1KACB 3CAFA 3PL6C 5LAXB 3O8XB 2VLMD 1S5IL 3O2VL 1ZVSA 2BHZA 1TVBA 1CF8H 2I25N 4YDVA 1FNAA 1OARH 5M7QA 2VABB 2W0FA 4Q6IB 5SWZA 1WGOA 2O93L 2CH8A 3G04B 1Z9LA 4G43A 3F6LA 2R2EB 1QNZH 4L29A 4KDVA 2P47B 2J7LA 1U92B 5F7UA 1MRCH 4RX4D 5GHWL 1EMTL 5A2JH 1BD2E 4P5KB 2X41A 2YPLA 4O51A 1AR1C 5FUOH 2NX5D 5ACZA 1KN4H 2XZAL 4POYA 1LQVA 1A6WL 3SKMA 5GSRB 1AGBB 2A6JA 3IGAB 4XNZB 1IM9B 2WQ8A 5DJYB 4OGAC 2CK2A 3M1BB 1OTSD 2VE6B 2BNRE 3FQWA 1CD9B 1JPST 2NNAB 5CINL 1D5IH 3RVVD 1YEJL 3QIBB 4P9MH 3NFPA 1A6UH 2BJML 1S7VB 4ZUVA 1L4IA 1PW3A 2MMXA 2HH0H 4ODHL 3UTTD 2PYFA 5ISZD 2EDHA 5C07B 2EE6A 4O51B 5EWIL 1P4BH 1PZ5B 5GS0C 5IF0A 4P9ML 5I66B 2K9UA 1BQHA 4R2GD 1SY6L 5CUSL 4KK9D 4X6EB 4ZUUB 5HPMA 4M61A 3SKOB 2ED9A 3HN3A 3QI9A 2H2SC 4WTWA 3KPTA 5CINH 2YXMA 3TJHC 3UJIH 2F74A 1I3UA 2ADFH 5HGHB 4MD5B 2AEIT 2VDLH 3QEGL 2P5WA 3BPCA 2EZ0D 1HI6B 5IGXL 4WFGD 1MHPL 3QWQB 5GGVH 5HHMB 3TIEA 1ONQA 5JPMA 3OKKA 4PJBA 1P4BL 4RGOL 1K8IB 3WS6C 1KUMA 4N9GA 4FQ1L 3WDJA 1A3LH 1HHGA 4WGVB 5AZEH 1ZGLA 2VISA 4D8PA 4CVZB 2YRPA 3U7WH 1DL7L 1A6ZB 1UA6H 4POZD 2YSSA 1A6WH 1ADQA 5JMRA 4JFEA 5DHXB 1KG0A 1CD1A 2R56L 4MQSB 1EO8L 5F72S 4G7VH 1RFDH 1FL5B 3G6JF 1CXIA 3RPKA 2FYYB 1XZ0A 2QV2A 3IDIB 4KMLB 2NY5H 2F9BT 3D1MC 2DL9A 4GBXD 5DMYA 1NDMB 3T2OA 3RAJH 3GO1H 1H3TA 2N56A 3IDYC 3DXAB 4JRXB 1L9MA 4LF3A 4UIKL 4X6DF 1JFMA 4ZO8A 4DTGH 4M7LL 3MXVH 1P4IH 1L6ZA 12E8L 4NQDB 4GG8B 5H8DA 4X6BB 3K2UL 3MV9A 3S98A 1DQLL 4G3YH 1RQ5A 5FYJL 2WIIB 2OZ4H 4WV1B 4TVSa 1YPZA 1IBGH 3NFSL 3GIVB 1I9JH 4QWWC 1SEQH 3UC0H 4U6VL 2GTZA 4RSVA 1MF2L 3RNKB 4IJ3B 3VWKA 1RJLA 3QDGD 1VFMA 4PJ7F 1K5NB 3N1PC 3GNMH 1YJDL 4NHCH 3OWEA 2HT4D 4EZMA 4JRXA 4LF3B 1CCZA 2HRLA 1XR8B 5GS0H 3AU1A 3W9EB 3OAZK 1IZJA 3MV9B 2HLFC 1W2KT 3V4PH 2A1WL 2DLIA 4PGCB 5I17A 2BNRB 5FEBA 3C8KB 5DZNA 3GM0A 1ZHNB 4LRIC 1NBZB 3ARDB 3TFKD 3GMMA 1DUZB 1FNFA 5E2WH 4WY7L 1AGDA 1T21A 2X1QA 4BKLA 4YXHH 4WEBH 5HI3D 5HHOB 5I8OL 3RWFA 5F97E 5GGQH 1F2QA 5SV3A 1J1OH 1B9ZA 5F89A 2Z31C 2Y9RT 4UV4H 3MX0A 1ZHBA 1INEH 1YQ2A 2XQBH 5JW4M 2M1KA 1U8NB 2DLTA 4IIQC 3UMTA 4D3CL 1WF5A 2DQIH 4XCYA 1OAUH 2DBJA 3FRUB 4I4WA 5D7IF 1RJZB 2HFGH 4NUJB 1CR9H 3TYGL 3ZE1E 3IJHA 3TA3A 2W65A 1DUZA 1KCVH 5IHZB 3RZCA 4IMLB 2PTVA 2Y07L 4ONGH 5FA4A 5CHNA 3NIGE 3FZUC 2LU7A 1HINL 5BW7A 4JKPL 2CJUL 3BKCL 2BOBB 2EEBA 5ID0A 2BDNH 3G5YA 4IOSD 1KCLA 5JHLL 4R96A 2AXHA 3DRTB 5J89A 4KMTH 4F9LC 4XWGH 2QR0A 2FX7L 5HHPA 4OZHA 4LBEB 5D1XB 3DURB 2GSIB 4Q74A 3ZTNL 1MH5B 5I71C 5KSAC 3FFCA 4QHNB 1J5OH 4N8CL 4YLQT 1A4KB 1NCWL 5JORB 5IBUG 3IS0X 3N9GL 1HSBB 2YXFA 1CL7H 4JZJC 3CX5J 1OAQL 2P4AB 5DGQA 4W81A 1A6AB 1H0DB 5EU3B 3KPRD 1B2WH 2VDNH 5CZXD 1IT9L 3OAZH 3VW3H 4M6MH 2ZJSL 4KUZL 1I8IB 4AEHL 3V5HA 5C0IB 2NW2A 15C8H 4N0YL 3NH7L 4WTXA 3FQTB 1MCPL 4TSAL 2YZ8A 4JVPA 3TBTA 1UJ3A 1BZ7A 4X7SL 3IETB 1MUJA 1JPTH 3CNKA 4WUUE 1OAYH 4JFDD 2X4TA 3ZTNH 4DUXA 4AIXA 3BP6A 3QZWB 3BE1H 3QRGL 1A6AA 1CDUA 1H0DA 3CXHK 4E41E 4C59B 4MSWB 2VH5L 4KVCL 1DBMH 1CZ8L 3T4AA 1RVFH 3OKLB 1MCFA 1MREH 4NN6B 1T83C 3S37X 1ZA6B 1JI1A 1KJMA 4B5EA 5L6YH 1M71B 1MJ7L 5ADOL 3V2AR 1FZOB 2EXWC 2D0FA 4DWHA 1JMXA 3NCCB 2PW1A 4BSWA 1QSEE 2IEPA 5HGDB 4N0YH 4NO0B 4DGVH 2ZOLA 1FBIH 2UZXB 5D1QA 2BVPA 5E6IB 3C60D 1JF1B 1DBJL 4MXVE 3QZWA 2NXYB 1MJ7H 1OAYL 4OLEA 1MFAH 3V7AG 4P5TD 1OGTB 5EU4A 2G5BB 1UM4L 1A4JA 5FK9B 5ACMA 1F6FB 2CLRB 4G8GB 4LCWB 3P30L 3U9UB 4KDWA 2VSCA 5KSBB 2LV4A 3TBSA 5IFHH 3QHFH 4E0RA 5HVFB 3M17B 5I76B 4KDTA 2PTUA 3OX8A 5SX4H 5D6DC 3DX7A 1F4AA 3B5HA 3ZT5A 2F15A 4ORGB 5BXFB 5I9QC 3ULSA 4HQQH 1URLA 3QDMB 1ZLSH 5KSUB 1J5OL 3OXSB 3LN4B 5EU5A 5ANME 4HK3N 2J8UA 5EBLA 1I85A 4QRTB 1VSCA 4NQXA 5C6PB 4L5FH 4C83B 4YEEA 4GSDL 1EGJH 1S7XB 3RFZC 3LQAL 4M93B 2EIBA 3P0YH 5ESQB 1UH4A 4NCDA 1RZJL 4APQC 2WBJB 4FMKA 2DQTH 5FM8A 1HHHB 4HKBA 3FKUS 1DVFA 2F53B 4PJCB 2NY3C 4X4YB 1Z0MA 1D6EB 1IM3B 3S96B 3MC0A 2JB6A 2E9WA 1E4JA 1PEZA 2GK0A 5D2NE 5IWLC 5HJ3B 1K2DB 1G0YR 1RZIB 4OIIL 3FHAA 1KPUB 4HFWB 2A6KA 1E6JH 3OXSA 4KKAC 4MA3B 4RX4A 1UVQB 3HZMB 4XBPB 1RU9L 2YA2A 3P11H 5HVHC 3T0BA 5IBLD 3MRDB 1OTTD 1R3JA 4I77L 4JE4B 1QSFE 4J4PC 5IB4A 5JXEC 3NCYS 5HHMD 1KENL 3KYKH 5D6CA 4OZIB 3EZ8A 1HH9B 3CFEB 4IIQA 4Y7MA 3HE7C 3RU8L 3WE6A 4AEEA 1D6EA 2C9AA 1EH9A 4G80A 3PGDB 5IOPB 4M62H 2JB6B 4RGMC 2BMKB 5HJ3A 4LPCA 1H3UA 1IAOA 4YX2H 1JPGA 2D2OA 1MCHA 1P7QA 4QT5A 5DSCA 5ISZA 1M7IB 2X2YA 2FNBA 1BJ1H 1NUNB 3N85H 4M4PA 5IROA 2DQJL 3HAEA 3HCVA 3FT3A 1SYSB 4WUUB 4OQTA 4HUVB 1TCRA 2HFFA 4PV8A 2FEDD 3B9KD 1HH9A 2FL5B 1GAFL 1BVLA 5EORH 5EU6A 5TE7L 3GSRB 1A3LL 2RFXA 2GQHA 3F7YA 5AZEL 5TDPA 2X4PB 4OD3H 5FO8A 1CLYL 4ONGL 2NXYD 4MVBC 1LEKA 2ATPB 5DWUL 4YPJA 3MQIA 2AABL 2VXSL 1IGMH 4DFIA 2FHFA 2CLZA 3MNZB 3MBEC 4O2EA 2ITCA 1BZQK 3HI6H 4MA1B 3CDCA 1CTNA 3V6OC 1NC4A 2Q76A 4FQ1H 2AJXL 2ARWA 4JDTH 4WUUA 5FECB 1HXYB 3SGEI 2XY2A 5HHQB 3NFNA 3SBWA 1FORL 1G7HB 5JNYA 3NA9L 4GRWB 5CEYA 3HNVL 4GW4A 4UT9H 3DJ9A 3TJHA 1XIWB 4WI7A 3DO7B 1G7MB 4EUPG 4XNQA 5I0ZA 3BMWA 3LB6D 1JPFA 1ZHLA 4OLXH 1UXWA 1V05A 3EO1B 5BRZB 2YBRB 4OI9A 3TFKC 3UBXG 4X6CB 2XKSA 3A6OA 3SO3C 1P4IL 2GFBA 4H20L 4YGVA 4JFED 2DQHH 4R7DB 4JR9L 3MLXH 1HWGB 3RVWD 5GJTL 4XCCL 3FMGL 1IGJA 5IMKA 4KHXL 3ETBF 2BNRD 2Z31D 1F90L 3WD5H 3G5XA 4G9FA 3EYSL 4JKKA 4F7PB 3QULA 1G7HA 5JNYB 3NCEB 3X13A 3GSNH 5KVGH 4Y88A 1U8IB 4BQ9A 4GW4B 2HN7B 2JCCB 3K0WA 4I48A 1J1XL 1UH2A 1BD2D 4H20H 3KNBA 4FABL 1UH3A 4YDVB 1GZQB 2AXFA 1MFNA 3BISA 2ZKHL 1NSNH 3EFDL 2L0DA 1NC2D 3I6LE 5F96L 2V9TA 1F8TH 4XP6L 2FHCA 3MMEB 1J8HD 5D4QA 3RA7L 1A8JH 4AY0A 3RVUD 1B0GB 4KKBD 3QULB 2J3SA 4LVHB 1KIPB 1CFSB 3MRNB 1JZ6A 5DJYA 1U8IA 4G9DB 2E27H 4NQEA 4MQ7B 3CDFA 4OLUH 3GHEH 4GAYB 1I1YA 1MFEL 2EEDA 3LQZA 1X44A 4XP1H 1EIBA 3QEUA 1OW0A 1A6UL 3C6LB 3D85D 4YXKL 2D0GA 4HK0B 4HS3B 2VAAA 1NSNL 4GW5B 3EFDH 5ESVA 4NT6B 3RTQA 4HF5L 5J9PA 4M43H 3MRCB 3OGCB 2DQGL 4CADB 1WSST 3S36X 3X12A 1BJMA 2BCKB 4Z76A 3ARZA 5D5ME 4IOFD 2DYPA 5C0CE 5HDLA 4ELKA 1CFTB 5IJVA 3P4MA 1ZGLM 4U4BA 3EYVB 3ZE0F 3LDBB 2VITA 2OTUB 3SDYL 4P3DA 4P2QB 3MOAL 3RWCB 3TCLA 4MVBA 3VMPA 1CDIA 3REVA 1T0NA 3RAJL 1JV5A 5SWSB 2P48B 3MUHL 4HLZH 3DROB 3MLZH 4OCNC 2AJSH 3VXSD 4YDIL 2ESVD 4PG9A 5IW6A 5FYKD 4CJ1A 1UM5L 4OJFH 2R1WA 5FUZH 4JGUA 2OLDA 2OR9L 4MXWL 5IB2A 1MCRA 4K7PY 3UYRL 1YN7A 4I18A 4KGJA 4J3TA 1T5XA 1R3IH 1TQCB 3QUYD 4XHJC 3QFJE 4JRYE 3T2PA 2YSSB 1GOFA 1WIOA 3TCLB 4PRPD 4ZFOB 1C5CH 3RHWK 5DUBB 3EHBC 1QVOB 5GGUA 5SWSA 3ARVA 4XCCH 1YEEL 4I0PB 1FL3B 5E8OA 4WEMB 3MNVB 1FE8L 4AH2B 4LU5H 1ZT1A 1C1EH 1XCTA 5IFJA 3IDIA 3IFOB 2H1PH 2C7UB 3QO1A 4FXLA 1XF5B 2R9HC 3HC4L 3QDJB 3V4UH 1NDMA 2YMXH 3SDCC 2VR4A 4OCWH 3QEQD 3S97C 1RZ7H 4PJIE 3OAUL 2P5WE 1CBVL 4EDXA 1TIUA 4ZSOE 4JO2L 4MDJA 3WFDH 25C8H 4GLRH 3L3GA 3CDGB 2VZVA 2J6EA 3BEWB 1IL1A 4LVOB 1ZT1B 4XI5C 2JJVA 5CUSH 4RFOL 5DD3L 3KJ4C 3SCMC 3TBYB 3EW3B 4OZFB 1G6RB 2YC1B 4DKEL 4N9OB 2EYSA 3O0RL 4UUJB 1T03H 3KPOB 1YNTA 5L8LB 2IC2A 3AGVA 4F7MB 1KC5L 4X0KB 2W1NA 3U0WL 5LGKA 4KRLB 4LKXB 3VWJB 4RZCA 1P2CA 3LMJL 3H3KA 3QNXB 4EI5A 2P8MB 5GIRA 4M5YH 4ELMA 4KZEL 4EXKA 2VQ1A 3HC0B 4JY4B 4XVTH 3CFJA 2L7JA 4JO4H 4K3HA 32C2B 1G6RA 3MV7D 5HTSA 5HHOA 5J6HB 3QI9C 5KN5A 2GITB 2ZP0T 3T65B 5E4EC 3ZKND 4X7CC 2VLJE 2YD8A 5B22A 4CVXB 5MERA 1U95A 4GKNB 3K81A 5IVZB 3LZFL 3OKDB 5CD5D 4K9EC 2J5LC 4L8SC 1IARB 3V6OE 1T3FB 1UJ3C 3QNXA 4R8WH 1AHWA 5LXGL 3VE0A 1IC5L 4NUJA 1W0VB 3TN0C 4XGZB 1OQXA 2W9EH 3TA3B 3GBNH 3L95A 5EU7C 5JHDD 3VXUA 4YHIB 5JZ7D 1XH3B 1JZ8A 4QRPD 2YUVA 4PLKC 4OLZH 5CIPH 4MLSA 2VDPL 1JGUH 4F15C 4HBCH 5F3BB 1H9VA 2MCG1 1DBBL 1TQCC 3V6ZB 2Q87A 3GBML 4PJXF 1Z9OA 4EBQH 1MELA 4I8DA 2AJVL 2B2XH 4H5SA 2VN4A 4ZAKB 4OCSH 3TVMC 3PL6A 1S7TA 4JG0H 2Q8AL 1INQB 2VJXA 5GZNC 4OZHB 1YYLL 3BEVA 2NTSP 3FOLB 4F9LA 1DVFD 4PGBB 1E6JL 3DMMB 4PV9A 1IEAB 5HHOE 2BY0A 2IAMC 3QDJD 4NFDA 4KUZH 1X3DA 2HP4A 4HH9A 3CCHB 4ZUSA 3MLYL 1AE6H 4H25A 3B9AA 3BUTA 5HVHB 2ZUQC 2ADGA 2R0KH 3GB7B 4WO4D 2B4CC 2WWMC 4NZJA 2AKRA 5JXAH 3C6SA 4DVBB 4OCXL 5FDWA 1T2XA 4PY8J 3TBTB 5KVDH 5F7HA 1BZ7B 4RGMB 4JEGB 2ZPKL 1J1PL 3LEVH 1AKJD 3S35H 3O2DH 5E8NB 1KCUH 4FP8H 2Q6WA 1BFOB 5LAXA 2NY0B 3SCMD 1HE7A 2QQNL 4FFZL 1LO3L 4R4NC 1ZLUK 1IEHA 3DRQB 1LQSR 1JHKL 3ARYA 2UWEB 2CDEB 1FZOA 3P40A 5SWZB 5AUMB 3TNMB 1JYNA 1C12A 3G04A 4G43B 4KKCD 4XWOD 3O2DL 1Y0LA 4PRHA 1TMCB 3MRQA 4OM0L 3RZCD 3L5JA 4KJYA 1U41A 3RVTC 2YPLB 3LKOB 4H26B 5ACZB 2X5PA 3SKMB 2RGSA 5E1AB 4HQQL 1NEZA 4L9LB 4OF8A 3IU3A 3F58H 3FHQA 4WI6A 3D0VA 1HOCB 1TCMA 2J5LB 1I1RA 1LVEA 3H0TA 4JFOA 3GSNB 2X6MA 3DNKA 3LS5H 2FR4B 4HXAL 3U9UA 2X4UA 1TZHA 3MCKA 5DD0H 5L2KA 3UJJH 1LO4H 3VGAC 4MA7H 4GXUM 1UCBH 1WCBB 1Y0LB 4BFEA 3RNQB 4M6NH 1TMCA 5DHVH 1YZZA 3RWHB 4LEXL 1KSRA 3LCYA 3FQNA 3MXWH 4YDJA 1MLCB 1DBBH 3QO0B 2QQKH 2NY1C 4Z18A 4YHNB 5IW3A 3HHRB 1I9RL 2ITDB 1Y6MR 3MA9H 4QYOB 1VKXB 4RISH 2ZUXA 3SKOA 3RDTC 2YS4A 5K9JH 1AD0A 1S9XB 4LSVL 2G5RA 1R3LA 1X5LA 1S7XA 2F5BL 1NCTA 4TRPH 3QUKA 4KJPC 3FCTA 5SWQA 4MD5A 3V6FA 2IAMB 1K2DA 2EZ0C 4GJTB 3GHBL 5HYEA 5LG1A 5A2KH 3HG1A 4QXTB 3SGJC 1N5YL 1SJVA