2VABB

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
molecule tags Complex (mhc i/peptide)
source organism Mus musculus
publication title Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb.
pubmed rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1994-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vabB00
4QGTA 4DVBB 3RY4A 3U0PB 2HTKC 2YXMA 1P1ZA 5CINH 1XMWA 2VITA 2X4SB 3SGDI 2HFEB 5HYFA 3C8DA 1PYWB 4JO4H 3PDOB 3L3JB 2C1OB 1DR9A 3Q48A 3JSSA 4O2FB 1ACZA 2QHLA 1C12B 1U8KB 1PAMA 5IR1A 4NZUH 4CVWA 4NKDA 1I85A 4Q9BA 8FABA 3TC9A 4Z77B 4FFVC 4PJBA 1KCKA 3VG9B 2V2WA 3QWOA 1S9KC 2EKJA 1MWAH 1U3HC 4LSPL 3MV8A 1JHLH 3MZGB 1UM5L 1WF5A 4HS6A 4X7TA 3RBSA 2IH3B 5L8LB 2IADA 4XC3H 4HLJA 1IEBB 2B5IC 2IG2L 3VGAC 1QRKA 4DAGH 4KJYB 5IF0B 5ABDE 3BSZH 3R06B 3AROA 3HMXH 5DRZB 3GO1L 2GJZB 4UTBL 2VLLB 3X17A 2BMKB 4GQ9L 1XCTA 1CDJA 2AJZA 5E95B 4HWZA 5B22A 1H8OA 2AEPL 3QZWA 2HFGL 2IMMA 2MOVA 1GGTA 2BDNL 1I7UA 1CZ8H 4U05A 3MACH 4ESKA 3SE4C 1NDGB 3ISWA 2FYYB 1G7IB 1D5MB 2YD3A 4HMDA 4IDLA 4KI5D 2P5WB 3L9RB 2X4SA 3LEYL 5IQ7L 4HUKB 3FAWA 4Q9RL 2R0LH 5FO7A 3SJVD 3NIGE 2Z35B 2ICCA 4PG2A 3RVVC 4Y4KB 1AGEA 3ZHDA 2CIKB 2J88L 2VR9A 1IKNA 2XKNA 5KSAB 3C5ZA 2ESVA 3ARDA 3IFLH 5FA4A 4O2EB 2CUMA 3NGBC 3C60D 3TA3D 3TPUB 3ARZA 5MHSD 4GKSA 3QUXD 5GRJH 3TFKC 4N1EA 3ULUE 1EXUB 3T3PF 5C0EA 3W0WB 1E4JA 1C08B 1HXMB 4G7VL 2K3TA 3P9LA 4ODXB 3D69B 4Z95H 2DQUH 1RV6X 1JZ4A 1N0XL 1QSZA 5C09E 3QUZC 5IW1B 1JRHL 1DLFH 1PG7X 4QRPA 3VXRE 3B6SB 4KWUA 5B3NA 5I1EL 5L7XL 1T22A 1X5IA 4MCYB 5DK2B 4ZXBD 1IAII 2EEBA 1DQDH 4KZDH 1P7QD 5ICXB 1G7PB 2BNUB 1CFTB 4K7PL 2ZUYA 3LVEA 2P49B 3BT2H 3TFKD 4KRPB 3FMGH 1V3KA 5T1LD 4WHYH 2YD4A 2NXZB 2Q86B 3LS5H 1EZVY 3SBWC 1CFQB 3ULUH 5MEOB 3LY6A 2C7UB 1OTUC 2EIZA 3V52H 3H3PL 1QPXA 3RHWF 4P23D 4KKNA 3MR9A 3THML 3TNNB 1JGUH 1UM6H 5CEZL 3HFML 3T0AA 3MODH 1X5AA 1KJ2A 1Q1JH 3Q6FA 4IOFC 5IW3A 1ES0A 1PKQA 2CK2A 5C9KA 5IB3A 3VFUA 2P5ED 4B0MM 4WUKH 4N8VA 1ETZA 4HAFA 3QIUB 2NLJB 4MWFA 5K9JH 4LQFH 1I8KB 4C55A 4UBDD 4G3YH 1DQQA 4U1NA 2VLRD 4OI9A 2Z93B 5BVJB 1OTUD 4UB0H 4HUMB 2EKSA 1JK8B 5IM7B 1FAKT 2RQ8A 1FFOA 4PP2B 5I18H 1NLDH 4OV5B 2I5YH 3QI9D 3N1PC 3QXTA 3DECA 4P2RA 1CFVH 5FCUH 1OAKH 3CFBB 2Q87A 3ZDZE 3EOBB 4PJBE 1KPVB 3GGWB 1G7PA 4NO0D 5E9DB 1S7VA 4IRSD 3NFSL 3OF6A 4KVNL 3ARDD 3P73A 1MHHB 1F6LL 3VFOA 3DVGB 1B6DA 1CXHA 4G8IB 3RWDA 1M7IB 3UXFA 1GAFH 4P2QD 4EVNB 4Q0XL 1U41A 3WO4B 1SJEB 3LRGA 4JFEA 1FL5A 2DM2A 1VERA 3HPLA 4W6YB 2OLDA 2A1WH 5C6TL 5GRWA 2OQJA 4NNYA 1RJYB 1ZK9A 3I02B 3W0WA 1IL1B 1BFSA 3HAEH 5JDSA 4LLWB 1T4KB 3OJDB 5J3HD 3OJDA 3BH8B 5F8RC 4X6FB 2AJVH 1BQUA 3T4AB 4Y4HD 4Y16B 5D7JB 1XCTB 1FLTX 2FWOB 1XF5A 1K4CB 4MCZA 4UUJB 2VRAA 4XNUL 3UPRB 7CGTA 2G5BB 4PJXF 2Q3ZA 2XRAL 2YD1A 1U2CA 1RIHL 2QV2A 2IQ9L 4M1DH 5GGVL 1NCBH 3IXTB 3KPQB 4X5XA 2NXZD 1A02N 5GRUH 3GSNH 3ZLQC 3UBXI 3S4SA 1AGCB 5F1KC 3VFOB 2OJZL 1CQYA 3MOAH 5DMYA 1QR1B 1HINL 3MJ7A 4WRLA 5E5MA 3LQAC 5C7XH 4OZIA 4DCQB 4HIEB 4R90L 2HN7B 5I71C 3FFCA 4MQTB 5C0GB 3WE6A 4PD4K 3WXWL 4BFIA 4M00A 3CCHB 3KPTA 1IAIH 5INDA 4KKCD 2WBJA 2QHRL 5C09A 3KXFD 1EHNA 3LPFA 3R06A 1UB5A 5F72S 2LAGB 4R97C 3F5WB 3VXRA 5DMKB 5KW9L 1DUZB 3P77A 2VXSH 4I5BB 3VMNA 1MJ8H 3G5XA 3SDAB 3TYFB 1YN6A 1WZMA 1F11A 2P1YA 4F9PC 1MQKL 3FAXA 4H5SA 5C0BD 3FZUD 3A6OA 4OGZA 3L3JA 4EQ3A 2QQNL 4QCIA 5H35A 3D0LB 3TV3L 3WFCL 4WFGE 1X4XA 4WCYL 5CHNB 3EKCA 3LEVH 3Q1SH 3P0YL 4MA8L 2FZ3A 5DZNA 5HGDA 3WFEH 4PB9H 4HIXL 4PJEB 2EDTA 4U6XB 2AVGA 3U9UA 4DN3H 3E3QE 5BOPA 4PLKC 1ZLVH 3VFUB 5I1KL 5IFJB 2CXKA 2VDPH 3HUJA 2VDOH 4P48A 2Q8BL 2XTJB 3WIHL 1BLNA 4NBYB 1MJ7L 4WI6A 1ZVSB 5I30L 1YEGH 5GRVK 5IHUH 4M43H 4RSVA 3ARYA 3LV3A 3GKZA 1BIIA 4PJIF 1T3FB 1GGIH 3BQUC 4JDVA 2IAND 5DSCB 4P2RE 2DDQL 4WGWB 5JLZA 5J1SC 4PS4L 5FUZL 3M1BB 5TE7H 3DXAA 2Z4QA 4L29B 2DBLH 5CEYB 4YHNB 1E4KC 4LPWA 4M7JL 4P2OC 4P46A 4GW5B 3RWIB 3GBLA 5FUOL 1NAML 4NRZA 4P59H 4P4KA 5CD5D 2IBZX 4PB0H 1T04B 4PTUB 1BX2A 1QRND 1AGEB 4U1IB 4FQCH 3TBTA 2Z35A 3O6ML 1VGKA 4Y4HC 5F96L 2NTFA 1A64A 2GSIA 4PGEA 3EGSA 2R4RL 4UTAL 4UT7L 3RI5F 3HHRB 3QNYB 2R0ZH 2F74B 4FXKA 3BZFB 1H3UA 3G6AA 3BI9X 1MWAL 3O4LA 1MHEB 3QEHB 4RGOH 5EWIH 3MX0A 1PW3A 4PJDE 3I75A 2EC9T 3FB8B 1MFCL 4U6VH 5DJYB 3U48A 1UA6L 3IJSB 3QUKB 5KJRH 2UVFA 4D9LL 1T0NA 2BVEA 3GI8H 2MCG1 3VFVB 3ZE1E 5FGSA 4H88H 4GQ9H 3NIFE 4J1UA 5C0RH 4YIQA 1YN7A 4LSSH 1JPGA 5ID1B 1JPSH 4PRDA 4HPOH 4Z7UA 5FHBH 5BRZB 1U8LA 5HYJB 1GPOH 1IGYB 4FP8H 4Q6IB 4PREB 4K3EH 5E8EA 1HXYB 2HG5A 4EN3B 5DJ6B 4F7CA 5BCAA 3O9WD 2SEBB 4U0RC 5E9DA 3F12A 3K4DA 1PG7H 2SEBA 5IQ7H 3RWEB 4P0DA 2KQMA 2W59A 3TPKA 3RWJA 1VEPA 2ICWA 3AREC 4MNHA 3GI9H 5DJXA 3TT3H 4X6BA 3HZYA 4YHIA 4EXPX 1A4JA 1U8OB 5D2NB 3SY0A 1A9BA 3FT2A 4IMLA 3FT2B 5DHXB 5GGVY 1KJ2H 3AS2A 4YEEA 4JFHD 2XTJC 4U1LA 4NNPL 5IW6A 3QUKA 3IJSA 3HB3D 3CLFL 4PJ7F 4S1QL 3T8XB 5DJYA 4O51A 2CRZA 4FMFA 3SCMC 3HG1B 2QSCL 3L3HB 4CN4A 3G9AB 4Z0BL 1INEH 4YK4C 4F7MA 5E2WL 4JFQA 4C56D 4R7DB 1YPZF 5C8JA 3IKCB 4CBPA 3N85L 2PYEA 1ZANL 5I1EH 3VI3E 5DJ0B 5GSVA 4AENA 3CZFA 4CJ0A 4JDTL 25C8H 1HHIB 4ZPTA 3RX5A 1OW0A 2FLRT 4MAYA 5KTEH 2BVPA 4P3CL 3TIDA 1B90A 3VFGL 4NIKB 1KGCE 3BQUD 5IV2A 1FZKA 3MBEC 3C9NB 2FHCA 3FRPA 4RAUA 4ISVA 1FNLA 3KPSD 3H7BA 2DQGH 4UNVA 5E8OA 3BH9A 3E6HB 4QHLB 1HI6A 4GRMA 3G6AB 4GUPB 3WDJA 1UM6L 5CEZH 4PG9B 4BFEA 2NW2A 3KPRD 3GMRB 1M71A 3W2DL 3W82A 5FYLH 1AO7D 2BXZA 3VXPA 43CAB 5IVXA 2FJHB 5E2UH 3HMWL 1MELA 4OZHE 3X14A 1YMME 2AQ3A 1A6AA 4DTGH 3WNLA 5C2BL 3MXVH 4M61B 5I6XB 3G5ZB 4HX1A 3WO4C 1P7KB 5BRZD 1NAKL 2IGFH 4PRPA 1AXSA 3S36L 4GW5A 3QUMH 4PV8A 2X4NA 2YA1A 4S0TD 2NY1D 4Q6IC 4ERSL 4NWTL 5GZNC 3SE9L 3WKNA 2UYLB 3EFDH 4FS0A 4XPFL 5FYJL 3QIBA 4KY1L 3UTSD 3VFNA 3MLXL 3L9RA 1RK1A 3D6GA 1LE9A 4KUZL 3JV6A 4MAUH 1MRFH 2EYTB 3KPMA 1CDBA 4H0GA 4TVSa 5FYLE 2VIRA 1RZFL 1L9NA 5IB5A 1E6JH 3STBA 4UIKL 5CGMA 4UV4L 3F7VB 3K8LA 1BGXL 3V4VH 4C57C 4Q0XH 4NN6C 3RGVB 1WWAX 4G80A 5CJOL 3REVB 2N4IA 4BZ2L 4W4OA 1PJ9A 1EVTC 2GEEA 1KJMB 4KQ3H 5FKAA 4LCCA 5IBTH 1TLKA 5KN5A 5T1KB 4RFEA 4RGND 2HMIC 4OBRA 3GBNL 3D9AH 4NQCE 3FQNA 1FN4B 4WWKC 1N64H 3C09C 2NY4D 2ORBH 3W81A 3UROR 3RFZC 2ATKB 2DN7A 3FB7A 5T3XL 1RUKL 1T2XA 1OQOA 2JJTA 3NIGF 4PJ9B 1UWEH 5C0AB 3SKNA 15C8H 4JY6A 4POZC 3MOBH 4MD0B 5DUML 3UYPA 4XNUH 5I8OH 4H5SB 2J7LA 3WLWD 4LCYB 4CNIB 2AJSH 1JMXA 4EN3D 2NX5E 4I0PB 5E2TH 1B4RA 2C3XA 4DKDC 4YXHH 4JANB 1YEDB 3FONA 2G75B 5E8EB 2XN9B 3RPKA 3S96B 3K3QA 2X42A 3TBVA 3GJFA 4UU9B 3EFFA 2EYSA 1IAIM 1QBML 1WIOA 1UM5H 4S1SL 1S7WB 1SJHA 2XWJA 1WTLA 2MSPA 5DJXB 4QHUA 2PYFA 5BV7H 2IPUK 4KUCF 5EC2B 5CSGA 3ZT5A 1NC2A 4JRXE 1FC2D 2Z91B 2QHRH 1BQLL 3GBML 3WLWC 1LD9A 4U1JA 5D1XC 3HC0B 3U0WL 4LRNL 4NQUA 3B9KB 5KZCD 3NAAL 4YHOL 1UKQA 4LLWA 4P5KB 1ZEAL 3KPOA 1ULVA 1XH3B 4ZAKA 1DFBL 3MRIA 3MOQA 4KVCL 4ODVH 5CZVH 2CDGA 4P9HH 3O3DA 4LGPB 5KVFH 5GHWH 1UZ8B 2DLHA 5F6HI 1YN7B 2NY5H 4FXLA 3IS0X 3RNKA 1UEYA 3P4OB 3SKJL 4JHAL 3UJTH 4NQDA 1G7IA 3K2UH 4Y0GA 2VYRE 4OM0H 1C5BH 3C6SB 3S5LA 3D25A 1INDH 2PW1A 4Y1AD 5FXCH 3C6LB 2F5AH 5C0AD 4MX7B 5FO8B 2VISA 1MWAA 3TN0D 4PJHE 5ISZD 5HGBA 1JHTA 4NO2B 3TWCH 3IU3B 5AZ2H 1OY3B 2DQUL 2NY1C 1RZKC 1IJ9A 1U58A 1BD2B 1GGCL 1TPXC 3CSYB 4AEHH 4PYHA 5GZOD 4JFOA 5ETUA 4RFEB 3ARGD 4LHUD 5GS0D 1I8IA 3WKMH 3PIQA 1V05A 2ITCA 3B9DA 5MP6H 5GPRA 5IHUL 3C09B 4WIQA 3C08H 3H9SE 4HUWA 3QFJB 3AREA 5ERWA 3TBSA 2I24N 1OGAA 3CXHK 4PS4H 1JGVL 5FUZH 3TN0C 5JXEA 2R1WA 5ADOH 2F54A 4OV5A 1PYWA 1JYNA 3KPPA 1HZHL 3I50H 1FHGA 1SMAA 3RHWK 4JFED 3QT2A 3HC3L 2HTLD 3SJVB 2FBJH 4KJWD 4X98A 4F7PB 3N0PB 4ZUTA 3ZKQD 2ZWLT 5IROA 2VLRB 2OL3H 4PRNB 3VFWB 1ADQH 4QKXB 3U0TA 1Y6KR 5J9PB 1TQCB 1XR8A 2JCCA 2C4FU 3DX9B 5GZOC 4D0DA 4F9LC 2AV1B 3SKMA 1QVOB 3PWUB 2VXVH 4QOKA 1G7QA 5K93A 4U6XA 2QSVA 3O4OB 2ICEB 3FFCD 4XPBH 5BVPH 1N5AB 1OAZL 2CLRB 5C07D 3TNNA 5CWSA 1A6VL 1RFDH 4OCRL 1KENL 3SGEH 1Z9OA 3U4EB 3S8WA 4EN3C 5EZIH 2WWMC 1UB5B 5FHAL 2NNAA 4HV8B 2XA3A 5DJ8A 3IDMB 4PGDA 5J13B 1OM3L 2HTLC 1RJCA 4KJWC 1KB5H 4HIIA 4M48H 1WBYB 3AREB 3TBSB 3GSWB 2BRQA 5DEFB 4HUWB 1CD1A 5TQ0H 4H88L 5AD0B 3NCMA 1IVLA 3H42H 1OAKL 1CXKA 5DK2A 1D6VH 5GRVL 3CFIC 5BW7A 1N6QL 3ZHKA 3GSXA 1IGIH 4KDTC 3GSUB 3O3AA 4YGVB 3MC0A 2WWMD 3U7AA 5DS8B 1S3KL 4XPTL 1X7QA 2OK0L 1OD9A 1UFUA 2EDEA 1QBBA 1VFAB 4B7IA 4I1NB 1KCRL 1O0VA 5MEPA 1JE6A 5IKCB 3VW3L 2EXYC 2HN7A 4PJEF 1MEXL 4XP4H 2YN3A 3W5MA 1U8NA 5IVZB 1CU4L 3B4NA 3O2VH 5DFTA 4NCC1 2WNGA 3HC4H 2FLBT 3EJYC 3QPXL 5EC2A 4OIIL 4N0CC 4XVSL 3P4LA 2E6PA 1RZJC 2UWEF 2AJVL 1ED3A 2VLJD 3IT8D 2VKXA 4EOWL 4FQPA 2DJSA 3QUYD 1YY9C 4NQDE 1HIMH 2Q7YB 2NY7H 1SVCP 5EBMB 1T80A 2C3HA 2AK4E 1FSKC 1RZ7H 1FV1A 2VSDA 4KI5F 4FQHB 2Q8AH 2RR3A 4B53A 1UVQB 1NGYB 4LLUB 2ILLA 2NX5D 5JPMA 2DIJA 5A2LH 1MI5B 2WBJD 4O2FA 4X4XA 4PJ8D 1LE5A 4JDTH 2V5YA 5DRNA 2H2SD 3L1OH 3QHTC 3EJYD 1IC4L 1JL8A 1QLRB 3OKEA 2XXCB 1NEZB 3H0TA 4FN0A 4JDZA 3IDIB 4JFDB 4NN7B 5AYUH 1I1FA 3P2TA 1OGTB 1J0JA 4H1LH 1WEJL 3JWNC 3QUYC 4OFYA 3KYNA 5SV3A 4D0CB 4EXKA 1BIHA 1MCQA 3UX9B 1U8OA 3SY0B 4A2MA 4O2CB 2V5MA 3L3GB 4Q9CA 3EIFA 5BS0B 3GSRA 3CVIH 4OLXH 5FKAB 1CR9L 1A7NH 3FHQA 2BDNH 4U1GB 3DSFL 3LD8B 1T7VA 5SWSB 3KR3H 2LU7A 1AKJB 5FYJU 5IB3B 4HS3A 1U95B 1IC1A 5HXMA 5EUKA 2PO6B 4J7RA 5D6DA 5J06A 3S35X 3S88L 3DVIA 3HNTL 4PJCF 1SYSB 3LQAH 5JNYB 1MQKH 2I9LB 3IJYA 1J1XH 4OCXL 1Z6JT 4XBEH 4ZO9A 1G9MH 4FQHA 4PJ9A 4OKVA 5CUSL 3S5LG 3G6DL 1AHWB 5HBBA 4C58B 2DICA 3MBXL 1P9MC 1ZVYA 1NAKH 1EBAA 2JCCE 4ZFGL 3VCLB 4Q7DA 1W0WA 3QHFL 1CICB 5JORB 4KXZI 3JVGA 1BZ7A 5J1TC 2PCPA 4QOKE 1Z3GL 4P4KB 2ZCKH 3CLEL 1L7IL 5CJ5A 1A14L 2H26A 5JIHA 3I3DA 2DD8L 4U3XA 5F3BB 4YFEA 1N0XH 3JWDL 2VDPL 2D7PA 4P3DA 5DK0B 3GHBH 4IDJL 4PY8J 3L7EB 3QWRA 5KS9F 4OFKA 1YEGL 1D5XB 2GFBA 5BJTB 4M7ZC 4XNMB 1LEIA 1BLNB 5IBTL 2DYPB 4MZ3A 3SEPA 3PP4L 2FJFA 1RIVH 2X1XR 2CLZA 5GGRB 2I27N 4U0QB 1XCQA 1GZPB 5I8KH 5JXAL 4YHML 1R5IB 4K9EH 4QTIL 1YEIL 1WIUA 1EGJL 2UZXB 1IQDA 3ULUL 2GK0B 2X4OB 1E4KA 4FQQA 2VDML 5EZJA 2EEAA 2AK4B 1MPAH 2RFXA 2F5BL 5IOPA 4NPYB 1I1CA 2VZVA 4X80L 2DS4A 3I6LE 5E2TL 3OKOB 2X4UB 1Z0NA 1CLCA 5ACLA 3PWJA 4Q97A 5F3BA 3GMNB 4PRHD 1YY9D 4P23A 1QFWM 4NN7C 4XNYL 4LF3B 1MVUB 4RFNC 4P2YA 4ZUUB 4XPAL 1T21B 5KSUA 4Y16D 3L95B 4S1SH 3NFPB 1FZMA 2B0SH 4D2NA 3BZEB 1MFCH 3VI4F 1BD2A 1DL7L 3CSYA 3QXDB 4KJYA 5C70A 1KLUA 1ZT4B 4OLYH 3GBMH 4U1MB 1NGPL 2R2HB 2CKBL 1CLZL 3VRIB 1IC5H 3C6LC 4ONHB 3NIDF 1A7OH 3NTCH 5GGQL 3BAEL 1MCCA 1KTKE 2MQ0A 4HPOL 4HMCA 4WY7L 3MRKB 4FP8L 3S3SA 1OTTC 3BOVA 2NY5L 2R2CA 4F9PA 2HVKB 3FT4A 2Y6SC 4LLVA 4EN3A 5TQ2H 1A6WL 4G9FB 3MRNA 2FDBP 2GJ6E 5IJKC 2OZ4A 4JKWA 5T1MB 4M62H 3BZDA 3R0MA 4IOFD 1CICC 5IGXH 5DA4A 1OWRM 1R24B 3GB7A 1RUAL 3KNBA 1TZIB 1I8MA 1NEUA 3T0DA 2OL3A 3GI9L 5DD0H 1YY8B 4Z7UE 4MJ4A 5D93C 5MENB 2RCSH 1QPPA 2ESVD 4BQ8A 4IEFB 4JFFB 3C6LD 4M7KH 5I15L 5K9KB 3VFMB 3RWJB 4PJBB 3L6FB 5E9DE 3P4MA 1D7FA 4JN2B 4Z7OF 1HDMA 2O61B 3BXNB 1YNTA 3SGDH 4UNTA 1LHZA 5SWSD 2R0WL 2Y6SD 1GGYA 2F54D 5KVDH 4G5ZL 4N0UE 3ZZ1A 1RJYA 5E00A 1NCBL 1F4XL 3OXRA 1RZ8B 2KPNA 5CJXC 2H1PH 3SDXF 3P11H 3JXAA 5I76A 3LMJL 4UQ2B 2CGRH 5SWZB 5FYKE 3WUWB 1K85A 1P1ZB 3FO0L 4QLRA 1R3LB 1WT5C 3ARDC 5KVMC 1UZ8A 4I48B 3UPRA 5IMOA 5F71A 1EAJA 4JZJB 2IANE 2XYCA 3PWPD 5E5RB 4D9RD 4I0PA 4LCIH 2AK1H 4UDUB 3CFBA 3AS1A 3UTSA 2VLJB 2PYEE 2ID5A 5DVKA 4X6DF 4KRMB 4DJMA 5GJSH 2OL3L 2FB4L 3LN4B 4UT6H 4TRPH 2W0FB 2HLFD 4J3UA 1UB6A 4OB5L 3VG0H 1UQSA 2ED9A 1T1YA 4GMSH 1H3WM 2D4FA 4ZPVB 5FYLL 4GW1A 4XPBL 1OAZH 1BVLB 1I1YA 2XXMB 3OZ9L 4N9GB 4HMEA 3L5JA 4YNYA 4OLZH 1H3VA 2OBGA 4I18B 2KH2B 3OGCB 1U93A 2WLYA 4XRCB 3DV4A 4K3JL 2KUTA 5DEFA 1VEMA 4XHJC 3WIHA 3KHQA 4F15B 5JW5A 4MB3A 4JFDD 1QRNB 3L7FA 4OZFB 2XKUA 1MAMH 3RGVD 4JO2L 4MNQA 4PJCA 1BJ1H 1SJVA 3VWJB 4NYLB 1AHWA 2E27L 4LL9A 1JK8A 35C8L 4GXVH 5D1ZC 5GRXG 4NYLA 5IM7A 4XPFH 1HSBB 3RVWD 5B39A 1YMMA 2KDGA 1EO5A 3G04A 1GXEA 2CR6A 4M3JA 4K8RL 4KKCC 4WO4D 1NFDE 1S7UB 2M26A 1OSZA 1RMFL 4ZG1A 1NMBL 3ULVH 4N0YL 2Q8BH 4Y5YB 1NLBH 2P7TB 4D0DB 4YHYB 1BGXH 3FO1B 1B9ZA 4DGYL 4PJEA 5IIEA 1UCBH 4IBLT 2K7QA 2FX7L 3W11C 1OTTD 5CILL 3MSPA 3C87A 4ZPVA 4JFFE 1V5JA 4I0PD 1P7QB 3GZKA 3MUHL 4KJPC 3QPQD 3I2CH 5B21A 1UWGH 1KGCD 5D1ZD 2J5LC 5EC1A 5EO1A 4BUGA 1OPGH 1JPFB 5E56A 1N0LA 3SBWA 4XWGH 1I7TA 1WQVT 4XVSH 3T3MF 1NGXB 5D7SH 2VAAA 3LKNB 2Y4SA 3VXSD 1C16B 3QEQD 1OLZA 2PN5A 5AYQA 1OF2A 2BVOB 1VADB 1P7KA 2MPAL 3L5IA 1MJJB 2Y06L 1BJ8A 4HX1B 4WFFE 4M3KB 1ONQA 5F3HA 1UZ6E 2YWZA 1MLBB 3QWQB 4LFHG 3T0XA 1U2HA 4LCCC 2NY6D 1MY5A 4LGSB 1F3JA 4UT7H 3AC0A 4EZMA 5T33L 4PLKD 2WQRA 3OAYH 3QPQC 2VH5H 1U8JB 3MRCB 4WHCA 1WBZB 2MNUA 1DQMH 4M8QA 1BFVL 1CG9B 3O81A 1JNHA 3AFLA 3VRJA 4Y2OA 1BBJA 3O2DA 2UUDH 2XFXB 4RRPA 1KTLA 4M1GL 4S1DD 1ITBB 3CAFA 1XF1A 4MMXC 4ZO8A 1XGPA 1WC7A 3BMWA 1QBLH 3DIFB 2GCYA 2JTDA 4WO4B 1B0RA 4RBPH 2XG4A 1KACB 2VDKL 4P4KC 4GAYA 4PG2C 4HJJL 3KPSE 2K7PA 2VLKD 3PGCB 5I8EA 1C8PA 4OFYD 4GKOA 1KTDB 2PXYA 4QO1A 4R8WL 1P5UA 2DI9A 5FYKL 3G5VA 2FIKA 4OAWB 1FNGA 4QXUL 4N5EC 2IANA 5EUOF 4H26B 5D1QD 5D7JA 4UAOB 5C8JB 3NCEB 4RFOH 4AIXA 1AH1A 4LOUD 3IDJA 3VDCA 5BO1H 4DZ8B 1JWMA 2D7TH 5CP7B 3DX7B 1IGYA 4LAQH 4M03A 4Q6IA 2QR0A 2OI9B 1KJ2L 1CDGA 5DHVA 4CKVX 2HVJA 5F8QC 5JO5A 1YY8A 2YK1L 4S10A 4XC1H 5DC9B 4MA3A 4MA1C 4BH8B 1OGTA 4WUUD 2D4DA 4QEGA 1FLRL 5HHOA 5HYSB 5IIEB 4PJ5D 1U3HA 5I1DA 3W9DA 3UCRA 3CSGA 2QSCH 1GIGL 3TO4D 3JWDH 3LQZB 2R23B 4AEHL 1W8OA 4LCWA 2P5EE 1QBAA 2KKQA 2YKLH 3REVA 5E2WH 3GHBL 4IDJH 5HTSA 3MJ9A 4JVPA 2H41A 3LEXB 1C7TA 3MGOB 4LEXL 5TPWL 1ES0B 5JHDB 3T2PA 1PSKH 2JJVA 2HRPL 2LE9A 3UZVB 1FNFA 1JPFA 3U7WH 4YXLH 3CX2A 1JGLH 3CFKA 4NO3B 4XVTL 2EKSB 3C5SB 3M45A 2BHYA 2D03H 3RVTC 2IALA 1X5YA 2NY6B 1HZHH 1OGAB 3IFNH 4XPHH 1ZLVK 1Q94B 3O9WA 1FNEA 4WW2C 1EUUA 4K3DL 3ARFD 4NRZB 5ICXA 1H8NA 1FNSL 3GIZL 1HH6B 4AM0B 3HI6H 1OGAE 4G6JH 5EOTB 2F54E 1FORH 3R1GL 3O6FB 1KLFA 1HH9A 2F74A 2B4CC 4XH2A 3HMWH 1I4FB 2VQ1B 3WHE0 2XZQL 2VXQH 4OCRH 1GYAA 1MSPA 4K55A 4S1RL 5I1IL 4P3DB 3UTTA 4JFDE 4KC3B 5F7MC 5JXEC 2JIXB 4ZSOB 2C3VB 1OCWH 4JPWH 1I3VA 4X6CA 3BH9B 5ITFA 1AFVH 4R4NC 1T20A 4XHQA 3ILQC 2BC4A 5IQ9A 3PWPB 1EFXD 4JR9L 1DL7H 4HLZH 3W39A 1F4AA 3OBAA 4Y88A 3VMOA 4OLWH 1CDYA 5A3ID 5B4MD 1CLZH 3EHBC 2P8PA 1J1OH 3PGDA 4JRXD 3ZTJG 5DR5L 3GMMA 5F89B 1YEFL 4PJ5B 4RISH 4L29A 4KKAD 2X4TB 5JLZB 4YDKH 4M5YH 3S36X 4AEIL 4AT6A 4WY7H 2DLFH 4TUKH 2JELH 5DFVD 1CE1L 3CVHL 1E6JL 1LK3L 5DJ0A 1I9IL 2EXWD 5C0DA 1RI8A 5TQ2L 4XPTH 1JPTH 3VJ6B 4C59B 1ADQA 3D5OF 2VLJA 2HJLB 3V7MA 1G0XA 1MY7A 5FF6A 1EV2E 3SO5A 3CMOL 1EZVX 5J6GB 4YXKH 3SKMB 4MA1B 4TNWF 5FA4B 3L6FA 4UOJA 4J4PD 2ESVB 3D9AL 3OGOE 1BZ9A 3MV7D 5HYSA 4CAGA 4H20L 4DUWA 4HKXA 4KRLB 3PWNB 5DC0A 4XNQB 3F5WA 2V7NB 4ALAH 4XVJL 1FO0A 4IRJD 4HS6B 5J7CC 4ETYA 5I8OL 1K8DA 2NR6D 5ANME 1KB5A 4RGMC 5FV1L 5EU3B 1ACYL 2QADD 4NWUH 2A6DB 1AGDB 1G6RA 3QCTH 3HE7C 3U4BH 1AXTH 4HWZB 2FO4B 4U1HA 1BJMA 3IF1A 4W4NA 3SKNB 3F6LA 2F58L 4DGIL 1FYTB 5HI4C 1WUNT 5L0QB 3HZVA 5E1AA 1BP3B 3H7LA 4IOSD 4P4RA 1U8HA 1F58L 1FBIH 1GZQA 4HH9A 1EIBA 3HZKA 4L8BB 3ZKSD 2V17H 3OR7B 3T1FA 1HKLH 4L3CB 2IAMD 1OAXL 1YNLH 3TZVD 4BKLA 5J11C 1NBVH 4GLRH 4CN1A 4FQ1H 5F6IC 4K9EC 4NKOB 5F1NA 1S7RA 2BK8A 4M6OH 1LP9E 5BV7C 4ONGH 1DFBH 2CRMA 4HGWB 1DBAL 5CZVL 1CGSH 1YEKL 3IDNB 4P9HL 5IMMA 1OAUH 5CIPA 3NH7L 4WDIB 4NNYB 3D39D 3P9MB 5HI4D 3G6JB 3PNWA 2EE2A 3CDCA 3MA7A 3CU1A 1P4BL 1J1XL 4OCXH 2R2HA 3DJ9A 4OD2B 4OLZL 5DRXA 3SDCB 1Q72H 5HHQB 1MCNA 4J1UB 3MUGB 3FQXA 4OM0L 4OBSA 3GMMB 4NM4H 4HFUH 4MCZB 2IPTH 3RVUD 2IFGA 4XMPH 4XP9H 4Y16A 2F5AL 4M93C 4WUUE 3RWFA 1ZTXL 4QXTB 4HK3J 4RWYH 4AJ0A 3B5HA 4ODTH 5I9QC 3QCVL 4R4ND 2E9WA 3BD5A 5IFHH 3OAZK 4NHUB 1LO2H 3S6CA 1IE5A 3K46A 3P30H 3BEWA 3MRRB 3MMEB 4X8XA 5I73C 2R2EB 1IT9H 1I4FA 5DS8A 4IHOB 1FNHA 3MRGB 5TFSH 1KBGH 3DMMB 3O2DH 4PY7B 1QSEE 2YD6A 4OM1L 4S11A 3VXOB 4IRJB 5L2KE 1DSFH 5DFVC 1S7QB 4NJAL 3ET9F 1ETZB 2EXWC 2BERA 4LBEB 4IRZH 2WWKO 4UINH 1PGRB 5JR1H 1JGVH 3Q5YA 4JAMA 2BC4B 4JQXC 1ZLSH 4HS8L 1RZIA 1SEBB 1A1OB 3FQXB 1OPGL 2F53A 3AS3A 1LEIB 1WBYA 1TVBA 4OZFH 1A7PH 2C3WA 1T3FA 4EDXA 1A7QH 4NQCB 2VDQL 2VE6B 2HWZH 1J05B 2VLJE 3HR6A 5BVJA 2CIIB 4F2MA 1VACB 5TDNB 4ELKB 2BVQA 4NQDD 3BPCB 4Y89A 5J56B 1QRNE 5D8JH 2VERN 2BNUA 3QFJE 3HPJB 2B5IB 3VGAB 4I77L 3TJHC 5H2BB 3DX9A 4TVPD 3FRUA 5CJQL 3CUPB 4S2SB 5FYKU 1U9KA 4JRXB 1IGFL 5DHVH 4MDJA 1ZHNB 5EZIL 4C54A 3C5JB 3T1FB 3T2NH 3U6RA 2FZ3B 2R1YB 1CN4A 4DOHB 4LMQE 3KYNB 4D0CA 3F7YB 3BESR 1I1FB 3HZYB 4QOKD 4UDTA 4KK9D 3BE1H 3MLPA 1XR9A 1TJHH 4JFXB 1SM3L 3T0EA 1A1OA 4NO5B 4AIZA 1MIML 2D7OA 2Z8SA 4K8RD 2VDKH 4Q2ZA 5HI5D 4JG0H 4YHZL 1W0VB 4DK6A 5C0IB 4NP4L 1BFOA 1BD2E 4N1CA 5EU7C 1U3YA 1FAIH 3C60B 3TA3B 2WP3T 4LEOA 1AR1C 4HXAH 2G9HA 2ZUVA 5C86A 3NGBB 4HK3N 4FQ2L 4G8GA 1OAYH 2DQTL 3DHJA 5B8CC 2R29H 3VW3H 3U1SH 2WUBH 4FZEH 5DD0L 3KJ4B 5GGSY 4BZYA 1G7JB 1LP9A 5EOCJ 3CH1B 2VJXA 2ENYA 4WU5B 1MHPH 4OZIB 3HNVL 1JBJA 5C9JB 3NZHH 4KAQH 5HI5C 3SCMA 2XFXA 3PJSB 1LO0L 5FA3A 3DMMC 3QISA 4EOWH 1S8DA 5I17B 4JY5L 5KS9E 4X9GA 1NDMB 1Q9OB 5GGTA 2CJUH 1CDCA 4XBPA 2A74B 4FG6C 3SDDA 3HN3A 1RZ7L 3QJFA 1N2RB 4JPKL 5KVGL 3IAGC 4XCNA 4LCWD 5DVNA 5DRXB 3SDCA 4GAYB 5IEHB 5LKNA 3QDJB 2HJFB 4WO4A 4LHUA 1MCSA 3H3KA 3G6JA 3PNWB 4DN4L 3HLAB 3FO0H 4I4WA 1RD6A 4HDIB 4WWKB 5MEQB 3UO1H 1ODAA 3VH8B 1OF2B 3S34L 4O9HH 2HP4A 1KJ3L 1IC4H 3BGMB 3QZWB 4M9OA 4AQ1B 1N3NB 3KPNB 2RHEA 3TN0A 3IJHB 2Y5TA 1JUFA 1AD9B 3TT1H 1PY4A 2RB8A 3LKPB 1WFOA 3RDTD 3CVHB 1EJOL 1DVFB 4JPVH 4D3CL 2EIEA 2X9WA 4O4YH 5DJ2A 3V79C 4N8PA 1QSEA 3A6BH 2OL3B 4X4MA 3N1MC 2WP3O 1A7NL 3QG6B 1M7IA 5IHZB 2NY2D 1BREA 4JE4B 5DMGD 1FORL 4I3RH 3R1GH 2ICWB 4MNHB 12E8L 3L95A 3RA7L 1MI5E 1T1ZA 2XA8H 2AV1A 2I60H 3DVNA 5TJWK 4XWOD 3E0GA 2XZQH 3FB5A 5GGTL 4L4VB 3RDTA 1U8MA 4MQXC 3MLTB 2P4AB 3CDGB 3CK0H 4NGHH 4Z76A 1X4ZA 3OG4B 4WEUD 5CUSH 1BM3H 3JWOC 4GG6B 4ODHH 3T0EB 1J11A 5GSRB 1NGWA 1IGTA 1KG0B 3DSNA 5EO1B 4Q74A 5GGRY 2BVUA 2V7HB 5DEZA 3RVVD 4ZFOB 3VRIA 4EDXB 1S5HB 3QHFH 3RL1A 3RL2B 4MNQB 1PZ5B 3MA9H 2A0LD 4PJCB 5I0ZA 1QRNA 2GTWA 4R26L 4DVBA 2NY2C 3QFJA 3C60C 3TA3C 2L7UA 5E8PA 2R8SH 1C1EH 1NQBA 4ZXBB 5J6HB 4WFED 1YPZB 2XQBL 2Q3AA 3SDDD 4DGVH 1CE1H 3CVHH 5E7FA 4EI5C 3LS4H 5HVHB 1BBDL 3QG6A 1J88A 2EIDA 1FNAA 4K8RC 3OAUH 1UC6A 4X7DC 5JO5B 1D5BB 5TE6H 2O5XH 3T0EE 2NTFB 5J57B 2EIZB 2NMSA 2XZZA 1A3RL 1EHXA 5EOQH 3BW9B 5KG9A 1X44A 3MCKB 4GUPA 1PX3A 3WEXA 4Z76B 4PGZA 2UV3A 2IFFL 3RDTB 3MCLL 3QULA 1LO4H 3QDGA 3TNMA 4FQXC 1LO3L 1YZZA 4Y8DC 5E9DD 4I4WB 3F6IA 2BNQE 1A6AB 1PQZB 4LVNB 2FIKB 4R96A 2ZOLB 4FQLH 1JGEA 4K2UL 2CKBA 3DMMD 1R6VA 3L3DA 4ZNEE 4XGZB 5A16A 3QB7C 5IEKB 3GDBA 5JOPD 3VFRB 2JF1A 3KXFB 4XNYH 3IJHA 4FG6D 3EDJA 2EYRA 3T0WA 2ARJQ 2F58H 4DGIH 4HJ0D 5DD6A 2W0LA 1KLGA 4TVPE 3V8OA 5D2LE 2VDNH 4XC3L 3K7UA 1UWXH 4PV9B 4FQXD 2NXYB 1LP9B 4GRWH 1OP3H 4MAYB 1J0ZA 2XV6B 5KSAA 1F00I 3MJGX 4OLYL 1Q9LA 4G43A 1T2QL 2WUCH 2RBLA 3G6JE 1X6LA 2EO9A 5ISZB 5DURD 4X6BB 3BAEH 5IVXF 3O4LD 4KU1A 5LG1A 2FECL 4Z78A 1CGSL 1YEKH 1D9KB 1FZJB 1SBBA 1CT8A 4L4VE 5JNYA 3BO8A 4N5UA 1Q9WB 2P46B 3PHSA 4DKAA 3ULVD 3SOBL 5C0FB 4OT1L 1U95A 2R0LL 5DMGC 2AJZB 5T5NG 5IGXL 4JY6B 2ADGA 1Q0XH 4JFYB 5GISH 3MNVA 4HFUL 4KRNA 3IFLL 2LABA 4MYWB 4NT6B 5JW3L 3NPZB 4GS7B 5FM5O 1I9JH 1BVKA 1TFHA 1V7MH 3K74B 4MVBD 4H8WC 4Y1AE 5E1AB 4LLDA 1OW0C 1ZHNA 3VXTB 1LO2L 3TM6A 2MHAB 4JANA 3EYFA 1BVZA 4AL8H 2J4WH 4DUXA 5D7LB 3WXVL 4OCWH 2A0LC 3MJ8B 3HCVB 5HHPB 1U8KA 3MACL 4QRTA 5H8DA 4LSDA 1VGEL 1MRDL 4UNUA 4Z7NF 3P11L 3RUGB 4U7MA 2XICA 4DFHA 3QEGL 1BQHA 4OLEA 5ENWA 3BWAB 1JNNH 1A1MB 2FX8L 4OGYL 3WHXB 3TH4T 4NJAH 3M8OL 1EO8H 1QFOA 4I9WD 3MLYH 1KT2B 5JR1L 4R96B 1HYRC 1L0QA 2D03L 5EOCH 3PUCA 3Q2CA 1IQDB 4YX2H 2FWOA 5D2LB 3FHAA 3GM8A 2BNQB 3AAZA 1A7PL 1YC7A 4L9DA 2XN9E 3PL6B 5GJTL 4HHAB 1FNSH 4OGXL 1RURL 4Y19A 3L5WA 3QO1A 3RVXD 1JNLH 4I0KA 5DYOA 1Q1JL 2OMNA 5FECA 3OJ2C 1LE9B 1DLFL 1FZOB 1HNGA 5DWUL 2J8OA 1WTGT 3QIBC 4YDIH 3EDEA 4JM2D 5E4IA 2VN7A 1FFRA 2R1XA 4L8DA 1T83C 4PBVC 2HH0L 4LHUG 3CDFA 3H9HB 4APQA 3H7BB 2ZNXA 4YGAB 3RUGF 4YFLI 4DEPB 5CCKL 4K3JH 3KPRB 4OF8A 4JY4A 3X12B 4UB0L 3CC5B 3LS5L 1I7RB 4QF1B 1YEJH 3FJTA 2AI0H 1K8IA 4PRAB 2E27H 3NVQA 5BJTA 4ZNEA 1J1OL 4HWUA 3WN5C 3RVXC 1KJVA 1FRGL 5F9OL 3M07A 3WS6C 5HJ3A 2F8VA 3CIQA 3HFMH 2ITDA 4AEIH 5T1DL 4XP6L 4NNXA 4KDWA 5FGBC 4TUKL 1E28B 4YBLB 2H6PA 3IJYB 5EBLB 3ZKXC 2ZG2A 1YEEH 5DC4B 3ZE2E 1JZ5A 4WENB 1FO0L 1V7NL 1S7SB 2E9IA 3MRQB 5SX4H 3QQ4B 4NKMB 4CW1A 2R2BB 3MLSH 5I8CB 3QO0B 3GSNB 4FQ2H 4G3YL 3BP6B 4OZIE 1NCNA 3VXTA 2R29L 5E5UB 4P3WA 1DQJB 4PJGA 2BZDA 1M6OB 4KTEL 4KMTH 1NLDL 4P9MH 5F7YC 5E94B 1UEMA 3IDGB 5ELIA 2V2XA 2D9QB 3DLQR 4U1SA 3VXMB 3N9GH 4PJFE 5C09B 4L1DA 4CVXA 1R3KA 4HUUA 5I19L 2O93L 2AK4D 4Y5XB 3QQ9D 4YHLL 4G6FB 5EIIA 3WNMA 2Y06H 2FH8A 1RIHH 1KIUA 1IM3A 1AKJA 2BY1A 3O6LL 4KDTA 3V9FA 2PNDA 2Z31D 3HI5H 4YEFA 3UTQB 1T0MB 3HLAA 4JQXA 4JB9H 1TTGA 3KDMA 4HF5L 4YIQB 2AXHA 3UO1L 1DQML 4Z5RB 4NHCL 4HGKC 3FOMA 8CGTA 3QDJE 4HUXA 4BH7A 2IWGA 2OR8A 1CDHA 1F58H 5IUSA 4D0BA 1P4LB 3X3FL 3MRFA 5IJKA 5CP7A 5F21B 3WO3B 3EO9L 1DLHB 1MHCB 4PV9A 3BHBA 3UTSB 2BJML 2FCBA 3ZL4L 4WU5A 2VZ3A 3E2HC 3SDYH 5SWQB 1CGWA 4YQXL 1QR1A 2BCKB 1IBGH 1EEYA 3WFHB 2XKNB 1J1PH 4PGEB 5GRUL 1HEZA 5KSBE 4RFNB 3CFCH 4ZXBC 1JYVA 3IDYB 4X5LA 4IS6A 1FH5H 3WBDA 3LOWA 1TDQA 3QI9A 1ED3B 1HINH 2IH1A 3F7QA 3A67H 7FABH 2I9TA 1ZSDB 3DXAE 5HDQL 1G6RH 5EDXA 4PRIB 3EOYG 3SO3C 4JN1L 1WAAF 4XMPL 1CD1B 3PGFL 1GL4B 1RPQA 3LEVL 4UTBH 4YBLC 1U0QA 5I1GL 1EVUA 4P5TC 1AGBB 2WIIA 2Y1VA 3VFRA 2DMKA 3RKPA 5A16B 2R8SL 2H32H 5FKPB 2C3GA 4HUXB 5BS0D 4PJFB 4X9HA 4R6UA 4PJHB 3GSXB 4NDMB 4DGVL 4PTUA 3VXNA 5D7IB 2X1OA 3DVGA 4NM8H 2CQVA 2M2DA 4WUUA 3P73B 4P4KD 4YLQT 3O11A 3UAJC 1QEWA 3DTXA 8FABB 3QUYA 4PJDA 4ACPA 3U7WL 1XR8B 1XGYH 4YXLL 1E4XI 4PUBH 3BVNB 4DUVA 2ZUUA 4HWNA 4Y5XA 1K9TA 3LRSA 3VXME 2MKWA 2B1HL 4KKBD 4MSWA 5GS1C 1CFSB 2DBLL 4NSKA 3AS0A 5EC1B 3SDXB 4LOUC 1Y18B 1AO7B 1A6UH 3OF6D 4YDJB 4FQJL 5FUOH 3LH2H 2I9LA 4P59L 5BZDA 1SYSA 1JTPA 5EN2A 2ATPA 3L3IB 3FB6A 5C0JA 1HQ4A 3T3ME 4FQCL 5DMJB 4LSUL 5KSVA 4UIMB 3O6MH 1IAKB 4FTVD 3HE6C 1TJGH 1YYML 2CK0H 4CW1B 2MWCA 4IM8A 4MCYA 4RIRB 3QQ9C 4R4BB 1LK2B 2NYYD 3G04B 1NCDL 4X98B 3WFDL 3OKOA 4TTDD 4PJFA 2QTEA 5KVEL 2XQYK 4X9BA 1K6QL 4WGVB 4ETQA 3H0TB 1N5YH 3SPVB 4XMLL 5GS2H 3MLVL 4AZ8A 3QQNA 3LDBC 4JR9H 5FO8A 1NCTA 5DGRA 3GJFK 2YEZA 1D6EA 1TJHL 3DGGB 4X6CF 1KNOB 3L3OB 5JIIA 4O5LH 3PDGA 4MJIA 2VKWA 4UI2A 4JY4B 1ORQB 3MLUH 4Q9QL 1YEFH 4RISL 2JLLA 3HE6D 4G7YL 1I3GL 4OZHB 3MODL 5GGRA 3MRBB 1U58B 1FQ9C 1KT2A 3QDJA 1MFAH 1KTDA 3ARED 1V8HA 4UTAH 4PJAE 5HHQA 3ES6B 4OD2A 4PIRF 2G5BA 5K9JL 4XP1H 1JWSA 5C0BB 2IJ0C 4GSDH 3CMOH 4JJ5B 4KV5E 2GSGA 4D9RE 5D1ZA 3BEVB 3W9EA 2AJYL 4MA7L 4YFDB 4QXTA 3KJ6L 3HRZA 1GVIA 5D1ZB 3W9EB 5JW3H 4XAWL 1REIA 4XCYB 3EOAB 1UH3A 4XI5D 5F88A 5DJCB 5D6CA 2MHAA 1MFEL 3NZHL 4KAQL 4OF3A 4L8SC 3WJJC 2VSCA 4JM2F 5MERB 5EH1A 2EECA 5TGBA 3WSQL 5FHBL 4KVNH 1EAPB 3CD4A 1VGEH 1BQHB 2UWEB 3QCTL 4OZHA 4DW2L 1S8DB 5I17A 3MRMA 5H37G 3RNQB 3QDHA 5C0CB 3QEGH 1J7VR 5EZLA 5I16A 3RTQC 2A1WL 1T4KA 4NO5A 4AIZB 3TT3L 1QSFE 1IL1A 1AGDA 3BYYA 3MLYL 3UAJD 4ONHA 5BXFA 2KQNA 1DBJL 3DURB 4FTVB 2DI7A 5C92A 5ESQA 4DQOL 1ZGLB 4GFTB 5DUBB 4LIQH 5E8NB 3FKUS 3OX8A 2QQKL 3O2WL 4NT6A 4GRWE 1MLBA 1K3ZA 2OZ4H 1DQJA 1F4HA 1AP2A 4X6DE 5I2IA 4ONGL 5T5NF 2DB8A 5HHXL 1ZHKB 5F9DC 3F12B 1NKOA 4XTRD 3F7VA 2YD7A 2I60L 5J13C 2X7LA 5JHLL 5GGTH 3MLWL 1XGQA 4I13B 2ZCLH 4ZUWA 2HH0H 4HJGB 1ZHLB 1HQRA 3EYSL 4JKPH 3RU8H 5CJ8A 4I2XB 1GC1H 3IGAB 1CFSA 3FQRA 3PWNA 4FXGB 2IPTL 4LIQE 5D71H 3OKLA 4Y19D 5HGHB 4GJTB 5TDOB 2XQYG 4IIQC 4BK5A 3MA9L 2NLJA 4MWFB 3PGDB 1NFKA 3T2OA 1R5IA 4GKNB 5EFIA 1GZPA 3PIQB 5KW9H 1XCQB 5J12B 3SHSA 1T5WB 1KB9J 4YHNA 4QRPB 4JJ5A 2X10A 1RJZA 1MCBA 4UIKH 3AB0C 4NKQB 3PABA 4OF5A 4Y8AA 5FKPA 5D1XA 5E70A 4E0RA 4E5XB 5IOPB 4R0LC 4N68A 3QO1B 4RZCB 1XF4A 2OI9C 4QXGL 1FE8L 2VABA 4ZTOH 3LKOA 3S36H 1BQSA 1CXFA 1FDLL 4KTEH 3SE3A 5FUCE 3KPLB 1KCSL 1KPUA 5DI8A 3O3BA 3D0VA 1A2YA 2DQJH 5CGYC 3TO4A 3GSVB 3P0YH 4MA8H 3QULB 3QNZB 1RUKH 5EULV 5IMKB 3OKKB 4PJAA 4POUB 1NL0H 4L3EB 3WEXB 4ODUA 4FXGA 5DD5L 2VDQH 2X6MA 3G5YB 5DJ8B 1EH9A 2CKNA 5GGUB 4EUPB 4HV8A 3UPCA 4I2XE 4ODXA 5CEZE 1XH3A 3WIHH 2HLAA 4OIBA 3V4VL 1YDPB 3OXSA 3ZHLA 1EPFA 5DEGB 1KELL 3NOIA 4YPGA 4IMKA 3PL6A 4N0UB 1GGIL 3IDYC 4FFZL 1IAKA 1QLFB 2BNQA 5J6HA 3WIFB 1HHKA 2M1KA 1PEZA 2R69H 5D1XD 3BMVA 1TTUA 2VLRE 5B38B 4D0BB 5DDHB 2EO1A 3O9WB 4JLRA 4L4JA 1AD0A 5BV7L 2YPLA 2YXFA 6FABL 1UJ3B 3ROLB 3RTQD 4TVPL 4F7PA 2H45A 3IETB 1TZIA 5AAMA 4J12A 5DHVB 5D7KE 1RUMH 2EYSB 3D87B 4LRNH 4WJ5B 1ZA3B 4WFEE 3AXLB 4X0KA 2BSRB 2Q76A 3O6FC 3IDNA 2D7NA 3CDGA 4XNZB 2FJGA 3CFCL 2O61A 3OV6A 4L1HA 5EIIB 5FOBB 5I0DA 3CMGA 1U3ZA 3JV4A 3QNXA 5TF1L 2VLLA 3GHEH 5JDJA 1HWHB 1XGUA 2J6EL 1QBMH 3FFCE 4JFOB 3UTPE 4QRRB 2VLKB 4C56A 4JQVA 4BQBA 4U1KB 1JV5A 3T4YA 1E6OL 3CXDL 1UA6H 3U9PL 5KJRL 2EH7H 1NMCC 3PQYA 3MV8D 4XZUA 1HK6A 1MHPL 2VXUH 3O41A 5BQ7B 1HHKB 3GSNA 3KPNA 3PV7A 5C0CD 4XCYA 4K94H 4OCSH 5EU6E 3LIZL 1UJTA 4NKMA 1KLGB 5F44A 1XF2A 4MMZC 3RY5A 4BSWB 1NBZA 4H25B 3IDUA 1A6ZA 4M8QB 2DLIA 3ARQA 3QJHB 2X09A 3VGGA 1WBZA 1MRDH 1HOCB 1YYLH 1J8HA 3O0RL 4NZTL 5ID0B 5MP6L 3MFFB 4JQVC 5IB4A 2HFTA 3P4NB 3K2UL 4NRXB 3DROA 5MENE 4PUBL 1HEZB 1Q9OA 4OCYL 1XGPB 1ITCA 1KJ3H 3H9SB 4W4OC 3N1FC 3QDGB 3BH8A 2Y7QB 3O3EB 4P5MB 2WV3A 5DEGA 3LH2L 4OFVA 3BPLC 2W65A 3SQBA 2HA1A 1WITA 2W9LA 5IEKA 2PW2A 1L0XA 2AGJL 4QRRE 4XNXH 3FL7A 4NCDA 2AXFB 5EUOB 4Y4FD 1JJUA 1F3JB 4W70A 3NA9L 4K3GA 4Y19B 5DWUH 3C8KA 4YDIL 4KI1A 2ZKHH 2XN9A 1A6VH 1KF9B 1RFDL 1KENH 5H2BA 1Q0YH 5IP4A 1DANU 4Y5YA 3OJVC 4A6YB 1FZKB 3K4ZA 3MBEB 4Y2DD 1N26A 4FZ8H 4X5WA 5DRWB 1IC7H 4ZODA 4Y19E 1J0YA 4XMLH 2YEZB 3ZYIA 1T7YA 4JGUA 5SX5K 3ZE0F 1A4KA 5DQDL 3MRHA 4QT5A 2FH6A 2JCCF 4JFZH 4JFXA 3MR9B 4GRLC 4I2XA 2JB6B 3MJ9H 1AIFA 1IEHA 3VD9A 2DQGL 3MLUL 1ZVSA 5CLTA 4BZ1H 4G7YH 1MRCH 4WW1A 3ZE1F 4OZGF 3MRLA 4A2LA 5H37H 2PO6A 3KAAA 4XT1C 5IJVA 3RWHA 1JFQH 4HLZG 1U91A 3O4LE 4KMQA 4G42A 3TYFA 2OK0H 2YPLE 2ZUTA 4PJIE 3LPWA 3QQ4A 2EICA 4XB8A 3MLSL 1J5OH 3BISA 4GAGL 4NFDA 1KCRH 3MXVL 4OQ1A 3FCTA 4GRLD 3CXHJ 1VESA 3B2UC 4M5ZL 2GUOA 1OOAA 4EBQH 4HWEH 2WSKA 3O2VL 3ZKND 3LN4A 5EPMB 3F7RA 3QH3A 5JIKA 4TSCL 4KY1H 4HIEA 5L88H 1EA9C 5ACZB 1T1ZB 5E99H 2R23A 4O2EA 3EZ8A 4PJGE 5I1DB 3O6LH 5BS0A 1VFUA 2L7JA 4LHUB 2W60B 1DUZA 3P77B 5IEHA 5KZCB 3HUJF 3GRWL 5I8EB 3HTLX 4YZFF 4NO0A 2DRUA 3MYZA 2L0DA 3TO2B 1SY6H 3MLZH 1SEQL 3L1OL 4ZAKC 1UH4A 3GBNH 4G8FA 4ZNCD 1I7UB 3HZMB 2P8LB 2CUIA 1GC1C 2NZIA 5DMIL 3B5TA 4DQOH 3RWFB 2GSGB 4GRLA 4LLUA 4AY0A 3TLRA 3ULVF 4HKJA 1J8HE 3KXFA 1IGJA 4IIQB 3LN5A 1AGCA 5IBLC 2HJKA 4WNQB 3WUZA 4OLXL 4R2GD 5MENA 1EBPA 3K8KA 3O8XA 1VGKB 2ZZUT 3D39E 4LSRH 4TPRL 4KI5E 4ZO6A 1YJDC 5TGBB 4F9LA 1I8MB 1BX2B 2BNRB 3RUGE 1E4XH 4MJ5B 5J12C 1MAJA 1T1XA 4MQSB 4UU9A 3MV8B 4N8CH 4F15C 1SBSL 4YC2B 5TE4L 5JHLH 2V2WB 3QWOB 1MCRA 5C07B 1T0PB 3EO1A 4ONFH 4P2QB 4XX1G 4YO0B 4JZJC 4M6NL 2F8OA 5K59E 1RZKH 3A67L 7FABL 4NZJA 1KNOA 3IFOA 3RU8L 3FT3B 4O58L 2Z91A 1NGXA 4MS8C 3I02A 5AYUL 2A6DA 5KSBA 4JKKA 2GJZA 2V2TB 3QIWD 2APFA 4UT9L 3D18B 1JI2A 1NCWH 3H3BC 1TITA 4Y4HA 1LO5B 1E27B 3MNZB 1NSNL 3DUSB 32C2A 3PWVB 4QTHA 1JN6B 4LEOB 1B6UA 1TJIL 4KVCH 2J4WL 3LAFA 5IESH 1QSFB 3GMOB 5E0QA 4ZDHA 5GHWL 3ROOA 1GJIA 4WHTB 5E6IA 3ULSB 3WIFA 1N6UA 3QO0A 3HPJA 3OR6B 4LCUA 4R3SB 1MJUL 1KPVA 5HDBF 2IBGA 1PD6A 4HQQL 2AJUL 3U0TB 4LASH 3QDMD 3QH3B 5HYJE 1XIWC 4R4FL 4V1DD 2Y25A 3M8OH 3LSOA 3PHQA 3PP4H 1C5BL 1RIVL 1ZA3A 3BP7A 4ZTOL 1CI5A 4H0IA 4P2CG 1RAMA 5J1AB 5MEND 3QWRD 1FDLH 3BDYL 4U2ZA 1F4YH 1CF8L 3QXAA 2XY2A 4G6MH 5I8KL 1YMHB 5JXAH 4MSWB 1P4IL 1X5FA 4QTIH 4CRPA 4ODUB 4C4KT 3CLEH 3UTOA 3FTGA 5LVEA 4LCCB 4ZQKA 3TWCL 1DTUA 1XT5A 4I18A 3I6GB 3RJDA 5AZEL 1MNUL 1P6FA 4U49A 5IJVB 1GGCH 3F58H 1TNMA 3LKQB 2K1MA 3FB6B 2VNCA 2ARJA 3L3IA 5I1HL 2R0KL 3KPRE 1B3JA 4X6EB 1VFBB 4FQIL 5EO9A 4KH2A 1LEKA 4ZD3H 1M4KA 1WZLA 4QGYA 2EXYD 2CMRL 4TULH 2BVYA 4NQCA 3KPPB 1DVFA 4RQQA 1UXWA 1VB9A 4BFGA 2J5LB 4ZFOL 4FFZH 5DYOB 1S7XA 3HNSL 4YR6A 3JWDC 2UYLA 2R69L 2CXGA 3QRGL 1MCLA 2Q20A 4QXWA 5EU7E 1N5YL 4UILH 3VI4E 4QRQB 5DRWA 1D3CA 2YMXL 3MBEA 5EA0L 4WTXA 3PWPE 1NGPH 4Z7NE 4WUUB 2DQIL 3WLBA 3TZVA 1EFQA 3LKOB 4WV1C 4MB5A 1NMCB 1SHMA 5CJBA 4YC2C 2Z8WC 2OXGA 1WT5A 3EUUA 3MCKA 3P4NA 4NRXA 2Z8RA 1YMHA 4L4TD 4MXQC 1CBVL 4KJQC 3UC0L 3CFEA 3BWAA 1GGBH 1CQKA 2R39A 3D85A 3KYKH 5I1JL 4JFPB 3IVKA 3RPIB 4C4KO 1G7HB 1OM3H 4LK4A 2E9JA 4LHQB 1X6NA 4Z7UF 3RX8A 4G8FB 3HG1E 2KL6A 3FN0H 3W11D 5BQ7A 2RCSL 2EH7L 3VMPA 5F9JB 1Q94A 3VWJD 1RIUH 2P5WD 1R5WB 5JIPA 1LNUB 5AUMB 4FQXA 4ORGA 4Z7WA 1BVKB 2AEPH 4R7NA 4OFPA 4MS8D 3ULUF 3EDDA 3LIZH 4HUVB 3GJFH 4CGTA 3TBVB 4G5ZH 4UOW1 3BPLB 4Z77A 1F97A 2XZCL 5DLML 1F4WH 2DTML 5DD3H 1S3KH 1FGNL 2YBRA 5IR1B 1HHGA 4NQXA 4D94A 5TH2B 4Q9RH 3PV6B 4JN2A 3LQZA 2EH8H 1XR9B 4KFZC 3RQ3A 2J88H 4PRIE 4KI5C 4UDTB 3NCYP 3JV0A 4WW2B 3QI9C 5DRZA 3DX8B 3JTSB 4I5BA 3VXUB 1SJXA 1DEEB 1LO5A 4LU5L 5E8DL 4LCIL 3QPXH 1I3UA 2NQCA 2FGZA 5FIEA 2XWTA 4UV7H 5E4EB 1QFWI 4HG4J 2GJJA 2OZ4L 2YOCA 5LXGH 4XBGA 1IGML 2J3SA 3BGMA 4J4PA 4LRIA 1GH7A 4TYUA 3RJQB 1A9EA 1JRHH 1NGYA 1HXYA 5F7NC 1HCFX 1RUPH 1EHLH 2E7HA 3MRCA 5B39G 2A73B 3EBAA 3T1WA 4FHBD 1IZJA 2BOBB 4X7SH 1ZMYA 4MD5B 4YE4L 3DUUB 1A4KB 3U46A 2XPGA 3UMTA 1I9EA 4X6DA 3EJZC 4MLIA 1MFBL 2OTWA 3IDXL 1BZ9B 1MUJA 3QNZA 2AK1L 3O6KL 3TO4B 1A7RL 1I75A 1FFNB 5DJAB 3VU2A 5A40E 3PGFH 3KPRA 4OTXH 1J10A 5I1GH 4M1CD 5EO0B 1OB1A 4FNLH 2J12B 5IQ9B 1IAOA 3HAEB 3BIAX 2ED7A 4LDEB 3DX6B 3NABL 5L2KB 2DWDA 5LAXA 3F7PC 4TN9A 1IEAB 2ITDB 3BQUA 4HPYL 1SY6A 4TUJA 1JFQL 3L3DB 5BOZG 1YJDH 4OZGB 2PW2B 3H2WA 3B83A 3S88H 2YUZA 1RU9L 4HZLA 4WEBL 5EZJB 1CXLA 5HVWA 4U6TA 3EJZD 1KCVH 1T5WA 4R4BA 3G6DH 3NZ8B 3HR5A 1XGYL 1OTSC 1AQKH 3CZJA 1NCCL 3U7YH 2AP2A 1NJ9B 3TJEL 3I2CL 5FDYA 4J3VA 4E42B 3EOBA 4F37K 1S7UA 4JO2H 1CICA 4APQD 2CDFB 4U31A 5D7IF 4RGMB 5C6WH 3VE0A 1Z3GH 3OKMA 1A6UL 2CRIA 5JPNA 4OI7A 1DEDA 1H9VA 1A14H 3QRFM 1DN0B 2CSPA 1FL6B 5ENWB 1AR2A 3KPSB 4E9LA 1UT9A 1F3DJ 4PJXE 3VFTB 4GRMB 5DURB 3NCCB 4KRPD 1T66C 3GM0A 4JREC 4DVRL 5L0QC 3DV4B 3ESUF 3HG1A 4J8RB 4POYA 1U92A 4GG8B 1WVZA 4N8VB 1A7BA 5EFIB 5T33H 1BAFH 4DKFH 4KQ4H 1K5NA 4F7EA 4APQC 2EIBA 2J1KA 1K4DB 4TSBH 3STZB 4UOW0 1QNZH 1UWGL 4HWBH 4NC2B 3TBWB 2NY0C 1IQWL 5E8NA 4PRBB 1J05A 3ALXA 1HSBA 4F3FB 2D0GA 4DZBB 1MFDH 2PTUA 3D0LA 1MCJA 3CVHA 3A0OA 2VDMH 4O5LL 3MRPB 1JWMB 4HKZA 2V5SA 5DRNB 1KIQA 1J0IA 1MPAL 3RWEA 1A1NA 1VSCA 2XWBA 2VLMD 4Q9QH 3C6LA 5DJZB 2PW1B 4X5WB 1JZ2A 3ORJA 4A6YA 2P24A 3BZ4B 1CL7L 5D7JC 3MV9A 3GSNL 1NGZA 3X3GL 3MGTA 4LSQL 5DT1L 5HHOB 5TE4H 2YN5A 1CDUA 3HE6A 3GSOB 3K4AA 3KHOA 1B0RB 3D18A 5FDWA 5B38G 5HGGS 4OCNC 4JGJA 1FCCA 4QNPE 1TETL 1ZKAA 1A5FL 3FB8A 3WN5B 1XGRA 1G7HA 4X6FA 3O3EA 4P5MA 2W38A 3VA6A 1LEGB 2ADFH 4NQVA 2VXUL 2ENSA 4KDVA 5I71B 5MEQA 1WZ1L 2VDRH 1DBBL 1FLRH 5C0DB 5D9SA 4C56E 4NQDB 5ID1A 3S4SB 4IRJC 3DHMA 5CMAB 1TQBB 4P46D 1K2DA 3SDCC 3KPQA 3QDAA 3PQYE 1K2DB 5D93B 3S98A 1R24A 3GB7B 3JVGC 1KXTB 1D9KD 2PKDA 1HOCA 4M62L 3VGFA 4J3TA 4XHJD 4JM2B 4X6CE 1NGZB 1MHHA 1A6ZB 1A2YB 4V1DB 1V3MA 2C1PB 2QQNH 4X7FC 4LAQL 3NN8B 3O45A 4GW4A 3L3KA 3MUJA 3FZUC 1R3KB 1QKZL 1QSVA 3UTTB 1I3RA 3P40A 3U36B 2ZOKB 3STLA 4PB9L 3BDBA 4ODSL 2ADJA 3B9AA 5D2NE 3SDCD 2R0WH 4NJ9H 5KVDL 1MNUH 3Q3GB 1DQQB 4U1NB 4AEFA 4WV1B 5I1HH 1I8KA 2YKLL 2P8MB 1ORSA 2R56L 2Y9RT 4H0HB 2NCMA 9CGTA 3WJLA 3ILQD 1P9MA 5ITBH 1CTNA 4CNIA 5AWNH 4MXWH 5EORH 5LWYL 1JIBA 2FHBA 4KRPC 1KIQB 2YRPA 5B4MC 2B20A 2ZP0T 5TE7L 1IAMA 3ZYJA 3V4UH 5FV2A 4WJ5A 4QRUA 5DO2D 1ZAGA 5J4MA 4J6RL 1JZ6A 2V2XB 1DN0A 3AUVA 1O5DT 3GKWL 5E94A 1OARH 1MH5B 1JGDA 4CUCA 3LRSB 5ANMA 2NY0D 2AERT 2W1NA 3GK8H 1MCEA 3HUJB 3NFPA 2W9EL 3FB5B 4JZOA 3UDWC 4I18C 4JZOB 4PLOB 2JELL 1GGUA 2P5EB 1GGBL 4OLUL 5EN2B 3KJ4C 2FJFB 3IS1X 4LSVH 1JPTL 3OZ9H 2YSSA 3HAEG 1A3LH 3D48R 4U33A 4NNXB 3RL2A 4DK3A 1AI1L 1PKOA 4Y4HB 1UXSB 3GSQB 4FTVA 4NQCD 2ARWA 3BPOC 1AXIB 4H8WL 4S1DC 4X4YA 2VZOA 3FQTA 2Y5TB 5D2LF 1QR4A 2ZG1A 2D31B 2O5YH 3OSKA 4XXDA 2EDJA 3D25B 3MV9E 3VFSA 3RWGB 4DWHA 4KV5F 5DR5H 4MZ2A 3FRPG 2W91A 2PCPB 5DD5H 3SKUD 1GPOL 2CIKA 2GJ6A 1KCUH 3TCXA 2H2PC 4E41A 1XZ0A 5F9WC 5AAWA 1RMFH 4LLYA 1NMBH 1X5KA 1FVCB 1S9VB 1GAFL 3KLDA 5DGQA 5B8CB 3UBXA 1M71B 2WBJB 1ZLWH 1I3RB 4OIAA 3PP3K 4WDIA 3ALPA 2EDQA 3N1GC 3T77A 2IBZY 43C9B 5GS1B 3QFDA 3FT3A 2FEDC 5ILTL 1ZLUH 4U0RB 4X7EC 1ZT7A 4HXBH 1XGRB 3U30C 4GKNA 3P0GB 2V17L 2CH8A 5C0BA 5F70A 3VD5A 3CX5K 5CINL 3TO2A 4XZUB 2FL5A 4XVJH 5ICYA 4BH7B 2JJSC 3CLFH 5EU5A 4S1QH 3TO4C 3SN6N 2OM5A 4MQ7A 5LXGL 1NMAH 3CZFB 4P4RB 1KIRA 2CUHA 5EG6C 3VDBA 2DLEA 2P5WA 2IQ9H 4LSRL 2JB5H 3AU1B 1EMTL 4TPRH 3PXHA 5CZXC 2A9NL 5JA8B 4HKJB 3HB3C 4OGAC 2EZ0D 2AEIT 3GUTB 1CXIA 4H25A 2JJWA 5IVOA 5SWQA 5IK3B 4N8CL 5GRYA 2FEDD 3IKKA 1X5HA 4QRTB 1G9NL 4ONFL 3MJ8A 1IARB 4WWKD 3P3YA 1Q72L 4LSPH 3O3UN 4WHYG 4QYOB 1C7SA 2R15A 2ZPKL 1JZ8A 1B2WH 4CU8A 1MFBH 3IDXH 2OQJB 1FBIL 1U3HB 3D39A 4P49A 3X11A 5IVNA 2WBKA 4DAGL 4Z78B 1E6OH 1TCRA 3ARFC 5JHDD 5IF0A 3V6OE 4ENEC 3OKDB 4HAGA 4XNQA 3QXVA 3TF7C 5ISZE 5F7EL 4RWYL 3QA3B 4L9LA 4PJ8A 4KGJA 5FYJD 3MTRA 1BFOB 5KSBB 1I9RH 2O5ZH 3H9YA 5F1OB 2DQFA 4BUHA 1MJ8L 5JUEH 3KYOB 4EQ2A 2KBGA 2GTZB 3DO7B 2QSTA 4Y5VA 2BVQB 1RU9H 5F7DA 3TVMA 1N4XL 4F2MB 5LQBL 2YR3A 3T0EC 4PREA 5HVFB 1JYXA 1KXVC 5C2BH 1RJLA 4RBPK 2YUVA 4FQXB 4NM4L 4LFHD 1EEZB 2W0KA 4MGXA 2D0FA 2Q86A 2FSEA 2MQCA 1CF8H 2NY2B 4U6HA 4K7FB 2GHWB 1PX4A 3O3BB 4ODTL 2MCPH 4ZMAT 3GMQA 3QCVH 5HVGB 1ORQA 2DM7A 1M7XA 1CIDA 4IRJA 5JW4N 4EI5B 1DUYB 43C9A 3L5HA 3GIVA 2GFBB 1G7MB 3IU4L 1F13A 4WW2F 3SGKA 2GT9A 3IDMA 3O2DL 2Y5EA 4Z8FH 2AJXH 1MCOL 3BQUB 4NUGL 3WS6A 2W9DL 1RK0B 1UADC 1OSPH 4DKFL 2YSSB 1TVHA 1CD8A 1Q0YL 4OKDA 4QY8A 4PJ5A 2EEDA 3HNSH 4HHAA 4XWOC 1ONQB 5F3HB 1QNZL 3WD5H 1AXSB 1MJJA 1ZS8A 1YPZA 4MXVF 1ZLSL 1MCIA 3UDWA 2DI8A 1XEDA 4LPVA 1BZ7B 3TVMD 4LVNC 2NR6C 3QG7H 5L6YL 3BFOA 1SM3H 2X1PA 4PRNA 15C8L 3VFWA 2VR4A 1A7QL 4LVOB 4ZUTB 2ZUQB 4PJFF 4XMKH 5EPMA 5FO7B 4PLNC 2NY4C 2BOBA 4FABH 3HI6L 1MRCL 2A73A 3QXWA 1M7DA 4JG0L 1ZHLA 1CBVH 1U8QA 3KYAA 2DL9A 2R4RH 1DUYA 4WUKL 5I1LA 2R0ZL 5I1JH 5JHDA 3ARFB 2DIAA 4JM4H 3CPLB 1OWWA 1A21A 4HK0B 4K3HA 1H8SA 3Q6GH 3BN9D 4Y4KD 4OZ4B 4OGAD 4JPWL 4KTDH 4PJ8B 2IAMC 4X9FA 3TZVC 5BZDB 5DFWH 2GTWB 2FNBA 4QTHB 4M5ZH 4EBQL 1PZ5A 2CO6B 3BE1L 4D9LH 4C56B 5EIVA 1R0AH 5FEBA 1C5DB 3PDDA 2E3VA 4BQ6A 4YJZL 1LO0H 5FCUL 2R1WB 1AD9A 2CR3A 4LSSL 5KAQF 1T5XB 1NBZB 5T1KD 1NKRA 1MI5A 4WFFD 1C12A 1ZHKA 2VQUA 2Z31A 3MJ7B 1FAIL 3VWKA 5IK3A 3HS0B 4LAJH 1A6PA 2BSRA 4FA8A 4JM2A 2IAMA 2UZYB 5DQJA 4Z7WE 5HGAB 5CEXB 3QUXA 5JQHC 1QFUH 4O2CA 3IDGA 5ISZA 4GAJH 5L9DL 3OKDA 4IS6B 2DM3A 4PJDF 5HGBB 2YHGA 1NFIB 3D39B 3T04D 1CD0A 1S5IL 4P5KA 1DANT 5D4QA 4ZOAA 3CFDB 4L8CA 3HC0A 3V4PH 3RPIA 1Q9WA 1EDQA 2P8LA 4WVRA 4PRIA 3U2SA 3QDMB 1YDPA 3OXSB 4TSAL 4MQXD 5BRZA 3SQOH 1M05A 3U4BL 3RWCA 12E8H 1E4XL 3OKNB 5BZWB 5FM8A 1RVFL 1RUPL 3BUTA 3QHZH 5AUMA 5E6IC 5ITBL 2FBOJ 3OKNA 5BZWA 2YPLB 2HJKB 4WNQA 2M8XA 5JOPE 5DHYA 1EJ6A 4KK8C 4NN5B 4X7SL 4IIQA 3N1QC 5D6CB 1ZLUK 5FA3B 3C5ZD 4O58H 2YWYA 4J6RH 4JZNA 3O6KH 1A7RH 3OHXA 3PL6C 1D6EB 3DGGA 3GKWH 3GO1H 1YNLL 3ZKXB 3GNMH 3P4MB 3BZFA 4R26H 4FNLL 4FQ1L 1ADQL 2MFNA 4EI5D 3GK8L 3V7AG 3WL9A 3FN9A 4L3ED 3HPLB 3UJJH 2DLGA 4PJ5E 1CZ8L 2VLKA 2LQRA 4X9IA 2VXVL 2ZOLA 3MRBA 5F89A 5LBSL 4Q6YA 1K5NB 4F7EB 1P2CA 3SDAC 5C0IA 2BSSB 1CVRA 1G0YR 4LASL 3FT4B 1G0DA 4HEPG 5D2LA 4ZXBA 3ULVE 4PTTB 3RX7A 1S7SA 1VFOA 5CZKA 3VCLA 3DRQB 3BDYH 4Z6AT 2OTUA 3QUML 1Q9KA 2IQAA 4M4PA 3MUY1 1JWUB 5E6YA 4L4TB 3TIEB 1RK1B 2XN9D 5ICZA 4IOIA 4QRUB 3IETA 2AXJA 5IFHL 3EOTL 1CFQA 3ALWA 3VE0B 5T3ZH 2DMBA 1D6VL 4JFHE 2X7LB 3QIWC 4G6KL 3BVNA 1H0DA 4L4VA 1TZHA 1RZFH 1ERNA 3KLHD 4FQLL 4QOKB 1IT9L 4UV4H 1YA5A 2WM0A 3X12A 4LCWB 2X5PA 4MHHI 4RX4D 2B39A 1PKQB 1S7QA 2FD6L 3ARFA 1N8ZA 2YC1A 1QG3A 4L9LB 5CEZD 1BAFL 5F7KC 1Q38A 3MLRL 5HDLA 4OZHF 1N59B 1MIEL 4AH2A 3QIBD 5DMKA 3VXRB 4ODBD 3C5SA 5GGUA 3Q5TA 1CU4H 1TVBB 1IEAA 4HXBL 5E24E 1CIUA 3TH2T 1ZGLM 4I9WE 5I1CH 3OB0K 1MFDL 4KK5D 3MNWB 5EA0H 4JO3L 1LO3H 2W07A 3V52L 2GK0A 5JQ6H 5HDBE 1CFTA 1YECH 3H3PH 1TXKA 1NUNB 3MOBL 1RZGA 4PRPB 4R3SA 4ZUVA 4RX4A 3C6SA 5E6IB 1MAKA 5CD3A 4XCEB 3NZ8A 4LDLB 4MD4A 4NN5C 3VXNB 2A9NH 5DQ9A 4YXHL 3BIKA 3IXAA 5D8JL 5L2JB 2XPGB 3X3GH 5L8JB 3MFFA 2FGWH 3QUZA 2X4RA 1YUHB 4JRYD 3TBYB 1QFWH 2ZG3A 5CJQH 1ZHBB 3WS3B 4P2OA 1ZE3C 3L7EA 1X5XA 3QQ3A 5INDB 1Z9LA 4XAKD 1WC7B 3WE6B 2DOCA 4NUJB 5T3XE 4RGOL 5EWIL 1WICA 2E7LC 1IAOB 4HGWA 5E1HB 5M7QA 1TETH 3B9VA 4L8CB 4JO1H 1LD9B 1CWVA 5I18L 3DUHA 4KK8D 5BRZE 3WN5A 2H2SC 1RIUL 3N50A 2CRYA 2FRGP 4H26A 4PJ7E 3VGHA 3U4AA 5SWSE 1IKNC 1CFVL 5FM4A 2UZIH 2A6IA 4U1KA 3T4YB 4Z5RA 3EYQD 1JGEB 2G9HB 2WK2A 5INCA 3WXVH 4OCWL 2OXHA 3DRTB 4EDWH 2H8PB 3HZVB 5D9SB 4Y4FB 1NDGA 2ZSVB 2OJEB 3S96A 4JHAH 4G8EB 4G9FA 1G9ML 3L5XL 5D5ME 3VFSB 1S7VB 2Z31C 1JCKA 2EDDA 4YHPB 5DJZA 4JKLA 1EO8L 2WUBL 1UKTA 2APVA 2NTSP 4GLRI 4J3SA 5LCVL 3VD4A 1R5VA 3BP5A 5KG9B 4Y1AB 2BRRH 3AXLA 5D5MB 2PYED 4LSTL 5SX4I 3WS3A 3BJLA 3GSRB 1V7ML 4GG6F 4YX2L 1L0YA 1IKFH 3LZFL 1OP9A 1ND0B 3GSOA 5C2UB 3ZDZF 4N1HB 3HE6B 5CWSB 4X7TB 4HKXB 1TPXB 1CD9B 4PR5B 4WW2A 2C26A 4L9LC 1QLEL 1T7ZA 5KN5B 2XRAH 3FOLB 4DOHE 4U2YA 2MMXA 3I75B 1VADA 4CL7A 5KVGH 1JPST 2XNAB 4LKXB 4ZUSB 3MREB 1FFPA 1MCOH 2W0PA 2GITA 3LKNA 4YPGB 4EKXA 4DN4H 1NBYB 1KYOK 1JNNL 2FX8H 5AWNL 5B39B 3QFJD 4QHMA 1FFOB 4PP2A 3S34H 1DVFC 4O9HL 1C5DA 4YE4H 1DP0A 1MCKA 4L4TA 1KIRB 4R7NB 1I1AD 4OUUB 3RI5K 1Q9KB 2IQAB 1RUQH 4K9EL 1UJ3A 5KTEL 1LK2A 3DRQA 3QDJD 3I50L 1SVZA 2A9MH 4OD1L 4PLJC 4U1IA 3U6RB 2CDFA 3HC3H 1OARL 3BKJH 1T7XA 3CUPA 3S7GA 4L3EE 4LLMB 1KB9K 1KPUB 1J9CT 3OQ3B 5DI8B 5JZ7C 5EU6B 3GRWA 3VXSB 1MVUA 3V5DB 3E8UH 4BSJA 4HZAA 4LGRB 4C83B 1VA9A 1K3IA 4YDLB 3KLSA 4GXUM 2C3VA 2KZ1B 3JZ7A 4TUOB 1DVFD 2DQDH 2L4OA 2A2QT 4P99A 4U3HA 3H8NA 2DWDB 1SMOA 4OZFA 1G9MC 3D3VE 3VRLE 1JHKH 2X4TA 1X5LA 5EO9B 5AG8A 1NANH 3V0AC 2HT2C 5F9AC 3VH8A 2Z92A 4WCYH 2O5YL 1H3PL 3AAZB 1Z2KA 4BQ9A 2Z92B 4WWID 5TQ0L 3SE9H 4GBXA 3H42L 5A2KH 4HBCH 5C0AE 1JVKA 4FFYL 5EU4B 2A77H 3RGHA 2GAZB 5DZOA 5T1DH 4YHLH 4E0RB 4OUUA 3ULVC 4D9QE 2VQTA 4ETQB 2VDOL 1JTOA 3BEWB 3T65B 4I0CC 1F6AA 4ZUWB 3O6FA 4P5TA 3F65A 1HKFA 5E8OB 3OAUL 5K9QI 3LN9A 3EYQC 1ZWIB 3ZDXF 3ZDYF 2ICEA 4ISVB 2D9CA 3RGVC 3TPUA 5DXWA 2DDQH 5SWSA 1NC2B 2C9AA 3S9DB 3LHPL 4E41E 5BW7C 3FOLA 4MNGB 3TCLA 1CICD 3QA3A 5KS9A 1Y0LB 3MUGA 2BSED 3WDIA 3MNZA 5SWZA 2NW3B 4PD4J 4NOBA 2BJMH 5GS2D 3UPAA 5EBGA 5ESAB 4KPHH 4N0FB 1I8LA 4N90E 1JUFB 1A9EB 2FO4A 4K2UH 2JB5L 4U1HB 4HT1H 5F96H 1P84J 3IDJB 2H1PL 2DMCA 2GI7A 4I0PC 4DFIA 1DZBA 5F1IA 1INQA 3MRPA 2HG5B 1G9NH 4G8EA 3S4SG 1MI5D 1T66D 1PG7W 4JRYE 4U1SB 3VXMA 1NFDF 2ZPKH 2ADIA 2FATL 3KLAA 4IMLB 1FVDA 4U6VL 4YHIB 1U6AL 3QUXB 3E1F1 1G1YA 4X4ME 1RHFA 4XBPB 1WEJH 3DIFA 1BHGA 3HI1A 2B8OT 1BF2A 3GNML 3U0WH 3LD8C 4LMQI 3L3KB 5GS0H 5C0RL 3CVIL 1PEWA 3I6KA 1A0QH 4ELMB 1ZT7B 2J8HA 2LU3A 4NQSA 3PWLA 2ZUSA 4GMSL 2YD5A 3B9KC 2F19H 3IVKB 4R0LB 2EDOA 2EDXA 2HLAB 1B0GB 3GMPA 4I8DA 2AQ1A 4LVHB 2K9UA 3QIWB 5LBSH 1N4XH 3SKJH 1JPGB 4XGZA 1PG7L 1WAAA 3EYUH 3NA4A 2E5EA 1KSRA 1PZUB 2VXTH 5C3TA 1G6RL 5F9JA 3TGXA 4WI2A 2QQLL 3QDME 5HYJD 2A83A 1IGJB 2QSQA 1INDL 1MAML 4YAQB 4PJGF 2F53D 5DJCA 2X05A 1T6VN 1MQ8A 4MJIE 3SCMB 4JEGB 4LF3A 2HFFA 4WU7B 4D8PA 1FG9C 2PF6A 2ZCKL 1Z9MA 1L7IH 3MO1B 4P23B 1WWBX 1JZ3A 1CG9A 1JP5A 5IKCA 4NUJA 3AB0B 5AZ2L 4QHUB 4KK6C 1A8JH 3VD7A 4YPJA 4FFWC 3D3VA 5CD5C 3PXJA 1UACH 5A2IH 2NNAB 5CKAA 3GMRA 4JFEB 3G5YA 1P7QA 1SYVB 5CFHA 1N59A 2CK0L 1HHJA 3ECBA 2W60A 4ODWA 1ZANH 4LP5A 3MLRH 3IYLW 3QIUA 1NCDH 5IMLA 2MQ3A 4X99A 4MNGE 4WHDA 5KVEH 3QDGE 3A6CH 2N56A 1C16A 3RWHB 4AG4H 3PP3H 4F7TB 4OJFL 2FR4B 4QY8B 4YHMH 1CGYA 3GSWA 4LP4A 4NKIH 2Z4QB 3MLVH 3ILPB 3ESVF 2DQHL 1BOYA 1HWGB 2AJ3B 3CSPA 4JRWA 3FQTB 5D7SL 1S7XB 2VL4A 4JO3H 4RQQB 2GUOB 4FFWD 3VH8G 2GQHA 5GJTH 4ORZC 4XMKL 1HSAB 3BKCL 4X4ZA 2MKLC 3RIFF 3ZTNH 2KZWA 1LWRA 4RMWA 2R1YA 1JNLL 1YPZE 2FX9L 3C5JA 3JTTB 5HHPA 3FRUB 2CD0A 4PJDB 2FGWL 4OLUH 1X4YA 3U9UB 2YA0A 2VH5L 1KN2L 3W9DB 3O4OC 3CFJA 1FG2A 3ZTJH 5CLWA 1ZV5A 1KJ2B 3O9WC 3RVTD 4DTGL 3OKLB 5HGHA 4GSDL 5KANI 2D7MA 1PY9A 1UJ3C 4H1LG 1F45A 1KIPA 3LKRA 5FCSH 2IGFL 5T5FL 1Y18A 2ADJB 4JO1L 1IRAY 2VN4A 3VGEA 4OI8A 2ADGB 2CKBH 4NWTH 1MFEH 5JHDE 4RMRA 5K59F 2ZCHH 5FYJH 4HH8A 5E2VL 1G84A 2F9BT 4F7TA 2FR4A 1XAUA 5DUPL 1A7OL 3NTCL 3DO7A 1MRFL 5IG7B 1TTFA 2XTJD 3ZE0E 4EDWL 1KCUL 5I2IB 4ZDHB 1YEEL 4Y4FA 4K71C 5IMOB 4MJ6A 3ARGB 5JXED 3C8KB 1BECA 4YBHA 1IM9D 3NCJH 5DJ2B 4XP1L 1JI1A 2R2EA 4KQ3L 4GAJL 2YRZA 3MMEA 3MRRA 3OAZH 4FRWA 2NY3C 1NDMA 3OPZL 4Y1AA 5HYSG 3KJ6H 3S97C 1YQVL 3PJSA 2R9HC 2ORBL 1FJ1A 4LSTH 3NN8A 3O45B 2X4QB 5HHVL 1ZA6B 4E41D 3LZFH 3I6KB 3MXWH 4ELMA 4LIQL 3BRFA 4NFBA 1D9KA 3T77B 3O2WH 3BD4A 3E6FA 3MFGB 4XP5H 5DUMH 2YUWA 4HEME 1X5GA 5FDWB 1NMAL 3WIIL 1TCMA 1A3QA 4NO0B 2H9GB 2AJSL