2VAFA

Crystal structure of human cardiac calsequestrin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
349
structure length
349
Chain Sequence
GLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALSEQUESTRIN-2
publication title Characterization of Human Cardiac Calsequestrin and its Deleterious Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 72
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vafA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vafA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vafA02
1AIUA 1F3AA 2OE1A 1ZGNA 4Q5NA 4IS0A 5IIZA 3BJ5A 4K0GA 5ELGA 3H1NA 2CA8A 4E8EA 5GSSA 3QOUA 4KSOA 4F0CA 3IE3A 12GSA 5CRDA 3EU3A 3BOAA 3TKSE 4E8HA 1GSEA 2VLVA 3RBTA 3HJPA 4HQZA 4MF7A 3F6DA 1GL8A 4HZ2A 2GZZA 4X1UA 3NOFA 2K8VA 5DAKA 1XBSA 4V1Ag 2NPBA 2FLSA 4TR3A 5C04A 2DMLA 2EIQA 3GKNA 3KP8A 5CYYA 2M46A 3C71A 4FO5A 3HJMA 14GSA 3CSHA 4I8BA 3FZ4A 2L6DA 5ECNB 2PU9C 3PINA 2IMIA 2C8UA 1XWGA 1PRXA 4PQIA 2H73A 1WOUA 3Q74A 1MD3A 1B9XC 4AJ7A 4HQSA 4IVFA 5GAPD 2YCDA 1PX7A 2YZUA 4MZCA 2JADA 2WRTA 3ISOA 4ZILA 4PNFA 1SD9A 2WZ9A 3VWXA 5DVBA 2VLTA 4WR5A 3F63A 2FA8A 4MPGA 3O3TA 1O73A 1XVWA 3D0ZA 5HFGA 3TJJA 3I69A 3H8QA 2WS2A 1M7TA 4BVXA 1AAZA 2GDRA 1TW9A 4OFMA 1XW5A 1AXDA 3IC4A 3IRAA 3DGQA 3ME8A 1UC7A 3G7YA 4FYCA 3L9UA 1K0MA 4ZB9A 1SKRB 2GT6A 1SK0A 2R5GA 3VWVA 5A4VA 3IAS2 3W6GA 1G7OA 3LEFA 2BMXA 1GSFA 2LRCA 2ZNMA 2TRCP 2M80A 3UMAA 5IMDA 4K2DA 5C00A 1JZRA 1ERTA 5DDLA 2AJQB 1EOHA 3KM6A 1XOAA 3MWHA 5ELAA 1XWKA 5DQSA 4PURA 4KDUA 3QFAC 2O89A 2TIRA 5B8AA 4OFTA 2VLUA 1F2EA 2FWHA 3GV1A 3WYWA 4XS1A 4POMA 5HFIA 3L78A 2G0FA 2CVBA 2NTOA 1GP1A 3A3TA 2CZ3A 1X5DA 4MCUA 4K6XA 1X9MB 3TKRA 3ZIVA 1YF1A 3IK7A 3APOA 3GKXA 3C1SA 1XIYA 5IM9A 17GSA 4LL1B 3ZFBA 3RHCA 2ON7A 3ZL5A 2FY6A 3FHKA 2WB9A 4YH2A 1YQ1A 1K0OA 1GTIA 5COHA 4BPYA 5JCGA 2L57A 4GQCA 1NHYA 2PUKC 1ILOA 5B8BA 3QR6A 3ZZXA 3GHAA 4POLA 4K7OA 4PUFC 1BG5A 1PSQA 1O8XA 20GSA 1VF3A 1X5EA 1Z3EA 2EIOA 3LWAA 5KN0A 1TXXA 4QQ7A 4P3YB 2YWMA 2GSRA 4V2MA 3DRNA 5E4WA 1J9BA 2B7KA 1VF4A 2N5FA 2VCXA 4N0ZA 2O7KA 1K0AA 2EIRA 2V32A 3W8JA 4GF0A 1AQXA 2WJUA 3ZMKA 5JCWA 3LYPA 1GUKA 3GSTA 5ECSA 5IMFA 3ZITA 2PERA 4JEDA 3IXRA 1EGRA 1FOVA 5JWQB 3HVVA 1YEPA 2VL2C 4OD7A 2RIIA 1R5PA 3HXSA 3A2XA 5AGYA 2YWOA 4CDOA 1GRXA 4YAVA 3APQA 2LJAA 4EDYA 4TR4A 2P0GA 1V58A 3EURA 5ENUA 5CRGA 2FWGA 5D93A 4HOJA 4ZXGA 1K0BA 1WWJA 1F6MC 4NV5A 1O6JA 3ME7A 2ZCTA 2GTUA 3QPMA 1GUMA 2H74A 2YWNA 1ABAA 1TK5B 4KB3A 1DE2A 1JLVA 5F0GA 3LFLA 2ON5A 2FCHA 3UVTA 3K8NA 1RK4A 3KTLA 1B4PA 1OE8A 2CAIA 4IQ1A 4V1Ap 2WGRA 5L71A 3P90A 2DC5A 4K9ZA 1TKDB 5JCUA 3U6VA 3TJGA 1QUWA 1TU7A 3EYTA 6GSVA 5AN1A 2C0GA 4L8EA 1IYIA 1WPIA 3FKFA 4MPFA 3VI7A 4L0WA 2DSAA 4EUYA 1BQ7A 3CTGA 3L0HA 3GNJA 1YF0A 4ZBDA 3HJOA 1SL0B 18GSA 4WF5A 1E2YA 1TTZA 2YV9A 1XW9A 1SENA 3EMPA 3IR4A 1X5CA 2OBIA 1ZYQB 2C3NA 1PKZA 2AAWA 2HRNA 4TKYA 4EDZA 4QL9A 1T00A 4IGJA 1GTBA 2C1YA 3J7Yb 3FK8A 3RDWA 3MAKA 3KJYA 1J08A 4MZWA 1W4VA 4MA9A 3KGKA 2H1GA 1BEDA 1DSBA 2B5YA 2M72A 5H5RA 1YZXA 1HYUA 4K0NA 4NHWA 3WGDA 5ECMB 1ZCPA 3IV4A 1NSWA 2R2JA 2F8FA 1TOFA 4I5QA 2DJJA 4CHSA 4GTUA 3G7IA 3KTBA 3UEMA 4HJ2A 1FB6A 2VL9A 2VOCA 2TRXA 1FVJA 3ZFLA 2P5RA 3DEXA 1PQNA 2X8GA 2LRTA 2HE3A 1N8JA 1TDIA 1FHEA 1WIKA 5HQPA 3UOMA 1PGTA 2DMMA 2H8LA 1GNEA 1GWCA 5GZZB 1IYHA 2LQOA 4BWQA 2H66A 4ACSA 3Q6OA 1PL2A 3HZ8A 4O7HA 4XTSA 2MYGA 1R5AA 1EOGA 5F05A 1C72A 4FIWA 4MJBA 2B5XA 3UL3A 2PPTA 3A2VA 3HDCA 2L5OA 2MMNA 3D6IA 4HEA2 2IMFA 1SL2B 4HS1A 1TK0B 2IJYA 1B48A 5EPFA 2PN8A 6GSSA 2D2ZA 3D22A 2VL3A 4XRAA 4FH8A 1BAYA 3N9JA 4Z7XA 1TK8B 2OACA 3N5OA 1N2AA 2C3TA 2BJXA 3CRTA 3WT1A 4TXVA 3TKSC 3ERFA 1YKAA 4MZBA 4BVYA 4YQUA 5AIVA 4EXJA 4HU7A 4EVMA 6GSUA 4ULXA 3DVXA 1ACVA 1S3AA 5KN2A 2ES7A 3J7Yk 3LSZA 1A24A 2DJ2A 4XCSA 3UAPA 4MP4A 1BX9A 1GH2A 3ERGA 5AISA 2NVLA 3CYNA 2YZHA 1T8EB 1BJXA 4MK3A 2IMKA 5GAND 5J9CA 3P2AA 4NAXA 2OE0A 1Q4JA 2YWIA 2I3YA 3GL5A 1GSYA 3FRCA 3ZREA 2QC7A 1HNAA 2L4CA 2H30A 3VFIA 2RM6A 5KEJA 1SK1A 1O81A 4WBJA 1DBYA 1Q98A 2V6OA 2XBQA 3GN3A 3FW2A 1HNCA 3ZIJA 5CAXA 3JCML 2LJRA 3M1GA 3F9UA 1FB0A 1XWBA 3ZTLA 2X99A 3ZRDA 1GLQA 2GSSA 4FYUA 2RUEA 4WXTA 3GURA 4AJ6A 4N11A 1TRWA 2HRFA 4I6XA 1A2JA 4KCAA 2E2MA 4JR4A 1R7HA 5IMZA 4ML6A 2B1LA 1JZDA 3BCKA 5B6MA 2F51A 3EC3A 2YV7A 4WF4A 3E0UA 3TRXA 4N30A 3QCPA 5G31A 1QFNA 2H1AA 1FAAA 5D9VA 1SKWB 2K9FA 1UN2A 4MDCA 1TU8A 4RQRA 1XWAA 3BCIA 2H0GA 3ZVJD 5ECQB 2N5AA 1XCCA 2CAQA 4XS6A 5G5FA 3UJ1A 1OKDA 3TOTA 4DSSB 4G10A 3IBHA 1F9MA 4G9HA 5G2ZA 2LRNA 4KUNA 3CBUA 6GSYA 2E0QA 2RUFA 1YEXA 1K0NA 1EEJA 2FUG2 2X8HA 5FHIA 4ECBA 2VL2A 2C4JA 5IMCA 3O76A 3G7JA 3TJBA 2GQKA 2VM2A 3P8WA 2CVDA 19GSA 3EE2A 5D9TA 2XPEA 3KMOA 1XZOA 1M0UA 2WFCA 3EU4A 3IK9A 2PVOC 1UVZA 1GSDA 3M9KA 1GSUA 2RLIA 4KE3A 3BBYA 1Z9HA 4ZL7A 2JACA 2YNXA 1WE0A 2H76A 2OE3A 2WULA 2H1BA 1YY7A 1H75A 4YAPA 3F3RA 3WGEA 1VF2A 5DJMA 1DUGA 4K1FA 4JR6A 1XXUA 5ABRA 3ZMLA 1EV4A 5F07A 1XW6A 5J4UA 4KNDA 1PMTA 1OC3A 3LXTA 2VCTA 4MH3A 1OVNA 2OJLA 1K3YA 1V98A 4IKHA 13GSA 2CVKA 2V41A 2VIMA 4F82A 3WGXA 3HA9A 4H86A 3ERWA 5ID2A 1S3DA 3DD3A 1LJRA 1NM3A 1MDJA 4GSTA 3GL3A 5CRHA 4MF5A 2J23A 6GSTA 1UA5A 5FWGA 1LBKA 3BD2A 3KH7A 2KLXA 3D4MA 2V1MA 5A4UA 1ZYEA 4EO3A 1ON4A 1T7PB 5ECRB 3O6TA 4IP6A 1U3IA 4TW5A 2HI7A 4GWRA 2YJHA 4ISDA 1T4YA 5KN1A 2B1KA 1G7EA 3MSZA 2C0DA 8GSSA 1U3AA 4KGIA 4NWYA 3NIVA 1QK8A 4ML1A 3FZAA 1JLWA 4ZB6A 3D5JA 1T4ZA 2GSTA 5DBQA 1TJDA 2VCQA 3AY8A 1M2AA 1Y25A 1PA3A 4TRXA 5J3RA 2J9HA 4PUAA 2JSZA 2H0HA 5ECKB 2HSHA 3GSSA 2YP6A 1SD8A 1FG4A 1SJZA 1CQHA 3EINA 3M0FA 3RPNA 1QMVA 4IQAA 3PGTA 2QKEA 2P31A 3C8EA 2NDOA 1KBNA 5D9XA 2JSYA 5B6NA 4XS4A 1K0CA 3IPZA 5IO2A 1AUCA 1S3CA 3DKSA 3VI5A 1EP7A 4PNGA 2K8SA 5EY6A 4O92A 3LGCA 5ECLB 1A0RP 3QFBC 4PQHA 1EV9A 1U88A 1Y6EA 1SK2A 4TOPA 2DLXA 4DVCA 2MMAA 4ZL9A 2LEGA 4V2LA 2LTKA 3GRXA 1I9DA 5DJLA 1TRSA 2ZUPA 3L9VA 3QAVA 4G2EA 3RAZA 3TJFA 1URMA 2LS5A 5H5QA 4G19A 4WBRD 2YN1A 2GQLA 1FW1A 1JZOA 4GSNA 3F4RA 1AC1A 4EF0A 2QGVA 2IL3A 4JE1A 5DALB 5IOXA 3IHQA 4DSSA 1GSSA 4J2FA 3KMNA 1JHBA 5LCZA 11GSA 3HYPA 3DYRA 5D96A 5IQYA 2R4VA 4TXOA 4LL4B 1ZOFA 4KX4A 2XPDA 1QQ2A 2C80A 3VK9A 1U87A 2WCIA 3H93A 5HFKA 2IIYA 4GCIA 3C7MA 3VPQA 3TKSA 5B7CA 1WMJA 3F3QA 5HR1A 2H0IA 3PR8A 2CX3A 3DIEA 3GTUA 4TR1A 1KNGA 2DJ1A 5CP1A 2H72A 4AF2A 1F37A 4IHUA 5FT3A 1VF1A 3OR5A 2LUSA 4N0VA 1B8XA 1GSQA 4FYBA 4HZ4A 4F2IA 2B3SA 3DMLA 1V2AA 4BA7A 3TKPA 4RI6A 4YQVA 4JZQA 2PVQA 3GYKA 2PGTA 5KN3A 3F6FA 3U5RE 3KXOA 4WEYA 2YOIA 2R6KA 1RQMA 3ED3A 2VAFA 3QMXA 2K6VA 3MNGA 5AIXA 2FA4A 2Z9SA 1K3LA 2KP2A 2X8CA 2OBKA 2F9SA 1GUHA 3NZNA 1QGVA 3FY7A 4J56E 3L4NA 3UVHA 1VRSD 2GVPA 3HY2A 3IA1A 3Q18A 3LORA 2O8VB 1TI1A 4ZBAA 2IPAA 1SU9A 1OKTA 2H6ZA 1WJKA 3KCMA 2JZRA 1MD4A 1MDKA 3GKMA 5DCGA 3A5WA 3V1WA 4XIHA 4HDEA 3APSA 2V2GA 2YPMA 2EC4A 2HSYA 1EWXA 3GH6A 2AHEA 2IFQA 1A8LA 3TRQA 5A4WA 3HKRA 2FHEA 2AV4A 3FR3A 2L6CA 2WDUA 2IMDA 2OADA 5ID2B 2IN3A 2YANA 2GQMA 2VM1A 3IOSA 4GXZA 4N10A 3ZYWA 5IPHA 2H6YA 3C73A 5IOWA 1ERUA 2CQ9A 2VO4A 22GSA 4F0BA 1A2LA 4KDXA 1OE7A 1M2DA 2L5LA 4PXOA 1M9AA 3DXBA 2HZEA 2GZPA 1Z7RA 5G1LA 3IDVA 2VCWA 4MMMA 1SYXA 5IO0A 2FWEA 1AW9A 3LG6A 3VWWA 1XWCA 1OC9A 1ZZYA 1GTAA 2B5EA 2REMA 4IP1A 3DVWA 4MJCA 5D9WA 3SBCA 2H19A 1Z5YE 4IBPA 3RPPA 1V40A 1FO5A 3GMFA 1OYJA 2C0FA 2PWJA 2H70A 3FR6A 6GSWA 2LSTA 5CREA 2DIYA 1FVKA 2E2GA 5G5EA 4EKZA 2HYXA 4D73B 4OO5A 3M9JA 5IPGA 1THOA 5DCHA 16GSA 1PKWA 4BWSA 4KSMA 3TGZA 5HR2A 2H1DA 4XS4B 4Q5RA 1AQWA 1H4OA 4JRRA 1OC8A 2MZCA 4PQ1A 4EL1A 5DALA 2H71A 3QDNA 2HZFA 2GZYA 2DJ3A 4KCEA 1K0DA 4OFNA 3VPTA 4GLTA 1JZWA 3GKKA 3HCZA 4PX1A 5INYA 1JFUA 4TVEA 4XHMA 4ECIA 1A2MA 3L9SA 3F4SA 5D73A 3GUSA 1V57A 1ST9A 1K3OA 3HD5A 5G1KA 2VCVA 3KP9A 1EGOA 4LMWA 4PGTA 2ALBA 1GULA 4MF6A 4X43A 4LLRA 4AGSA 2MMOA 5CO3A 5IMVA 4IW9A 1B9YC 2KHPA 3CMIA 4KH7A 1KEBA 3MDKA 4RUVA 4TR0A 4TXOB 4ZIJA 3CSJA 3TRPA 3C1RA 2B6MA 3IAM2 3KIJA 1DE1A 3DWVA 5H5SA 5CRWA 1ERWA 4MABA 4V2NA 3HVSA 3LQ7A 2VCZA 1EZKA 3GTUB 4TR1B 2OA7A 1VGLA 3TB2A 2I81A 3I43A 1R26A 1PX6A 4IN0A 1TP9A 1YKCA 6GSXA 4DSQA 1XVQA 4ID0A 4WR4A 2JZTA 3VURA 1ZL9A 1T3BA 4KW6A 3P7XA 1WP0A 3R2QA 4WKWA 1TRVA 1O85A 2H01A 1SJIA 4KA0A 1ERVA 4JBBA 3EWLA 3UBKA 5IMAA 5E59A 1ZMAA 4K7IA 1X9WB 1XFLA 1MTCA 4HJMA 1XPVA 2CZ2A 4AJ8A 2I9HA 4NV2A 4Q5QA 1PN9A 2GLRA 2L59A 2V6KA 3FZ5A 4I97A 4ECCA 5J5NA 1M99A 4OWYA 1I5GA 3LJRA 2AUVA 1MEKA 1AQVA 3UIWA 2CT6A 2LJKA 5F06A 3GX0A 3PH9A 4ECJA 10GSA 1HNBA 5F8BA 5ECHB 1TRUA 3TJKA 4MH2A 1F3BA 4IJ3A 2C0EA 2BTOT 4EC0A 5J9BA 3KD0A 2HLSA 4L0UA 1A0FA 2E7PA 3CXGA 5A5KA 2OKAA 3E3EA 5HR3A 4NHZA 4K7NA 3VLNA 2IFQB 4GQFA 2H75A 3E9JB 4CW9A 1T1VA 1A23A 3ZVJA 5JWOB 4YQMA 4ILFA 4I2UA 1RW1A 3H4KA 1PD21 3M3MA 3CTFA 3M8NA 4RI7A 2A4VA 1G6YA 2F8AA 2C3QA 1A8YA 4ZB8A 4POBA 3CSIA 5HR0A 2DJKA 1M9BA 4NMUA 2N5BA 2JZSA 2CX4A 4MJAA 4K8MA 4D73A 2PMTA 4L5OA 2DIZA 3HZ4A 4LA1A 1HD2A 2GT5A 2HZEB 4TN8A 3UBLA 2MMZA 3KZQA 5EL8A 2HNLA 4DEJA 3QAGA 1OC9B 2O85A 4MJEA 3CRUA 5G30A 3US3A 1J0FA 2XBIA 2LQQA 4OMVA 3TUEA 3Q19A 2P5QA 3WD6A 3EMXA 2K18A 4ZL8A 1XOBA 2XC2A 4L5LA 1W89A 2HT9A 4O5RA 3A2WA 4HU9A 2I4AA 4HUAA 3GA4A 2X64A 2LNSA 2LKUA 2VUPA 3ZLPA 3VWUA 5DAKB 3RHBA 3WT2A 2DBCA 4IJIA 2GSQA 1SJ6A 4XRDA 3W8SA 3GH9A 4GSSA 3I9V2 2MBSA 2MBTA 2GGTA 4HI7A 2NBSA 1EP8A 3TOUA 4NXIA 2PBJA 3F0IA 5LNKe 2G2QA 2HXKA 1M2BA 3I6AA 1R4WA 5D8IA 1KTEA 2IWTA 4OCEA 4OCFA 5LD0A 4RQXA 4EE0A 5JWRB 5J41A 3FEUA 1BYEA 1NW2A 3KH9A 1U6TA 4O32A 2R37A 1SKSB 3FR9A 1X9SB 3GFKA 2O87A 4JU5A 1QXHA 3H79A 1SYRA 1O8WA 2F3MA 3EVIA 2AYTA 2FD3A 2I1UA 1MDIA 3S9FA 1LU4A 2RM5A 2KUCA 1TI3A 4LMVA 1G6WA 3SWLA 2HFDA 3HVXA 1Z6NA 2H6XA 1USBA 2LNTA 3LXZA 2IMEA 2KP1A 2A2RA 1EEMA 3TCOA 4I2TA 1HQOA 2L4QA 1YDKA 3HHVA 2JU5A 4F9ZA 2VD1A 3KEBA 1WRYA 2DJ0A 2CV4A 5ECIB 5EVOA 1YJ6A 1V9WA 1G0TA 1NHOA 3F8UA 1CQGA 3UARA 4POKA 2XHFA 3GX8A 2LV3A 4WETA 1X0RA 4GRFA 3G9BA 4F03A 2QSIA 4KAEA 2FGXA 4DSRA 2FWFA 2JL4A 3QAWA 5CNWA 3TKQA 4BL7A 3TDGA 7GSSA 4NPBA 4KDYA 5ECPB 5GSTA 3D21A 1Z6MA 1OAZA 3LYKA 1THXA 2R3XA 3D4TA 2GS3A 5DQYA 1E6BA 3GIXA 1SL1B 4ZBBA 4Q5FA 3F4TA 4MLYA 1GNWA 4J57E 2VD0A 1PL1A 2YJ7A 2B7JA 4QL7A 1B4QA 1O7UA 9GSSA 1GTUA 2KOKA 1ML6A 1Z7PA 3QD9A 2FNOA 4X0XA 4OO4A 1GLPA 2A2SA 2AB6A 4IELA 3FZ9A 5ECOB 3FYGA
chains in the Genus database with same CATH superfamily
1AIUA 1F3AA 2OE1A 1ZGNA 4Q5NA 4IS0A 5IIZA 3BJ5A 4K0GA 5ELGA 3H1NA 2CA8A 4E8EA 5GSSA 3QOUA 4KSOA 4F0CA 3IE3A 12GSA 5CRDA 3EU3A 3BOAA 3TKSE 4E8HA 1GSEA 2VLVA 3RBTA 3HJPA 4HQZA 4MF7A 3F6DA 1GL8A 4HZ2A 2GZZA 4X1UA 3NOFA 2K8VA 5DAKA 1XBSA 4V1Ag 2NPBA 2FLSA 4TR3A 5C04A 2DMLA 2EIQA 3GKNA 3KP8A 5CYYA 2M46A 3C71A 4FO5A 4EIPA 3HJMA 14GSA 3CSHA 4I8BA 3FZ4A 2L6DA 5ECNB 2PU9C 3PINA 2IMIA 2C8UA 1XWGA 1PRXA 4PQIA 2H73A 1WOUA 3Q74A 1MD3A 1B9XC 4AJ7A 4Z2RA 4HQSA 4IVFA 5GAPD 2YCDA 1PX7A 2YZUA 4MZCA 2JADA 2WRTA 3ISOA 4Z2UA 4ZILA 4PNFA 1SD9A 2WZ9A 3VWXA 5DVBA 2VLTA 4WR5A 3F63A 2FA8A 4MPGA 3O3TA 1O73A 1XVWA 3D0ZA 5HFGA 3TJJA 3I69A 3H8QA 2WS2A 1M7TA 4BVXA 1AAZA 2GDRA 1TW9A 4OFMA 4PTSA 1XW5A 1AXDA 3IC4A 3IRAA 3DGQA 3ME8A 1UC7A 3G7YA 4FYCA 3L9UA 1K0MA 4ZB9A 1SKRB 2GT6A 2QA1A 1SK0A 4Z2TA 2R5GA 3VWVA 5A4VA 3IAS2 3W6GA 1G7OA 3LEFA 2BMXA 1GSFA 2LRCA 2ZNMA 2TRCP 2M80A 3PPUA 3UMAA 5IMDA 4K2DA 5C00A 1JZRA 1ERTA 5DDLA 2AJQB 1EOHA 3KM6A 1XOAA 3MWHA 5ELAA 1XWKA 5DQSA 4PURA 4KDUA 3QFAC 2O89A 2TIRA 5B8AA 4OFTA 2VLUA 1F2EA 2FWHA 3GV1A 3WYWA 4XS1A 4POMA 5HFIA 3L78A 2G0FA 2CVBA 2NTOA 1GP1A 3A3TA 2CZ3A 1X5DA 4MCUA 4K6XA 1X9MB 3TKRA 3ZIVA 1YF1A 3IK7A 3APOA 3GKXA 3C1SA 1XIYA 5IM9A 17GSA 4LL1B 3ZFBA 3RHCA 2ON7A 3ZL5A 2FY6A 3FHKA 2WB9A 4YH2A 1YQ1A 2HSMA 1K0OA 1GTIA 5COHA 4BPYA 5JCGA 2L57A 4GQCA 1NHYA 2PUKC 1ILOA 5B8BA 3QR6A 3ZZXA 4BL7B 3GHAA 4POLA 4K7OA 2R0GA 4PUFC 1BG5A 1PSQA 1O8XA 20GSA 1VF3A 1X5EA 1Z3EA 2EIOA 3LWAA 5KN0A 1TXXA 4QQ7A 4P3YB 2YWMA 2GSRA 4V2MA 3DRNA 5E4WA 1J9BA 2B7KA 1VF4A 2N5FA 2VCXA 4N0ZA 2O7KA 1K0AA 2EIRA 2V32A 3W8JA 4GF0A 1AQXA 2WJUA 3ZMKA 5JCWA 3LYPA 1GUKA 3GSTA 5ECSA 5IMFA 3ZITA 2PERA 4JEDA 3IXRA 1EGRA 1FOVA 5JWQB 3HVVA 1YEPA 2VL2C 4OD7A 2RIIA 1R5PA 3HXSA 3A2XA 5AGYA 2YWOA 4CDOA 1GRXA 4YAVA 3APQA 2LJAA 4EDYA 4TR4A 2P0GA 1V58A 3EURA 5ENUA 5CRGA 2FWGA 5D93A 4HOJA 1FOHA 4ZXGA 1K0BA 1WWJA 1F6MC 4NV5A 1O6JA 3ME7A 2ZCTA 3MIXA 2GTUA 3QPMA 1GUMA 2H74A 2YWNA 1ABAA 1TK5B 4KB3A 1DE2A 1JLVA 5F0GA 3LFLA 2ON5A 2FCHA 3UVTA 3K8NA 1RK4A 3KTLA 1B4PA 1OE8A 2CAIA 4IQ1A 4V1Ap 2WGRA 5L71A 3P90A 2DC5A 4K9ZA 1TKDB 5JCUA 3U6VA 3TJGA 1QUWA 1TU7A 3EYTA 6GSVA 5AN1A 2C0GA 4L8EA 1IYIA 1WPIA 3FKFA 4MPFA 3VI7A 4L0WA 2DSAA 4EUYA 1BQ7A 3CTGA 3L0HA 3GNJA 1PFOA 1YF0A 4ZBDA 3HJOA 1SL0B 18GSA 4WF5A 1E2YA 1TTZA 2YV9A 1XW9A 1SENA 3EMPA 3IR4A 1X5CA 2OBIA 1ZYQB 2C3NA 1PKZA 2AAWA 2HRNA 2X4AA 4TKYA 4EDZA 4QL9A 4G0KA 1T00A 4IGJA 1GTBA 1ZYPA 2C1YA 3J7Yb 3FK8A 3RDWA 3MAKA 3KJYA 1J08A 4MZWA 1W4VA 4MA9A 3KGKA 2H1GA 1BEDA 1DSBA 2B5YA 2M72A 5H5RA 1YZXA 1HYUA 4K0NA 4NHWA 3WGDA 5ECMB 1ZCPA 3IV4A 1NSWA 2R2JA 2F8FA 1TOFA 4I5QA 2DJJA 4CHSA 4GTUA 3G7IA 3KTBA 3UEMA 3A5IA 4HJ2A 1FB6A 2VL9A 2VOCA 2TRXA 1FVJA 4YKFA 4YKGA 4ICYA 1PN0A 3ZFLA 2P5RA 3DEXA 1PQNA 2X8GA 2LRTA 2HE3A 1N8JA 1TDIA 4K5RA 1FHEA 1WIKA 5HQPA 4K5SA 3UOMA 1PGTA 2DMMA 2H8LA 1GNEA 1GWCA 5GZZB 3MYDA 1IYHA 2LQOA 4KF9A 4BWQA 2H66A 4ACSA 3Q6OA 1PL2A 3HZ8A 4O7HA 1S3RA 4XTSA 2MYGA 1R5AA 1EOGA 5F05A 1C72A 4FIWA 4MJBA 2B5XA 3UL3A 4CY8A 2PPTA 3A2VA 3HDCA 2L5OA 2MMNA 3D6IA 4HEA2 2IMFA 1SL2B 4HS1A 1TK0B 2IJYA 1B48A 5EPFA 2PN8A 6GSSA 2D2ZA 3D22A 2VL3A 4XRAA 4FH8A 1BAYA 3N9JA 4Z7XA 1TK8B 2OACA 3N5OA 1N2AA 2C3TA 2BJXA 3CRTA 2A2PA 3WT1A 4TXVA 3TKSC 3ERFA 1YKAA 4MZBA 4BVYA 4YQUA 5AIVA 4EXJA 1XG8A 4HU7A 4EVMA 6GSUA 4ULXA 3DVXA 1ACVA 1S3AA 5KN2A 2ES7A 3J7Yk 3LSZA 1A24A 2DJ2A 4XCSA 3UAPA 4MP4A 1BX9A 1GH2A 3ERGA 5AISA 2NVLA 3CYNA 2YZHA 1T8EB 1BJXA 4MK3A 2IMKA 5GAND 5J9CA 3P2AA 4NAXA 2OE0A 1Q4JA 2YWIA 2I3YA 3GL5A 1GSYA 3FRCA 3ZREA 2QC7A 1HNAA 2L4CA 2H30A 4EIQA 3VFIA 2RM6A 2X49A 5KEJA 1SK1A 1O81A 4WBJA 1DBYA 1Q98A 2V6OA 2XBQA 3GN3A 3FW2A 1HNCA 3ZIJA 5CAXA 5KOWA 3JCML 2LJRA 3M1GA 3F9UA 1FB0A 1XWBA 3ZTLA 2X99A 3ZRDA 1GLQA 2GSSA 4FYUA 2RUEA 4WXTA 3GURA 4AJ6A 4N11A 1TRWA 2HRFA 4I6XA 1A2JA 4KCAA 2E2MA 4JR4A 1R7HA 5IMZA 4ML6A 2B1LA 1JZDA 3BCKA 5B6MA 2F51A 3EC3A 1M3JA 2YV7A 4WF4A 3E0UA 3TRXA 4N30A 3QCPA 5G31A 1QFNA 2H1AA 1FAAA 5D9VA 1SKWB 2K9FA 1UN2A 4MDCA 1TU8A 4RQRA 1XWAA 3BCIA 2H0GA 3ZVJD 5ECQB 2N5AA 1XCCA 2CAQA 4XS6A 5G5FA 3UJ1A 1OKDA 3TOTA 4DSSB 4G10A 3IBHA 1F9MA 4O5UA 4G9HA 5G2ZA 2LRNA 4KUNA 3CBUA 1ZYNA 6GSYA 2HRAA 2E0QA 2RUFA 1YEXA 1K0NA 1EEJA 2FUG2 2X8HA 5FHIA 4ECBA 2VL2A 2C4JA 5IMCA 3O76A 3G7JA 3TJBA 2GQKA 2VM2A 3P8WA 2CVDA 19GSA 3EE2A 5D9TA 2XPEA 3KMOA 3HVNA 1XZOA 1M0UA 2WFCA 3EU4A 3IK9A 2PVOC 1UVZA 1GSDA 3M9KA 1GSUA 2RLIA 4KE3A 3BBYA 1Z9HA 4ZL7A 2JACA 2YNXA 1WE0A 2H76A 2OE3A 2WULA 2H1BA 1YY7A 1H75A 4YAPA 3F3RA 3WGEA 1VF2A 5DJMA 1DUGA 4K1FA 4JR6A 1XXUA 5ABRA 3ZMLA 1EV4A 5F07A 1XW6A 5J4UA 4KNDA 1PMTA 1OC3A 3LXTA 2VCTA 4MH3A 1OVNA 2OJLA 1K3YA 1V98A 4IKHA 13GSA 2CVKA 2V41A 2VIMA 4F82A 3WGXA 3HA9A 4H86A 3ERWA 5ID2A 1S3DA 3DD3A 3CQFA 1LJRA 1NM3A 1MDJA 4GSTA 3GL3A 5CRHA 4MF5A 2J23A 4USSA 6GSTA 1UA5A 4FQUA 5FWGA 1LBKA 3BD2A 3KH7A 2KLXA 3D4MA 2V1MA 5A4UA 1ZYEA 4EO3A 1ON4A 1T7PB 5ECRB 3O6TA 4IP6A 1U3IA 4TW5A 2HI7A 4GWRA 2YJHA 4ISDA 1T4YA 5KN1A 2B1KA 1G7EA 3MSZA 2C0DA 8GSSA 1U3AA 4KGIA 4NWYA 3NIVA 1QK8A 4ML1A 3FZAA 1JLWA 4ZB6A 3D5JA 1T4ZA 2GSTA 5DBQA 1TJDA 2VCQA 3AY8A 1M2AA 1Y25A 1PA3A 4TRXA 5J3RA 2J9HA 4PUAA 2JSZA 2H0HA 5ECKB 2HSHA 3GSSA 2YP6A 1SD8A 1FG4A 1SJZA 1CQHA 3EINA 3M0FA 3RPNA 3EPTA 1QMVA 4IQAA 3PGTA 4BVYB 2QKEA 2P31A 3C8EA 2NDOA 1KBNA 5D9XA 2JSYA 5B6NA 4XS4A 1K0CA 3IPZA 5IO2A 1AUCA 1S3CA 3DKSA 3VI5A 1EP7A 4PNGA 2K8SA 5EY6A 4O92A 3LGCA 5ECLB 5BMUA 1A0RP 3QFBC 4PQHA 1EV9A 1U88A 1Y6EA 1SK2A 4TOPA 2DLXA 4DVCA 2MMAA 4ZL9A 2LEGA 4V2LA 2LTKA 3GRXA 1I9DA 5DJLA 1TRSA 2ZUPA 3L9VA 3QAVA 4G2EA 3RAZA 3TJFA 1URMA 2LS5A 5H5QA 4G19A 4WBRD 2YN1A 2GQLA 1FW1A 1JZOA 4GSNA 3F4RA 1AC1A 4EF0A 2QGVA 2IL3A 4JE1A 5DALB 5IOXA 3IHQA 4DSSA 1GSSA 4J2FA 3KMNA 1JHBA 5LCZA 11GSA 3HYPA 3DYRA 5D96A 5IQYA 2R4VA 4TXOA 4LL4B 1ZOFA 4KX4A 2XPDA 1QQ2A 2C80A 3VK9A 1U87A 2WCIA 3H93A 5HFKA 2IIYA 4GCIA 3C7MA 3VPQA 3TKSA 5B7CA 1WMJA 3F3QA 5HR1A 2H0IA 3PR8A 2CX3A 3DIEA 3GTUA 4TR1A 1KNGA 2DJ1A 5CP1A 2H72A 4AF2A 1F37A 4IHUA 5FT3A 1VF1A 3OR5A 2LUSA 4N0VA 2A4HA 1B8XA 1GSQA 4FYBA 4HZ4A 4F2IA 2B3SA 3DMLA 1V2AA 4BA7A 3TKPA 4RI6A 4YQVA 4JZQA 2PVQA 3GYKA 2PGTA 5KN3A 3F6FA 3U5RE 3KXOA 4WEYA 2YOIA 2R6KA 1RQMA 3ED3A 2VAFA 3QMXA 2K6VA 3MNGA 5AIXA 2FA4A 2R0PA 2Z9SA 1K3LA 2KP2A 2X8CA 2OBKA 2F9SA 1GUHA 3NZNA 1QGVA 3FY7A 4J56E 3L4NA 3UVHA 1VRSD 2GVPA 3HY2A 3IA1A 3Q18A 3LORA 2O8VB 1TI1A 4ZBAA 2IPAA 1SU9A 1OKTA 2H6ZA 1WJKA 3KCMA 2JZRA 1MD4A 1MDKA 3GKMA 5DCGA 3A5WA 3V1WA 4XIHA 4HDEA 3APSA 2V2GA 2YPMA 2EC4A 2HSYA 1EWXA 3GH6A 2AHEA 2IFQA 1A8LA 3TRQA 5A4WA 3HKRA 2FHEA 2AV4A 3IHGA 3FR3A 2DKIA 2L6CA 2WDUA 2IMDA 2OADA 5ID2B 2IN3A 2YANA 2GQMA 2VM1A 3IOSA 4GXZA 4N10A 3ZYWA 5IPHA 2H6YA 3C73A 5IOWA 1ERUA 2CQ9A 2VO4A 22GSA 4F0BA 1A2LA 3LW9A 4KDXA 1OE7A 1M2DA 2L5LA 4PXOA 1M9AA 3DXBA 2HZEA 2GZPA 1Z7RA 5G1LA 3IDVA 2VCWA 4MMMA 1SYXA 5IO0A 2FWEA 1AW9A 3LG6A 3VWWA 1XWCA 1OC9A 1ZZYA 1GTAA 2B5EA 2REMA 4K2XA 4IP1A 3DVWA 4MJCA 5D9WA 3SBCA 2H19A 1Z5YE 4IBPA 3RPPA 1V40A 1FO5A 3GMFA 1OYJA 2C0FA 2PWJA 2H70A 3FR6A 6GSWA 2LSTA 5CREA 2DIYA 1FVKA 2E2GA 5G5EA 4EKZA 2HYXA 4D73B 4OO5A 3M9JA 5IPGA 1THOA 5DCHA 16GSA 1PKWA 4BWSA 4KSMA 3TGZA 5HR2A 2H1DA 4XS4B 4Q5RA 1AQWA 1H4OA 4JRRA 1OC8A 2MZCA 4PQ1A 4EL1A 5DALA 2H71A 3QDNA 2HZFA 2GZYA 2DJ3A 4KCEA 1K0DA 4OFNA 3VPTA 4GLTA 1JZWA 3GKKA 3HCZA 4PX1A 5INYA 1JFUA 4TVEA 4XHMA 4ECIA 1A2MA 3L9SA 3F4SA 5D73A 3GUSA 1V57A 1ST9A 1K3OA 3HD5A 5G1KA 2VCVA 3KP9A 1EGOA 4LMWA 4PGTA 2ALBA 1GULA 4MF6A 4X43A 4LLRA 4AGSA 2MMOA 5CO3A 5IMVA 4IW9A 1B9YC 2KHPA 4CY6A 3CMIA 4KH7A 1KEBA 3MDKA 4RUVA 4TR0A 4TXOB 4ZIJA 3CSJA 3TRPA 3C1RA 2B6MA 3IAM2 3KIJA 1DE1A 3DWVA 5H5SA 5CRWA 1ERWA 4G0IA 4MABA 4V2NA 3HVSA 3LQ7A 2VCZA 1EZKA 3GTUB 4TR1B 2OA7A 1VGLA 3TB2A 2I81A 3I43A 1R26A 1PX6A 4IN0A 1TP9A 1YKCA 5BRTA 6GSXA 4DSQA 1XVQA 4ID0A 4WR4A 2JZTA 3VURA 1ZL9A 1T3BA 4KW6A 3P7XA 1WP0A 4MNNA 3R2QA 3IC8A 4WKWA 1TRVA 1O85A 2H01A 1SJIA 2HRKA 4KA0A 1ERVA 4JBBA 3EWLA 3UBKA 5IMAA 5E59A 1ZMAA 4K7IA 1X9WB 1XFLA 1MTCA 4HJMA 1XPVA 2CZ2A 4AJ8A 2I9HA 4NV2A 4Q5QA 1PN9A 2GLRA 2L59A 2V6KA 3FZ5A 4I97A 4ECCA 5J5NA 1M99A 4OWYA 1I5GA 3LJRA 2AUVA 1MEKA 1AQVA 3UIWA 2CT6A 2LJKA 5F06A 3GX0A 3PH9A 4ECJA 10GSA 1HNBA 5F8BA 5ECHB 1TRUA 3TJKA 4MH2A 1M3IA 1F3BA 4IJ3A 2C0EA 2BTOT 4EC0A 5J9BA 3KD0A 2HLSA 4L0UA 1A0FA 2E7PA 3CXGA 5A5KA 2OKAA 3E3EA 5HR3A 4NHZA 4K7NA 3VLNA 2IFQB 4GQFA 2H75A 3E9JB 2QA2A 4CW9A 1T1VA 1A23A 3ZVJA 5JWOB 4YQMA 4ILFA 4I2UA 1RW1A 3H4KA 1PD21 4BIKA 3M3MA 3CTFA 3M8NA 4RI7A 2A4VA 1G6YA 2F8AA 2C3QA 1A8YA 4ZB8A 4POBA 3CSIA 5HR0A 2DJKA 1M9BA 4NMUA 2N5BA 2JZSA 2DKHA 3FMWA 2CX4A 4MJAA 4K8MA 4D73A 2PMTA 4L5OA 2DIZA 3HZ4A 4LA1A 1HD2A 2GT5A 2HZEB 4TN8A 3UBLA 2MMZA 3KZQA 5EL8A 2HNLA 4DEJA 3QAGA 1OC9B 2O85A 4MJEA 3CRUA 5G30A 3US3A 1J0FA 2XBIA 2LQQA 4OMVA 3TUEA 3Q19A 2P5QA 3WD6A 3EMXA 2K18A 4ZL8A 1XOBA 2XC2A 4L5LA 1W89A 2HT9A 4O5RA 3A2WA 4HU9A 2I4AA 4HUAA 3GA4A 2X64A 2LNSA 2LKUA 2VUPA 3ZLPA 3VWUA 5DAKB 5KOXA 3RHBA 3WT2A 2DBCA 4IJIA 2GSQA 1SJ6A 4XRDA 3W8SA 3GH9A 4GSSA 3I9V2 2MBSA 2MBTA 2GGTA 4HI7A 2NBSA 1EP8A 3TOUA 4NXIA 2PBJA 3F0IA 5LNKe 2G2QA 2HXKA 1M2BA 3I6AA 1R4WA 5D8IA 1KTEA 2IWTA 4OCEA 4OCFA 5LD0A 4RQXA 4EE0A 5JWRB 5J41A 3FEUA 1BYEA 4HSCX 1NW2A 3KH9A 1U6TA 4O32A 2R37A 1SKSB 3FR9A 1X9SB 3GFKA 4O5QA 2O87A 4JU5A 1QXHA 3H79A 1SYRA 1O8WA 2F3MA 3EVIA 2AYTA 2FD3A 2I1UA 1MDIA 3S9FA 1LU4A 2RM5A 2KUCA 1TI3A 4LMVA 1G6WA 3SWLA 2HFDA 3HVXA 1Z6NA 2H6XA 1USBA 2LNTA 4BVXB 3LXZA 2IMEA 4G0LA 2KP1A 2A2RA 1EEMA 3TCOA 4I2TA 1HQOA 2L4QA 1YDKA 3HHVA 2JU5A 4F9ZA 2VD1A 3KEBA 1WRYA 2DJ0A 2CV4A 5ECIB 5EVOA 1YJ6A 1V9WA 1G0TA 1NHOA 3F8UA 1CQGA 3UARA 4POKA 2XHFA 3GX8A 2LV3A 4WETA 1X0RA 4GRFA 3G9BA 4F03A 2QSIA 4KAEA 2FGXA 4DSRA 2FWFA 4A5PA 2JL4A 3QAWA 5CNWA 3TKQA 4BL7A 3TDGA 7GSSA 4NPBA 4KDYA 5ECPB 5GSTA 3D21A 1Z6MA 1OAZA 3LYKA 1THXA 2R3XA 3D4TA 2GS3A 5DQYA 1E6BA 3GIXA 3R3EA 1SL1B 4ZBBA 4Q5FA 3F4TA 4MLYA 1GNWA 2R0CA 4J57E 2VD0A 1PL1A 2YJ7A 2B7JA 2UZ8A 4QL7A 1B4QA 1O7UA 4X4JA 9GSSA 1GTUA 2KOKA 1ML6A 1Z7PA 3QD9A 2FNOA 4X0XA 4OO4A 1GLPA 2A2SA 2AB6A 4IELA 3FZ9A 5ECOB 3FYGA
chains in the Genus database with same CATH topology
1AIUA 1F3AA 2OE1A 1ZGNA 4Q5NA 4IS0A 5IIZA 3BJ5A 4K0GA 5ELGA 3H1NA 2CA8A 4E8EA 5GSSA 3QOUA 4KSOA 4F0CA 3IE3A 12GSA 5CRDA 3EU3A 3BOAA 3TKSE 4E8HA 1GSEA 2VLVA 3RBTA 3HJPA 4HQZA 4MF7A 3F6DA 1GL8A 4HZ2A 2GZZA 4X1UA 3NOFA 2K8VA 5DAKA 1XBSA 4V1Ag 2NPBA 2FLSA 4TR3A 5C04A 2DMLA 2EIQA 3GKNA 3KP8A 5CYYA 2M46A 3C71A 4FO5A 4EIPA 3HJMA 14GSA 3CSHA 4I8BA 3FZ4A 2L6DA 5ECNB 2PU9C 3PINA 2IMIA 2C8UA 1XWGA 1PRXA 4PQIA 2H73A 1WOUA 3Q74A 1MD3A 1B9XC 4AJ7A 4Z2RA 4HQSA 4IVFA 5GAPD 2YCDA 1PX7A 2YZUA 4MZCA 2JADA 2WRTA 3ISOA 4Z2UA 4ZILA 4PNFA 1SD9A 2WZ9A 3VWXA 5DVBA 2VLTA 4WR5A 3F63A 2FA8A 4MPGA 3O3TA 1O73A 1XVWA 3D0ZA 5HFGA 3TJJA 3I69A 3H8QA 2WS2A 1M7TA 4BVXA 1AAZA 2GDRA 1TW9A 4OFMA 4PTSA 1XW5A 1AXDA 3IC4A 3IRAA 3DGQA 3ME8A 1UC7A 3G7YA 4FYCA 3L9UA 1K0MA 4ZB9A 1SKRB 2GT6A 2QA1A 1SK0A 4Z2TA 2R5GA 3VWVA 5A4VA 3IAS2 3W6GA 1G7OA 3LEFA 2BMXA 1GSFA 2LRCA 2ZNMA 2TRCP 2M80A 3PPUA 3UMAA 5IMDA 4K2DA 5C00A 1JZRA 1ERTA 5DDLA 2AJQB 1EOHA 3KM6A 1XOAA 3MWHA 5ELAA 1XWKA 5DQSA 4PURA 4KDUA 3QFAC 2O89A 2TIRA 5B8AA 4OFTA 2VLUA 1F2EA 2FWHA 3GV1A 3WYWA 4XS1A 4POMA 5HFIA 3L78A 2G0FA 2CVBA 2NTOA 1GP1A 3A3TA 2CZ3A 1X5DA 4MCUA 4K6XA 1X9MB 3TKRA 3ZIVA 1YF1A 3IK7A 3APOA 3GKXA 3C1SA 1XIYA 5IM9A 17GSA 4LL1B 3ZFBA 3RHCA 2ON7A 3ZL5A 2FY6A 3FHKA 2WB9A 4YH2A 1YQ1A 2HSMA 1K0OA 1GTIA 5COHA 4BPYA 5JCGA 2L57A 4GQCA 1NHYA 2PUKC 1ILOA 5B8BA 3QR6A 3ZZXA 4BL7B 3GHAA 4POLA 4K7OA 2R0GA 4PUFC 1BG5A 1PSQA 1O8XA 20GSA 1VF3A 1X5EA 1Z3EA 2EIOA 3LWAA 5KN0A 1TXXA 4QQ7A 4P3YB 2YWMA 2GSRA 4V2MA 3DRNA 5E4WA 1J9BA 2B7KA 1VF4A 2N5FA 2VCXA 4N0ZA 2O7KA 1K0AA 2EIRA 2V32A 3W8JA 4GF0A 1AQXA 2WJUA 3ZMKA 5JCWA 3LYPA 1GUKA 3GSTA 5ECSA 5IMFA 3ZITA 2PERA 4JEDA 3IXRA 1EGRA 1FOVA 5JWQB 3HVVA 1YEPA 2VL2C 4OD7A 2RIIA 1R5PA 3HXSA 3A2XA 5AGYA 2YWOA 4CDOA 1GRXA 4YAVA 3APQA 2LJAA 4EDYA 4TR4A 2P0GA 1V58A 3EURA 5ENUA 5CRGA 2FWGA 5D93A 4HOJA 1FOHA 4ZXGA 1K0BA 1WWJA 1F6MC 4NV5A 1O6JA 3ME7A 2ZCTA 3MIXA 2GTUA 3QPMA 1GUMA 2H74A 2YWNA 1ABAA 1TK5B 4KB3A 1DE2A 1JLVA 5F0GA 3LFLA 2ON5A 2FCHA 3UVTA 3K8NA 1RK4A 3KTLA 1B4PA 1OE8A 2CAIA 4IQ1A 4V1Ap 2WGRA 5L71A 3P90A 2DC5A 4K9ZA 1TKDB 5JCUA 3U6VA 3TJGA 1QUWA 1TU7A 3EYTA 6GSVA 5AN1A 2C0GA 4L8EA 1IYIA 1WPIA 3FKFA 4MPFA 3VI7A 4L0WA 2DSAA 4EUYA 1BQ7A 3CTGA 3L0HA 3GNJA 1YF0A 4ZBDA 3HJOA 1SL0B 18GSA 4WF5A 1E2YA 1TTZA 2YV9A 1XW9A 1SENA 3EMPA 3IR4A 1X5CA 2OBIA 1ZYQB 2C3NA 1PKZA 2AAWA 2HRNA 2X4AA 4TKYA 4EDZA 4QL9A 4G0KA 1T00A 4IGJA 1GTBA 1ZYPA 2C1YA 3J7Yb 3FK8A 3RDWA 3MAKA 3KJYA 1J08A 4MZWA 1W4VA 4MA9A 3KGKA 2H1GA 1BEDA 1DSBA 2B5YA 2M72A 5H5RA 1YZXA 1HYUA 4K0NA 4NHWA 3WGDA 5ECMB 1ZCPA 3IV4A 1NSWA 2R2JA 2F8FA 1TOFA 4I5QA 2DJJA 4CHSA 4GTUA 3G7IA 3KTBA 3UEMA 3A5IA 4HJ2A 1FB6A 2VL9A 2VOCA 2TRXA 1FVJA 4YKFA 4YKGA 4ICYA 1PN0A 3ZFLA 2P5RA 3DEXA 1PQNA 2X8GA 2LRTA 2HE3A 1N8JA 1TDIA 4K5RA 1FHEA 1WIKA 5HQPA 4K5SA 3UOMA 1PGTA 2DMMA 2H8LA 1GNEA 1GWCA 5GZZB 3MYDA 1IYHA 2LQOA 4KF9A 4BWQA 2H66A 4ACSA 3Q6OA 1PL2A 3HZ8A 4O7HA 4XTSA 2MYGA 1R5AA 1EOGA 5F05A 1C72A 4FIWA 4MJBA 2B5XA 3UL3A 4CY8A 2PPTA 3A2VA 3HDCA 2L5OA 2MMNA 3D6IA 4HEA2 2IMFA 1SL2B 4HS1A 1TK0B 2IJYA 1B48A 5EPFA 2PN8A 6GSSA 2D2ZA 3D22A 2VL3A 4XRAA 4FH8A 1BAYA 3N9JA 4Z7XA 1TK8B 2OACA 3N5OA 1N2AA 2C3TA 2BJXA 3CRTA 2A2PA 3WT1A 4TXVA 3TKSC 3ERFA 1YKAA 4MZBA 4BVYA 4YQUA 5AIVA 4EXJA 4HU7A 4EVMA 6GSUA 4ULXA 3DVXA 1ACVA 1S3AA 5KN2A 2ES7A 3J7Yk 3LSZA 1A24A 2DJ2A 4XCSA 3UAPA 4MP4A 1BX9A 1GH2A 3ERGA 5AISA 2NVLA 3CYNA 2YZHA 1T8EB 1BJXA 4MK3A 2IMKA 5GAND 5J9CA 3P2AA 4NAXA 2OE0A 1Q4JA 2YWIA 2I3YA 3GL5A 1GSYA 3FRCA 3ZREA 2QC7A 1HNAA 2L4CA 2H30A 4EIQA 3VFIA 2RM6A 2X49A 5KEJA 1SK1A 1O81A 4WBJA 1DBYA 1Q98A 2V6OA 2XBQA 3GN3A 3FW2A 1HNCA 3ZIJA 5CAXA 5KOWA 3JCML 2LJRA 3M1GA 3F9UA 1FB0A 1XWBA 3ZTLA 2X99A 3ZRDA 1GLQA 2GSSA 4FYUA 2RUEA 4WXTA 3GURA 4AJ6A 4N11A 1TRWA 2HRFA 4I6XA 1A2JA 4KCAA 2E2MA 4JR4A 1R7HA 5IMZA 4ML6A 2B1LA 1JZDA 3BCKA 5B6MA 2F51A 3EC3A 2YV7A 4WF4A 3E0UA 3TRXA 4N30A 3QCPA 5G31A 1QFNA 2H1AA 1FAAA 5D9VA 1SKWB 2K9FA 1UN2A 4MDCA 1TU8A 4RQRA 1XWAA 3BCIA 2H0GA 3ZVJD 5ECQB 2N5AA 1XCCA 2CAQA 4XS6A 5G5FA 3UJ1A 1OKDA 3TOTA 4DSSB 4G10A 3IBHA 1F9MA 4O5UA 4G9HA 5G2ZA 2LRNA 4KUNA 3CBUA 1ZYNA 6GSYA 2HRAA 2E0QA 2RUFA 1YEXA 1K0NA 1EEJA 2FUG2 2X8HA 5FHIA 4ECBA 2VL2A 2C4JA 5IMCA 3O76A 3G7JA 3TJBA 2GQKA 2VM2A 3P8WA 2CVDA 19GSA 3EE2A 5D9TA 2XPEA 3KMOA 1XZOA 1M0UA 2WFCA 3EU4A 3IK9A 2PVOC 1UVZA 1GSDA 3M9KA 1GSUA 2RLIA 4KE3A 3BBYA 1Z9HA 4ZL7A 2JACA 2YNXA 1WE0A 2H76A 2OE3A 2WULA 2H1BA 1YY7A 1H75A 4YAPA 3F3RA 3WGEA 1VF2A 5DJMA 1DUGA 4K1FA 4JR6A 1XXUA 5ABRA 3ZMLA 1EV4A 5F07A 1XW6A 5J4UA 4KNDA 1PMTA 1OC3A 3LXTA 2VCTA 4MH3A 1OVNA 2OJLA 1K3YA 1V98A 4IKHA 13GSA 2CVKA 2V41A 2VIMA 4F82A 3WGXA 3HA9A 4H86A 3ERWA 5ID2A 1S3DA 3DD3A 1LJRA 1NM3A 1MDJA 4GSTA 3GL3A 5CRHA 4MF5A 2J23A 4USSA 6GSTA 1UA5A 4FQUA 5FWGA 1LBKA 3BD2A 3KH7A 2KLXA 3D4MA 2V1MA 5A4UA 1ZYEA 4EO3A 1ON4A 1T7PB 5ECRB 3O6TA 4IP6A 1U3IA 4TW5A 2HI7A 4GWRA 2YJHA 4ISDA 1T4YA 5KN1A 2B1KA 1G7EA 3MSZA 2C0DA 8GSSA 1U3AA 4KGIA 4NWYA 3NIVA 1QK8A 4ML1A 3FZAA 1JLWA 4ZB6A 3D5JA 1T4ZA 2GSTA 5DBQA 1TJDA 2VCQA 3AY8A 1M2AA 1Y25A 1PA3A 4TRXA 5J3RA 2J9HA 4PUAA 2JSZA 2H0HA 5ECKB 2HSHA 3GSSA 2YP6A 1SD8A 1FG4A 1SJZA 1CQHA 3EINA 3M0FA 3RPNA 3EPTA 1QMVA 4IQAA 3PGTA 4BVYB 2QKEA 2P31A 3C8EA 2NDOA 1KBNA 5D9XA 2JSYA 5B6NA 4XS4A 1K0CA 3IPZA 5IO2A 1AUCA 1S3CA 3DKSA 3VI5A 1EP7A 4PNGA 2K8SA 5EY6A 4O92A 3LGCA 5ECLB 5BMUA 1A0RP 3QFBC 4PQHA 1EV9A 1U88A 1Y6EA 1SK2A 4TOPA 2DLXA 4DVCA 2MMAA 4ZL9A 2LEGA 4V2LA 2LTKA 3GRXA 1I9DA 5DJLA 1TRSA 2ZUPA 3L9VA 3QAVA 4G2EA 3RAZA 3TJFA 1URMA 2LS5A 5H5QA 4G19A 4WBRD 2YN1A 2GQLA 1FW1A 1JZOA 4GSNA 3F4RA 1AC1A 4EF0A 2QGVA 2IL3A 4JE1A 5DALB 5IOXA 3IHQA 4DSSA 1GSSA 4J2FA 3KMNA 1JHBA 5LCZA 11GSA 3HYPA 3DYRA 5D96A 5IQYA 2R4VA 4TXOA 4LL4B 1ZOFA 4KX4A 2XPDA 1QQ2A 2C80A 3VK9A 1U87A 2WCIA 3H93A 5HFKA 2IIYA 4GCIA 3C7MA 3VPQA 3TKSA 5B7CA 1WMJA 3F3QA 5HR1A 2H0IA 3PR8A 2CX3A 3DIEA 3GTUA 4TR1A 1KNGA 2DJ1A 5CP1A 2H72A 4AF2A 1F37A 4IHUA 5FT3A 1VF1A 3OR5A 2LUSA 4N0VA 2A4HA 1B8XA 1GSQA 4FYBA 4HZ4A 4F2IA 2B3SA 3DMLA 1V2AA 4BA7A 3TKPA 4RI6A 4YQVA 4JZQA 2PVQA 3GYKA 2PGTA 5KN3A 3F6FA 3U5RE 3KXOA 4WEYA 2YOIA 2R6KA 1RQMA 3ED3A 2VAFA 3QMXA 2K6VA 3MNGA 5AIXA 2FA4A 2R0PA 2Z9SA 1K3LA 2KP2A 2X8CA 2OBKA 2F9SA 1GUHA 3NZNA 1QGVA 3FY7A 4J56E 3L4NA 3UVHA 1VRSD 2GVPA 3HY2A 3IA1A 3Q18A 3LORA 2O8VB 1TI1A 4ZBAA 2IPAA 1SU9A 1OKTA 2H6ZA 1WJKA 3KCMA 2JZRA 1MD4A 1MDKA 3GKMA 5DCGA 3A5WA 3V1WA 4XIHA 4HDEA 3APSA 2V2GA 2YPMA 2EC4A 2HSYA 1EWXA 3GH6A 2AHEA 2IFQA 1A8LA 3TRQA 5A4WA 3HKRA 2FHEA 2AV4A 3IHGA 3FR3A 2DKIA 2L6CA 2WDUA 2IMDA 2OADA 5ID2B 2IN3A 2YANA 2GQMA 2VM1A 3IOSA 4GXZA 4N10A 3ZYWA 5IPHA 2H6YA 3C73A 5IOWA 1ERUA 2CQ9A 2VO4A 22GSA 4F0BA 1A2LA 3LW9A 4KDXA 1OE7A 1M2DA 2L5LA 4PXOA 1M9AA 3DXBA 2HZEA 2GZPA 1Z7RA 5G1LA 3IDVA 2VCWA 4MMMA 1SYXA 5IO0A 2FWEA 1AW9A 3LG6A 3VWWA 1XWCA 1OC9A 1ZZYA 1GTAA 2B5EA 2REMA 4K2XA 4IP1A 3DVWA 4MJCA 5D9WA 3SBCA 2H19A 1Z5YE 4IBPA 3RPPA 1V40A 1FO5A 3GMFA 1OYJA 2C0FA 2PWJA 2H70A 3FR6A 6GSWA 2LSTA 5CREA 2DIYA 1FVKA 2E2GA 5G5EA 4EKZA 2HYXA 4D73B 4OO5A 3M9JA 5IPGA 1THOA 5DCHA 16GSA 1PKWA 4BWSA 4KSMA 3TGZA 5HR2A 2H1DA 4XS4B 4Q5RA 1AQWA 1H4OA 4JRRA 1OC8A 2MZCA 4PQ1A 4EL1A 5DALA 2H71A 3QDNA 2HZFA 2GZYA 2DJ3A 4KCEA 1K0DA 4OFNA 3VPTA 4GLTA 1JZWA 3GKKA 3HCZA 4PX1A 5INYA 1JFUA 4TVEA 4XHMA 4ECIA 1A2MA 3L9SA 3F4SA 5D73A 3GUSA 1V57A 1ST9A 1K3OA 3HD5A 5G1KA 2VCVA 3KP9A 1EGOA 4LMWA 4PGTA 2ALBA 1GULA 4MF6A 4X43A 4LLRA 4AGSA 2MMOA 5CO3A 5IMVA 4IW9A 1B9YC 2KHPA 4CY6A 3CMIA 4KH7A 1KEBA 3MDKA 4RUVA 4TR0A 4TXOB 4ZIJA 3CSJA 3TRPA 3C1RA 2B6MA 3IAM2 3KIJA 1DE1A 3DWVA 5H5SA 5CRWA 1ERWA 4G0IA 4MABA 4V2NA 3HVSA 3LQ7A 2VCZA 1EZKA 3GTUB 4TR1B 2OA7A 1VGLA 3TB2A 2I81A 3I43A 1R26A 1PX6A 4IN0A 1TP9A 1YKCA 5BRTA 6GSXA 4DSQA 1XVQA 4ID0A 4WR4A 2JZTA 3VURA 1ZL9A 1T3BA 4KW6A 3P7XA 1WP0A 4MNNA 3R2QA 3IC8A 4WKWA 1TRVA 1O85A 2H01A 1SJIA 2HRKA 4KA0A 1ERVA 4JBBA 3EWLA 3UBKA 5IMAA 5E59A 1ZMAA 4K7IA 1X9WB 1XFLA 1MTCA 4HJMA 1XPVA 2CZ2A 4AJ8A 2I9HA 4NV2A 4Q5QA 1PN9A 2GLRA 2L59A 2V6KA 3FZ5A 4I97A 4ECCA 5J5NA 1M99A 4OWYA 1I5GA 3LJRA 2AUVA 1MEKA 1AQVA 3UIWA 2CT6A 2LJKA 5F06A 3GX0A 3PH9A 4ECJA 10GSA 1HNBA 5F8BA 5ECHB 1TRUA 3TJKA 4MH2A 1F3BA 4IJ3A 2C0EA 2BTOT 4EC0A 5J9BA 3KD0A 2HLSA 4L0UA 1A0FA 2E7PA 3CXGA 5A5KA 2OKAA 3E3EA 5HR3A 4NHZA 4K7NA 3VLNA 2IFQB 4GQFA 2H75A 3E9JB 2QA2A 4CW9A 1T1VA 1A23A 3ZVJA 5JWOB 4YQMA 4ILFA 4I2UA 1RW1A 3H4KA 1PD21 3M3MA 3CTFA 3M8NA 4RI7A 2A4VA 1G6YA 2F8AA 2C3QA 1A8YA 4ZB8A 4POBA 3CSIA 5HR0A 2DJKA 1M9BA 4NMUA 2N5BA 2JZSA 2DKHA 3FMWA 2CX4A 4MJAA 4K8MA 4D73A 2PMTA 4L5OA 2DIZA 3HZ4A 4LA1A 1HD2A 2GT5A 2HZEB 4TN8A 3UBLA 2MMZA 3KZQA 5EL8A 2HNLA 4DEJA 3QAGA 1OC9B 2O85A 4MJEA 3CRUA 5G30A 3US3A 1J0FA 2XBIA 2LQQA 4OMVA 3TUEA 3Q19A 2P5QA 3WD6A 3EMXA 2K18A 4ZL8A 1XOBA 2XC2A 4L5LA 1W89A 2HT9A 4O5RA 3A2WA 4HU9A 2I4AA 4HUAA 3GA4A 2X64A 2LNSA 2LKUA 2VUPA 3ZLPA 3VWUA 5DAKB 5KOXA 3RHBA 3WT2A 2DBCA 4IJIA 2GSQA 1SJ6A 4XRDA 3W8SA 3GH9A 4GSSA 3I9V2 2MBSA 2MBTA 2GGTA 4HI7A 2NBSA 1EP8A 3TOUA 4NXIA 2PBJA 3F0IA 5LNKe 2G2QA 2HXKA 1M2BA 3I6AA 1R4WA 5D8IA 1KTEA 2IWTA 4OCEA 4OCFA 5LD0A 4RQXA 4EE0A 5JWRB 5J41A 3FEUA 1BYEA 1NW2A 3KH9A 1U6TA 4O32A 2R37A 1SKSB 3FR9A 1X9SB 3GFKA 4O5QA 2O87A 4JU5A 1QXHA 3H79A 1SYRA 1O8WA 2F3MA 3EVIA 2AYTA 2FD3A 2I1UA 1MDIA 3S9FA 1LU4A 2RM5A 2KUCA 1TI3A 4LMVA 1G6WA 3SWLA 2HFDA 3HVXA 1Z6NA 2H6XA 1USBA 2LNTA 4BVXB 3LXZA 2IMEA 4G0LA 2KP1A 2A2RA 1EEMA 3TCOA 4I2TA 1HQOA 2L4QA 1YDKA 3HHVA 2JU5A 4F9ZA 2VD1A 3KEBA 1WRYA 2DJ0A 2CV4A 5ECIB 5EVOA 1YJ6A 1V9WA 1G0TA 1NHOA 3F8UA 1CQGA 3UARA 4POKA 2XHFA 3GX8A 2LV3A 4WETA 1X0RA 4GRFA 3G9BA 4F03A 2QSIA 4KAEA 2FGXA 4DSRA 2FWFA 4A5PA 2JL4A 3QAWA 5CNWA 3TKQA 4BL7A 3TDGA 7GSSA 4NPBA 4KDYA 5ECPB 5GSTA 3D21A 1Z6MA 1OAZA 3LYKA 1THXA 2R3XA 3D4TA 2GS3A 5DQYA 1E6BA 3GIXA 3R3EA 1SL1B 4ZBBA 4Q5FA 3F4TA 4MLYA 1GNWA 2R0CA 4J57E 2VD0A 1PL1A 2YJ7A 2B7JA 2UZ8A 4QL7A 1B4QA 1O7UA 4X4JA 9GSSA 1GTUA 2KOKA 1ML6A 1Z7PA 3QD9A 2FNOA 4X0XA 4OO4A 1GLPA 2A2SA 2AB6A 4IELA 3FZ9A 5ECOB 3FYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIU A;  1F3A A;  2OE1 A;  1ZGN A;  4Q5N A;  4IS0 A;  5IIZ A;  3BJ5 A;  4K0G A;  5ELG A;  3H1N A;  2CA8 A;  4E8E A;  5GSS A;  3QOU A;  4KSO A;  4F0C A;  3IE3 A;  12GS A;  5CRD A;  3EU3 A;  3BOA A;  3TKS E;  4E8H A;  1GSE A;  2VLV A;  3RBT A;  3HJP A;  4HQZ A;  4MF7 A;  3F6D A;  1GL8 A;  4HZ2 A;  2GZZ A;  4X1U A;  3NOF A;  2K8V A;  5DAK A;  1XBS A;  4V1A g;  2NPB A;  2FLS A;  4TR3 A;  5C04 A;  2DML A;  2EIQ A;  3GKN A;  3KP8 A;  5CYY A;  2M46 A;  3C71 A;  4FO5 A;  3HJM A;  14GS A;  3CSH A;  4I8B A;  3FZ4 A;  2L6D A;  5ECN B;  2PU9 C;  3PIN A;  2IMI A;  2C8U A;  1XWG A;  1PRX A;  4PQI A;  2H73 A;  1WOU A;  3Q74 A;  1MD3 A;  1B9X C;  4AJ7 A;  4HQS A;  4IVF A;  5GAP D;  2YCD A;  1PX7 A;  2YZU A;  4MZC A;  2JAD A;  2WRT A;  3ISO A;  4ZIL A;  4PNF A;  1SD9 A;  2WZ9 A;  3VWX A;  5DVB A;  2VLT A;  4WR5 A;  3F63 A;  2FA8 A;  4MPG A;  3O3T A;  1O73 A;  1XVW A;  3D0Z A;  5HFG A;  3TJJ A;  3I69 A;  3H8Q A;  2WS2 A;  1M7T A;  4BVX A;  1AAZ A;  2GDR A;  1TW9 A;  4OFM A;  1XW5 A;  1AXD A;  3IC4 A;  3IRA A;  3DGQ A;  3ME8 A;  1UC7 A;  3G7Y A;  4FYC A;  3L9U A;  1K0M A;  4ZB9 A;  1SKR B;  2GT6 A;  1SK0 A;  2R5G A;  3VWV A;  5A4V A;  3IAS 2;  3W6G A;  1G7O A;  3LEF A;  2BMX A;  1GSF A;  2LRC A;  2ZNM A;  2TRC P;  2M80 A;  3UMA A;  5IMD A;  4K2D A;  5C00 A;  1JZR A;  1ERT A;  5DDL A;  2AJQ B;  1EOH A;  3KM6 A;  1XOA A;  3MWH A;  5ELA A;  1XWK A;  5DQS A;  4PUR A;  4KDU A;  3QFA C;  2O89 A;  2TIR A;  5B8A A;  4OFT A;  2VLU A;  1F2E A;  2FWH A;  3GV1 A;  3WYW A;  4XS1 A;  4POM A;  5HFI A;  3L78 A;  2G0F A;  2CVB A;  2NTO A;  1GP1 A;  3A3T A;  2CZ3 A;  1X5D A;  4MCU A;  4K6X A;  1X9M B;  3TKR A;  3ZIV A;  1YF1 A;  3IK7 A;  3APO A;  3GKX A;  3C1S A;  1XIY A;  5IM9 A;  17GS A;  4LL1 B;  3ZFB A;  3RHC A;  2ON7 A;  3ZL5 A;  2FY6 A;  3FHK A;  2WB9 A;  4YH2 A;  1YQ1 A;  1K0O A;  1GTI A;  5COH A;  4BPY A;  5JCG A;  2L57 A;  4GQC A;  1NHY A;  2PUK C;  1ILO A;  5B8B A;  3QR6 A;  3ZZX A;  3GHA A;  4POL A;  4K7O A;  4PUF C;  1BG5 A;  1PSQ A;  1O8X A;  20GS A;  1VF3 A;  1X5E A;  1Z3E A;  2EIO A;  3LWA A;  5KN0 A;  1TXX A;  4QQ7 A;  4P3Y B;  2YWM A;  2GSR A;  4V2M A;  3DRN A;  5E4W A;  1J9B A;  2B7K A;  1VF4 A;  2N5F A;  2VCX A;  4N0Z A;  2O7K A;  1K0A A;  2EIR A;  2V32 A;  3W8J A;  4GF0 A;  1AQX A;  2WJU A;  3ZMK A;  5JCW A;  3LYP A;  1GUK A;  3GST A;  5ECS A;  5IMF A;  3ZIT A;  2PER A;  4JED A;  3IXR A;  1EGR A;  1FOV A;  5JWQ B;  3HVV A;  1YEP A;  2VL2 C;  4OD7 A;  2RII A;  1R5P A;  3HXS A;  3A2X A;  5AGY A;  2YWO A;  4CDO A;  1GRX A;  4YAV A;  3APQ A;  2LJA A;  4EDY A;  4TR4 A;  2P0G A;  1V58 A;  3EUR A;  5ENU A;  5CRG A;  2FWG A;  5D93 A;  4HOJ A;  4ZXG A;  1K0B A;  1WWJ A;  1F6M C;  4NV5 A;  1O6J A;  3ME7 A;  2ZCT A;  2GTU A;  3QPM A;  1GUM A;  2H74 A;  2YWN A;  1ABA A;  1TK5 B;  4KB3 A;  1DE2 A;  1JLV A;  5F0G A;  3LFL A;  2ON5 A;  2FCH A;  3UVT A;  3K8N A;  1RK4 A;  3KTL A;  1B4P A;  1OE8 A;  2CAI A;  4IQ1 A;  4V1A p;  2WGR A;  5L71 A;  3P90 A;  2DC5 A;  4K9Z A;  1TKD B;  5JCU A;  3U6V A;  3TJG A;  1QUW A;  1TU7 A;  3EYT A;  6GSV A;  5AN1 A;  2C0G A;  4L8E A;  1IYI A;  1WPI A;  3FKF A;  4MPF A;  3VI7 A;  4L0W A;  2DSA A;  4EUY A;  1BQ7 A;  3CTG A;  3L0H A;  3GNJ A;  1YF0 A;  4ZBD A;  3HJO A;  1SL0 B;  18GS A;  4WF5 A;  1E2Y A;  1TTZ A;  2YV9 A;  1XW9 A;  1SEN A;  3EMP A;  3IR4 A;  1X5C A;  2OBI A;  1ZYQ B;  2C3N A;  1PKZ A;  2AAW A;  2HRN A;  4TKY A;  4EDZ A;  4QL9 A;  1T00 A;  4IGJ A;  1GTB A;  2C1Y A;  3J7Y b;  3FK8 A;  3RDW A;  3MAK A;  3KJY A;  1J08 A;  4MZW A;  1W4V A;  4MA9 A;  3KGK A;  2H1G A;  1BED A;  1DSB A;  2B5Y A;  2M72 A;  5H5R A;  1YZX A;  1HYU A;  4K0N A;  4NHW A;  3WGD A;  5ECM B;  1ZCP A;  3IV4 A;  1NSW A;  2R2J A;  2F8F A;  1TOF A;  4I5Q A;  2DJJ A;  4CHS A;  4GTU A;  3G7I A;  3KTB A;  3UEM A;  4HJ2 A;  1FB6 A;  2VL9 A;  2VOC A;  2TRX A;  1FVJ A;  3ZFL A;  2P5R A;  3DEX A;  1PQN A;  2X8G A;  2LRT A;  2HE3 A;  1N8J A;  1TDI A;  1FHE A;  1WIK A;  5HQP A;  3UOM A;  1PGT A;  2DMM A;  2H8L A;  1GNE A;  1GWC A;  5GZZ B;  1IYH A;  2LQO A;  4BWQ A;  2H66 A;  4ACS A;  3Q6O A;  1PL2 A;  3HZ8 A;  4O7H A;  4XTS A;  2MYG A;  1R5A A;  1EOG A;  5F05 A;  1C72 A;  4FIW A;  4MJB A;  2B5X A;  3UL3 A;  2PPT A;  3A2V A;  3HDC A;  2L5O A;  2MMN A;  3D6I A;  4HEA 2;  2IMF A;  1SL2 B;  4HS1 A;  1TK0 B;  2IJY A;  1B48 A;  5EPF A;  2PN8 A;  6GSS A;  2D2Z A;  3D22 A;  2VL3 A;  4XRA A;  4FH8 A;  1BAY A;  3N9J A;  4Z7X A;  1TK8 B;  2OAC A;  3N5O A;  1N2A A;  2C3T A;  2BJX A;  3CRT A;  3WT1 A;  4TXV A;  3TKS C;  3ERF A;  1YKA A;  4MZB A;  4BVY A;  4YQU A;  5AIV A;  4EXJ A;  4HU7 A;  4EVM A;  6GSU A;  4ULX A;  3DVX A;  1ACV A;  1S3A A;  5KN2 A;  2ES7 A;  3J7Y k;  3LSZ A;  1A24 A;  2DJ2 A;  4XCS A;  3UAP A;  4MP4 A;  1BX9 A;  1GH2 A;  3ERG A;  5AIS A;  2NVL A;  3CYN A;  2YZH A;  1T8E B;  1BJX A;  4MK3 A;  2IMK A;  5GAN D;  5J9C A;  3P2A A;  4NAX A;  2OE0 A;  1Q4J A;  2YWI A;  2I3Y A;  3GL5 A;  1GSY A;  3FRC A;  3ZRE A;  2QC7 A;  1HNA A;  2L4C A;  2H30 A;  3VFI A;  2RM6 A;  5KEJ A;  1SK1 A;  1O81 A;  4WBJ A;  1DBY A;  1Q98 A;  2V6O A;  2XBQ A;  3GN3 A;  3FW2 A;  1HNC A;  3ZIJ A;  5CAX A;  3JCM L;  2LJR A;  3M1G A;  3F9U A;  1FB0 A;  1XWB A;  3ZTL A;  2X99 A;  3ZRD A;  1GLQ A;  2GSS A;  4FYU A;  2RUE A;  4WXT A;  3GUR A;  4AJ6 A;  4N11 A;  1TRW A;  2HRF A;  4I6X A;  1A2J A;  4KCA A;  2E2M A;  4JR4 A;  1R7H A;  5IMZ A;  4ML6 A;  2B1L A;  1JZD A;  3BCK A;  5B6M A;  2F51 A;  3EC3 A;  2YV7 A;  4WF4 A;  3E0U A;  3TRX A;  4N30 A;  3QCP A;  5G31 A;  1QFN A;  2H1A A;  1FAA A;  5D9V A;  1SKW B;  2K9F A;  1UN2 A;  4MDC A;  1TU8 A;  4RQR A;  1XWA A;  3BCI A;  2H0G A;  3ZVJ D;  5ECQ B;  2N5A A;  1XCC A;  2CAQ A;  4XS6 A;  5G5F A;  3UJ1 A;  1OKD A;  3TOT A;  4DSS B;  4G10 A;  3IBH A;  1F9M A;  4G9H A;  5G2Z A;  2LRN A;  4KUN A;  3CBU A;  6GSY A;  2E0Q A;  2RUF A;  1YEX A;  1K0N A;  1EEJ A;  2FUG 2;  2X8H A;  5FHI A;  4ECB A;  2VL2 A;  2C4J A;  5IMC A;  3O76 A;  3G7J A;  3TJB A;  2GQK A;  2VM2 A;  3P8W A;  2CVD A;  19GS A;  3EE2 A;  5D9T A;  2XPE A;  3KMO A;  1XZO A;  1M0U A;  2WFC A;  3EU4 A;  3IK9 A;  2PVO C;  1UVZ A;  1GSD A;  3M9K A;  1GSU A;  2RLI A;  4KE3 A;  3BBY A;  1Z9H A;  4ZL7 A;  2JAC A;  2YNX A;  1WE0 A;  2H76 A;  2OE3 A;  2WUL A;  2H1B A;  1YY7 A;  1H75 A;  4YAP A;  3F3R A;  3WGE A;  1VF2 A;  5DJM A;  1DUG A;  4K1F A;  4JR6 A;  1XXU A;  5ABR A;  3ZML A;  1EV4 A;  5F07 A;  1XW6 A;  5J4U A;  4KND A;  1PMT A;  1OC3 A;  3LXT A;  2VCT A;  4MH3 A;  1OVN A;  2OJL A;  1K3Y A;  1V98 A;  4IKH A;  13GS A;  2CVK A;  2V41 A;  2VIM A;  4F82 A;  3WGX A;  3HA9 A;  4H86 A;  3ERW A;  5ID2 A;  1S3D A;  3DD3 A;  1LJR A;  1NM3 A;  1MDJ A;  4GST A;  3GL3 A;  5CRH A;  4MF5 A;  2J23 A;  6GST A;  1UA5 A;  5FWG A;  1LBK A;  3BD2 A;  3KH7 A;  2KLX A;  3D4M A;  2V1M A;  5A4U A;  1ZYE A;  4EO3 A;  1ON4 A;  1T7P B;  5ECR B;  3O6T A;  4IP6 A;  1U3I A;  4TW5 A;  2HI7 A;  4GWR A;  2YJH A;  4ISD A;  1T4Y A;  5KN1 A;  2B1K A;  1G7E A;  3MSZ A;  2C0D A;  8GSS A;  1U3A A;  4KGI A;  4NWY A;  3NIV A;  1QK8 A;  4ML1 A;  3FZA A;  1JLW A;  4ZB6 A;  3D5J A;  1T4Z A;  2GST A;  5DBQ A;  1TJD A;  2VCQ A;  3AY8 A;  1M2A A;  1Y25 A;  1PA3 A;  4TRX A;  5J3R A;  2J9H A;  4PUA A;  2JSZ A;  2H0H A;  5ECK B;  2HSH A;  3GSS A;  2YP6 A;  1SD8 A;  1FG4 A;  1SJZ A;  1CQH A;  3EIN A;  3M0F A;  3RPN A;  1QMV A;  4IQA A;  3PGT A;  2QKE A;  2P31 A;  3C8E A;  2NDO A;  1KBN A;  5D9X A;  2JSY A;  5B6N A;  4XS4 A;  1K0C A;  3IPZ A;  5IO2 A;  1AUC A;  1S3C A;  3DKS A;  3VI5 A;  1EP7 A;  4PNG A;  2K8S A;  5EY6 A;  4O92 A;  3LGC A;  5ECL B;  1A0R P;  3QFB C;  4PQH A;  1EV9 A;  1U88 A;  1Y6E A;  1SK2 A;  4TOP A;  2DLX A;  4DVC A;  2MMA A;  4ZL9 A;  2LEG A;  4V2L A;  2LTK A;  3GRX A;  1I9D A;  5DJL A;  1TRS A;  2ZUP A;  3L9V A;  3QAV A;  4G2E A;  3RAZ A;  3TJF A;  1URM A;  2LS5 A;  5H5Q A;  4G19 A;  4WBR D;  2YN1 A;  2GQL A;  1FW1 A;  1JZO A;  4GSN A;  3F4R A;  1AC1 A;  4EF0 A;  2QGV A;  2IL3 A;  4JE1 A;  5DAL B;  5IOX A;  3IHQ A;  4DSS A;  1GSS A;  4J2F A;  3KMN A;  1JHB A;  5LCZ A;  11GS A;  3HYP A;  3DYR A;  5D96 A;  5IQY A;  2R4V A;  4TXO A;  4LL4 B;  1ZOF A;  4KX4 A;  2XPD A;  1QQ2 A;  2C80 A;  3VK9 A;  1U87 A;  2WCI A;  3H93 A;  5HFK A;  2IIY A;  4GCI A;  3C7M A;  3VPQ A;  3TKS A;  5B7C A;  1WMJ A;  3F3Q A;  5HR1 A;  2H0I A;  3PR8 A;  2CX3 A;  3DIE A;  3GTU A;  4TR1 A;  1KNG A;  2DJ1 A;  5CP1 A;  2H72 A;  4AF2 A;  1F37 A;  4IHU A;  5FT3 A;  1VF1 A;  3OR5 A;  2LUS A;  4N0V A;  1B8X A;  1GSQ A;  4FYB A;  4HZ4 A;  4F2I A;  2B3S A;  3DML A;  1V2A A;  4BA7 A;  3TKP A;  4RI6 A;  4YQV A;  4JZQ A;  2PVQ A;  3GYK A;  2PGT A;  5KN3 A;  3F6F A;  3U5R E;  3KXO A;  4WEY A;  2YOI A;  2R6K A;  1RQM A;  3ED3 A;  2VAF A;  3QMX A;  2K6V A;  3MNG A;  5AIX A;  2FA4 A;  2Z9S A;  1K3L A;  2KP2 A;  2X8C A;  2OBK A;  2F9S A;  1GUH A;  3NZN A;  1QGV A;  3FY7 A;  4J56 E;  3L4N A;  3UVH A;  1VRS D;  2GVP A;  3HY2 A;  3IA1 A;  3Q18 A;  3LOR A;  2O8V B;  1TI1 A;  4ZBA A;  2IPA A;  1SU9 A;  1OKT A;  2H6Z A;  1WJK A;  3KCM A;  2JZR A;  1MD4 A;  1MDK A;  3GKM A;  5DCG A;  3A5W A;  3V1W A;  4XIH A;  4HDE A;  3APS A;  2V2G A;  2YPM A;  2EC4 A;  2HSY A;  1EWX A;  3GH6 A;  2AHE A;  2IFQ A;  1A8L A;  3TRQ A;  5A4W A;  3HKR A;  2FHE A;  2AV4 A;  3FR3 A;  2L6C A;  2WDU A;  2IMD A;  2OAD A;  5ID2 B;  2IN3 A;  2YAN A;  2GQM A;  2VM1 A;  3IOS A;  4GXZ A;  4N10 A;  3ZYW A;  5IPH A;  2H6Y A;  3C73 A;  5IOW A;  1ERU A;  2CQ9 A;  2VO4 A;  22GS A;  4F0B A;  1A2L A;  4KDX A;  1OE7 A;  1M2D A;  2L5L A;  4PXO A;  1M9A A;  3DXB A;  2HZE A;  2GZP A;  1Z7R A;  5G1L A;  3IDV A;  2VCW A;  4MMM A;  1SYX A;  5IO0 A;  2FWE A;  1AW9 A;  3LG6 A;  3VWW A;  1XWC A;  1OC9 A;  1ZZY A;  1GTA A;  2B5E A;  2REM A;  4IP1 A;  3DVW A;  4MJC A;  5D9W A;  3SBC A;  2H19 A;  1Z5Y E;  4IBP A;  3RPP A;  1V40 A;  1FO5 A;  3GMF A;  1OYJ A;  2C0F A;  2PWJ A;  2H70 A;  3FR6 A;  6GSW A;  2LST A;  5CRE A;  2DIY A;  1FVK A;  2E2G A;  5G5E A;  4EKZ A;  2HYX A;  4D73 B;  4OO5 A;  3M9J A;  5IPG A;  1THO A;  5DCH A;  16GS A;  1PKW A;  4BWS A;  4KSM A;  3TGZ A;  5HR2 A;  2H1D A;  4XS4 B;  4Q5R A;  1AQW A;  1H4O A;  4JRR A;  1OC8 A;  2MZC A;  4PQ1 A;  4EL1 A;  5DAL A;  2H71 A;  3QDN A;  2HZF A;  2GZY A;  2DJ3 A;  4KCE A;  1K0D A;  4OFN A;  3VPT A;  4GLT A;  1JZW A;  3GKK A;  3HCZ A;  4PX1 A;  5INY A;  1JFU A;  4TVE A;  4XHM A;  4ECI A;  1A2M A;  3L9S A;  3F4S A;  5D73 A;  3GUS A;  1V57 A;  1ST9 A;  1K3O A;  3HD5 A;  5G1K A;  2VCV A;  3KP9 A;  1EGO A;  4LMW A;  4PGT A;  2ALB A;  1GUL A;  4MF6 A;  4X43 A;  4LLR A;  4AGS A;  2MMO A;  5CO3 A;  5IMV A;  4IW9 A;  1B9Y C;  2KHP A;  3CMI A;  4KH7 A;  1KEB A;  3MDK A;  4RUV A;  4TR0 A;  4TXO B;  4ZIJ A;  3CSJ A;  3TRP A;  3C1R A;  2B6M A;  3IAM 2;  3KIJ A;  1DE1 A;  3DWV A;  5H5S A;  5CRW A;  1ERW A;  4MAB A;  4V2N A;  3HVS A;  3LQ7 A;  2VCZ A;  1EZK A;  3GTU B;  4TR1 B;  2OA7 A;  1VGL A;  3TB2 A;  2I81 A;  3I43 A;  1R26 A;  1PX6 A;  4IN0 A;  1TP9 A;  1YKC A;  6GSX A;  4DSQ A;  1XVQ A;  4ID0 A;  4WR4 A;  2JZT A;  3VUR A;  1ZL9 A;  1T3B A;  4KW6 A;  3P7X A;  1WP0 A;  3R2Q A;  4WKW A;  1TRV A;  1O85 A;  2H01 A;  1SJI A;  4KA0 A;  1ERV A;  4JBB A;  3EWL A;  3UBK A;  5IMA A;  5E59 A;  1ZMA A;  4K7I A;  1X9W B;  1XFL A;  1MTC A;  4HJM A;  1XPV A;  2CZ2 A;  4AJ8 A;  2I9H A;  4NV2 A;  4Q5Q A;  1PN9 A;  2GLR A;  2L59 A;  2V6K A;  3FZ5 A;  4I97 A;  4ECC A;  5J5N A;  1M99 A;  4OWY A;  1I5G A;  3LJR A;  2AUV A;  1MEK A;  1AQV A;  3UIW A;  2CT6 A;  2LJK A;  5F06 A;  3GX0 A;  3PH9 A;  4ECJ A;  10GS A;  1HNB A;  5F8B A;  5ECH B;  1TRU A;  3TJK A;  4MH2 A;  1F3B A;  4IJ3 A;  2C0E A;  2BTO T;  4EC0 A;  5J9B A;  3KD0 A;  2HLS A;  4L0U A;  1A0F A;  2E7P A;  3CXG A;  5A5K A;  2OKA A;  3E3E A;  5HR3 A;  4NHZ A;  4K7N A;  3VLN A;  2IFQ B;  4GQF A;  2H75 A;  3E9J B;  4CW9 A;  1T1V A;  1A23 A;  3ZVJ A;  5JWO B;  4YQM A;  4ILF A;  4I2U A;  1RW1 A;  3H4K A;  1PD2 1;  3M3M A;  3CTF A;  3M8N A;  4RI7 A;  2A4V A;  1G6Y A;  2F8A A;  2C3Q A;  1A8Y A;  4ZB8 A;  4POB A;  3CSI A;  5HR0 A;  2DJK A;  1M9B A;  4NMU A;  2N5B A;  2JZS A;  2CX4 A;  4MJA A;  4K8M A;  4D73 A;  2PMT A;  4L5O A;  2DIZ A;  3HZ4 A;  4LA1 A;  1HD2 A;  2GT5 A;  2HZE B;  4TN8 A;  3UBL A;  2MMZ A;  3KZQ A;  5EL8 A;  2HNL A;  4DEJ A;  3QAG A;  1OC9 B;  2O85 A;  4MJE A;  3CRU A;  5G30 A;  3US3 A;  1J0F A;  2XBI A;  2LQQ A;  4OMV A;  3TUE A;  3Q19 A;  2P5Q A;  3WD6 A;  3EMX A;  2K18 A;  4ZL8 A;  1XOB A;  2XC2 A;  4L5L A;  1W89 A;  2HT9 A;  4O5R A;  3A2W A;  4HU9 A;  2I4A A;  4HUA A;  3GA4 A;  2X64 A;  2LNS A;  2LKU A;  2VUP A;  3ZLP A;  3VWU A;  5DAK B;  3RHB A;  3WT2 A;  2DBC A;  4IJI A;  2GSQ A;  1SJ6 A;  4XRD A;  3W8S A;  3GH9 A;  4GSS A;  3I9V 2;  2MBS A;  2MBT A;  2GGT A;  4HI7 A;  2NBS A;  1EP8 A;  3TOU A;  4NXI A;  2PBJ A;  3F0I A;  5LNK e;  2G2Q A;  2HXK A;  1M2B A;  3I6A A;  1R4W A;  5D8I A;  1KTE A;  2IWT A;  4OCE A;  4OCF A;  5LD0 A;  4RQX A;  4EE0 A;  5JWR B;  5J41 A;  3FEU A;  1BYE A;  1NW2 A;  3KH9 A;  1U6T A;  4O32 A;  2R37 A;  1SKS B;  3FR9 A;  1X9S B;  3GFK A;  2O87 A;  4JU5 A;  1QXH A;  3H79 A;  1SYR A;  1O8W A;  2F3M A;  3EVI A;  2AYT A;  2FD3 A;  2I1U A;  1MDI A;  3S9F A;  1LU4 A;  2RM5 A;  2KUC A;  1TI3 A;  4LMV A;  1G6W A;  3SWL A;  2HFD A;  3HVX A;  1Z6N A;  2H6X A;  1USB A;  2LNT A;  3LXZ A;  2IME A;  2KP1 A;  2A2R A;  1EEM A;  3TCO A;  4I2T A;  1HQO A;  2L4Q A;  1YDK A;  3HHV A;  2JU5 A;  4F9Z A;  2VD1 A;  3KEB A;  1WRY A;  2DJ0 A;  2CV4 A;  5ECI B;  5EVO A;  1YJ6 A;  1V9W A;  1G0T A;  1NHO A;  3F8U A;  1CQG A;  3UAR A;  4POK A;  2XHF A;  3GX8 A;  2LV3 A;  4WET A;  1X0R A;  4GRF A;  3G9B A;  4F03 A;  2QSI A;  4KAE A;  2FGX A;  4DSR A;  2FWF A;  2JL4 A;  3QAW A;  5CNW A;  3TKQ A;  4BL7 A;  3TDG A;  7GSS A;  4NPB A;  4KDY A;  5ECP B;  5GST A;  3D21 A;  1Z6M A;  1OAZ A;  3LYK A;  1THX A;  2R3X A;  3D4T A;  2GS3 A;  5DQY A;  1E6B A;  3GIX A;  1SL1 B;  4ZBB A;  4Q5F A;  3F4T A;  4MLY A;  1GNW A;  4J57 E;  2VD0 A;  1PL1 A;  2YJ7 A;  2B7J A;  4QL7 A;  1B4Q A;  1O7U A;  9GSS A;  1GTU A;  2KOK A;  1ML6 A;  1Z7P A;  3QD9 A;  2FNO A;  4X0X A;  4OO4 A;  1GLP A;  2A2S A;  2AB6 A;  4IEL A;  3FZ9 A;  5ECO B;  3FYG A; 
#chains in the Genus database with same CATH topology
 1AIU A;  1F3A A;  2OE1 A;  1ZGN A;  4Q5N A;  4IS0 A;  5IIZ A;  3BJ5 A;  4K0G A;  5ELG A;  3H1N A;  2CA8 A;  4E8E A;  5GSS A;  3QOU A;  4KSO A;  4F0C A;  3IE3 A;  12GS A;  5CRD A;  3EU3 A;  3BOA A;  3TKS E;  4E8H A;  1GSE A;  2VLV A;  3RBT A;  3HJP A;  4HQZ A;  4MF7 A;  3F6D A;  1GL8 A;  4HZ2 A;  2GZZ A;  4X1U A;  3NOF A;  2K8V A;  5DAK A;  1XBS A;  4V1A g;  2NPB A;  2FLS A;  4TR3 A;  5C04 A;  2DML A;  2EIQ A;  3GKN A;  3KP8 A;  5CYY A;  2M46 A;  3C71 A;  4FO5 A;  4EIP A;  3HJM A;  14GS A;  3CSH A;  4I8B A;  3FZ4 A;  2L6D A;  5ECN B;  2PU9 C;  3PIN A;  2IMI A;  2C8U A;  1XWG A;  1PRX A;  4PQI A;  2H73 A;  1WOU A;  3Q74 A;  1MD3 A;  1B9X C;  4AJ7 A;  4Z2R A;  4HQS A;  4IVF A;  5GAP D;  2YCD A;  1PX7 A;  2YZU A;  4MZC A;  2JAD A;  2WRT A;  3ISO A;  4Z2U A;  4ZIL A;  4PNF A;  1SD9 A;  2WZ9 A;  3VWX A;  5DVB A;  2VLT A;  4WR5 A;  3F63 A;  2FA8 A;  4MPG A;  3O3T A;  1O73 A;  1XVW A;  3D0Z A;  5HFG A;  3TJJ A;  3I69 A;  3H8Q A;  2WS2 A;  1M7T A;  4BVX A;  1AAZ A;  2GDR A;  1TW9 A;  4OFM A;  4PTS A;  1XW5 A;  1AXD A;  3IC4 A;  3IRA A;  3DGQ A;  3ME8 A;  1UC7 A;  3G7Y A;  4FYC A;  3L9U A;  1K0M A;  4ZB9 A;  1SKR B;  2GT6 A;  2QA1 A;  1SK0 A;  4Z2T A;  2R5G A;  3VWV A;  5A4V A;  3IAS 2;  3W6G A;  1G7O A;  3LEF A;  2BMX A;  1GSF A;  2LRC A;  2ZNM A;  2TRC P;  2M80 A;  3PPU A;  3UMA A;  5IMD A;  4K2D A;  5C00 A;  1JZR A;  1ERT A;  5DDL A;  2AJQ B;  1EOH A;  3KM6 A;  1XOA A;  3MWH A;  5ELA A;  1XWK A;  5DQS A;  4PUR A;  4KDU A;  3QFA C;  2O89 A;  2TIR A;  5B8A A;  4OFT A;  2VLU A;  1F2E A;  2FWH A;  3GV1 A;  3WYW A;  4XS1 A;  4POM A;  5HFI A;  3L78 A;  2G0F A;  2CVB A;  2NTO A;  1GP1 A;  3A3T A;  2CZ3 A;  1X5D A;  4MCU A;  4K6X A;  1X9M B;  3TKR A;  3ZIV A;  1YF1 A;  3IK7 A;  3APO A;  3GKX A;  3C1S A;  1XIY A;  5IM9 A;  17GS A;  4LL1 B;  3ZFB A;  3RHC A;  2ON7 A;  3ZL5 A;  2FY6 A;  3FHK A;  2WB9 A;  4YH2 A;  1YQ1 A;  2HSM A;  1K0O A;  1GTI A;  5COH A;  4BPY A;  5JCG A;  2L57 A;  4GQC A;  1NHY A;  2PUK C;  1ILO A;  5B8B A;  3QR6 A;  3ZZX A;  4BL7 B;  3GHA A;  4POL A;  4K7O A;  2R0G A;  4PUF C;  1BG5 A;  1PSQ A;  1O8X A;  20GS A;  1VF3 A;  1X5E A;  1Z3E A;  2EIO A;  3LWA A;  5KN0 A;  1TXX A;  4QQ7 A;  4P3Y B;  2YWM A;  2GSR A;  4V2M A;  3DRN A;  5E4W A;  1J9B A;  2B7K A;  1VF4 A;  2N5F A;  2VCX A;  4N0Z A;  2O7K A;  1K0A A;  2EIR A;  2V32 A;  3W8J A;  4GF0 A;  1AQX A;  2WJU A;  3ZMK A;  5JCW A;  3LYP A;  1GUK A;  3GST A;  5ECS A;  5IMF A;  3ZIT A;  2PER A;  4JED A;  3IXR A;  1EGR A;  1FOV A;  5JWQ B;  3HVV A;  1YEP A;  2VL2 C;  4OD7 A;  2RII A;  1R5P A;  3HXS A;  3A2X A;  5AGY A;  2YWO A;  4CDO A;  1GRX A;  4YAV A;  3APQ A;  2LJA A;  4EDY A;  4TR4 A;  2P0G A;  1V58 A;  3EUR A;  5ENU A;  5CRG A;  2FWG A;  5D93 A;  4HOJ A;  1FOH A;  4ZXG A;  1K0B A;  1WWJ A;  1F6M C;  4NV5 A;  1O6J A;  3ME7 A;  2ZCT A;  3MIX A;  2GTU A;  3QPM A;  1GUM A;  2H74 A;  2YWN A;  1ABA A;  1TK5 B;  4KB3 A;  1DE2 A;  1JLV A;  5F0G A;  3LFL A;  2ON5 A;  2FCH A;  3UVT A;  3K8N A;  1RK4 A;  3KTL A;  1B4P A;  1OE8 A;  2CAI A;  4IQ1 A;  4V1A p;  2WGR A;  5L71 A;  3P90 A;  2DC5 A;  4K9Z A;  1TKD B;  5JCU A;  3U6V A;  3TJG A;  1QUW A;  1TU7 A;  3EYT A;  6GSV A;  5AN1 A;  2C0G A;  4L8E A;  1IYI A;  1WPI A;  3FKF A;  4MPF A;  3VI7 A;  4L0W A;  2DSA A;  4EUY A;  1BQ7 A;  3CTG A;  3L0H A;  3GNJ A;  1PFO A;  1YF0 A;  4ZBD A;  3HJO A;  1SL0 B;  18GS A;  4WF5 A;  1E2Y A;  1TTZ A;  2YV9 A;  1XW9 A;  1SEN A;  3EMP A;  3IR4 A;  1X5C A;  2OBI A;  1ZYQ B;  2C3N A;  1PKZ A;  2AAW A;  2HRN A;  2X4A A;  4TKY A;  4EDZ A;  4QL9 A;  4G0K A;  1T00 A;  4IGJ A;  1GTB A;  1ZYP A;  2C1Y A;  3J7Y b;  3FK8 A;  3RDW A;  3MAK A;  3KJY A;  1J08 A;  4MZW A;  1W4V A;  4MA9 A;  3KGK A;  2H1G A;  1BED A;  1DSB A;  2B5Y A;  2M72 A;  5H5R A;  1YZX A;  1HYU A;  4K0N A;  4NHW A;  3WGD A;  5ECM B;  1ZCP A;  3IV4 A;  1NSW A;  2R2J A;  2F8F A;  1TOF A;  4I5Q A;  2DJJ A;  4CHS A;  4GTU A;  3G7I A;  3KTB A;  3UEM A;  3A5I A;  4HJ2 A;  1FB6 A;  2VL9 A;  2VOC A;  2TRX A;  1FVJ A;  4YKF A;  4YKG A;  4ICY A;  1PN0 A;  3ZFL A;  2P5R A;  3DEX A;  1PQN A;  2X8G A;  2LRT A;  2HE3 A;  1N8J A;  1TDI A;  4K5R A;  1FHE A;  1WIK A;  5HQP A;  4K5S A;  3UOM A;  1PGT A;  2DMM A;  2H8L A;  1GNE A;  1GWC A;  5GZZ B;  3MYD A;  1IYH A;  2LQO A;  4KF9 A;  4BWQ A;  2H66 A;  4ACS A;  3Q6O A;  1PL2 A;  3HZ8 A;  4O7H A;  1S3R A;  4XTS A;  2MYG A;  1R5A A;  1EOG A;  5F05 A;  1C72 A;  4FIW A;  4MJB A;  2B5X A;  3UL3 A;  4CY8 A;  2PPT A;  3A2V A;  3HDC A;  2L5O A;  2MMN A;  3D6I A;  4HEA 2;  2IMF A;  1SL2 B;  4HS1 A;  1TK0 B;  2IJY A;  1B48 A;  5EPF A;  2PN8 A;  6GSS A;  2D2Z A;  3D22 A;  2VL3 A;  4XRA A;  4FH8 A;  1BAY A;  3N9J A;  4Z7X A;  1TK8 B;  2OAC A;  3N5O A;  1N2A A;  2C3T A;  2BJX A;  3CRT A;  2A2P A;  3WT1 A;  4TXV A;  3TKS C;  3ERF A;  1YKA A;  4MZB A;  4BVY A;  4YQU A;  5AIV A;  4EXJ A;  1XG8 A;  4HU7 A;  4EVM A;  6GSU A;  4ULX A;  3DVX A;  1ACV A;  1S3A A;  5KN2 A;  2ES7 A;  3J7Y k;  3LSZ A;  1A24 A;  2DJ2 A;  4XCS A;  3UAP A;  4MP4 A;  1BX9 A;  1GH2 A;  3ERG A;  5AIS A;  2NVL A;  3CYN A;  2YZH A;  1T8E B;  1BJX A;  4MK3 A;  2IMK A;  5GAN D;  5J9C A;  3P2A A;  4NAX A;  2OE0 A;  1Q4J A;  2YWI A;  2I3Y A;  3GL5 A;  1GSY A;  3FRC A;  3ZRE A;  2QC7 A;  1HNA A;  2L4C A;  2H30 A;  4EIQ A;  3VFI A;  2RM6 A;  2X49 A;  5KEJ A;  1SK1 A;  1O81 A;  4WBJ A;  1DBY A;  1Q98 A;  2V6O A;  2XBQ A;  3GN3 A;  3FW2 A;  1HNC A;  3ZIJ A;  5CAX A;  5KOW A;  3JCM L;  2LJR A;  3M1G A;  3F9U A;  1FB0 A;  1XWB A;  3ZTL A;  2X99 A;  3ZRD A;  1GLQ A;  2GSS A;  4FYU A;  2RUE A;  4WXT A;  3GUR A;  4AJ6 A;  4N11 A;  1TRW A;  2HRF A;  4I6X A;  1A2J A;  4KCA A;  2E2M A;  4JR4 A;  1R7H A;  5IMZ A;  4ML6 A;  2B1L A;  1JZD A;  3BCK A;  5B6M A;  2F51 A;  3EC3 A;  1M3J A;  2YV7 A;  4WF4 A;  3E0U A;  3TRX A;  4N30 A;  3QCP A;  5G31 A;  1QFN A;  2H1A A;  1FAA A;  5D9V A;  1SKW B;  2K9F A;  1UN2 A;  4MDC A;  1TU8 A;  4RQR A;  1XWA A;  3BCI A;  2H0G A;  3ZVJ D;  5ECQ B;  2N5A A;  1XCC A;  2CAQ A;  4XS6 A;  5G5F A;  3UJ1 A;  1OKD A;  3TOT A;  4DSS B;  4G10 A;  3IBH A;  1F9M A;  4O5U A;  4G9H A;  5G2Z A;  2LRN A;  4KUN A;  3CBU A;  1ZYN A;  6GSY A;  2HRA A;  2E0Q A;  2RUF A;  1YEX A;  1K0N A;  1EEJ A;  2FUG 2;  2X8H A;  5FHI A;  4ECB A;  2VL2 A;  2C4J A;  5IMC A;  3O76 A;  3G7J A;  3TJB A;  2GQK A;  2VM2 A;  3P8W A;  2CVD A;  19GS A;  3EE2 A;  5D9T A;  2XPE A;  3KMO A;  3HVN A;  1XZO A;  1M0U A;  2WFC A;  3EU4 A;  3IK9 A;  2PVO C;  1UVZ A;  1GSD A;  3M9K A;  1GSU A;  2RLI A;  4KE3 A;  3BBY A;  1Z9H A;  4ZL7 A;  2JAC A;  2YNX A;  1WE0 A;  2H76 A;  2OE3 A;  2WUL A;  2H1B A;  1YY7 A;  1H75 A;  4YAP A;  3F3R A;  3WGE A;  1VF2 A;  5DJM A;  1DUG A;  4K1F A;  4JR6 A;  1XXU A;  5ABR A;  3ZML A;  1EV4 A;  5F07 A;  1XW6 A;  5J4U A;  4KND A;  1PMT A;  1OC3 A;  3LXT A;  2VCT A;  4MH3 A;  1OVN A;  2OJL A;  1K3Y A;  1V98 A;  4IKH A;  13GS A;  2CVK A;  2V41 A;  2VIM A;  4F82 A;  3WGX A;  3HA9 A;  4H86 A;  3ERW A;  5ID2 A;  1S3D A;  3DD3 A;  3CQF A;  1LJR A;  1NM3 A;  1MDJ A;  4GST A;  3GL3 A;  5CRH A;  4MF5 A;  2J23 A;  4USS A;  6GST A;  1UA5 A;  4FQU A;  5FWG A;  1LBK A;  3BD2 A;  3KH7 A;  2KLX A;  3D4M A;  2V1M A;  5A4U A;  1ZYE A;  4EO3 A;  1ON4 A;  1T7P B;  5ECR B;  3O6T A;  4IP6 A;  1U3I A;  4TW5 A;  2HI7 A;  4GWR A;  2YJH A;  4ISD A;  1T4Y A;  5KN1 A;  2B1K A;  1G7E A;  3MSZ A;  2C0D A;  8GSS A;  1U3A A;  4KGI A;  4NWY A;  3NIV A;  1QK8 A;  4ML1 A;  3FZA A;  1JLW A;  4ZB6 A;  3D5J A;  1T4Z A;  2GST A;  5DBQ A;  1TJD A;  2VCQ A;  3AY8 A;  1M2A A;  1Y25 A;  1PA3 A;  4TRX A;  5J3R A;  2J9H A;  4PUA A;  2JSZ A;  2H0H A;  5ECK B;  2HSH A;  3GSS A;  2YP6 A;  1SD8 A;  1FG4 A;  1SJZ A;  1CQH A;  3EIN A;  3M0F A;  3RPN A;  3EPT A;  1QMV A;  4IQA A;  3PGT A;  4BVY B;  2QKE A;  2P31 A;  3C8E A;  2NDO A;  1KBN A;  5D9X A;  2JSY A;  5B6N A;  4XS4 A;  1K0C A;  3IPZ A;  5IO2 A;  1AUC A;  1S3C A;  3DKS A;  3VI5 A;  1EP7 A;  4PNG A;  2K8S A;  5EY6 A;  4O92 A;  3LGC A;  5ECL B;  5BMU A;  1A0R P;  3QFB C;  4PQH A;  1EV9 A;  1U88 A;  1Y6E A;  1SK2 A;  4TOP A;  2DLX A;  4DVC A;  2MMA A;  4ZL9 A;  2LEG A;  4V2L A;  2LTK A;  3GRX A;  1I9D A;  5DJL A;  1TRS A;  2ZUP A;  3L9V A;  3QAV A;  4G2E A;  3RAZ A;  3TJF A;  1URM A;  2LS5 A;  5H5Q A;  4G19 A;  4WBR D;  2YN1 A;  2GQL A;  1FW1 A;  1JZO A;  4GSN A;  3F4R A;  1AC1 A;  4EF0 A;  2QGV A;  2IL3 A;  4JE1 A;  5DAL B;  5IOX A;  3IHQ A;  4DSS A;  1GSS A;  4J2F A;  3KMN A;  1JHB A;  5LCZ A;  11GS A;  3HYP A;  3DYR A;  5D96 A;  5IQY A;  2R4V A;  4TXO A;  4LL4 B;  1ZOF A;  4KX4 A;  2XPD A;  1QQ2 A;  2C80 A;  3VK9 A;  1U87 A;  2WCI A;  3H93 A;  5HFK A;  2IIY A;  4GCI A;  3C7M A;  3VPQ A;  3TKS A;  5B7C A;  1WMJ A;  3F3Q A;  5HR1 A;  2H0I A;  3PR8 A;  2CX3 A;  3DIE A;  3GTU A;  4TR1 A;  1KNG A;  2DJ1 A;  5CP1 A;  2H72 A;  4AF2 A;  1F37 A;  4IHU A;  5FT3 A;  1VF1 A;  3OR5 A;  2LUS A;  4N0V A;  2A4H A;  1B8X A;  1GSQ A;  4FYB A;  4HZ4 A;  4F2I A;  2B3S A;  3DML A;  1V2A A;  4BA7 A;  3TKP A;  4RI6 A;  4YQV A;  4JZQ A;  2PVQ A;  3GYK A;  2PGT A;  5KN3 A;  3F6F A;  3U5R E;  3KXO A;  4WEY A;  2YOI A;  2R6K A;  1RQM A;  3ED3 A;  2VAF A;  3QMX A;  2K6V A;  3MNG A;  5AIX A;  2FA4 A;  2R0P A;  2Z9S A;  1K3L A;  2KP2 A;  2X8C A;  2OBK A;  2F9S A;  1GUH A;  3NZN A;  1QGV A;  3FY7 A;  4J56 E;  3L4N A;  3UVH A;  1VRS D;  2GVP A;  3HY2 A;  3IA1 A;  3Q18 A;  3LOR A;  2O8V B;  1TI1 A;  4ZBA A;  2IPA A;  1SU9 A;  1OKT A;  2H6Z A;  1WJK A;  3KCM A;  2JZR A;  1MD4 A;  1MDK A;  3GKM A;  5DCG A;  3A5W A;  3V1W A;  4XIH A;  4HDE A;  3APS A;  2V2G A;  2YPM A;  2EC4 A;  2HSY A;  1EWX A;  3GH6 A;  2AHE A;  2IFQ A;  1A8L A;  3TRQ A;  5A4W A;  3HKR A;  2FHE A;  2AV4 A;  3IHG A;  3FR3 A;  2DKI A;  2L6C A;  2WDU A;  2IMD A;  2OAD A;  5ID2 B;  2IN3 A;  2YAN A;  2GQM A;  2VM1 A;  3IOS A;  4GXZ A;  4N10 A;  3ZYW A;  5IPH A;  2H6Y A;  3C73 A;  5IOW A;  1ERU A;  2CQ9 A;  2VO4 A;  22GS A;  4F0B A;  1A2L A;  3LW9 A;  4KDX A;  1OE7 A;  1M2D A;  2L5L A;  4PXO A;  1M9A A;  3DXB A;  2HZE A;  2GZP A;  1Z7R A;  5G1L A;  3IDV A;  2VCW A;  4MMM A;  1SYX A;  5IO0 A;  2FWE A;  1AW9 A;  3LG6 A;  3VWW A;  1XWC A;  1OC9 A;  1ZZY A;  1GTA A;  2B5E A;  2REM A;  4K2X A;  4IP1 A;  3DVW A;  4MJC A;  5D9W A;  3SBC A;  2H19 A;  1Z5Y E;  4IBP A;  3RPP A;  1V40 A;  1FO5 A;  3GMF A;  1OYJ A;  2C0F A;  2PWJ A;  2H70 A;  3FR6 A;  6GSW A;  2LST A;  5CRE A;  2DIY A;  1FVK A;  2E2G A;  5G5E A;  4EKZ A;  2HYX A;  4D73 B;  4OO5 A;  3M9J A;  5IPG A;  1THO A;  5DCH A;  16GS A;  1PKW A;  4BWS A;  4KSM A;  3TGZ A;  5HR2 A;  2H1D A;  4XS4 B;  4Q5R A;  1AQW A;  1H4O A;  4JRR A;  1OC8 A;  2MZC A;  4PQ1 A;  4EL1 A;  5DAL A;  2H71 A;  3QDN A;  2HZF A;  2GZY A;  2DJ3 A;  4KCE A;  1K0D A;  4OFN A;  3VPT A;  4GLT A;  1JZW A;  3GKK A;  3HCZ A;  4PX1 A;  5INY A;  1JFU A;  4TVE A;  4XHM A;  4ECI A;  1A2M A;  3L9S A;  3F4S A;  5D73 A;  3GUS A;  1V57 A;  1ST9 A;  1K3O A;  3HD5 A;  5G1K A;  2VCV A;  3KP9 A;  1EGO A;  4LMW A;  4PGT A;  2ALB A;  1GUL A;  4MF6 A;  4X43 A;  4LLR A;  4AGS A;  2MMO A;  5CO3 A;  5IMV A;  4IW9 A;  1B9Y C;  2KHP A;  4CY6 A;  3CMI A;  4KH7 A;  1KEB A;  3MDK A;  4RUV A;  4TR0 A;  4TXO B;  4ZIJ A;  3CSJ A;  3TRP A;  3C1R A;  2B6M A;  3IAM 2;  3KIJ A;  1DE1 A;  3DWV A;  5H5S A;  5CRW A;  1ERW A;  4G0I A;  4MAB A;  4V2N A;  3HVS A;  3LQ7 A;  2VCZ A;  1EZK A;  3GTU B;  4TR1 B;  2OA7 A;  1VGL A;  3TB2 A;  2I81 A;  3I43 A;  1R26 A;  1PX6 A;  4IN0 A;  1TP9 A;  1YKC A;  5BRT A;  6GSX A;  4DSQ A;  1XVQ A;  4ID0 A;  4WR4 A;  2JZT A;  3VUR A;  1ZL9 A;  1T3B A;  4KW6 A;  3P7X A;  1WP0 A;  4MNN A;  3R2Q A;  3IC8 A;  4WKW A;  1TRV A;  1O85 A;  2H01 A;  1SJI A;  2HRK A;  4KA0 A;  1ERV A;  4JBB A;  3EWL A;  3UBK A;  5IMA A;  5E59 A;  1ZMA A;  4K7I A;  1X9W B;  1XFL A;  1MTC A;  4HJM A;  1XPV A;  2CZ2 A;  4AJ8 A;  2I9H A;  4NV2 A;  4Q5Q A;  1PN9 A;  2GLR A;  2L59 A;  2V6K A;  3FZ5 A;  4I97 A;  4ECC A;  5J5N A;  1M99 A;  4OWY A;  1I5G A;  3LJR A;  2AUV A;  1MEK A;  1AQV A;  3UIW A;  2CT6 A;  2LJK A;  5F06 A;  3GX0 A;  3PH9 A;  4ECJ A;  10GS A;  1HNB A;  5F8B A;  5ECH B;  1TRU A;  3TJK A;  4MH2 A;  1M3I A;  1F3B A;  4IJ3 A;  2C0E A;  2BTO T;  4EC0 A;  5J9B A;  3KD0 A;  2HLS A;  4L0U A;  1A0F A;  2E7P A;  3CXG A;  5A5K A;  2OKA A;  3E3E A;  5HR3 A;  4NHZ A;  4K7N A;  3VLN A;  2IFQ B;  4GQF A;  2H75 A;  3E9J B;  2QA2 A;  4CW9 A;  1T1V A;  1A23 A;  3ZVJ A;  5JWO B;  4YQM A;  4ILF A;  4I2U A;  1RW1 A;  3H4K A;  1PD2 1;  4BIK A;  3M3M A;  3CTF A;  3M8N A;  4RI7 A;  2A4V A;  1G6Y A;  2F8A A;  2C3Q A;  1A8Y A;  4ZB8 A;  4POB A;  3CSI A;  5HR0 A;  2DJK A;  1M9B A;  4NMU A;  2N5B A;  2JZS A;  2DKH A;  3FMW A;  2CX4 A;  4MJA A;  4K8M A;  4D73 A;  2PMT A;  4L5O A;  2DIZ A;  3HZ4 A;  4LA1 A;  1HD2 A;  2GT5 A;  2HZE B;  4TN8 A;  3UBL A;  2MMZ A;  3KZQ A;  5EL8 A;  2HNL A;  4DEJ A;  3QAG A;  1OC9 B;  2O85 A;  4MJE A;  3CRU A;  5G30 A;  3US3 A;  1J0F A;  2XBI A;  2LQQ A;  4OMV A;  3TUE A;  3Q19 A;  2P5Q A;  3WD6 A;  3EMX A;  2K18 A;  4ZL8 A;  1XOB A;  2XC2 A;  4L5L A;  1W89 A;  2HT9 A;  4O5R A;  3A2W A;  4HU9 A;  2I4A A;  4HUA A;  3GA4 A;  2X64 A;  2LNS A;  2LKU A;  2VUP A;  3ZLP A;  3VWU A;  5DAK B;  5KOX A;  3RHB A;  3WT2 A;  2DBC A;  4IJI A;  2GSQ A;  1SJ6 A;  4XRD A;  3W8S A;  3GH9 A;  4GSS A;  3I9V 2;  2MBS A;  2MBT A;  2GGT A;  4HI7 A;  2NBS A;  1EP8 A;  3TOU A;  4NXI A;  2PBJ A;  3F0I A;  5LNK e;  2G2Q A;  2HXK A;  1M2B A;  3I6A A;  1R4W A;  5D8I A;  1KTE A;  2IWT A;  4OCE A;  4OCF A;  5LD0 A;  4RQX A;  4EE0 A;  5JWR B;  5J41 A;  3FEU A;  1BYE A;  4HSC X;  1NW2 A;  3KH9 A;  1U6T A;  4O32 A;  2R37 A;  1SKS B;  3FR9 A;  1X9S B;  3GFK A;  4O5Q A;  2O87 A;  4JU5 A;  1QXH A;  3H79 A;  1SYR A;  1O8W A;  2F3M A;  3EVI A;  2AYT A;  2FD3 A;  2I1U A;  1MDI A;  3S9F A;  1LU4 A;  2RM5 A;  2KUC A;  1TI3 A;  4LMV A;  1G6W A;  3SWL A;  2HFD A;  3HVX A;  1Z6N A;  2H6X A;  1USB A;  2LNT A;  4BVX B;  3LXZ A;  2IME A;  4G0L A;  2KP1 A;  2A2R A;  1EEM A;  3TCO A;  4I2T A;  1HQO A;  2L4Q A;  1YDK A;  3HHV A;  2JU5 A;  4F9Z A;  2VD1 A;  3KEB A;  1WRY A;  2DJ0 A;  2CV4 A;  5ECI B;  5EVO A;  1YJ6 A;  1V9W A;  1G0T A;  1NHO A;  3F8U A;  1CQG A;  3UAR A;  4POK A;  2XHF A;  3GX8 A;  2LV3 A;  4WET A;  1X0R A;  4GRF A;  3G9B A;  4F03 A;  2QSI A;  4KAE A;  2FGX A;  4DSR A;  2FWF A;  4A5P A;  2JL4 A;  3QAW A;  5CNW A;  3TKQ A;  4BL7 A;  3TDG A;  7GSS A;  4NPB A;  4KDY A;  5ECP B;  5GST A;  3D21 A;  1Z6M A;  1OAZ A;  3LYK A;  1THX A;  2R3X A;  3D4T A;  2GS3 A;  5DQY A;  1E6B A;  3GIX A;  3R3E A;  1SL1 B;  4ZBB A;  4Q5F A;  3F4T A;  4MLY A;  1GNW A;  2R0C A;  4J57 E;  2VD0 A;  1PL1 A;  2YJ7 A;  2B7J A;  2UZ8 A;  4QL7 A;  1B4Q A;  1O7U A;  4X4J A;  9GSS A;  1GTU A;  2KOK A;  1ML6 A;  1Z7P A;  3QD9 A;  2FNO A;  4X0X A;  4OO4 A;  1GLP A;  2A2S A;  2AB6 A;  4IEL A;  3FZ9 A;  5ECO B;  3FYG A; 
#chains in the Genus database with same CATH homology
 1AIU A;  1F3A A;  2OE1 A;  1ZGN A;  4Q5N A;  4IS0 A;  5IIZ A;  3BJ5 A;  4K0G A;  5ELG A;  3H1N A;  2CA8 A;  4E8E A;  5GSS A;  3QOU A;  4KSO A;  4F0C A;  3IE3 A;  12GS A;  5CRD A;  3EU3 A;  3BOA A;  3TKS E;  4E8H A;  1GSE A;  2VLV A;  3RBT A;  3HJP A;  4HQZ A;  4MF7 A;  3F6D A;  1GL8 A;  4HZ2 A;  2GZZ A;  4X1U A;  3NOF A;  2K8V A;  5DAK A;  1XBS A;  4V1A g;  2NPB A;  2FLS A;  4TR3 A;  5C04 A;  2DML A;  2EIQ A;  3GKN A;  3KP8 A;  5CYY A;  2M46 A;  3C71 A;  4FO5 A;  4EIP A;  3HJM A;  14GS A;  3CSH A;  4I8B A;  3FZ4 A;  2L6D A;  5ECN B;  2PU9 C;  3PIN A;  2IMI A;  2C8U A;  1XWG A;  1PRX A;  4PQI A;  2H73 A;  1WOU A;  3Q74 A;  1MD3 A;  1B9X C;  4AJ7 A;  4Z2R A;  4HQS A;  4IVF A;  5GAP D;  2YCD A;  1PX7 A;  2YZU A;  4MZC A;  2JAD A;  2WRT A;  3ISO A;  4Z2U A;  4ZIL A;  4PNF A;  1SD9 A;  2WZ9 A;  3VWX A;  5DVB A;  2VLT A;  4WR5 A;  3F63 A;  2FA8 A;  4MPG A;  3O3T A;  1O73 A;  1XVW A;  3D0Z A;  5HFG A;  3TJJ A;  3I69 A;  3H8Q A;  2WS2 A;  1M7T A;  4BVX A;  1AAZ A;  2GDR A;  1TW9 A;  4OFM A;  4PTS A;  1XW5 A;  1AXD A;  3IC4 A;  3IRA A;  3DGQ A;  3ME8 A;  1UC7 A;  3G7Y A;  4FYC A;  3L9U A;  1K0M A;  4ZB9 A;  1SKR B;  2GT6 A;  2QA1 A;  1SK0 A;  4Z2T A;  2R5G A;  3VWV A;  5A4V A;  3IAS 2;  3W6G A;  1G7O A;  3LEF A;  2BMX A;  1GSF A;  2LRC A;  2ZNM A;  2TRC P;  2M80 A;  3PPU A;  3UMA A;  5IMD A;  4K2D A;  5C00 A;  1JZR A;  1ERT A;  5DDL A;  2AJQ B;  1EOH A;  3KM6 A;  1XOA A;  3MWH A;  5ELA A;  1XWK A;  5DQS A;  4PUR A;  4KDU A;  3QFA C;  2O89 A;  2TIR A;  5B8A A;  4OFT A;  2VLU A;  1F2E A;  2FWH A;  3GV1 A;  3WYW A;  4XS1 A;  4POM A;  5HFI A;  3L78 A;  2G0F A;  2CVB A;  2NTO A;  1GP1 A;  3A3T A;  2CZ3 A;  1X5D A;  4MCU A;  4K6X A;  1X9M B;  3TKR A;  3ZIV A;  1YF1 A;  3IK7 A;  3APO A;  3GKX A;  3C1S A;  1XIY A;  5IM9 A;  17GS A;  4LL1 B;  3ZFB A;  3RHC A;  2ON7 A;  3ZL5 A;  2FY6 A;  3FHK A;  2WB9 A;  4YH2 A;  1YQ1 A;  2HSM A;  1K0O A;  1GTI A;  5COH A;  4BPY A;  5JCG A;  2L57 A;  4GQC A;  1NHY A;  2PUK C;  1ILO A;  5B8B A;  3QR6 A;  3ZZX A;  4BL7 B;  3GHA A;  4POL A;  4K7O A;  2R0G A;  4PUF C;  1BG5 A;  1PSQ A;  1O8X A;  20GS A;  1VF3 A;  1X5E A;  1Z3E A;  2EIO A;  3LWA A;  5KN0 A;  1TXX A;  4QQ7 A;  4P3Y B;  2YWM A;  2GSR A;  4V2M A;  3DRN A;  5E4W A;  1J9B A;  2B7K A;  1VF4 A;  2N5F A;  2VCX A;  4N0Z A;  2O7K A;  1K0A A;  2EIR A;  2V32 A;  3W8J A;  4GF0 A;  1AQX A;  2WJU A;  3ZMK A;  5JCW A;  3LYP A;  1GUK A;  3GST A;  5ECS A;  5IMF A;  3ZIT A;  2PER A;  4JED A;  3IXR A;  1EGR A;  1FOV A;  5JWQ B;  3HVV A;  1YEP A;  2VL2 C;  4OD7 A;  2RII A;  1R5P A;  3HXS A;  3A2X A;  5AGY A;  2YWO A;  4CDO A;  1GRX A;  4YAV A;  3APQ A;  2LJA A;  4EDY A;  4TR4 A;  2P0G A;  1V58 A;  3EUR A;  5ENU A;  5CRG A;  2FWG A;  5D93 A;  4HOJ A;  1FOH A;  4ZXG A;  1K0B A;  1WWJ A;  1F6M C;  4NV5 A;  1O6J A;  3ME7 A;  2ZCT A;  3MIX A;  2GTU A;  3QPM A;  1GUM A;  2H74 A;  2YWN A;  1ABA A;  1TK5 B;  4KB3 A;  1DE2 A;  1JLV A;  5F0G A;  3LFL A;  2ON5 A;  2FCH A;  3UVT A;  3K8N A;  1RK4 A;  3KTL A;  1B4P A;  1OE8 A;  2CAI A;  4IQ1 A;  4V1A p;  2WGR A;  5L71 A;  3P90 A;  2DC5 A;  4K9Z A;  1TKD B;  5JCU A;  3U6V A;  3TJG A;  1QUW A;  1TU7 A;  3EYT A;  6GSV A;  5AN1 A;  2C0G A;  4L8E A;  1IYI A;  1WPI A;  3FKF A;  4MPF A;  3VI7 A;  4L0W A;  2DSA A;  4EUY A;  1BQ7 A;  3CTG A;  3L0H A;  3GNJ A;  1YF0 A;  4ZBD A;  3HJO A;  1SL0 B;  18GS A;  4WF5 A;  1E2Y A;  1TTZ A;  2YV9 A;  1XW9 A;  1SEN A;  3EMP A;  3IR4 A;  1X5C A;  2OBI A;  1ZYQ B;  2C3N A;  1PKZ A;  2AAW A;  2HRN A;  2X4A A;  4TKY A;  4EDZ A;  4QL9 A;  4G0K A;  1T00 A;  4IGJ A;  1GTB A;  1ZYP A;  2C1Y A;  3J7Y b;  3FK8 A;  3RDW A;  3MAK A;  3KJY A;  1J08 A;  4MZW A;  1W4V A;  4MA9 A;  3KGK A;  2H1G A;  1BED A;  1DSB A;  2B5Y A;  2M72 A;  5H5R A;  1YZX A;  1HYU A;  4K0N A;  4NHW A;  3WGD A;  5ECM B;  1ZCP A;  3IV4 A;  1NSW A;  2R2J A;  2F8F A;  1TOF A;  4I5Q A;  2DJJ A;  4CHS A;  4GTU A;  3G7I A;  3KTB A;  3UEM A;  3A5I A;  4HJ2 A;  1FB6 A;  2VL9 A;  2VOC A;  2TRX A;  1FVJ A;  4YKF A;  4YKG A;  4ICY A;  1PN0 A;  3ZFL A;  2P5R A;  3DEX A;  1PQN A;  2X8G A;  2LRT A;  2HE3 A;  1N8J A;  1TDI A;  4K5R A;  1FHE A;  1WIK A;  5HQP A;  4K5S A;  3UOM A;  1PGT A;  2DMM A;  2H8L A;  1GNE A;  1GWC A;  5GZZ B;  3MYD A;  1IYH A;  2LQO A;  4KF9 A;  4BWQ A;  2H66 A;  4ACS A;  3Q6O A;  1PL2 A;  3HZ8 A;  4O7H A;  4XTS A;  2MYG A;  1R5A A;  1EOG A;  5F05 A;  1C72 A;  4FIW A;  4MJB A;  2B5X A;  3UL3 A;  4CY8 A;  2PPT A;  3A2V A;  3HDC A;  2L5O A;  2MMN A;  3D6I A;  4HEA 2;  2IMF A;  1SL2 B;  4HS1 A;  1TK0 B;  2IJY A;  1B48 A;  5EPF A;  2PN8 A;  6GSS A;  2D2Z A;  3D22 A;  2VL3 A;  4XRA A;  4FH8 A;  1BAY A;  3N9J A;  4Z7X A;  1TK8 B;  2OAC A;  3N5O A;  1N2A A;  2C3T A;  2BJX A;  3CRT A;  2A2P A;  3WT1 A;  4TXV A;  3TKS C;  3ERF A;  1YKA A;  4MZB A;  4BVY A;  4YQU A;  5AIV A;  4EXJ A;  4HU7 A;  4EVM A;  6GSU A;  4ULX A;  3DVX A;  1ACV A;  1S3A A;  5KN2 A;  2ES7 A;  3J7Y k;  3LSZ A;  1A24 A;  2DJ2 A;  4XCS A;  3UAP A;  4MP4 A;  1BX9 A;  1GH2 A;  3ERG A;  5AIS A;  2NVL A;  3CYN A;  2YZH A;  1T8E B;  1BJX A;  4MK3 A;  2IMK A;  5GAN D;  5J9C A;  3P2A A;  4NAX A;  2OE0 A;  1Q4J A;  2YWI A;  2I3Y A;  3GL5 A;  1GSY A;  3FRC A;  3ZRE A;  2QC7 A;  1HNA A;  2L4C A;  2H30 A;  4EIQ A;  3VFI A;  2RM6 A;  2X49 A;  5KEJ A;  1SK1 A;  1O81 A;  4WBJ A;  1DBY A;  1Q98 A;  2V6O A;  2XBQ A;  3GN3 A;  3FW2 A;  1HNC A;  3ZIJ A;  5CAX A;  5KOW A;  3JCM L;  2LJR A;  3M1G A;  3F9U A;  1FB0 A;  1XWB A;  3ZTL A;  2X99 A;  3ZRD A;  1GLQ A;  2GSS A;  4FYU A;  2RUE A;  4WXT A;  3GUR A;  4AJ6 A;  4N11 A;  1TRW A;  2HRF A;  4I6X A;  1A2J A;  4KCA A;  2E2M A;  4JR4 A;  1R7H A;  5IMZ A;  4ML6 A;  2B1L A;  1JZD A;  3BCK A;  5B6M A;  2F51 A;  3EC3 A;  2YV7 A;  4WF4 A;  3E0U A;  3TRX A;  4N30 A;  3QCP A;  5G31 A;  1QFN A;  2H1A A;  1FAA A;  5D9V A;  1SKW B;  2K9F A;  1UN2 A;  4MDC A;  1TU8 A;  4RQR A;  1XWA A;  3BCI A;  2H0G A;  3ZVJ D;  5ECQ B;  2N5A A;  1XCC A;  2CAQ A;  4XS6 A;  5G5F A;  3UJ1 A;  1OKD A;  3TOT A;  4DSS B;  4G10 A;  3IBH A;  1F9M A;  4O5U A;  4G9H A;  5G2Z A;  2LRN A;  4KUN A;  3CBU A;  1ZYN A;  6GSY A;  2HRA A;  2E0Q A;  2RUF A;  1YEX A;  1K0N A;  1EEJ A;  2FUG 2;  2X8H A;  5FHI A;  4ECB A;  2VL2 A;  2C4J A;  5IMC A;  3O76 A;  3G7J A;  3TJB A;  2GQK A;  2VM2 A;  3P8W A;  2CVD A;  19GS A;  3EE2 A;  5D9T A;  2XPE A;  3KMO A;  1XZO A;  1M0U A;  2WFC A;  3EU4 A;  3IK9 A;  2PVO C;  1UVZ A;  1GSD A;  3M9K A;  1GSU A;  2RLI A;  4KE3 A;  3BBY A;  1Z9H A;  4ZL7 A;  2JAC A;  2YNX A;  1WE0 A;  2H76 A;  2OE3 A;  2WUL A;  2H1B A;  1YY7 A;  1H75 A;  4YAP A;  3F3R A;  3WGE A;  1VF2 A;  5DJM A;  1DUG A;  4K1F A;  4JR6 A;  1XXU A;  5ABR A;  3ZML A;  1EV4 A;  5F07 A;  1XW6 A;  5J4U A;  4KND A;  1PMT A;  1OC3 A;  3LXT A;  2VCT A;  4MH3 A;  1OVN A;  2OJL A;  1K3Y A;  1V98 A;  4IKH A;  13GS A;  2CVK A;  2V41 A;  2VIM A;  4F82 A;  3WGX A;  3HA9 A;  4H86 A;  3ERW A;  5ID2 A;  1S3D A;  3DD3 A;  1LJR A;  1NM3 A;  1MDJ A;  4GST A;  3GL3 A;  5CRH A;  4MF5 A;  2J23 A;  4USS A;  6GST A;  1UA5 A;  4FQU A;  5FWG A;  1LBK A;  3BD2 A;  3KH7 A;  2KLX A;  3D4M A;  2V1M A;  5A4U A;  1ZYE A;  4EO3 A;  1ON4 A;  1T7P B;  5ECR B;  3O6T A;  4IP6 A;  1U3I A;  4TW5 A;  2HI7 A;  4GWR A;  2YJH A;  4ISD A;  1T4Y A;  5KN1 A;  2B1K A;  1G7E A;  3MSZ A;  2C0D A;  8GSS A;  1U3A A;  4KGI A;  4NWY A;  3NIV A;  1QK8 A;  4ML1 A;  3FZA A;  1JLW A;  4ZB6 A;  3D5J A;  1T4Z A;  2GST A;  5DBQ A;  1TJD A;  2VCQ A;  3AY8 A;  1M2A A;  1Y25 A;  1PA3 A;  4TRX A;  5J3R A;  2J9H A;  4PUA A;  2JSZ A;  2H0H A;  5ECK B;  2HSH A;  3GSS A;  2YP6 A;  1SD8 A;  1FG4 A;  1SJZ A;  1CQH A;  3EIN A;  3M0F A;  3RPN A;  3EPT A;  1QMV A;  4IQA A;  3PGT A;  4BVY B;  2QKE A;  2P31 A;  3C8E A;  2NDO A;  1KBN A;  5D9X A;  2JSY A;  5B6N A;  4XS4 A;  1K0C A;  3IPZ A;  5IO2 A;  1AUC A;  1S3C A;  3DKS A;  3VI5 A;  1EP7 A;  4PNG A;  2K8S A;  5EY6 A;  4O92 A;  3LGC A;  5ECL B;  5BMU A;  1A0R P;  3QFB C;  4PQH A;  1EV9 A;  1U88 A;  1Y6E A;  1SK2 A;  4TOP A;  2DLX A;  4DVC A;  2MMA A;  4ZL9 A;  2LEG A;  4V2L A;  2LTK A;  3GRX A;  1I9D A;  5DJL A;  1TRS A;  2ZUP A;  3L9V A;  3QAV A;  4G2E A;  3RAZ A;  3TJF A;  1URM A;  2LS5 A;  5H5Q A;  4G19 A;  4WBR D;  2YN1 A;  2GQL A;  1FW1 A;  1JZO A;  4GSN A;  3F4R A;  1AC1 A;  4EF0 A;  2QGV A;  2IL3 A;  4JE1 A;  5DAL B;  5IOX A;  3IHQ A;  4DSS A;  1GSS A;  4J2F A;  3KMN A;  1JHB A;  5LCZ A;  11GS A;  3HYP A;  3DYR A;  5D96 A;  5IQY A;  2R4V A;  4TXO A;  4LL4 B;  1ZOF A;  4KX4 A;  2XPD A;  1QQ2 A;  2C80 A;  3VK9 A;  1U87 A;  2WCI A;  3H93 A;  5HFK A;  2IIY A;  4GCI A;  3C7M A;  3VPQ A;  3TKS A;  5B7C A;  1WMJ A;  3F3Q A;  5HR1 A;  2H0I A;  3PR8 A;  2CX3 A;  3DIE A;  3GTU A;  4TR1 A;  1KNG A;  2DJ1 A;  5CP1 A;  2H72 A;  4AF2 A;  1F37 A;  4IHU A;  5FT3 A;  1VF1 A;  3OR5 A;  2LUS A;  4N0V A;  2A4H A;  1B8X A;  1GSQ A;  4FYB A;  4HZ4 A;  4F2I A;  2B3S A;  3DML A;  1V2A A;  4BA7 A;  3TKP A;  4RI6 A;  4YQV A;  4JZQ A;  2PVQ A;  3GYK A;  2PGT A;  5KN3 A;  3F6F A;  3U5R E;  3KXO A;  4WEY A;  2YOI A;  2R6K A;  1RQM A;  3ED3 A;  2VAF A;  3QMX A;  2K6V A;  3MNG A;  5AIX A;  2FA4 A;  2R0P A;  2Z9S A;  1K3L A;  2KP2 A;  2X8C A;  2OBK A;  2F9S A;  1GUH A;  3NZN A;  1QGV A;  3FY7 A;  4J56 E;  3L4N A;  3UVH A;  1VRS D;  2GVP A;  3HY2 A;  3IA1 A;  3Q18 A;  3LOR A;  2O8V B;  1TI1 A;  4ZBA A;  2IPA A;  1SU9 A;  1OKT A;  2H6Z A;  1WJK A;  3KCM A;  2JZR A;  1MD4 A;  1MDK A;  3GKM A;  5DCG A;  3A5W A;  3V1W A;  4XIH A;  4HDE A;  3APS A;  2V2G A;  2YPM A;  2EC4 A;  2HSY A;  1EWX A;  3GH6 A;  2AHE A;  2IFQ A;  1A8L A;  3TRQ A;  5A4W A;  3HKR A;  2FHE A;  2AV4 A;  3IHG A;  3FR3 A;  2DKI A;  2L6C A;  2WDU A;  2IMD A;  2OAD A;  5ID2 B;  2IN3 A;  2YAN A;  2GQM A;  2VM1 A;  3IOS A;  4GXZ A;  4N10 A;  3ZYW A;  5IPH A;  2H6Y A;  3C73 A;  5IOW A;  1ERU A;  2CQ9 A;  2VO4 A;  22GS A;  4F0B A;  1A2L A;  3LW9 A;  4KDX A;  1OE7 A;  1M2D A;  2L5L A;  4PXO A;  1M9A A;  3DXB A;  2HZE A;  2GZP A;  1Z7R A;  5G1L A;  3IDV A;  2VCW A;  4MMM A;  1SYX A;  5IO0 A;  2FWE A;  1AW9 A;  3LG6 A;  3VWW A;  1XWC A;  1OC9 A;  1ZZY A;  1GTA A;  2B5E A;  2REM A;  4K2X A;  4IP1 A;  3DVW A;  4MJC A;  5D9W A;  3SBC A;  2H19 A;  1Z5Y E;  4IBP A;  3RPP A;  1V40 A;  1FO5 A;  3GMF A;  1OYJ A;  2C0F A;  2PWJ A;  2H70 A;  3FR6 A;  6GSW A;  2LST A;  5CRE A;  2DIY A;  1FVK A;  2E2G A;  5G5E A;  4EKZ A;  2HYX A;  4D73 B;  4OO5 A;  3M9J A;  5IPG A;  1THO A;  5DCH A;  16GS A;  1PKW A;  4BWS A;  4KSM A;  3TGZ A;  5HR2 A;  2H1D A;  4XS4 B;  4Q5R A;  1AQW A;  1H4O A;  4JRR A;  1OC8 A;  2MZC A;  4PQ1 A;  4EL1 A;  5DAL A;  2H71 A;  3QDN A;  2HZF A;  2GZY A;  2DJ3 A;  4KCE A;  1K0D A;  4OFN A;  3VPT A;  4GLT A;  1JZW A;  3GKK A;  3HCZ A;  4PX1 A;  5INY A;  1JFU A;  4TVE A;  4XHM A;  4ECI A;  1A2M A;  3L9S A;  3F4S A;  5D73 A;  3GUS A;  1V57 A;  1ST9 A;  1K3O A;  3HD5 A;  5G1K A;  2VCV A;  3KP9 A;  1EGO A;  4LMW A;  4PGT A;  2ALB A;  1GUL A;  4MF6 A;  4X43 A;  4LLR A;  4AGS A;  2MMO A;  5CO3 A;  5IMV A;  4IW9 A;  1B9Y C;  2KHP A;  4CY6 A;  3CMI A;  4KH7 A;  1KEB A;  3MDK A;  4RUV A;  4TR0 A;  4TXO B;  4ZIJ A;  3CSJ A;  3TRP A;  3C1R A;  2B6M A;  3IAM 2;  3KIJ A;  1DE1 A;  3DWV A;  5H5S A;  5CRW A;  1ERW A;  4G0I A;  4MAB A;  4V2N A;  3HVS A;  3LQ7 A;  2VCZ A;  1EZK A;  3GTU B;  4TR1 B;  2OA7 A;  1VGL A;  3TB2 A;  2I81 A;  3I43 A;  1R26 A;  1PX6 A;  4IN0 A;  1TP9 A;  1YKC A;  5BRT A;  6GSX A;  4DSQ A;  1XVQ A;  4ID0 A;  4WR4 A;  2JZT A;  3VUR A;  1ZL9 A;  1T3B A;  4KW6 A;  3P7X A;  1WP0 A;  4MNN A;  3R2Q A;  3IC8 A;  4WKW A;  1TRV A;  1O85 A;  2H01 A;  1SJI A;  2HRK A;  4KA0 A;  1ERV A;  4JBB A;  3EWL A;  3UBK A;  5IMA A;  5E59 A;  1ZMA A;  4K7I A;  1X9W B;  1XFL A;  1MTC A;  4HJM A;  1XPV A;  2CZ2 A;  4AJ8 A;  2I9H A;  4NV2 A;  4Q5Q A;  1PN9 A;  2GLR A;  2L59 A;  2V6K A;  3FZ5 A;  4I97 A;  4ECC A;  5J5N A;  1M99 A;  4OWY A;  1I5G A;  3LJR A;  2AUV A;  1MEK A;  1AQV A;  3UIW A;  2CT6 A;  2LJK A;  5F06 A;  3GX0 A;  3PH9 A;  4ECJ A;  10GS A;  1HNB A;  5F8B A;  5ECH B;  1TRU A;  3TJK A;  4MH2 A;  1F3B A;  4IJ3 A;  2C0E A;  2BTO T;  4EC0 A;  5J9B A;  3KD0 A;  2HLS A;  4L0U A;  1A0F A;  2E7P A;  3CXG A;  5A5K A;  2OKA A;  3E3E A;  5HR3 A;  4NHZ A;  4K7N A;  3VLN A;  2IFQ B;  4GQF A;  2H75 A;  3E9J B;  2QA2 A;  4CW9 A;  1T1V A;  1A23 A;  3ZVJ A;  5JWO B;  4YQM A;  4ILF A;  4I2U A;  1RW1 A;  3H4K A;  1PD2 1;  3M3M A;  3CTF A;  3M8N A;  4RI7 A;  2A4V A;  1G6Y A;  2F8A A;  2C3Q A;  1A8Y A;  4ZB8 A;  4POB A;  3CSI A;  5HR0 A;  2DJK A;  1M9B A;  4NMU A;  2N5B A;  2JZS A;  2DKH A;  3FMW A;  2CX4 A;  4MJA A;  4K8M A;  4D73 A;  2PMT A;  4L5O A;  2DIZ A;  3HZ4 A;  4LA1 A;  1HD2 A;  2GT5 A;  2HZE B;  4TN8 A;  3UBL A;  2MMZ A;  3KZQ A;  5EL8 A;  2HNL A;  4DEJ A;  3QAG A;  1OC9 B;  2O85 A;  4MJE A;  3CRU A;  5G30 A;  3US3 A;  1J0F A;  2XBI A;  2LQQ A;  4OMV A;  3TUE A;  3Q19 A;  2P5Q A;  3WD6 A;  3EMX A;  2K18 A;  4ZL8 A;  1XOB A;  2XC2 A;  4L5L A;  1W89 A;  2HT9 A;  4O5R A;  3A2W A;  4HU9 A;  2I4A A;  4HUA A;  3GA4 A;  2X64 A;  2LNS A;  2LKU A;  2VUP A;  3ZLP A;  3VWU A;  5DAK B;  5KOX A;  3RHB A;  3WT2 A;  2DBC A;  4IJI A;  2GSQ A;  1SJ6 A;  4XRD A;  3W8S A;  3GH9 A;  4GSS A;  3I9V 2;  2MBS A;  2MBT A;  2GGT A;  4HI7 A;  2NBS A;  1EP8 A;  3TOU A;  4NXI A;  2PBJ A;  3F0I A;  5LNK e;  2G2Q A;  2HXK A;  1M2B A;  3I6A A;  1R4W A;  5D8I A;  1KTE A;  2IWT A;  4OCE A;  4OCF A;  5LD0 A;  4RQX A;  4EE0 A;  5JWR B;  5J41 A;  3FEU A;  1BYE A;  1NW2 A;  3KH9 A;  1U6T A;  4O32 A;  2R37 A;  1SKS B;  3FR9 A;  1X9S B;  3GFK A;  4O5Q A;  2O87 A;  4JU5 A;  1QXH A;  3H79 A;  1SYR A;  1O8W A;  2F3M A;  3EVI A;  2AYT A;  2FD3 A;  2I1U A;  1MDI A;  3S9F A;  1LU4 A;  2RM5 A;  2KUC A;  1TI3 A;  4LMV A;  1G6W A;  3SWL A;  2HFD A;  3HVX A;  1Z6N A;  2H6X A;  1USB A;  2LNT A;  4BVX B;  3LXZ A;  2IME A;  4G0L A;  2KP1 A;  2A2R A;  1EEM A;  3TCO A;  4I2T A;  1HQO A;  2L4Q A;  1YDK A;  3HHV A;  2JU5 A;  4F9Z A;  2VD1 A;  3KEB A;  1WRY A;  2DJ0 A;  2CV4 A;  5ECI B;  5EVO A;  1YJ6 A;  1V9W A;  1G0T A;  1NHO A;  3F8U A;  1CQG A;  3UAR A;  4POK A;  2XHF A;  3GX8 A;  2LV3 A;  4WET A;  1X0R A;  4GRF A;  3G9B A;  4F03 A;  2QSI A;  4KAE A;  2FGX A;  4DSR A;  2FWF A;  4A5P A;  2JL4 A;  3QAW A;  5CNW A;  3TKQ A;  4BL7 A;  3TDG A;  7GSS A;  4NPB A;  4KDY A;  5ECP B;  5GST A;  3D21 A;  1Z6M A;  1OAZ A;  3LYK A;  1THX A;  2R3X A;  3D4T A;  2GS3 A;  5DQY A;  1E6B A;  3GIX A;  3R3E A;  1SL1 B;  4ZBB A;  4Q5F A;  3F4T A;  4MLY A;  1GNW A;  2R0C A;  4J57 E;  2VD0 A;  1PL1 A;  2YJ7 A;  2B7J A;  2UZ8 A;  4QL7 A;  1B4Q A;  1O7U A;  4X4J A;  9GSS A;  1GTU A;  2KOK A;  1ML6 A;  1Z7P A;  3QD9 A;  2FNO A;  4X0X A;  4OO4 A;  1GLP A;  2A2S A;  2AB6 A;  4IEL A;  3FZ9 A;  5ECO B;  3FYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...