2VAMA

Ftsz b. subtilis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Conformational Variability of Ftsz
pubmed doi rcsb
molecule keywords CELL DIVISION PROTEIN FTSZ
molecule tags Cell cycle
source organism Bacillus subtilis
total genus 103
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2vamA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2vamA01
3RYHB 5J2TA 4O4JB 3N2GA 5LYJA 5JCOA 3RYCA 1W59A 5CA1A 3JAKB 1W5AA 4ZOLA 5IJ9B 5IJ0A 4X20B 4I55A 4F6RA 3V3TA 4X1KB 5LP6A 5J2UA 3HKDB 5CB4B 5KX5A 4LNUB 4B46A 3HKCB 1TVKA 5EYPB 3R4VA 5C8YA 4YJ3A 3ZBPA 2VAWA 4IHJB 5CA0B 1Z5VA 4DRXA 5JH7B 1OFUA 3HKBA 3VOAA 5JVDA 4FFBB 5LOVB 5MN4A 5LA6A 4WBNA 4KWEA 5BMVB 4U3JB 5IYZA 3JATB 3HKEA 4X1IB 1RQ2A 5JQGB 5KMGA 1W5BA 5FNVB 1SA0A 4M8IA 4DXDA 4EB6A 4TV9B 3JASB 3RYFB 4YJ2A 4I50A 4O2BA 4EI9A 5M7EA 4HNAA 2VAMA 3E22B 4TUYB 3CB2A 3N2KA 4IIJA 4ZI7B 3VO9A 3UT5B 4O2AB 3JALB 2BTQB 5MN6A 5LXTB 1TUBA 4O4HB 5KX5B 4E6EA 4O4LA 5J2TB 2R6R1 3JAWA 3N2GB 3WGLA 4ZHQA 5LYJB 3RYCB 5ITZA 5EZYA 2RHHA 5EIBC 5CA1B 1W5EA 4ZOLB 5GONA 3JARA 4I4TA 3WGJA 5IJ0B 2XKBA 4I55B 4F6RB 1JFFA 5LP6B 5J2UB 3C8LA 1FFXA 4TV8A 4O4IA 4EI7A 3RYIA 1TVKB 5EIBD 5C8YB 4YJ3B 4X1YA 3RYHA 2BTOA 3ZIDA 4O4JA 4DRXB 3HKBB 3VPAA 3VOBA 5JVDB 4EI8A 3ZBQA 3WGKA 5JCOC 2Q1XA 5LA6B 3JAKA 4WBNB 1FSZA 5IJ9A 3RB8A 5IYZB 1RQ7A 4X20A 3HKEB 1W581 5KMGB 4X1KA 1SA0B 3HKDA 5CB4A 4EB6B 4LNUA 2VXYA 4YJ2B 3HKCA 4I50B 4O2BB 2Q1YA 5EYPA 4HNAB 3WGNA 3N2KB 4IIJB 2GVIA 4IHJA 5CA0A 5JH7A 3M89A 3M8KA 4FFBA 5MN5A 5LOVA 2XKAA 1TUBB 3WGMA 4O4LB 5BMVA 4U3JA 3JATA 3JAWB 4X1IA 5JQGA 4ZHQB 5FNVA 5ITZB 5EZYB 4TV9A 1RLUA 3JASA 4X1YB 5GONB 3RYFA 3JARB 4I4TB 3VO8A 2RHOA 3E22A 4TUYA 2VAPA 4ZI7A 1JFFB 3UT5A 4O2AA 1FFXB 1W5FA 2RHLA 3JALA 4O4IB 4TV8B 3RYIB 2BTQA 5LXTA 1Z5WA 2RHJA 4B45A 5LP6C 4XCQA 4U39A 4O4HA 2R751
chains in the Genus database with same CATH superfamily
4H1WA 4J1TA 4IZOA 2YBDA 4EK9A 4MCJA 4L4ZA 1P1IA 3U56A 1Q1BA 1FVOA 1XAGA 2YVQA 3CZQA 1QS0A 4M0EA 4NU5A 4EF4A 4UM9B 2LD4A 1GTZA 5GINE 2ST1A 3IHLA 3ZNPA 4NFYA 1UPXA 4HAOA 4D02A 3ZVRA 1DWPA 4BN4A 1K8AH 1UC8A 4JI3B 4ZGGA 4HNGA 3TLAA 2BFEA 1S89A 1UKAA 5C3UA 3G5UA 1KE2A 4FX2A 4JODA 1Q21A 4YHHB 2FFJA 3BD9A 4D43A 1Y3BE 4GEKA 3A9RA 5DWVA 2VNSA 5FWYB 1E79D 1LQUA 3PYXA 1HKUA 4XCVA 4DWJA 4V2IA 2D1FA 4YJKA 1CUUA 1LSOA 1XMVA 2W6NA 2HMSA 3LCJA 2IPAB 4KFTA 1LPAB 4ID9A 3WMFA 5IT0A 1ZVKA 4DR5B 1G55A 2ZYUX 1O2DA 4HCJA 3RASA 4X1IB 1IHPA 2ZUDA 1VGVA 4LFBB 2PTGA 1W5BA 2B1GA 4YLYA 2PUDA 2DBYA 4D44A 4ECEA 2HQSC 1QIFA 3D02A 1JIUA 1DO2A 5BRNA 3WNDA 4NWOB 2DERA 3UOGA 1JMYA 3MUNA 5B2FA 4EGAA 3OURA 4ZANA 3JALB 3QU4A 2JD2A 2PRZA 2QK4A 2OCPA 4EBFA 2RHBA 1MOZA 3D6TB 5JAUA 1QYWA 3CCFA 1XDZA 4JJGA 2QUBA 4DB2A 1EVZA 3NHYA 4KGDA 3B51X 1Q17A 2XMSA 1VPVA 1UP6A 3HV2A 3IP6A 3RFFA 5F1OA 4BL5A 1U1EA 1R0SA 1HY3A 1JKFA 1OZHA 2VWGA 5IJ0B 2J6IA 2R85A 1L7MA 1BH2A 1PZGA 5DV9A 5SYNA 4GZLA 3ROZA 5AKLA 2QR3A 1OLUB 2I1WA 1T29A 1YZUA 4PYLA 2JHCA 3R0IA 1U5BB 1IVYA 1U7ZA 2AUTA 3GP5A 3GJSA 1IV1A 3TAXA 3ZWMA 2V5AA 5L4NA 1LZKA 5EJEA 4E5UA 1H1TA 2UYJA 4URZR 3IBCA 4KN9S 2IEBA 2XYVA 4C30A 3WGZA 2E5WA 2PX6A 2PZFA 1RMQA 3B2QA 5BSTA 1A7KA 3C5WP 3ZC3A 4DJDC 3NMUF 5EWRA 3IEUA 1K1EA 2IC5A 4KJZA 4TSFD 4P38A 2ZOSA 4GMKA 2QGZA 2JZCA 3AQIA 4J8PA 3PRHA 1Q7RA 4MVJA 1M6VB 3G7NA 4W8HA 4JC4A 3C1AA 4P4LA 2DETA 1Q2UA 1VCHA 5L53A 1FTWA 3GRAA 4IDNA 3IVCA 4ZQIA 5TR9A 1UDAA 5BN3A 4TRRA 4M86A 4G88A 1F0KA 4JJ6A 4RKWA 4BX3A 1RPNA 1ZD9A 5AM4A 2XODA 1OLOA 1YZNA 2AIRA 3BAZA 1L5QA 1KI2A 5G1NA 2F1HA 5A04A 2ZCVA 5YASA 1OW3B 1KDOA 4RIFA 3ONWA 4FBMA 4DFDA 3M70A 3DEHA 1CUZA 3MQ2A 3ORRA 4WBXC 3R7SA 4E5VA 3BTUA 4ZO7A 2Y1DA 1AQIA 1K9SA 1PP4A 4Q9KA 4Z4EA 1OLXB 3LIPA 4OQZA 2XNKA 1PR6A 2B3DA 4OI2A 4O4IB 1X13A 1QVGF 2TSYB 3TS1A 1QGZA 4JGBA 3TSWA 1PTJA 5LP6C 2IP4A 1A5BB 3AEKB 2XQGA 4FPXA 3TKLA 5HYVA 3GV0A 3TSAA 4BO3A 2XZTA 3SBDA 3FZNA 3TQRA 1J0CA 1YS4A 3U40A 4AP6A 1D6MA 1ZAKA 5JCOA 2FP4A 3F4LA 1QHHB 3G1TA 1G8PA 3KS9A 4H4EA 5IC6A 4ZCIA 1ZMRA 1N3YA 2Q3MA 3TJRA 1OILA 1P4GA 2DE0X 4GECA 3IULA 3M4JA 5L51A 3GROA 4UDNA 5TMPA 1EBFA 1EWKA 3K0FA 4UARA 1KGSA 4YPOA 4IMIB 4J2OA 1QF6A 1OYWA 1BMFD 1U2PA 2Q99A 3NHUA 4LDRA 4RZHA 3WDSA 1IUKA 3UGKA 4PS0A 1CZNA 2VJYA 3EGDA 2HA2A 2AMYA 3LHSA 4GLFA 3HKBA 3V8VA 1M0WA 1G5TA 1GUBA 2CWWA 2V7PA 3EVDA 3U17A 3TVYA 3TTUA 2I3BA 4RLQA 4BB6A 3DLCA 2O3QA 1R3UA 1AK2A 4G6ZA 1I1NA 5JCJD 2GXUA 4JB2A 3UXHA 3BXEA 2KLBA 3EW7A 2HCBA 1D0VA 2CNWD 2B3TA 2Q5CA 4YEDA 3S29A 1WKBA 3B82A 3MGKA 1HPLA 2G88A 1OPRA 2Z30A 3LO8A 1N0UA 2UVPA 2C4TA 1PR3A 2JS7A 4LI0A 3VO9A 4OQPA 5C3MA 2GAAA 4EPRA 1D2GA 2GJ9A 2NZUG 3AP2A 3D7KA 3L8DA 5FUQA 1KH2A 2I6QA 2V96A 4MYSA 4FCCA 4UBJA 2WFAA 5A02A 4WY2A 1T0UA 4II3A 2HRQA 1YKSA 2VPXA 5LCXA 5JI2E 4P5DA 4DUZB 5EKUA 2F55A 3GAMA 2QG4A 2G1UA 4ZAWA 2G17A 2X0RA 3P0FA 2O8CB 5B1HA 1FFSA 6ADHA 1ZIXA 3PLRA 1N57A 3IQEA 3U26A 3HDGA 3NT2A 3K9BA 4KZKA 3HK2A 3G2OA 4MK4A 3DOHA 1G291 1V39A 1RPJA 3QEMB 4WLEA 4L50A 4LKOA 1NQAO 2Q0QA 3BSYA 3QU2A 4LS3A 4ND5A 4R1MA 3DUFA 3GP3A 5E9AA 3VPAA 4KR0A 3JS5A 5LBTA 1SUAA 1LX7A 2JI9A 3CONA 5JCOC 5I01A 1DBFA 1TK2A 5U9CA 4WZBB 4L02A 5FO1A 3RSOA 2GPBA 4MMZB 3EODA 3ZTYA 4BBPA 4WNAB 5IW8A 3IQIX 4TZ6A 2R60A 1N25A 1UFKA 2EJWA 3BFXA 1QH9A 3BRWD 3VKVA 4C87A 1DT9A 2P9YA 1V11B 5J40A 2UZAA 5BWMA 4G0NA 1K7CA 1VE3A 2C5AA 2C96A 5AIAA 1O9BA 3WWPA 4C88A 2BM1A 2OHVA 3A70A 3PWZA 1JAHA 1PWEA 3UEOA 5IFKA 3ZOKA 2ZBFA 3HZRA 1M1NB 2V7TA 3Q7QA 4KAXA 4RIIA 5AUPB 5C1DA 1L6RA 1QJCA 1PAUA 3OZRA 3PQ8A 4EW1A 2G9NA 5KOIA 3ABOB 3HU2A 4B6QA 1VKZA 1WPQA 1R18A 1ZL0A 2G5PA 4G0PA 2CSUA 1WR8A 1US8B 1C3EA 2ZRPA 3OUZA 3JWIA 4G1EB 4EMUA 3J7AR 4ON9A 3OLYA 4QOIA 1XJCA 5CLIA 2C5HA 4JV5B 3N53A 4I4TB 3E4DA 3USCS 5DNWA 1F7UA 2XMZA 3SD7A 4F9EA 1MQSA 1U02A 4ASUA 3PQCA 3HA2A 2C4UA 3WRYA 3I7TA 1Z2AA 4JD5A 5FORA 1CV2A 1C9DB 2R47A 3UAVA 1L7PA 4R9UC 2HL6A 5GMOA 3ENWA 1OIVA 3JWJA 1OXUA 3GYQA 4IJUA 3CB4A 4KXYA 5LM3A 1VPLA 3HA7A 3R3VA 1FMCA 2D2FA 2FMUA 1R50A 3VR4D 1OAOC 1C4OA 3SF8B 1ODJA 2ZYDA 1X1AA 2W2PA 2K7ZA 4GP7A 4NJEB 5AH0A 2QQGA 1N4AA 3KQVA 1QK4A 4BVJA 4KU4A 3GJ6A 2DVMA 4UOQA 1PJCA 2HJ9A 3F5MA 3TM4A 1SU6A 2Q3DA 1MNAA 1KC1A 5E0KB 3WXBA 2BF7A 3WNQA 3BGSA 4KGVA 4PG7A 4Z0TA 5EJ7A 1C7ZA 1KZGB 2FRXA 2JGDA 4LXIA 2YS7A 3AEQA 4BQRA 1V9CA 2IP1A 1MO4A 2QL6A 2W6JD 1OT5A 3W9SA 4B7ZA 4DR3B 4RL6A 4ZRMA 2MT9A 5BQ3A 4NENB 2WSLA 5K9ZA 3HKEA 3AOEC 4OFWA 2QLMA 1UIMA 5BSMA 5JYCA 4KE7A 1KJ8A 2J9YB 4BQPA 4IHKA 4YJ2A 1O8BA 3AEUA 2QG6A 3RTCA 3LWOC 2G0NA 2QNBA 3ONDA 4R2JA 5REQB 3DFMA 5FA8A 3N6RA 3LWNA 1QO7A 2DUWA 2OFXA 5GOZA 1JEOA 2HP0B 2C7QA 2CWDA 1RM4A 3WXMB 4NH4A 3BCHA 1ZEMA 5IC4A 1HM5A 3UAOA 1AN9A 4TMVA 1MVOA 2FUEA 4FMPA 4MVJI 1SUEA 1WOMA 1XPJA 2WY2D 2Z2JA 2HU7A 5L4LA 5F1YA 4UE6A 3GLVA 3FCEA 3F1LA 1BEUB 5DGDA 3CUKA 5BYAA 1ULZA 3N28A 4ZTZB 1NDHA 3M2PA 1GQYA 2EKQA 3CUEF 3F73A 1WCWA 1UBJS 4TRMA 3VDMA 2Q5JA 3VNQA 1XYGA 5J2UB 1XKXA 1UFQA 4WESB 4LBVA 1TYDE 1ECGA 3KSZO 4RESA 5EY5B 1E1MA 3SQNA 3ZIAA 2P2YA 2X7XA 4BV3A 3WICA 1B8NA 4UZEA 4CPDA 2GCOB 5H5JA 4D9KA 2PVCA 5H0IA 1A9RA 4K0RA 2UYNB 1V8ZA 2REOA 4JHXA 4DQ0A 1V9LA 4HJXA 1PT5A 1QG6A 1T9DA 2WSBA 3B7PA 4UMFA 5ARCA 4J76A 3D00A 3UXYA 1K2WA 4BGUA 1G60A 1H1LB 1MA3A 1P8JA 3HN7A 3P4EA 4OCZA 4XUEA 5DH9A 5I6DA 3KJJA 1LS1A 4OK6A 3ZZ0A 2VJCA 4GZMA 1ZRNA 3N0VA 5LJLA 3S8MA 2L18A 3AY0A 4KQCA 1ACLA 1XWFA 2PKWA 3QPAA 4L5AA 4LNAA 1RBZA 3VKUA 1E0AA 2VF4X 1CS0B 4OGGA 1FJHA 2F62A 2JHPA 3LXUX 4JA2A 4MUFA 3I4FA 2Y1XA 1HT0A 5DHTA 2ZQ5A 4O4IF 4G8BA 5DGTA 5EIFA 4QFDA 1HFKA 3HYRA 4BNZA 4RJTA 3V2UA 2WG1A 2AOVA 3H1GA 1JH8A 3I6QA 3GRRA 2IHUA 3EG5A 4W99A 5KIAA 3H11A 2BE9A 1T5DX 3DAOA 3H9BA 3KZXA 3OE5A 1K6EA 1J8DA 1D2CA 3VAZA 3IQDB 1YNOA 2FEMA 2B1IA 3I6BA 3OLWA 5EGSA 5TY0A 4US2R 4R7ZA 2G5CA 2IU4A 2UDPA 3HUDA 1I3KA 1ADJA 4U0JA 1QVFF 2XKJE 3NDIA 3PXGA 3TMYA 4M60A 4NCJA 4BMCA 4PANA 1RYHA 2FFBA 3DOJA 3HZHA 3EH2A 3CCLF 3QMWA 5CB8A 1EUCA 4QLBA 3MCWA 4MVCA 4YH1A 5C8XA 2HW8A 4LBWA 2INGX 1OI3A 1P9OA 2JIZA 2IYPA 3KBBA 2OMEA 3AHGA 4BHTA 1H6BA 3TW6A 2FZKA 4IJMA 4OHCA 3FVTA 4ZOCA 1F9AA 1SCQA 4O33A 4XJTA 2AG6A 5KC9A 5EVJA 3FWNA 1XVUA 5DF1A 1B26A 4UTRA 3WB2A 2PMEA 1N6IA 5FF9A 3J7AC 2HA4A 1BROA 2YASA 1HTWA 1YB2A 1VG1A 2AOUB 3OJXA 4WHMA 4X7MA 3L4KA 4CKWA 4RD3A 5IG2A 3ZD6A 3QPUA 1ADBA 3V2GA 5KYVA 3K0KA 1BHO1 1C0IA 1RWNA 2A9KA 2AG5A 1V8FA 1VMAA 1YUMA 1BWRA 3K32A 3GRUA 3PSHA 4KQWA 1CY6A 1DMRA 3VVCA 1IDN1 3H5LA 4YRGA 3PTLA 2BBOA 4EVQA 5FAKA 3ER9A 1OE0A 3RQSA 1N8RH 1DBQA 3CRVA 3G8DA 4OLJA 4QQRA 4YLEA 5AVSA 5JBIA 3SZGA 1SXQA 3BD8A 2N46A 4CM7A 1IRXA 3TVDA 1XMQB 3OVMA 2ZIUB 3M9LA 3IBYA 2FWMX 4BZQA 2NXCA 3IP7A 5I3ZA 5DTMA 1N3LA 3HCCA 3TQSA 1GZSA 1C9MA 4EA9A 4DLWA 2ORWA 2YWCA 3H5NA 1E1YA 3VSEA 1E0SA 1K88A 2PRKA 1E20A 1DOZA 4N3BA 3ON5A 5A0FA 2BFBB 4MW1A 2NSDA 1UP7A 2JB9A 2O1WA 2QX9A 3Q3CA 4DZRA 5BWNA 3NWOA 4ZVLA 4OFBA 3PB3A 5EPOA 1M6WA 3JD3A 4RLSA 3KJIA 5EE5B 3MJDA 3GEEA 3ANLA 3HUFA 2IYWA 5E4TA 3M6FA 5CXSA 2YCBA 1Q91A 4INOA 2AD5A 1Q3TA 4XA8A 3VIUA 1GTMA 5TT0A 3GRVA 3F4KA 3QJGA 1L5YA 4V38A 3EXG1 4Q02A 3HJHA 5B1DA 4E1VA 2CHVA 5KNCA 4FLFA 1JXOA 3P2OA 4QFCA 4Q12A 3L79A 4Q47A 1OFHA 2D4HA 2OHXA 4LF9B 2QN9A 5H80A 3K0CA 4A82A 4JI4B 1RI3A 5BPHA 1J0EA 3LYHA 3ND7A 1UJMA 1BKDR 4QDUA 4AJ1A 4OHFA 4S04A 2GN2A 1K27A 4BW0B 2ATIA 4YAKA 3LDGA 2CV0A 1YR1A 4MS1B 2PCLA 3W1VA 3D8UA 4QZVA 4I4TF 3RREA 3PR2B 2AMLA 5H8WA 1YFLA 5AFSA 3DOUA 1VQ9F 1VQ8F 4KLCA 1O95D 1U3LA 1EWYA 1JN1A 1ORRA 1W96A 2GPTA 2X40A 4C0SA 2J0EA 1S72F 4MJXA 4G9EA 2PU7A 3D2CA 3RKUA 3AWDA 2O0JA 4KO2S 3LBNA 4E13A 1XRNA 3ZV3A 4BUJA 1XMJA 5CM2Z 4HT3B 5GZ1A 3LLCA 4Q4HB 1Q14A 1X38A 4Q4AB 1O6CA 1QYXA 5AJVB 4GQAA 3N7TA 1KDYA 3C8ZA 3T5DA 5LDDC 2XOXA 1NXTA 1YNSA 3KXKA 5K5EA 2J08A 4R69A 1HNXB 3A6KA 3IOMA 2WJJA 2CSLA 3R7FA 2XUAA 3REGA 4D5GA 1IONA 2XVMA 1PSZA 3BKXA 1MP0A 4D8XA 1B0PA 3L0SA 4N01A 4INZA 1QX3A 3TTYA 3ZG6A 4EKGA 2ZBEA 4UQLA 1G4UR 1WCIB 1YVRA 3ELWA 1HXHA 2AZ4A 4PE5B 2NMVA 5ESDA 1OI7A 1NOKA 5AKHA 2X0KA 4I19A 4CMIB 4NOMA 1SUBA 1Y4ZA 5E6UA 1YS6A 2NNWB 3KHNA 3HKDB 1QVVA 3VDRA 5IP5A 1JVSA 2ZWAA 4YQFA 1WSDA 5AW7A 3C7CB 2VT2A 1B93A 1UQTA 2VP6A 3GJ7A 3FBTA 2WHYA 4HUQB 3ORFA 3SHOA 1ULTA 2BGGA 5BSVA 4JMLA 3RJTA 3DCJA 4DCVA 1A98A 1FFDA 2C8VA 2JEZA 3TLGB 4ZDKA 1GDHA 3BPSA 4I4LA 2PQ0A 1V8DA 4WBNA 2WTAA 1BDMA 4I14A 3IELA 3L8GA 5ALIA 4N0QA 4PHGA 6NULA 3HP4A 4CYMA 2IVFA 4J91A 4L85A 1ZLXA 3IEXA 4XWKA 2XTJA 4EF5A 2D5IA 4C06A 3IODA 3GYBA 3KKZA 5KOYA 1A7AA 3HDYA 4MLDA 5M5BA 3OTQA 3S44A 1TYZA 3AFOA 4UM8B 1BEEA 2W2NA 5DSZA 5BOSB 1D2EA 1HNNA 1P4SA 2WSSD 1W48A 2HO5A 4L9WA 1JUDA 1C1DB 1OLSB 3A31A 1DB3A 1GIAA 1LS6A 3H5OA 3WLQA 1Z6AA 3SZUA 2ZYWX 1P60A 2HPHA 5E7MA 1SULA 5C5CA 3FOFC 1NOIA 3EK2A 3H8VA 5PGMA 3ZK9A 2YIMA 1ILWA 2XWSA 4HAXA 4K1XA 2YL2A 1EFVA 4K6MA 521PA 4XVCA 5EJ9A 2JFUA 3BTVA 3CH7A 3PIIA 2I4RA 2WZBA 4B7AA 4KRFA 1RLTA 4INJA 3LCVB 4S2EA 1TF7A 3A1UA 4DIEA 2K4MA 1YCGA 1CT9A 2QQ0A 1N0WA 3KIPA 1XZKA 4MV0A 2EBUA 2VHZA 2ZBRA 3OKCA 1OWNA 1RHJA 1RPTA 1QLHA 1KZHA 4B6FA 5JATA 3B6NA 4YAJA 2H63A 2W4MA 3TYXA 2O2XA 3OBWA 3JR7A 1WOYA 3KBOA 3KKLA 3NBYC 4DCOA 4LHEA 1U31A 3P4UA 2GS9A 4OHBA 1NW8A 4H6WA 4NEHB 3EEQA 2OLJA 3FETA 4HB0A 4K2HA 4OAOA 4ZQBA 1P0FA 2HK8A 5JZVA 5K0BA 2WHRA 4AZ3A 3ZDZB 2WM2A 3K0SA 5AI9A 1HL7A 2AN5A 2GK7A 2Z9CA 3SS8A 3W8FA 4GYKA 3NT5A 4M38A 3WSWA 3B12A 3L7NA 2RJNA 4RF4A 4CCYB 1NBOA 1HA3A 4URUR 3N87A 2ORYA 4R3UC 1FMTA 1CU1A 2WUVA 3UATA 5JDCA 5BUQA 4BJ6A 5JH7A 4UREA 2JLUA 3EZXA 1YBMA 3I72A 4FYIA 3KQUA 4Q1BA 3FN4A 1OXSC 5HWEA 3BMQB 4Y3UA 2EW1A 3AH8A 1YTLA 2XMGA 1XQWA 2FG7C 1H0RA 2CUNA 2PRIA 4F7WA 5EZYB 1CUIA 1VE1A 3LWRC 3AYXB 1NVBA 1P2FA 1ADYA 3K0AA 3MJTA 3HY3A 3O1HB 3RU9A 3LBFA 3WRWA 3B6ZA 2YFYA 2GN9A 4GPAA 4DN6A 2P6UA 2A9RA 4TXNA 3VI4B 4CL8A 1T4DA 3UUEA 2G0TA 2E21A 3I73A 1BC5A 2RI6A 3CLSD 3K8QA 1V5GA 3PQ7A 4JJ4A 4XLZA 4C4TA 2GCPA 1EFKA 3UYLA 5KX5A 1LK0A 1SUIA 1SCBA 1NASA 5FI0B 3OI7A 2QQ5A 3HJGA 4KR9A 2HA6A 4D3SA 1AZTA 4Z4CA 3QLVC 4OBBA 4BNHA 3D5TA 3DO6A 3OC6A 3VAAA 5IKEA 5IN4A 3KEFA 3QJYA 4BT5A 3CMEF 1G4HA 4G56A 4XWGA 2FPMA 5G0VA 5CT9A 3VPDA 5KDOA 3IESA 1UPCA 1VPWA 1TUGA 1X1SA 3DBOB 2MOKA 3HXMA 1NP6A 1E4OA 1WXDA 2MYNA 2QN8A 1NMSA 3HN2A 4MHSA 4B48A 2PL5A 4DPKA 1YL7A 3TGPA 4KR2A 1E4EA 4P6VF 4NI5A 3AHIA 3WLLA 1T3LA 1F5SA 1YACA 2WU0A 4LRUA 1E7RA 2QBYA 4C7OA 3W2TA 2F8SA 2Q1WA 3O94A 1X1QA 4I3HA 1XKLA 3FDFA 4BASA 2FWPA 4MGKR 3GLKA 4IJKA 3WR5A 3TKYA 1HZZA 3PUIA 5BUSA 2P69A 4W1QA 2DGDA 1I0IA 2EYQA 2Q4OA 4H18A 4M0MA 1S4MA 1SY7A 3SXUB 3VR6H 3JQGB 5JZBA 4PAOA 1WZIA 1Y6JA 4MGHA 4JENA 6ABPA 2JW5A 4WZBE 5FI1B 2EKLA 3M84A 1YKGA 2D54A 2ZJ7A 1VE6A 4D3YA 1EFPB 1PV1A 4LWZA 4PBTA 2A94A 3CF2A 3KZNA 4ND8B 1CRZA 4MZXA 1N2CB 4HLUA 3SEFA 1I5RA 4A8TA 1K4KA 3IDZA 1AQNA 4K05A 5JJBA 3SR3A 2QXYA 3T9EA 4ZXPA 4ZK2A 5BQFA 2WD8A 5AI0A 1W7AA 2P6NA 3FRHA 3O8QB 4UZSA 5E1DA 3TLEA 4UTNA 4G86A 3COJA 3QNUA 4XQ9A 1TT7A 1V6SA 2QRUA 5EP4A 3SI7A 3PE3A 1G20E 1Z17A 3OPQA 3QEBZ 3LL4A 1RCUA 2JBAB 4EJFA 1ZDMA 2LUOA 2I55A 5ESRA 2GK3A 1CVRA 5EZ5A 3RYIA 4RFSA 3LZ6A 5FV7A 2W2OA 4LMRA 5D7BA 1DXYA 3RG2A 3TRHA 1RXUA 1U3UA 1N2JA 1KHHA 5BT8A 1EFTA 4A8JA 3RYHA 1UT5A 4MUYA 1BMTA 5CW2A 3LBIA 1X19A 3QVWA 2AC7A 3PT5A 1UF9A 4W5QA 1X1RA 4F3RA 2XCTB 1XTIA 2Y3IA 5KOJB 1NZDA 2ZJ1A 4OSEA 2PRYA 2GHQA 4MPDA 4ENWA 1T9KA 1HT3A 4DW8A 1BFDA 4PPFA 3EXEA 3GMSA 1AF4A 1W94A 4LE1A 1QKIA 3PITA 4Q3KA 4NX2A 4ENUA 3K9FC 2DUMA 3B5JA 4HAVA 4K9RA 1E6UA 3DZBA 1MUUA 4B8ZA 1XELA 1KAGA 4FZVA 1LV7A 2QN1A 4XB1A 1U7HA 1DDOA 5JD6A 4MYRA 4WLUA 4EEZA 3TVTA 4CKCA 2OE2A 2H0AA 2A1IA 1YA4A 2PJZA 1B8VA 1MC1A 2IXBA 2VSYA 4XIFA 2W00A 3EXAA 4XRRA 4HNUA 4KJXA 1POXA 1JLLB 2WYWA 5LU8A 1KOGA 2OENG 2XR1A 1ZIOA 2GZHA 2ZUWA 4YP6A 4TV9A 1WF3A 1AGPA 1IMOA 5BQPA 5B6JA 1W2HA 1ZGJA 3JQFC 4QTTB 3ADCA 4GF5A 4ODIA 1J33A 3MW8A 5BW5A 4TYQA 4R2MA 2CDRA 3UAXA 1XHOA 3T7KA 1TU3A 1QQTA 2JCVA 4P3KA 4ZV4A 1RE0A 1NBMD 3OESA 4MJ3A 4OM7A 2O8EB 2FC3A 3MWYW 5LBIA 5C1BA 2V3WA 2YWGA 3EQ8A 2YWHA 4EPYA 5JC8A 1MX1A 3UN1A 3OEEA 4LJRA 1KK0A 1TE2A 2W8BB 1IHYA 4DIBA 4I6GA 2ZRKA 1E77A 4OQLA 4A03A 3QSYA 2AQ8A 4MUBA 1XRGA 4XIGS 1SHUX 5U1PA 4PN3A 4YX9A 5BPFA 1PS9A 1VHTA 2RARA 1XB2A 3BC1A 121PA 1Q20A 2HIMA 3GFTA 4MV8A 1E96A 5AJZA 1CEYA 1KP3A 1MORA 2NTYC 3NC1C 1UKVY 1MO2A 1WPGA 3ZIUA 4A8JC 3GNSA 1E1QA 2Y0EA 2OCKA 4MJLA 4BS9A 2XB2A 2MJLA 1FFEA 2QRNA 2Z2YA 2J4DA 1PK7A 3PL1A 5AJWA 5G4KA 5EJ6A 4DQDA 5AJXA 3T9AA 5FNVB 4BATA 3DFFA 1W88A 2JGKA 2OTLF 3EIOA 3AGKA 5AI4A 4O2BA 3F47A 1OA0A 3DB1A 4RJ2A 1I9CA 2TMDA 2Z5VA 3DDOA 4HUTA 2FGYA 2P91A 2VDRB 4HDNB 4LJ6A 5BYBA 3UJBA 2VYNA 1MAUA 4QT0A 3X1MA 1IY9A 4FR5A 4MKGA 5DPMA 4KR3A 1CJSA 4Z7OB 4W5OA 1YBAA 2GA9A 2PTHA 1KVRA 2L17A 4FWIB 4D8WA 1M2EA 1B3BA 1RJFA 2O8NA 1C80A 1YL6A 3D4PA 4KLRA 5I4KA 1I94B 1EE9A 1EX1A 1NQVA 4MUHA 3G82C 4PYNA 4GBMA 4DVGA 4RK0A 1P5ZB 1F2TA 4IXDA 3BREA 5H81A 4X66B 1Z83A 1WZEA 3ZW9A 3NI2A 5FOXA 4C81A 3LPCA 2ONKA 3OY7A 2Q6LA 4XEHA 2AJDA 3DAYA 2W58A 5FA6A 3GC6A 2GZMA 3P9XA 1N5LA 2VAXA 3COZA 4IVNA 5C5IA 3AIKA 4HDMB 4I8XA 2P5UA 2G1JA 2V54A 2YJTD 5EXTA 3PCXA 1QVZA 5JD3A 4EI8A 3VM6A 3WKAA 1AK1A 3BB3A 3D0RA 4ZV9A 4BKRA 4EJSA 3HU3A 4E6PA 1ILEA 2SNIE 4NHEA 4AURA 5L7WA 3SZLA 1WJGA 2VC2B 4IQ0A 1KBOA 3TE6A 3QWHA 4HFJA 3LFUA 1ESEA 3IOEA 5EZYF 4NDAA 4AQYB 1Z6PA 1E32A 1CUFA 3PXAA 4G36A 4IGAA 4LJAA 4DY6A 3NK6A 1XZBA 2IP2A 1IN4A 2JA2A 2VWHA 3OF3A 2O14A 1QSGA 1Z45A 3C3EA 3STVA 4X92A 4PBSA 5JAHA 5JJKA 1KI8A 1YGYA 4TVKA 3WWZA 1WMAA 3GGOA 4B47A 5B53A 2OV6A 1E3DA 1J0XO 1XTBA 5AOBA 4BUZA 2GFIA 2FXVA 3V4DA 1LDEA 1P31A 1G6OA 1RC0A 4TXJA 5CTAA 4K3VA 3NUQA 4DSUA 4ZIRB 5KSPA 5K6AA 1XALA 4UUAA 1J9ZA 3K8OE 1QZTA 3DEAA 2V3VA 3B78A 3N8GA 5F5LA 3S2IA 1VYUA 1KO1A 1SGWA 2FFAA 4FR2A 1U3CA 2RD2A 1IG3A 1UZNA 3WGYA 2WZCA 2C95A 3PQ3A 2FXIA 1AG9A 1VRCA 2C8JA 4D4IA 1P0QA 1JPNA 3OOHA 5A4KA 1JSCA 5FUVA 3E1SA 2M9MA 3I5AA 3RHFA 2CNKA 5K3EA 5EQDA 2A5LA 2J48A 3J7TA 4ZZ1A 3D6JA 2FSHA 1A0OA 5KQSA 2QTWB 4FKBA 4EMSA 1PJ8A 1TFRA 4UW9A 7MHTA 3E5MA 4DR2B 3KU1A 4U00A 5K3BA 2IE0A 3O8OA 3CZMA 2OHJA 1WMEA 1TCCA 3UCXA 1Z4IA 4AUKA 2Y0DA 1C81A 2PZBA 2R5NA 4Z9BA 1O0BA 4J16A 4MYDA 2CLHB 1YV9A 2CFRA 2W8ZA 2ZE5A 4H3KB 3UJ3X 4DCTA 3CQ9A 3GN1A 4INPA 3TCXB 4MYTA 1DLJA 2K2QB 1OC2A 2ATCA 4V24A 4X6XA 4PPQA 4GLLA 3QQPA 1NMUB 1CP3A 1M34B 1KK3A 3ND6A 4NWIA 5JMTA 2CLIB 2C2BA 1IZ0A 3NFYA 4Z4QA 4WMLA 5FTMA 2V6IA 4BNVA 1ZD8A 3D4LA 3JQ7B 3SYNA 4CLHA 2XDQA 4WK0B 2W22A 3FPHA 5A7GA 3TZBA 3MWFA 5KS2A 4AUMA 1E2HA 5BQXA 5G0WA 3TW8A 4TUYB 1WB9A 4L2IA 5H02A 4MX8A 1KDVA 5I4CA 5H83A 4R84A 4RPCA 1PJAA 2YWRA 2ZWPA 3G2LA 3S2YA 2GPYA 3TGWA 3UY4A 5F2NA 3OZGA 4IDGA 4OREX 5A2QM 2Q4EA 4ZU3A 4O4HB 5JG7A 2E4UA 3AIMA 4ZZ0A 2DHEA 4PVCA 4I1IA 2YC4C 2EFJA 4Q4JB 3WWDA 4MRMB 1L4MA 3VZRA 3C2QA 3AUUA 1UMDB 2IY9A 2Z58A 3G0DA 4GBGA 4GVXA 4NMHA 4EAAA 4FOPA 1XV2A 2EGHA 2G4CA 5KYUB 2IU0A 5KSZA 1OMOA 3R0JA 5HQJA 4TV8A 2YMMA 1E5DA 2ZXUA 3LA6A 3VO1A 4FN5A 3JQEA 4KOEC 3IPYA 3GLIE 2QSJA 2PXXA 3F6PA 2B4TO 1X7WA 2BTOA 1U80A 3OM8A 2WTNA 3H2ZA 3DVQX 2VZEA 3A4IA 1H2WA 1TJYA 1BDIA 4PR0A 1TYCA 3AC0A 4JFAA 2XAUA 3G13A 1DAMA 5FFNA 1ONPA 2QROA 1QPGA 4G41A 2ECQA 2VNAA 1ESCA 3N4YA 3GMIA 3LFHA 1SU4A 1IM2A 3DAGA 3BS4A 4O5AA 1E9CA 1JX6A 1CVLA 4PSCA 1U81A 1Z0IA 2GARA 3IS3A 1YR8A 4J16C 4LTMA 1GVNB 3WDMA 4FP9A 2WW8A 4YMWA 3I8OA 4MHTA 3F0DA 3QY9A 3DE4X 4Y2YA 5EMKA 3GXOA 3A0RB 3CNBA 3LUGA 1NURA 4MAAA 1RPAA 3N58A 3K9WA 4FFBA 1L8AA 2ECOA 1FDSA 3IMFA 4PFKA 4WDQA 3RVLA 1CZLA 1CJTC 4C78A 1RJWA 3O75A 1GQFA 3PFWO 4G9GA 5KHOC 1T91A 1JI0A 2XWBF 3WL3A 1J09A 1KY5A 1QH8B 3KXLA 1NUQA 4Y2PA 5GJBA 3JASA 3TFWA 1ZU4A 3ND8A 1VL5A 3MT7A 4F21A 5IF3A 2CYAA 3K16A 4ZDJA 5T8KC 4O4LF 1HDGO 1UXKA 2OC9A 1DWOA 3OHSX 3B6EA 1J25A 1CR1A 1L5VA 1UC5B 2XPCA 5HR5A 1K9MH 4FC7A 1WP4A 3QVKA 2YZMA 1RRMA 1CNMA 4CDMA 3KCQA 2NW6A 1T1JA 4XSVA 3KYDA 4HVAA 1RMTA 3ODPA 3O4IA 4M8SA 1JJIA 3TX6A 3TLZA 1LVHA 1Z5NA 1Z0JA 3CF4A 3G7SA 4I6JA 5AVMA 3ST7A 4RD4A 4FHEA 1QPBA 1S2GA 4A8PA 2KLHA 1AURA 2XXBA 5KI6A 3X3HA 2ZAMA 2GQ0A 4ZVOA 4B3GA 5FNVF 3STUA 1AUQA 1VJRA 1H0HA 1TA9A 3VXKA 4BO0A 2CNOA 3OFJA 1MT0A 1SVSA 3I83A 1LFAA 1WHTB 3F7OA 2PWPA 3JSXA 2YJNA 3I6YA 4FSHA 4H1VA 4IIGA 4X45A 2X0EA 3SC2B 4AO8A 1JT2A 4FE7A 1QIEA 2OV3A 2WJGA 3OIVA 5FQOA 1GWNA 3V2IA 3D3NA 3DV0B 4FHFA 4IZHA 4ZEMA 3W5DA 2BMVA 2HF8A 4XLLA 5G3ZA 4U3JB 4L4YA 2HPZA 4K9NA 4MROA 4RAOA 4ND4A 4OH1A 2AFHB 3I2GA 1XTRA 1CRPA 5B12A 4LGMA 5G0TA 3KOUA 1XROA 5D8DA 1HI9A 5HX7A 2WB2A 2IXFA 4C7JA 1DQZA 2QPOA 4GUDA 3IEIA 3KOXA 2JCBA 4OXKA 4JC0A 4EHAA 2ZJFA 3ZCUA 1X42A 2AC4A 3G8AA 3IVAA 3D9QX 4XDYA 2Z04A 3JAMM 2OO3A 2H57A 2HC9A 5F51A 3O4FA 3PLNA 3PVSA 2AHOA 1KYWA 3JAWA 1GXSA 1G8HA 4P31A 3HGMA 2JHGA 4KIWA 1FFCA 4HP8A 1A9OA 3OBIA 4LOHA 3RU3A 2NZJA 3T7CA 5EIBC 3NHPA 1XZEA 1VRWA 1YFZA 4WXHA 2W70A 2BGKA 2VSFA 3H4TA 4NP6A 4ZC1A 2O07A 3F6CA 3LG2A 4B44A 4JI5B 2JGRA 2ZZNA 3U09A 2WNSA 4EG8A 4XJVA 5LDHA 1AS2A 5AI5A 3K94A 5J5CA 5EFZA 5CU7A 5DM60 2R6HA 4GRIA 2BFFB 2C4VA 1B6GA 2P27A 3ESYA 2FJUA 2JLBA 1TADA 1W44A 1ZCJA 2JCYA 2YDYA 5AVJA 4DOMA 4YRMA 4MWBA 1EMDA 4MULA 4CF3A 3KCNA 2JD1A 3BD7A 3HFJA 2PFGA 3OZBA 5EVCA 2NU8B 3LI2A 2J5XA 4Q48A 3QPCA 4BJHB 2F43A 4OIFA 4TGLA 5GGXA 1PBNA 4EHJA 2IZ5A 2FN3A 4HLDA 3V1KA 1GHTA 3HWWA 2G80A 2SKCA 3Q2IA 2PUTA 4GXRA 1RJDA 1R66A 1WLSA 2FW9A 1O9GA 4GQBA 3LVRE 4GO1A 5HKOA 4LX8A 3H1PA 2AI2A 2F3UA 2IYNA 4N39A 3RS2A 2BGUA 2H2IA 2YWEA 1CK4A 1SUDA 1JJAA 2Q2OA 2ZDQA 3QVTA 4U9UA 3T15A 4K6GA 1J2RA 4TX1A 1A8IA 4XWTA 1C14A 1QGUB 2GBLC 1F8UA 2CJWB 1P1CA 2V6MA 1QZUA 2P4EA 3VO8A 2YRWA 4DF3A 4HAUA 4JBHA 3LRTA 3AVPA 4M9ZA 4JY7A 3U9TA 2HBQA 3COYA 1EJBA 1ZJ4A 2JH3A 1ND6A 5CXXA 2F3SA 4E22A 2QTZA 1VECA 2FNAA 3JD4A 4Z1MA 5B64A 1TIKA 2XMPA 3OEHD 4L3VA 3LWBA 4E32A 4IEFB 1QHFA 4IHAA 2K1SA 1NJ2A 2ZTUA 4EY3A 4D3FA 1G6Q1 3AR5A 4HC4A 3VDQA 1Q7GA 3GCGA 1H47A 5AXAA 1Z2PX 3AM5A 4MV5A 4QOGA 1OZ0A 1JR2A 2PIDA 1N9KA 3KYCB 3LX8A 4IRXA 4PC7A 4QSMA 3HYLA 3I6ZA 2G8NA 2PGJA 4YJFB 3A3OA 2XNHA 3VJKA 4TUYF 5B8FA 1F51E 3C70A 3H2SA 3P0JA 4KRXA 4PIPA 2ZI4A 3EAFA 4MRSA 2NIPA 3GT4A 4F5YA 3RKSA 5A2GA 1YZKA 1RKUA 5B5SA 4IMJB 3BK7A 3HBMA 4NV1A 1N3IA 4O4HF 3L02A 1HLGA 2MR5A 4G5OA 1UDXA 1AGRA 2WKWA 2AHRA 2I7VA 3E3OA 1RI2A 3HJNA 4RHFA 3URKA 3WHIA 1VDMA 4BZXA 3OTGA 4NMWA 4WK4B 5LMNB 2O2ZA 2ZBDA 2BEJA 2QL7A 5BSFA 2UYYA 4CQMD 3QUWA 1B41A 4PCVA 3CWQA 5TPZA 3TDKA 3TUIC 1N2IA 2AKEA 3SX4A 4JYBA 1U0GA 1DKMA 4DCCA 2XJ4A 4OHMA 1CZUA 4R1UA 5A3SA 1H3EA 5DYYA 4K7JA 1DJLA 2ZKLA 4CEHB 1JKIA 3HL4A 2E49A 2DECA 4OQFA 1OVGA 5CVEA 5LZ4A 3ORYA 5K8IA 1TA0A 1LSSA 2YOGA 3MGCA 4KCGA 3OAAD 5K05A 4GIBA 3VNAA 1ECCA 3KT8A 1SIUA 4ZCMA 1GG2A 4R9VA 2PX4A 4QXPA 4AI6A 4JJIA 5LZ2A 2Z1UA 2AC2A 3R7WB 1TTHA 2ZIVB 2Y2UA 4ETMA 3UJAA 1JR3D 4C0BA 1NJ8A 1BYUA 3DZFA 1MAAA 3S0WA 3AR4A 4F56A 4PGAA 2VZ9A 1BGXT 1K6IA 2RAVA 4Z9YA 5CEFA 5JAPA 1ORTA 3D54A 2GEFA 3CNNA 5H3CA 3K9QO 1QAOA 2ODNA 4RA6A 5A5GA 1R0YA 3AFNA 1ES9A 1GU1A 3AEXA 4OQQA 4P84A 1VL0A 4RANA 4UVHA 4YHBA 2H51A 3R7LA 1THMA 4KVFA 1YOVA 1Y5NA 5KQRA 4G85A 4QXMA 4S3MA 2N47A 1NAIA 4EYSA 4YBRA 1Z0KA 4HGRA 1SBIA 2R8BA 4WA8A 5KJ6A 4AZ0A 1QGYA 4HEJA 3WGNA 3WIEA 1XQXA 1NE2A 1CNFA 3W0LB 4HDCA 4RV4A 3DTVD 4QEZA 3OQMA 5GTDA 3NX4A 1ESNA 1KMQA 2GBCA 1M1YA 1LK5A 4M83A 4DLAA 5JISA 3RIEA 3JQAD 4P92A 3V32A 2H4YA 4CLOA 3MERA 5EQFA 1Z3CA 3AR7A 1KQGA 3TGLA 1MO5A 3QOFA 1QFJA 2H9AA 3HUTA 4C89A 1UOQA 1L1EA 5H82A 3K70D 2QPTA 1YRWA 1RLGA 2FOXA 4BQQA 3R3WA 1SUWA 1QO9A 1SCUB 1OKKD 4L76A 4X8MA 5DW3A 2H8EA 3CC2F 4RCZA 1EQUA 4BLVA 3LFTA 4XGQA 1V47A 3KJFA 3VBCA 3KOMA 4PZCA 1W5FA 3ACBA 3GTZA 2QA5A 4FLMA 4TMZA 1TVMA 5DCWA 4EJSB 4GWLA 4NIMA 2IIVA 3IRUA 1N92A 2C4MA 1T9ZA 4BNYA 721PA 4DSTA 3DH0A 1AUOA 5AI8A 4KKXB 1DKQA 2XTZA 3EFOB 4D45A 4J3JA 3VGPA 3CCVF 3VPBA 4DC9A 3H1BA 4RVFA 4DM4A 1M66A 3FYUB 4ND6A 3NXSA 1OPXA 1NXQA 2IKSA 1WMDA 4OYYA 2LCFA 1OREA 3JYQA 2PT6A 4OQEA 4EG6A 4F2HA 1P39A 4P3XA 2C88A 3LW8A 1JIKA 4YPFA 4C4PA 3IEVA 3JW8A 5DTIA 1ZN8A 5HKBA 1E4YA 4YDSA 4AROA 3IJ5A 4GM4A 1IWPB 3R0PA 3P2MA 4LHYA 3I58A 1U65A 4QARA 4F4DA 4F60A 5BVHA 3QLUC 2F67A 1NGSA 2J3QA 1FX0B 2MDTA 3DONA 3L7DA 3PUJA 1LF5A 1FDUA 2NU6B 3OQJA 5IKOA 3ERCA 1GEEA 1H2HA 3EZ9A 3TD9A 3V8EA 4M0UA 3IKTA 2PN1A 3NXKA 1QAHA 3OE7D 3T5PA 3I30X 3OIUA 2H7XA 3DXFA 4KDRA 4CM3A 2BR3A 2BGTA 3OTIA 2W0SA 4J2HA 2FPUA 4TMTA 3QUQA 4ARUA 2CFCA 2FZ4A 3L4BA 1P4AA 2BTQB 3KYIB 4Y30A 2RMKA 2I7CA 3IQZA 1DRUA 1DT5A 2H5IA 2IYAA 3BWMA 3NO4A 5CDUA 2X23A 4A6PA 1SZCA 2D2EA 3EPLA 1QQBA 4G89A 2I7DA 1Z73A 4NPHA 4QQKA 8LDHA 3BE6A 5B37A 1DG9A 2J9RA 2R5FA 5MFZA 3CLTC 5COQA 1NJ1A 3BMNB 3KQPA 3UB2A 2C9CA 1GPWB 3EIQA 1HKHA 4KBFA 4AN1A 2Z1EA 2Q1SA 1AOXA 2WWVD 3BDAA 5C8DA 5KNDD 4U8HA 4P0QB 2GK6A 4Q9DA 2Y6UA 4D99A 2LTAA 4DM3A 3PGXA 3V7NA 2PUVA 2AN1A 2PSHA 1OWMA 2D06A 5DNVA 3UJ9A 1AUPA 2QRVA 2QS9A 1HRDA 2JASA 1VKHA 2G09A 4U2BA 1T3SA 2PGNA 2Z56A 4WRRA 4CM4A 2C04A 2QJOA 2QMZA 3R3SA 3KAPA 4G0VA 5GZ6A 4IIYA 4KPGA 1TB4A 2IZ1A 3VNSA 1DKRA 3IJPA 2GO1A 3PRKE 4UXJA 3T1HB 4KXVA 4RZQA 1JR3E 5DB4A 5ALDA 1GPBA 1IJEA 1WVMA 2E37A 1PBTA 3O83A 1F3OA 4G5HA 2MQEA 1CXZA 2ENUA 5E9JA 5ITVA 3IV6A 3E3MA 3PYMA 4N76A 4BFTA 4NCKA 4ITRC 1SXJC 5LA6F 4DB4A 5J5VA 4RDCA 1OV4A 5CCEA 1KI6B 4YQYA 2HLNA 3FCUB 1YDHA 2R7AA 3CR3C 4IICA 1LU9A 1V0JA 4CT5A 5LOVA 2R3SA 2XMDA 4KNYA 3V7EA 1UK7A 4K9MA 4IDEA 4IFEA 1KO8A 3HU5A 3FMVA 1U8YA 4V0RA 3CPSA 4JI6B 1A9XA 2BFCB 1CJBA 4F12A 3IDAA 3FDIA 4DNPA 4N5NA 5C7IO 3NVDA 2D6FA 4G4SP 5FR2A 1LA2A 1M34E 1MOQA 2FW6A 1PQYA 1XNJA 2J07A 2QXTA 4HDOB 4EA7A 1DT3A 1JFFB 4L6IA 3OZUA 1NLMA 3FZEA 4K9QA 2P7HA 3CSSA 4XM1A 2FW1A 1X7HA 3K0TA 3L4BC 3WISA 3WYBA 4EFLA 4F5ZA 4ABTA 1UEXC 1L5SA 1NN3A 4H7PA 3ADPA 3F1KA 3SEAA 1NJGA 4LSGA 4MA4A 1QD9A 2AEJA 3WBKA 2UVQA 3FOCA 4BBAA 3SN6A 3SKVA 1COWD 2F1IA 1JEEA 3LHIA 5DBIA 4N65A 2H5LA 4RH1A 3EZ6A 4PC3A 4BNKA 2PZJA 5FPSA 1GL9B 2WZDA 5DHAA 4DWWA 2B7BA 3WLJA 2WPDD 1YQUA 2D8MA 2DULA 2XNSA 3I2HA 5D3KA 3GZ4A 2NVBA 4WASA 3ZDEA 3HE3A 4B2IA 1TO6A 3RT9A 5BWOA 3IKFA 4TQGA 1ZBDA 2O2GA 2ERXA 2VDPB 2PH3A 1YZHA 2WDPA 3FOAA 2F8MA 3WMWA 2VQEB 1CR0A 1P6UA 2Y4OA 3BMCB 4JYCA 4TS1A 3SIVA 1TT5A 1WO8A 2WVGA 5EJ4A 3MOSA 3B48A 4PLGA 4C3VA 1UJCA 2HRYA 4B3TB 3KSDO 1XNQB 3AVQA 4L7QA 1P2GA 4G5XA 4MV6A 4IHJF 4MWZA 3QYFA 4OQ4A 3ZQ6A 4CTNA 1KAOA 2C58A 2X5KO 3H86A 4IUBS 1W1UA 3KFLA 4ARZA 3ZVKA 4G1FA 1NVTA 2ZRDA 5E8RA 4D8TA 2QB5A 3MCTA 2BEUB 4X1OA 2DEUA 4YWHA 2P40A 4PX5A 1PJTA 4ARIA 2BKEA 3FNGA 5D84A 1JEQB 3CUUA 1WDMA 1SQ0A 2B1QA 2C0PA 2I2AA 5FTJA 3BB4A 2YUIA 1PVDA 1Z7EA 1WBJB 1KJWA 1ZQ9A 3SVLA 1Z7GA 2Z3VA 1CY4A 4ZHQA 1NQTA 1HDIA 1BCSA 3B3QA 2OCIA 2A9QA 2JKVA 3G2KA 1PV2A 2GPNA 1T13A 3AB7A 4RIHA 3VR0A 3DM9B 1H2ZA 1W0KA 1Y5LA 3PNLA 3LYBA 5KEIA 4AJ2A 3EGCA 5EWJB 5LP6B 2EFCB 5ED4A 5IHPA 1Z29A 4H16A 3RYTC 3ZDDA 1GNSA 4HG2A 1UDBA 3OZXA 3E9NA 4E5NA 3L6DA 3PGLA 4HPWA 4FFPA 3ZVNA 2C5BA 1Z74A 3GJTA 1SVOA 3EEIA 4PINA 3RFUA 4DHEA 4MQEB 5C37A 1M0TA 1VHJA 4R81A 1YB7A 1WWKA 2AOTA 2KHZA 4BCDA 4LOLA 1DFHA 2D00A 3BGOS 3MLAA 3PD7A 4PZ0A 4B35A 1YIAA 4MS3A 3PDWA 1TPZA 2IQQA 3R23A 1N8KA 1JQDA 3CINA 2JFZA 1RBMA 4KDCA 5K4GA 3MSXA 4Q3AA 3U2QA 4DAEA 4PYRA 4CLXA 2JGLA 2WT9A 3GGGA 3MK31 4BGVA 4C01A 1PL7A 2QYSA 4N18A 2J46A 4LYEA 2QNRA 3VISA 5IKXA 1KR2A 5PNTA 4Q6WA 2RAUA 2B2XA 2XV1A 2F48A 3WQBA 1UBCA 3TLKA 3KX2A 2DFPA 4PX9A 3L7BA 4YQZA 5A5DA 1Y3FE 1R4MB 4DG5A 1YUNA 2HWUA 4QODA 4R2WA 2VDLB 1R2QA 2FSGA 4FHGA 3GFGA 4XPIA 3FTFA 3VA7A 1AMNA 2EL9A 3HXPA 4C14A 2Y2VA 5BV7A 1I4DD 3O2NA 2DFLA 2BJVA 4IV8A 5CX1A 3T4XA 3UKOA 3D5QA 3LA8A 1YQWA 1KEPA 5HM6A 1RXWA 3LGXA 2VJQA 4TKUA 3SFZA 2BN4A 3ET5A 4C43A 1PT9A 1KPIA 1OHHD 4Z6KA 1EAYA 1UPAA 5JFOA 3HYTA 3KYJB 2EKDA 3J80M 2WPNA 2CUZA 2V7WA 5LQSA 2KGWA 2AFHE 2YMLA 3WP1B 2ILVA 4B7CA 4EMTA 4IOJA 4M7RA 1C1XB 4GMDA 4NMXB 1N1GA 2VH1A 3JVHA 1WXEA 3HPRA 5C5EA 5AKZA 2RHWA 5ARBA 5K7SA 3ROGA 1J99A 3AR9A 4OLHA 1RJEA 2O2SA 1GX1A 1TMYA 3L6EA 3DR3A 1MBZA 3OO1A 2G5TA 4CODB 3O3CA 2ZQZA 5CH8A 4CR6A 3P27A 1L1RA 4FMBB 1YULA 1GRCA 3NBQA 3G9TA 5FPHA 3GLHE 3OFKA 1KSHA 1FNMA 1ZM3A 2EKZA 4OJNA 5JT1A 1YK0A 2DF8A 4J4HA 5LWQA 3TJMA 1LGYA 3IERA 3BHJA 4JI8B 3P94A 5AVRA 3ZW7A 2ZJ4A 4L78A 3TEJA 2H8CA 3Q11A 3E58A 5FHRA 3E3LA 3GUZA 3TEMA 4AN0A 4F96A 4MKZA 3OLCX 3KXDA 4BXOB 2Z1FA 3M6LA 2ZSUA 3AL0C 1VG9B 3U60B 2QL5A 3C87A 1E2JA 1SQSA 1S2NA 5K8VA 1FIUA 2AV6A 5HTKA 5CDSA 1N0HA 4F04A 2VYQA 4ZI7B 4IIJA 1U6KA 1WQ1R 1JQLB 2RK3A 3BFJA 3MMPA 3GGJA 4L5CA 4DNQA 4B33A 2XE8A 4NE9A 1LTHR 2XAAA 4JQOA 1DCMA 4NAUA 1CJCA 1NPTO 1YMUA 1WPXA 1H6CA 3FVVA 3LQRA 4MQ6A 4QDJA 3OCZA 9LDBA 3WGLA 3FSGA 3ILHA 1CUJA 1CQWA 3THWB 2VP4A 1ISIA 4S0XA 3OMLA 1NSTA 3V4VB 4WN9B 3A3NA 3HWRA 3E8SA 1EZ4A 1QWSA 3AIOA 1QTNA 1QO0D 4JJKA 1MGPA 4EB3A 3VGJA 4GG1A 1J7JA 5CTJA 4YCCA 5C8YB 4E12A 3E15A 3ESXA 4J29A 4QYIA 2OPHA 3FWZA 2WJWA 3AEZA 2VF7A 3GA7A 5EFOA 4XVUA 1U28A 3AJRA 3ICWA 2D1YA 4P2BA 4Q24A 2WSMA 2IQ5A 5HY2A 1ODFA 2WT4A 3QVOA 1DIHA 4G9BA 1XEXA 4LJ9A 4WL0A 5EUCA 3FXAA 2WV7A 3CPQA 1WUYA 1T2VA 2FQYA 4HJRA 1DUIA 1IZ8A 3NHWA 2WAYA 5AP9A 2BHSA 3O2SB 1FB5A 1U0TA 3TD3A 1KH1A 3K53A 3K35A 4FYJA 4JOBA 1ONSA 4XLTA 4MPJA 1U1CA 2D3WA 1DP4A 3AUTA 1MEJA 4P8RA 3EX7C 1N1DA 1U40A 1Z13A 2CB0A 3DA8A 2HT6A 4JL6A 4NV3A 3NANA 1BRMA 2QUAA 3PI6A 5TMDA 2BEKA 1SCDA 4FFNA 3FUXA 2BEVA 2J9XB 1E2UA 4PFSA 5HF6A 1EHCA 4BP3A 4GOOD 5HFAA 4BE4A 4YDQA 2VFAA 4HZUB 5B1YA 2FOIA 3ZCXA 2AEMA 2PSSA 1CW2B 3FFBA 1KEUA 5ADWA 3NBXX 3FOWA 5D51S 1R4AA 3PC2A 2AW3A 3QFTA 3A4LA 4F06A 4B83A 5AVXA 4ZYWA 2VT7A 5ALZA 5ICGA 2JI8A 4YACA 1E1RA 1FLDA 3KUXA 3BCUA 3ZQ4A 3I9V6 4AKSA 3PTAA 6LDHA 3P2IA 2Y71A 2CUKA 3E84A 4IIHA 1BN6A 5FI3A 3KB1A 5F98A 1II8A 1REQA 2AL7A 5EIAA 2PPVA 5IJZA 2Z4RA 1P9NA 3QYJA 1H3FA 5IVDA 2IH4A 3EVNA 2JHFA 3H2HA 3EAGA 4MH0R 3RA6A 1ENZA 2VGNA 4KQMA 4WCFA 2OM6A 3ZHCA 2ZYSA 3I1IA 4MIEA 4PSUA 2BO1A 1W49A 2R96A 2XCUA 5K51A 1NWHA 1B23P 5GJVC 1OZGA 1NHGA 5LQNA 2VNIA 1GNPA 2IKQA 2IOFA 1PZEA 2TMYA 4ZEXA 4YMLA 5IXYA 2Q3EA 1JSZA 1ULBA 1P61B 2C9DA 3OU6A 3ITEA 2Z1MA 4LRQA 4GMHA 2CBGA 1QLWA 1UBNA 5DM0A 1JS1X 2OBLA 4Q1AA 1NW5A 1UBOS 4UHCA 1YR6A 4ZCLA 4PVDA 1IN6A 4U7WA 3BXPA 2I6FA 3VVBA 2BY4A 3ZQUA 4DILA 1B4DA 1CJUC 3HS3A 4LF8B 1YITF 4LYGA 1RQ2A 3GRCA 4JR0A 4K9KA 2RGWA 4XR4A 5LP1A 4M9UA 1ZI8A 3BH0A 2HF9A 2HJHA 5DM70 3EJ6A 2ES4A 3DL0A 3N7UA 1OFIA 1H2YA 1JZQA 5LP6F 2P3SA 4L07A 1VQNF 2VAVA 4JVOA 4FGJA 5BP7A 4GBED 2AQKA 1GQRA 2FSUA 3JVDA 2IT1A 1GPDG 3WFIA 4WUTA 5HCNA 2HJSA 4Q1CA 3N2GB 1J2JA 2P6YA 5E9QA 4JU9A 4B87A 2R1ZA 2JJYA 3R5KA 1BXKA 5LQKA 3W5BA 1Y7LA 2YS6A 4N54A 1I7PA 2CMGA 3EXG2 3SIPA 5JAOA 5D85A 3GLSA 3NCHA 1RP1A 5JYBA 4AJPA 4MGZR 3QKRA 2NUAA 3MBMA 3OPVA 4L3WA 3GEDA 4DA4A 1JQBA 3CW8X 5TARA 1JV2B 3PE6A 3SSMA 1IY8A 1Y7TA 1BGWA 3HVHA 2VTDA 3SC4A 3LKVA 3ZDCA 4CE6A 1NMYA 2BH9A 1YHNA 4OKIA 1LF0A 1CYDA 5DBEX 3RU2A 3SPXA 3WLAA 3NASA 3QIVA 4Z4HA 3V3KA 4J0CA 3OUUA 4M2LA 2ZZMA 1TMKA 5JBQA 1CQJB 1W19A 3VYRB 5AYVA 9LDTA 2SCUB 1SQGA 4WCFC 5JS2A 621PA 1DIOB 1MA0A 4DBZA 1HX7A 1VLMA 1JG4A 2CHGA 2QWXA 4ZKEA 3WB9A 4CKBA 5AM0A 3RHZA 4DBVO 3TTSA 3ZJ5A 4J7AA 2JHAA 4DCJA 4Y0VA 1NW9B 2Z8ZA 5AVKA 5CB0A 2ZP1A 4QD3A 2J0UB 2RJOA 1M74A 2WWTA 3BIWA 3OLZA 4Z9FA 4O59O 4LFCB 5TIIA 1S96A 1FE8A 3WKDA 3FWKA 5HUHA 3O8DA 2VUHB 3D1VA 4X41A 4XI9A 1E3IA 1RZRA 2NPOA 3LV8A 1ZD3A 3QKUA 4A6XA 1MC8A 2C4HA 3BILA 1IXRC 2P75A 3PQ4A 5ALMA 16PKA 4L9RA 3GX1A 5AESA 3G5AA 4FZ5A 2RGNA 3QFSA 3D5EA 3QVJA 2YOFA 2ZODA 4P5PA 5SZHB 4MS4B 4JJEA 3U7EB 2Y76A 3F2VA 1E2DA 4NBRA 3T1YB 1BS1A 4N82A 4B3CA 3CSDA 1E2GA 2WF5A 1XLWA 3QOXA 1ZN9A 4IEIA 1E3EA 4M22A 1S2LA 1J9EA 4CMCA 3RRNA 5IJWA 4G63A 4JX9A 3RYCA 4NJMB 2PS1A 3PNMA 2J3HA 3I9V1 2GDZA 2RBGA 2WVJA 1RZRD 2BDUA 2GJSA 2L82A 1TC2A 1TK9A 5TMEA 1UQRA 2PGIA 4BP8A 2ZS9A 2ZU6A 4IJQA 1UH5A 4JOCA 4B31A 3HP7A 4J0EA 1PR1A 3V3TA 3IHKA 4PICA 3P19A 4B3MB 2FZWA 1E5QA 2C2KA 3HKCB 2WYUA 1PEDA 5EINA 3TFQA 1G1MA 4WLNA 2H2DA 4ZI7F 1BMFA 1JWBB 3BMOB 4RXUA 2FAXA 4FNGA 4RTQA 1KY3A 1X86B 1QVRA 3QKSA 5B36A 2NYVA 4DDMA 4KO4S 1CQPA 4MR8B 4B82A 1ZXXA 3V6LA 4B0PA 1T36A 4QUAA 4XQ0A 2OORC 2FEAA 3B2EA 4GEGA 3PC8A 4GP9A 4EJ6A 1GUYA 1Z5ZA 2IXDA 2CXOA 2HSJA 4BT3A 2XMRA 4G97A 1ICEA 2RH4A 5JCJA 2IDMA 2WBLC 3CS3A 3WHPA 4IIFA 4C4RA 1NRIA 4ZFNA 1PGJA 5B57C 1C1HA 2GEDA 2Y92A 3G59A 3OH8A 1I80A 1UBMS 4YAFA 2VSXA 4ZCRA 4KTTE 4AN4A 4IMRA 2HS4A 3M82A 5AK4A 3WLEA 2CUTA 2OBFA 1RXIA 2P9HA 3ZY5A 4F92B 1MEEA 2I2BA 1Q1AA 3BJIC 2QAGC 5E6SB 5AR1A 2NXNA 5I7OA 2J6CA 3EG9B 2E5LB 3ZBUA 4MVJD 4Y1RB 3AF2A 4QELA 4AW9A 4YJGA 3E1KA 1Y5IA 3QE9Y 2WU8A 4XVHA 3U4DA 3QE3A 5EB1B 3PTZA 1SBTA 2BZ1A 2JDID 1EFRA 2RHTA 3GVCA 3LZDA 1W5EA 2A4KA 2D59A 2XH8A 3TSZA 4NS4A 5FEUA 1L7RA 3MJEA 1QQ6A 2WWRA 5KTOA 3PC4A 4G0QA 4I55B 4RHYA 1KA9H 4JVNA 4GFDA 4U2GA 5ESXA 4AIRA 2V6FA 2WFLA 3FKSD 1GPAA 1S0UA 2VWQA 1OD6A 3PHBE 4MO2A 3RLIA 5IU6A 2WD9A 3ZVMA 4YT2A 4J0HA 3FRIA 3ZHUA 1BA2A 4NK4A 3LMKA 2GNAA 1Q16A 2C07A 2AZMA 4GBJA 3ZCQA 5HQ3B 1GU0A 2IV3A 4DDHA 2FMIA 4X0EA 3RIYA 1YCFA 1KJIA 1WDWB 2XE6A 5AKKA 5EKSA 4X6YA 5KZMB 2Z1TA 1LB1B 2FPGA 1UBSB 1Z2OX 2ZYGA 4KV9A 2B78A 4Q3OA 1YU9A 3JWHA 3NHZA 4QT4A 4X7RA 2C61A 2DPMA 4I4CA 1NXVA 3RSFA 3KKMA 1I4WA 5A4IS 3E23A 3TD6A 4CEJB 1HGXA 1I24A 1P7CA 2MSNA 3BRWA 4QTXA 3KXPA 4MLCA 4OQDA 2IXGA 3TD5A 3B5IA 3I09A 2IU3A 4XR9A 4D9EA 4PLTA 2PUFA 1C9EA 1HYQA 4S1VA 3UK7A 1HOXA 3IA2A 4OHWA 4PXSA 3HXQA 3VSBA 1JDPA 2JRLA 2XI4A 2JAHA 3OCXA 5G53C 1GJRA 1JB1A 2UV8A 3KZCA 3NONA 4TZZA 1DEXA 3RQIA 4BGDA 4LF7B 1ZISA 1ZNZA 1G38A 4B2YA 1VQ1A 1XPOA 2PY6A 4BVBA 1DZ3A 1M2NA 4NQ3A 1QFXA 4ZAVA 4CIAA 4EKNB 4F3YA 5AUQA 2JGNA 4N5DA 5EP1A 2V97A 4GL2A 3H9QA 3LVBA 1T3ZA 4HXFB 4B45A 4B0OA 1YRBA 4XCQA 1OXTA 2G9ZA 4CUZA 1SPXA 4CM6A 2OT3B 4RACA 5ILQA 5IHXA 2H1SA 2E7ZA 1TRKA 2ZAGA 1L5RA 2HMAA 3B6IA 5AICA 3CVVA 2Q5IA 5EWLA 5EJMA 3USES 4LZAA 3ELCA 2CZQA 1D6NA 2VLIA 4WXRA 4PLVA 4DCNA 4I4NA 1CWUA 1CB7A 1DJNA 1T8YA 3S5JA 1NMQA 4ZHWA 3CYPB 1DDGA 1AKMA 3QWIA 4RCVA 1OX6A 1UM8A 3I0ZA 2J32A 3JQQA 3LQQA 4ZT2A 3TLJA 1VK3A 5KBYA 2C8KA 3FNHA 5BO5A 2W2TA 2C31A 2BFOA 4TTRA 1T4CA 5EXXA 5EMJA 3ASYA 1JLRA 4PXYA 3CC4F 5T57A 1Z63A 3ETCA 4IGIA 1A8SA 3F8WA 4PYJA 3GELA 2ZEJA 2L19A 2P68A 1DS6A 2II6A 4RVSA 2OQVA 1Y8QB 2O8DB 5F76A 1A76A 5JLJA 2B30A 1XA0A 2QZJA 4DHWA 1L4LA 4Q6BA 2NU7B 2HS3A 2B9EA 3CD6F 3ROXA 5BR1A 2R00A 4ERXA 1VI5A 1W4CA 1SKUA 4KVGA 4G24A 5SZKB 2H29A 4Q93A 5DNUA 4BB5A 3UTCA 2IOHA 1R4NA 4TVOA 2H1OA 2VPIA 4M8LA 4AY2A 2Q4BA 5DX0A 3WA6A 4Z0HO 3ISVA 1I2ZA 4QUIA 5A9SB 5JAMA 4KQJA 2UUBB 3ILVA 1ONOA 3RS3A 3GDFA 2OYRA 4C76A 4RD0A 1U4SA 1L5ZA 2DBQA 1XCBA 2H8KA 2R1VA 3K4HA 4OF4A 1J2TA 3L77A 4CTOA 1BFKA 1KS2A 2HMYB 3Q9UA 4IUCS 5JAQA 5EKDA 3D6FA 1YZFA 3B1XA 4TTPA 3MRXA 5CGZA 3B7WA 5DLYA 3ZGVA 4ZYUA 1DPGA 3IHTA 4RZ2A 1HETA 2ZSIA 3ZLJA 4C4OA 2WVHA 1SOWA 2HT1A 4LC1A 3NM6B 5KWEA 3VKHA 1WF6A 4ES6A 3KSMA 5CVJA 5DLPA 1WUJS 4PPNA 1FC0A 2WJVA 5J4HA 1NU6A 1VSBA 1HFJA 2OCAA 3R5TA 4I1OA 4NS1A 4C5CA 3VU8A 4IDOA 3RFVA 2WIFA 4GDFA 3P71T 1J8VA 3W5JA 2AK2A 5CH5A 3C1UA 3HVJA 4PZLA 4V02A 3T3NA 4B17A 4JHLA 2XTMA 2AZTA 1SVUA 3I01A 1UOOA 2B8WA 4R5MA 2WYVA 3UM9A 5GADl 1XA4A 4YPVA 2OGUA 4OBWA 4YGXB 5LZ8A 4HXEB 2E5FA 1X8XA 4NH0A 4KOAA 1GZ6A 2R7LA 1RKBA 2JVIA 2F1OA 4C5AA 1N5MA 3GRKA 1UZAA 4QO8A 4BWGA 2C2YA 1WUIS 2X0FA 5FWYA 2PL1A 3DCYA 4IQFA 3A3KA 4GR5A 2GYVA 4RQUA 1P19A 2O0HA 2ZSBA 2XKAA 5LYYA 2AW5A 3DOOA 5CT6A 1S4QA 5CFZA 3DNFA 5J23A 2CW4A 2EBWA 1FRVA 3T5AA 1E6KA 2YHBA 4L8YA 4X1IA 1ULAA 1IL0A 1SH7A 2CL5A 2RK6A 4BU0A 3D1LA 3VJMA 3B3AA 2OBYA 2PA0A 2I6TA 4YUYA 3BIXA 4XX1A 3AUXA 3X43A 5A0TA 4Y6QA 5GONB 1AHHA 1IDOA 2XBUA 3WBFA 2XA1A 5IXJA 4L1KA 1EEXB 3M4YA 5IZ4A 3TINA 2W0MA 5CM8B 5KTKA 4ZREA 3L92A 3IR5A 4JLWA 3T94A 3PBKA 1FFXB 2DWOA 3JALA 3K09C 2RI0A 1SK8A 2CMHA 5C1PA 4KACA 1IWBB 2IY8A 4Y6PA 4TMFA 2VXOA 3S7TA 1FU8A 5SICE 2WIBA 1PSWA 3ANTA 3UJHA 2O2YA 4P9NA 2WQ7A 1FP1D 4L8WB 4JU8A 4DQXA 4N3NA 3V1TC 3MAJA 3DD5A 4ZOEA 3VR1A 1W59A 4ZJYA 2G76A 3P9NA 5IJ0A 5C8ZA 4EL5A 2E85A 3IT3A 1DRKA 3ZH9B 5JHHB 1OLUA 3K71B 1TUIA 4LNUB 1RJ9B 2Q1TA 4PYKA 1U5BA 1OA1A 4QO7A 1TECE 2E55A 1K3FA 4YV1A 2J3LA 1KQPA 4TMKA 1MGOA 4KN5A 3WWYA 3BXGA 3CUSA 1TEXA 1J8QA 1WEHA 3HXKA 1L7OA 4GM0A 3SHVA 3RS7A 4L4XA 4JROA 1DCKA 1N2BA 5JXIA 1ZW1A 2OWEA 3PNBA 3ZIAD 3Q3HA 4OMFG 5T7BA 1HV8A 1H5QA 1KEWA 1FRQA 2GASA 2FK8A 2VF8A 4KLZA 3M3HA 1O5IA 1M6VA 1KY2A 2GBFA 1QQAA 5KKCA 1L4GA 2VAMA 4QGGA 2E2WA 4I9GA 4PV7A 5ICFA 1V5WA 2VRNA 3N07A 4S12A 1GDTA 1TQ4A 4JH0A 2CNNA 1GAJA 1G16A 2I67A 4JLAA 1IBMB 3GCZA 3AFGA 1U11A 2DOKA 3P97A 4MZDA 3KKEA 5G2OA 3KT0A 1K5PA 2QTMA 1J0DA 4IIUA 1QGOA 1UMBB 2HU5A 3UT0A 1DX4A 4NEGA 2RHHA 4D4JA 2NU9B 4PYMA 2VUSA 4QPJC 5AK6A 2Z1NA 3AL3A 2CLFB 1OLXA 2I8CA 3U3ZA 5FDFA 4WBSA 1F12A 5WRFA 3DEFA 5DXAA 1E99A 2QM3A 4ZALA 4KLAA 1ID1A 2YZ7A 2GZ1A 4KFSA 4O4IA 4MHOA 3IUNA 4QDOA 4D92A 5EB0A 1Q0SA 1D8AA 1ZK3A 4WWHA 5DISB 3ZHTA 4YJ3B 2OK8A 3E1YA 3AEKA 4MMXB 4QKQA 1TKAA 1IPHA 4YRZA 4W5WA 1L5MA 4RHAA 2ZDHA 2JEOA 1QHHA 1SBYA 2Z57A 3OE4A 4UU1A 5BV8A 2JGIA 1JHUA 2GJ4A 3AW9A 4P4TA 5ALWA 2QU8A 1QRSA 4EUFA 2ZDGA 1FJXA 4HY3A 5KTPA 4E5DA 3OBYA 3ND5A 2N48A 2JIZD 4HKTA 3RC3A 1M2OB 3GA5A 2OR3A 1QE0A 1Y4UA 1ZK4A 3LC0A 4LV8B 1FMJA 2QG9A 5TF0A 4GWKA 3THSA 2Y77A 4BFSA 5EZSA 3VV3A 1YIDA 5JOQA 2XRZA 5FBQB 2OZLB 3CLUC 3I23A 3WQRA 4WCVA 3I2YX 1OIWA 5EERA 2QN6A 2HS0A 3D64A 4RPKA 4YRCA 1T5HX 2JF0A 1A2KC 3DE3X 1BKYA 4AJLA 3FVQA 4RNCA 1N5JA 2BFNA 1V35A 3DMPA 3L49A 2H7CA 3GJZA 2ON6A 1SXGA 1UR5A 2P6OA 4WNIA 2IYQA 1CLUA 3N5KA 4Q9HA 3HJBA 3QJ5A 3MCQA 1ATIA 1NONA 2W2LA 1Q84A 2R6ZA 4LEIA 3GLFB 3FHCB 1G2QA 3AKZA 1ODIA 2QMHA 1Z5WA 5T3UA 2B4QA 2DY0A 3ITDA 5B3AA 4DIFA 5U4XA 3T12A 5KYWB 2C5GA 2RB9A 1NF8A 1P0IA 1EQAA 3E9EA 4TTVA 3L04A 3P9PA 4YJHB 5JSUA 1B43A 1AKTA 2REBA 3IIKA 3RTAA 2GM3A 3OZWA 1NQOA 1UKZA 3HJAA 4AJKA 3NB0A 3BAFA 1KS9A 2TRSB 4E09A 4Q3LA 5IJ9B 4MWTA 2J4CA 5E7IA 2O8CA 1B6TA 1JLHA 3Q2OA 1DEHA 2XHEA 5LZ7A 3AB8A 4N9QA 3V6MA 3IAEA 1P2UA 2F3PA 2O7QA 2OVFA 4L9SA 4MAMA 3SC6A 1HEIA 2C99A 3CH5A 3SEZA 5KYXA 4F3TA 1SG9A 2OVBA 1G4AE 1LI5A 2CLCX 2HK9A 2X8LA 3QEMA 3RUPA 3T9BA 3WMGA 4B2LA 2IY7A 4R2KA 2FHSA 2PIAA 3WGOA 2PGOA 4YC7A 4L5JA 4J43A 4QGBA 4K6KA 4MUXA 1SD5A 2E4VA 2JATA 2Q49A 3H2BA 1NL3A 3CUWA 2QLTA 4RZUA 1SD1A 4WZBA 2PQMA 4J0QA 1V16B 4WNAA 4NQZA 3FNRA 3FSRA 2V7UA 4CNBA 3E1GA 4CVNA 5CK5A 4P22A 4D97A 5JO0A 1W75A 2P90A 2Q5EA 4K6CA 1V11A 1Q0LA 4G84A 3EC2A 2I9PA 4LW8A 3GIWA 3ILXA 3Q3JB 3IVMA 5ES3A 1HUQA 2L0XA 3I6MA 3E48A 1VLZA 2BT4A 5DRYA 1M1NA 4JT4A 5BXYA 2A30A 4JASB 1EM6A 4KYVA 4JEUA 3SSOA 3HCBA 1NV8A 1U2GA 5HWSA 1JHRA 1Q0RA 1D07A 2ZS7A 1J5PA 1W8DA 3ON1A 2WSSA 1KKMA 1SQ5A 1US8A 1Z8NA 5D3ZA 2EWCA 3NRJA 2XOEA 5CCDA 4Q01A 2QZ4A 1TM5E 1FPMA 3W8NA 2XB9A 2AR7A 2VKTA 5CIQA 1RRKA 3CEAA 4Z0NA 4I4TA 3UWOA 3Q3GE 4H7DA 4HYTA 4DV4B 1Q8RA 2J1LA 4TKMA 1KOLA 4I2NA 2XYRA 3SR0A 2CLOB 1Y3IA 2XD4A 3MQ4A 4FJ2A 5CDHA 5FWNA 3FTDA 1RRCA 2MSDB 1KIAA 1YA6A 1ZYUA 1SFRA 3HFGA 3T5BA 2JEYA 5BNFA 2ZYHA 4QYWA 1Q7YH 2QE7A 4EF6A 1J0AA 1E9SA 3HY4A 3R5FA 2BVNA 3ZK7A 2ONZA 3C3WA 3ZLBA 3MJCA 1NNEA 2EJVA 2QJRA 4H59A 3A4MA 3SWWA 2W9XA 3SF8A 1KETA 1PR5A 2KS6A 3KE8A 4M0FA 1PW7A 4NJEA 3SC3A 1LD3A 1QV6A 5ANRB 3ZHBA 3BMXA 1E3SA 1U8XX 3JRXA 4MNTA 2G6TA 5TV2A 3RTDA 1YJNF 3CO0S 3T0IA 2IYSA 1Q6ZA 5GONF 1CIVA 3VH1A 3CHYA 2FUG6 3GT0A 3KK0A 2NLOA 2YZKA 1C2YA 1TIPA 3BIJA 2BSAA 1X94A 2LBTA 1O97C 2VHTA 3R77A 3T41A 3ZY2A 2XVAA 1Y8AA 2BBWA 3DZDA 5IC5A 1A9QA 3LM8A 2YVAA 3GGSA 4LRTB 5AI6A 1NM5A 4NENA 1MEOA 2CNBA 2XWJI 4DT1B 2OOKA 1GP2A 2AN9A 1Y3AA 1UKEA 2WKRA 4S1NA 1V3VA 1R0XA 3N8NA 4OHUA 1MO6A 4TLAA 2B37A 2HSGA 2GCIA 3JYPA 3RKRA 3AU9A 5REQA 4A2CA 4EECA 5FLXA 3FTPA 2J4FA 5IM4F 4FS3A 2HRDA 1SIWA 2GVDC 2R2GA 1L4HA 3FJOA 1NW7A 2B7CA 4H1TA 5CT5A 5CVVA 3WXMA 1WZNA 4YAGA 5DT9A 1X8JA 5AVZA 3KPVA 5E4YA 2FR8C 1RYEA 4RTKA 1AXEA 1IZ7A 1NJ6A 2RHMA 1AUXA 1EK1A 2ZTHA 3B85A 2V45A 1E1CB 3NM5A 2VNJA 4JLUA 4G0ZA 4UFPA 1YQTA 4IGEA 5HIAA 1YDFA 5E95A 2AXPA 1S2IA 3HVUA 2PUEA 1LBHA 3A4YA 1H6AA 5J2UA 4E7PA 4O29A 4WESA 5IBRA 4BCBA 1YS7A 1P1FA 4E33A 3FCCA 1K89A 2B5OA 4IS2A 4HN2A 4AJ9A 2GCOA 2ZSJA 2QI9C 3GHHA 3OICA 4JCCA 1NBAA 2QR5A 3LRXA 3ZO8A 3VDXA 2UYNA 2GA8A 2YUTA 1G66A 4KH1A 1KYTA 4GHWA 4PLHA 1ZEJA 1OTXA 2PUJA 1USIA 2DBZA 2IEZA 5BMVB 2OTJF 4HAWA 1H1LA 4QPCA 3U61B 3RBAA 2C9OA 2P2NA 1VBNA 4IILA 4GLBA 5EOVA 1T8RA 2IYFA 4S2UA 2WMDA 4BMYA 4F6CA 1FCJA 4II7A 3VU9B 2Z8XA 1CZHA 3VR4H 1PJSA 3RAFC 1CS0A 2YFKA 3CZ5A 3FCXA 3A9VA 3R41A 1P2DA 2ZR7A 3RSGA 3A9CA 5TRTA 2NPFA 3D0QA 1ISFA 1YZTA 5ALVA 2VRWA 3JQPA 4DIOA 5HNKA 2IHBA 4YJ3F 3VC3A 5HOQA 4MO9A 1U2DA 5THXA 1BHJA 1FK8A 4UAUA 3OCCA 4H2DA 5G1PA 1NM5C 2GD2A 5CAEB 4WEQA 5DO9A 2VJNA 1VTKA 1G2IA 1F20A 2HWWA 4PHCA 1C7EA 3A6HA 1OY1A 2PXCA 1PF7E 4CEIB 2A1UB 3GPIA 3V8PA 4PG4A 5J2TF 1DOAA 3BDVA 2OGSA 4ZOBA 4GICA 3WV4A 4WN3A 4L51A 4WNYA 1Z88A 3MD0A 5JS7A 1LSJA 3EIEA 4JIMA 4IH9A 1RAGA 1F6WA 2Q3CA 2WB4A 4WINA 2HO4A 3VPXA 5BSKA 3IUPA 2OAP1 1ZZGA 2VPYA 3IKLA 2OGTA 3HO6A 4QUKA 5A4JA 1V96A 1OUMA 1BJKA 2J5RA 1WDKA 2JLAA 4UPEA 1FX1A 2M6RA 2OBNA 5EHZA 1L4YA 1YZ3A 5ICMA 3VMFB 2GEBA 4CJXA 2P2ZA 1EAMA 1H4VB 1DFGA 1XYYA 3CEHA 4QUHA 4V0LA 4DM7A 4E0BA 2D7DA 4OHVA 2AOUA 3A4VA 5F1PA 5A3VA 3UFBA 1PFQA 5E2IA 3EOAI 4RNDB 5ERXA 4F9GA 1HFEL 2FX3A 2YV3A 2CE2X 2QTLA 3GVPA 3W5SA 1B3RA 1AZWA 2JIQA 5J58A 3ZWKA 2PUAA 1TUBB 2FUG1 4F4HA 1VC2A 3D01A 4O0LA 1E5XA 4QBKA 3PNPA 5DNEA 5DWDA 1HNWB 1BN7A 4HB4A 1PNRA 1KTIA 1U3GA 3AU8A 2FPRA 4BAGA 4EBBA 5ITZB 1LNSA 4S1WA 3K70B 4LMPA 1I2CA 2MCFA 3TIIA 5HCIA 2O1EA 2ZATA 3TCNA 3OKAA 3SVTA 5HUJA 3AXTA 4I9FA 4OK5A 5TT1A 5K8LA 5CLLA 1SKMA 1EB8A 3S8EA 3BK1A 1FF9A 2QRMA 4D81A 4TTSA 1RWBA 1LC3A 5HBRA 2A6PA 2EZ8A 2P6PA 1NZJA 4B4UA 2BFBA 3CNOA 1RZ3A 2W6ID 2J3MA 4R71A 2O2EA 1GCAA 1ZU5A 3UHOA 5B3LA 5JDIA 1G5FA 5FLEX 4LE2A 1H9AA 2FHPA 2VP0A 1M8KA 1IV4A 1Q81H 3HCDA 1KNJA 3PXEA 4FEEA 1ABFA 3HVKA 1ZZEA 2Q6IA 4NV0A 4H3HB 4DS3A 4YMTA 3EY9A 3FOZA 2PJRA 1SHLA 4RORA 3ZX5A 4J07A 2CF6A 3U3MA 2VEDA 4KK4A 1G2PA 1QM5A 2VI5A 4AX8A 3KJKA 4OHRA 2EEPA 1C7QA 3UJPA 1OI2A 3N2NA 3UMCA 4L5BA 1OXKB 3UKJA 3A9WA 4H7FA 2HBYA 4BRZA 1USUA 1OAPA 2NZYA 3OJOA 1P4RA 3KU4A 4JBYA 5HW0A 3RT7A 1NVXQ 3ZKWB 4YCBA 2PH7A 3HMKA 1FBNA 1TUEA 3KLBA 1USVA 2E4XA 4MXDA 4QUGA 4RH3A 4WVFA 2Q6TA 1XTTA 1BE1A 3AHCA 4EOGA 2GPSA 4MS1A 3A2KA 1OC4A 1TD9A 3DHNA 4HUJA 3C41J 3S6JA 1H1DA 3FSEA 2XQFA 1GFZA 1YBVA 3JYHA 2IYTA 2HN9A 2Q07A 3C6BA 3KL4A 2WQ6A 2P2DA 3WG9A 3PFKA 2YJ6A 3AY7A 3NOXA 5CJJA 2ECKA 5DTJA 1NQ3A 2SECE 2ODTX 4XEUA 4KUHA 4LRXA 2NVUB 4YROA 1G5HA 3ORSA 4XFKA 4IYJA 3G9ZA 4Q4HA 2PLRA 4Q4AA 2G1KA 4RMIA 3RVPA 1BG6A 1E0KA 3DR5A 2ZIXB 3FOBA 4KPUB 4NR0A 4CLRB 4BV2A 5C32A 1HORA 5FUYA 3EWAA 3RNOA 1F2DA 4LSMA 2BELA 1QIGA 2GCEA 3GGCA 4OJKA 4Q9JA 4BKMA 2CXHA 2CVLA 1U2TA 2RGCA 1DSSG 1RD4A 5INTA 3R0ZA 3BZWA 3EGXB 3LWVC 2DY1A 3HN6A 2IPNA 2Z83A 4H7HA 3ERNA 1K5DA 1WCIA 1EXNA 2DX7A 3HJRA 3Q6NA 3L0DA 3QVGB 2VP9A 4E30A 1GLNA 3EAQA 3HCWA 3K2EA 4PZYA 2R4QA 2FDCA 2ZRHA 1F1BA 4G07A 5FUXA 4CMIA 5FYDA 1LSUA 4X5OA 4F2WA 2PH5A 1QOZA 1J1IA 1K73H 3EMKA 3MIZA 4AJNA 2YXZA 1MB2A 3A1CA 3WJAA 2IPOA 5BYKA 1KPHA 3K72B 2XT9A 3EA4A 1RHQA 3HKDA 3JVVA 4JSTA