2VAVA

Crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
376
structure length
347
Chain Sequence
NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
total genus 116
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vavA00
2WJ6A 1TCBA 3FBWA 2OGSA 3G8YA 2R11A 4Y2XA 4Q3LA 1QJ4A 4V2IA 1EHYA 3VJLA 4ZXFA 1U2EA 4A23A 4G5XA 4DSAA 3SX4A 3KOOA 2X8BA 4DLNA 4KE9A 5KREA 2XUDA 4JYPA 4C4YA 4AO6A 2B9VA 1E3QA 1XRLA 3H1BA 2Z8XA 3PFBA 3LS2A 3C6ZA 3OC0A 3R0VA 2HA2A 3YASA 4FFVA 1QIEA 2VF2A 5K3AA 5DTJA 2Z8ZA 7YASA 1AMNA 2QM0A 4EA6A 5JZ9A 4KAJA 3D7RA 1JJFA 3DD5A 3CN7A 4LYEA 2JGKA 5DYYA 5D3ZA 1IUPA 2WIJA 2B20A 3H19A 3QPAA 4DMFA 2WFMA 5AKYA 3H2HA 2WU4A 2VJCA 3HSSA 4IO0A 3S2ZA 1WOMA 4Q05A 3DNMA 2HA3A 2PM8A 4BP8A 1VXRA 2O2HA 3O9VA 1CEXA 5FPQA 4B84A 3R3YA 1ZD3A 4N5HX 1JU4A 5A7HA 4EY8A 2WIFA 4P9NA 1SFRA 4X3CA 1Y7HA 3IUQA 1R9MA 4U2GA 3O4GA 3E4DA 2CMFA 1LPSA 1AUOA 3AZQA 3U1TA 1D07A 4EZIA 3C6YA 1K8QA 2XUPA 4KE6A 5H3HA 1THTA 1LNSA 2WHRA 5JZSA 1ZIYA 4I19A 3V1KA 4X6UA 2BKLA 4JUIA 4LHEA 3D4LA 4DMCA 1CV2A 3VJMA 1W1IA 2GZSA 2J4CA 4N8EA 4X7BA 5ALSA 3WKAA 5AK3A 4C87A 3QPCA 1TCAA 5JADA 1RWQA 5K3DA 5LZ8A 2JGIA 5CT4A 4B6GA 2I03A 3I6YA 4WCVA 4QE3A 4EY6A 3QM1A 2QJWA 4H7FA 1LPAB 2XMSA 4BVJA 2JGMA 2BAGA 1MJ5A 5AM0A 4JEIA 1XFDA 3RARA 1VOTA 3D2CA 4GHWA 5ALPA 4H7JA 2QXUA 3C5VA 2HU5A 1K4YA 4BZZA 3C6XA 4J0KA 3HXKA 2ORYA 1TAHA 1MO2A 3P2MA 1OCEA 2HFKA 1H2YA 4U2BA 4RGYA 4BBZA 3G0IA 1CUUA 2JF0A 3WKEA 1CPYA 4GXNA 3LP5A 4AO8A 5AM1A 4GECA 1QIKA 3WIOA 5LZ5A 2QS9A 4ZWNA 3OPMA 3WWEA 2XLBA 2FJ0A 4I3FA 5EIHA 3G0GA 5YASA 5AKGA 2XQKA 1B6GA 1SCQA 3WK4A 2DHCA 3AZPA 4TPKA 1ACJA 1EA5A 3DCNA 1CUZA 4HTAA 5BV7A 2RI6A 4E15A 5LKAA 1X70A 1DT5A 2W6CX 4J0DA 2G63A 5DNWA 1IZ7A 1MN6A 1YA8A 4UBIA 3WL5A 1Z68A 1VZ2A 3I1YA 1G5FA 1CUDA 4CI9A 3OTQA 2V9ZA 3A6ZA 3FCYA 1ORWA 1JJBA 4W1PA 2XUQA 2OGTA 3A2LA 2WFLA 4AX4A 2DHEA 1QIGA 3WL8A 4B82A 4J7AA 3DOHA 4X6YA 5A6VA 1ZJ5A 3FLEA 3AILA 5EFZA 1EK1A 3T52A 2XUAA 5HF9A 2DSNA 3G7NA 4G9GA 1B41A 5LZ2A 3B12A 1QGED 2ONCA 3JW8A 4J0HA 3GBSA 3B3QA 4W1QA 3ZWQA 4Q82A 2C5FA 4B9AA 3ILSA 3PICA 3W06A 4F21A 1TCCA 1WHTA 1CUSA 1TRHA 5AHXA 2HA5A 5FLKA 1GZ7A 5CT5A 1EX9A 1MNQA 5AK5A 1FFEA 4PSDA 3FVTA 3BXPA 4HZGA 3I6ZA 3HRHA 2BUBA 3OG9A 2JEZA 4MEBA 1L7AA 2R8BA 4UUQA 5AOBA 1A7UA 2C58A 3BWXA 4G4GA 5ALNA 4UBOA 1K63A 3DKKA 3AIMA 4RE6A 3I2JA 1FFCA 5AKIA 5LKRA 2VATA 2XMZA 5DLPA 3WYDA 3JWEA 1UFOA 4QNNA 4AN0A 1XZBA 2Y2UA 2OPHA 5EI5A 2JEYA 4FHZA 4WY8A 1ZGBA 2VQ6A 3FLAA 3STXA 4HVTA 2GYUA 1CRLA 3L1IA 4UBMA 4F60A 5ALLA 4P93A 4QWMA 5DTIA 5AM4A 3S8YA 3GA7A 5CRIA 3W9BA 1I6WA 4FFWA 1GKKA 1PJAA 1QIMA 3IULA 5AI0A 4BVLA 3DLTA 2CBGA 1UOPA 5ALRA 5EGNA 3X3HA 1EXWA 4EB0A 1UK6A 1CUYA 1XLUA 3OOSA 2IIVA 4HXFB 2GZRA 1NX9A 3ZLUA 2FJPA 3GFFA 2HL6A 1XZLA 3H17A 4KR0A 4BTVA 1CQZA 5C8VA 3VVMA 1QIJA 3FYUB 5CH8A 4FMPA 4ARAA 1DQYA 1Y37A 1BN6A 2HA6A 5AIAA 2AXEA 4IH1A 1LZLA 4E14A 1Q0ZA 2PVSA 2B61A 1O6GA 5ESRA 5JD6A 1CUGA 4OU4A 2WHPA 4Q1VA 1GPKA 3LCRA 4FWBA 3RKSA 3WK8A 3U0VA 1JMYA 1JKMA 1QIIA 2EEPA 4Y2YA 3WK9A 4RPCA 4AN1A 4ITVA 5HKAA 3M3DA 4QZVA 4UPDA 5DNVA 4FBLA 3GUUA 3C70A 4EUSA 3I28A 1W6RA 3AINA 4J0CA 1X2BA 4EY4A 3KDAA 4UFPA 5AICA 1HDEA 2HRRA 2J4FA 3ZLVA 5FPPA 4PV7A 3D2BA 3WL6A 3V48A 5CH5A 5ALFA 2Y6VA 5CT8A 5ALHA 2PSEA 4AB1A 1VZ3A 1Q83A 1UKCA 1KEZA 3BDIA 3I2GA 5FP0A 4G8CA 3SK0A 1RP1A 4U2CA 3AFIA 3G9UA 1CUHA 1UWCA 4FDMA 4X95A 5LLSA 5ALYA 4HRYA 1UKAA 3I2KA 3H1AA 2QUAA 1YA4A 5LZ4A 2I3ZA 1N8SA 1EDBA 4FOLA 1W75A 1R3DA 5CTAA 3FNBA 3ZPXA 2QRUA 3EQ7A 4FLEA 2O2IA 5CW2A 1CIJA 4X92A 3ICWA 3QBJA 5AM5A 2BGRA 2HADA 3C6BA 2WHQA 4KAAA 3ZV7A 3DKRA 5HKBA 5ALMA 1QONA 2C7BA 1CUJA 4X85A 2DQZA 2WUGA 5FUMA 2WFLB 2X5XA 3V1NA 2O7VA 1DT3A 1FJ2A 5FRDA 4QDOA 2V96A 4A5SA 2JGEA 3UUFA 4DIUA 2WIKA 3KWJA 5FV4A 4J3JA 5AIBA 1QE3A 2ZJFA 4H35A 4ARBA 2ACEA 2BGNA 1TQHA 3STVA 3WWOA 3AZOA 2I78A 1ORVA 1A8QA 4MXDA 2G5PA 3F96A 3OURA 2JIDA 3ZI7A 5CURA 4DNOA 5A7FA 3H2GA 2DCMA 3F9CA 1AZWA 5AKZA 4D9JA 4PSUA 3WKBA 2VAVA 2AJDA 2HA0A 2XUOA 5AOCA 2XUFA 1XQYA 1TK3A 4MJ3A 3IUJA 1JJIA 4LXHA 1IUOA 1AQLA 2IX9A 1F8UA 3WJ1A 1QIDA 3FWHA 3KWFA 1IUNA 3WL7A 2UZ0A 4H7KA 4Y2RA 2PX6A 1H2XA 1MX9A 4TGLA 3STWA 4B0PA 1MT3A 4NS4A 1AKNA 1P0MA 1N5MA 3QMVA 1XLWA 1X2EA 3QMMA 1N5RA 4H0CA 5E2IA 4H77A 5BWBA 2QZPA 3DYIA 1USWA 4DM7A 1CVLA 4GBGA 3IB3A 5JAOA 3H2IA 4DYHA 3KD2A 2YXPX 1XZIA 1CUFA 3V9AA 3QPDA 4ZGBA 4AXBA 1FFAA 3V1MA 2J3QA 4G8DA 1EDEA 5T4EA 1R50A 1UK8A 1YAJA 4CCYB 1DQZA 4GW3A 5EHZA 4C4ZA 4B80A 2WUDA 1JT2A 4BCDA 1YR2A 5SYNA 1F6WA 3EF3A 3NWOA 4UHDA 1UZAA 1QO7A 3D2AA 2WIGA 5ALWA 2HRQA 1ZICA 1EB8A 1XZMA 1P0QA 2AJBA 1HPLA 2PSDA 3HACA 4UHBA 2QKYA 4OD0A 1H22A 1ZD4A 2OCLA 1L7RA 1ZOIA 1UOOA 3TRDA 2WHPB 1VKHA 1DWQA 5I7UA 1SCKA 1ZI8A 3BIXA 2XMCA 1J1IA 3FYUA 4DNFA 4AMYA 4K2AA 2VSQA 4EY7A 1MAAA 1WPXA 1P0PA 2AJCA 1OXMA 3PF9A 3CCCA 4W63A 4DNQA 3D59A 4BATA 1XZJA 1QIHA 4QEKA 3BIWA 4OU5A 2ES4A 4QWWA 2GBCA 1L7QA 3TGLA 3EQ9A 4YK7A 1W76A 3UUEA 2WUEA 2HU7A 4AO7A 1G4HA 1LPBB 5ALEA 3HC7A 1KU0A 3B5EA 2ROQA 3O9MA 2QOEA 4BZWA 1HL7A 2XMQA 1BS9A 4FLMA 5SYMA 4B9EA 4BVKA 5AKLA 3WZLA 3O4HA 1H2WA 3LIPA 4DNPA 1UXOA 3BF7A 5BOVA 3RLIA 2VEOA 4Y2TA 3G02A 5CXUA 1TKRA 3PI6A 3ED1A 2OQVA 2XMBA 3FSGD 1BN7A 5AK4A 5D6OA 2PSHA 3R3WA 3R3UA 2CUTA 2ZJ6A 2VT7A 4HXGA 3OM8A 1JMKC 1LLFA 4MQMA 4Y9SA 1SOMA 2K2QB 1HBJA 2DHDA 4Q3OA 1XRPA 2Z3ZA 3HEAA 3QITA 4IQ4A 5FKJA 1HQDA 4G8BA 3HI4A 1CUAA 5HF6A 2LIPA 4H7HA 4AQDA 4X00A 1J2EA 4Y2PA 1WB5A 3Q0TA 5ALDA 4KE7A 4YASA 4YPVA 5DJ5A 2RIPA 2BCEA 5FOQA 3C43A 1LBTA 1QTRA 4DMHA 4M0MA 3L1JA 2RAUA 4UFOA 3G9TA 4FKBA 1BE0A 4JNCA 3RK4A 5AJHA 4GEGA 3HJUA 1CR6A 4Q3KA 1W4LA 4XJVA 2AJLI 2CJPA 4Z49A 3LLCA 2ACKA 1WHSA 1Y7IA 2XUGA 4QLAA 3K2IA 5DYWA 3MUNA 4DMKA 2PUHA 4GDMA 1ZD5A 5ALQA 3DL4A 5ALXA 2XI4A 5AH0A 2E3JA 4Y2UA 3A2NA 3ESAA 1CUVA 5HZGA 4N8SA 1XQWA 4IH4A 2OCGA 4H7DA 1DX6A 1YSCA 3L1HA 2PU7A 4UFNA 1XROA 1CUEA 5D7BA 4PW0A 3BF8A 2QT9A 2XQFA 2HHAA 3C8HA 5JAHA 3FLBA 4P08A 1WCYA 2YYSA 4BRSA 2XUIA 5EHXA 3NUZA 1AGYA 3BJMA 1G42A 3KXPA 4X97A 1CUBA 5T4HA 3LIIA 4U2EA 5AOAA 4KRXA 3QYJA 2WLSA 3BE8A 3QH4A 3PUIA 4PSCA 4K6KA 3W9UA 4MWTA 2XT0A 4LIPD 1SC9A 2H7CA 4NVRA 2WIDA 3DS8A 3CCBA 1QO9A 1BRTA 5E4TA 3WLAA 5BWCA 3K9BA 4Y2SA 1TIBA 3IUMA 4BTLA 2PUJA 2HIHA 5AKXA 5AI6A 4CCYA 1XQVA 3GZJA 5J3JA 5HK8A 5IH7A 2RHWA 5JANA 1E5TA 3M81A 5ALTA 2VJAA 3G0BA 2ZYSA 3STTA 2WU3A 2CKMA 1IMJA 5JASA 5KBYA 1VE6A 4IHAA 4LKOA 1F0NA 3W2TA 3ZLTA 4J0IA 4EHBA 5AM3A 5AKJA 3F98A 4WFKA 4HS9A 1PFQA 3H18A 5HFAA 3I2HA 4C88A 4J03A 4KACA 4U2DA 1DTEA 5JATA 3BJRA 1QFMA 3JYHA 3WKDA 4OPMA 2JGJA 4CG3A 4CIAA 3NGMA 4BC0A 2X76A 2XQGA 1E8MA 5C7YA 1E66A 2OAEA 3MUOA 3O95A 1XRRA 3GELA 1VXOA 1ODTC 2DFPA 3D3NA 4OCZA 2C4HA 3DEAA 1LGYA 1LZKA 4BE9A 3E0XA 1A88A 2ZYIA 3ICVA 1Q84A 3N0TA 5JIBA 2OXEA 3O4JA 3ESDA 3Q8WA 3CXUA 4H18A 4BC1A 4MYDA 5K3BA 5K3FA 1HLGA 1MU0A 4W9RA 4CIBA 4GI1A 5A7GA 4WJLA 5AI5A 4FBMA 4F5ZA 1R4ZA 1VA5A 1EDDA 2BJHA 1EVEA 5I8PA 2O7RA 4XWGA 4E11A 3FAKA 4L0CA 2QVBA 4XVCA 1XQXA 4IH9A 3DDUA 2PSFA 1UK9A 3MGAA 1BEZA 4UBLA 3ESCA 3HZOA 1YS1X 1QTIA 4M0EA 4KYVA 2ECFA 3G9ZA 4XX1A 4Y2VA 3UMJA 5ALUA 5EIAA 2HU8A 2BFNA 1H23A 1YASA 3IIIA 3N2ZB 4QDTA 1GKLA 5FXMA 3WWPA 1XRQA 1GGVA 1WPRA 4JH0A 1S8OA 2QR5A 4HRXA 2DQYA 1VJ5A 1R88A 4C89A 4MYSA 3R40A 1DWPA 4AZ0A 1W52X 1U4NA 2J3DA 1XRMA 4ETWA 1IVYA 1QOZA 5T4FA 4GWLA 1XKLA 5CMLA 3WYNA 2O2GA 2XB6A 2HA4A 4RE5A 2GBIA 2XQJA 3R3XA 4JYMA 3WQHA 5DYTA 1NU6A 1M33A 4BP9A 2GYWA 1CUXA 1GT6A 4LXIA 4BAUA 5AI4A 1ISPA 2YASA 1MTZA 3I6MA 2W22A 1FFBA 3VKFA 5AO9A 3SWWA 1MX5A 2XUHA 4W1RA 4G4JA 3IURA 1NU8A 1CUIA 4OB6A 4KJXA 2XUKA 5HQ3A 5JAUA 5LP1A 1DU4A 4C6HA 1YCDA 4B85A 3RM3A 3QZUA 1MNAA 2XLCA 1UKBA 5HK9A 3EIOA 2ZSHA 1ODCA 1YS2X 2HFJA 1YAHA 2WUFA 2GYVA 2XDWA 1ETHA 4PQEA 2VT6A 2PSJA 2WFZA 2WM2A 3AIOA 1QZ3A 2BUCA 2CZQA 4J0GA 2PPLA 5AI8A 1CLEA 4Q34A 3O0DA 1U8EA 4N5IX 4B81A 3W05A 3DOIA 2WSLA 3R3ZA 1VA4A 5C8ZA 4X94A 3F67A 2HDWA 4ZREA 1JI3A 3G9XA 5AM2A 5E4YA 6YASA 3DYVA 5K5EA 2G5TA 1VE7A 2FX5A 2Y2VA 3I2FA 5EIEA 5AKEA 2XQIA 2OAGA 4PF1A 1A8UA 3ANSA 1JU3A 1JFRA 1MX1A 5E4JA 1XRNA 1CUWA 4UBJA 4EBBA 4K6HA 2VJBA 3CN9A 2JGFA 4DGQA 4INZA 5HF5A 1XZCA 4YX9A 4AMZA 2C5GA 1G66A 2V98A 2WILA 4Y7DA 1EINA 2FUKA 1T2NA 2PBLA 5AI9A 3WK5A 4UHEA 4B83A 1XLVA 3VJKA 2CB9A 3WKCA 3TEJA 4X91A 4DTCA 3R3VA 3WIBA 1QIFA 4QA9A 3G0CA 5K3FB 4ZI5A 4P92A 4MQLA 4I4CA 4WFJA 2Z3WA 2RHTA 1Q0RA 5I9IA 5DWDA 4C4XA 1CQWA 2C0QA 2ZYRA 4QDUA 3IUNA 1ZGCA 3I1IA 1AX9A 2QXTA 4OYYA 1ODSA 3D5EA 5CT9A 4B0OA 1C4XA 4H7EA 3WI7A 4LYDA 1WM1A 1WB4A 1THGA 2H9YA 5JZBA 3WA7A 4OB7A 4DSZA 1GQSA 1KU6A 4CG1A 5IVDA 2Z5GA 1GPNA 3EQ8A 4L9AA 1BCRA 2BUAA 3VVLA 2QUBA 1O6FA 5AK6A 1HKHA 1XKTA 1BU8A 2ZSIA 5IKXA 4QLOA 1E8NA 1K6EA 2AJ8A 2OLEA 1VLQA 4UBNA 1XZDA 4OSEA 2XMDA 3M83A 2EDAA 1C7JA 1ZIXA 3V1LA 4G4IA 3NOXA 3VDXA 2CEKA 3DQZA 4FLFA 3GROA 3PUHA 2QTBA 5JARA 3AIKA 3K6KA 4GLBA 1J07A 3VISA 3R41A 3C5WP 1FSSA 5ALIA 1EVQA 4K5QA 5ALVA 1E89A 1T4MA 2JGLA 3IBTA 4KAFA 3FVRA 4QDZA 4O08A 2D0DA 2QJRA 2JBWA 5CBKA 3STYA 5HCUA 2VTVA 1BROA 3DJYA 5LYYA 4N8DA 4WFIA 3WK7A 1C7IA 4C01A 5EHNA 4X71A 4MEAA 4BDSA 4HXEB 5EHQA 3FYUC 2WQZA 2WG0A 3QVMA 3AUKA 4XIIA 3WK6A 4TVKA 3KSRA 5ALOA 1LPOA 1H2ZA 2IITA 2WJ4A 4UHHA 4FNGA 5CT6A 5ISMA 1XZHA 4CG2A 1YB6A 3FOBA 5F4ZA 5HF8A 5DNUA 1IZ8A 1ZI6A 3FSGA 1LBSA 1EK2A 4UHFA 2OQIA 1XZKA 3H0CA 2Q0XA 5HQ3B 3PE6A 5JD4A 3DL7A 2VJDA 3IDAA 1N1MA 2WTNA 2HA7A 2VA9A 3PDCA 1ZD2P 5CH3A 3WA6A 1LPPA 2Y1KA 4S0XA 5K3CA 2WG2A 3HYSA 4E46A 4K6GA 1ZJ4A 3PF8A 2Y6UA 4MWSA 4ZRDA 3F8SA 4BB0A 4FNMA 5AKKA 5CXXA 2H1IA 3C8DA 1AURA 1ZI9A 5ALJA 5A62A 2PKYX 5ALZA 4J0JA 4CFSA 1GQRA 4KEAA 4OB8A 1UT6A 4B7ZA 5AP9A 4ZV9A 5KWIA 4BCCA 4L72A 1F0PA 2G4LA 1EH5A 4H7IA 4UBKA 1FFDA 1AC5A 2EDCA 4AZ3A 5K3EA 4PO3X 4BAZA 5A71A 3WWCA 2XMRA 2NW6A 2WKWA 3IVMA 5JALA 2WG1A 1XZAA 4OYLA 1DWOA 4RNCA 5C81A 2P8SA 3WZMA 1K5PA 2OG1A 2ZVDA 3WMRA 3WJ2A 5HFNA 5IVKA 1SCIA 1R9NA 1CUCA 1E8DA 4X93A 3W04A 2V97A 2OCKA 3FYTA 1XZFA 3H2JA 5A2GA 3BDVA 3H04A 2C0PA 5LIPA 2PU5A 3EBLA 2D5LA 2I3DA 3WWDA 1XZEA 2RONA 3STUA 3D0KA 4BYMA 4Y2JA 1A8SA 4L3WA 1BCSA 4QDXA 4ZV7A 1QLWA 1UK7A 3M82A 1BEEA 1MAHA 2WJ3A 4KRYA 2H7YA 3A70A 4BE4A 5IVIA 5C8XA 3IA2A 3PFCA 1P0IA 1DINA 4W1SA 3H2KA 3SC2A 3ESBA 2B4KA 4M0FA 3I2IA 3VXKA 4ROTA 4OUKX 1R1DA 3BL8A 2YH2A 2QMQA 1CFJA 4Y2QA 5ALKA 4G9EA 2WTMA 4WDQA 1WB6A 1LPMA 4WY5A 1U65A 1GPLA 1LPNA 1MPXA 2DR0A 2RGUA 2PL5A 4X6XA 5JYCA 1QFSA 4U2FA 3QMWA 1J06A 2HM7A 3HLKA 3A2MA 1RYYA 4KE8A 4BAGA 4HAIA 4BDTA 2VAXA 5LZ7A 1ACLA 3E3AA 4X90A 4LXGA 2OCIA 4EY5A 2H7XA 3T4UA 2GBFA 5JD5A 4F0JA 4UHCA 4A16A 5KWJA 3ANTA 5LZ9A 2ZJ7A 1GXSA 5JAPA 1YB7A 2XMGA 2ZYHA 5IVHA 4BRZA 1OILA 1DX4A 3FCXA 4WDRA 5D3KA 3C45A 5ALGA 3TJMA 4CCWA 2OGZA 3AJAA 3HABA 3E1GA 1XZGA 1PV1A 4NMWA 5T4BA 4PNZA 2GBGA 3C87A 4BCBA 4FTWA 4G1FA 4NZZA 1UOQA 2XE4A 3MVEA 2XUJA 3O4IA 3F97A 5FDFA 3G0DA 1EB9A 1EI9A 5AKHA
chains in the Genus database with same CATH superfamily
3GOQA 4PXAA 4IMPA 3OJWA 4B48A 2ODPA 2AVDA 1HDOA 3C4QA 1CDDA 2JPDA 5KYGA 2D7DA 4O4JF 4QLBA 4ENQA 2WWHA 3NM6B 3T5CA 1VIMA 4ZDWA 5ES4B 1RZRD 2H29A 2PL3A 4R2JA 1JFFA 5BW8A 2P4EA 1N2ZA 4Z9YA 1RE0A 3RRXA 4FKMA 4PSKA 1Q95A 2FN9A 4MQEA 3M6LA 1SUPA 1YJ8A 3OMLA 3DO5A 2DFLA 3HI6A 3P9YA 3QENA 4D4IA 3LHKA 2WD7B 2I22A 4RF4A 2QUKA 2WAMA 3C4JA 4GBJA 3DV2A 1KE2A 5EG5A 3RV4A 3ZJ5A 4DSAA 4CEJB 2BZGA 1IQPA 1PT9A 2J1LA 4MGHA 5HQJA 3SX4A 3KOOA 3UHPA 4CJXA 3UAYA 5ADVA 4AJKA 1QFYA 1O5TA 5DCWA 4KXXA 4DLNA 3VZQA 4RXMA 4ZMSA 2XCLA 3PXEA 3CPJB 3KT8A 4YIKA 1KNQA 3UHFA 1N5IA 4XYGA 1LTKA 5KREA 2XUDA 1C3LA 3IVXA 1YDFA 2Z3VA 2AG1A 2Q6OA 3ZKAA 5F9MA 4KPGA 1Q44A 3PCTA 3VSDA 4AK9A 2VYNA 1KS9A 1M3SA 5ESDA 2Z8XA 5JQGA 4ZVOA 1XU7A 2O2ZA 1EZ1A 3QELA 4AF8A 9LDBA 1N32B 5JCJA 3UAZA 2GF0A 5EJGA 1UJCA 3ORYA 1YZYA 5DTJA 4Q39A 1WSAA 1PT8A 4FZ3A 4ZP1A 5HM6A 5BVGB 1TZ2A 3U7GA 4IZOA 1IQ0A 4PANA 3F4BA 4CIXA 3W5JA 5KKCA 1KQ3A 5K8IA 3UXYA 1E1RD 2K87A 3TBHA 3VV2A 1KR5A 4DBLE 3PHCA 4MGZR 4NPAA 1V7QA 3E58A 5BN4A 3K1JA 3PWZA 4KQGA 4TT8A 5D3ZA 3N0WA 1GPDG 2CWWA 3G5TA 1BOFA 1T3LA 4GE3A 3SYRA 3H19A 4M1OA 3ZU2A 3EB9A 5KNBA 4KO3S 1WZ2A 1JR2A 4IIBA 2ZQ5A 4PLPA 5AKYA 4B33A 3MGGA 3CUVA 3H2HA 2ATIA 5L9AA 2BELA 2QROA 4EHNA 4FZ5A 1QG6A 1V5GA 1P2FA 5L51A 1IHOA 4ZZ3A 3ZD6A 3G2NA 5IAEA 4Q9DA 3TPCA 2FPIB 3CMMA 4CDGA 3MIIA 5TXGA 2W4MA 1V7ZA 4BKUA 1AHHA 3PQFA 4IO0A 1R3UA 1TQDA 1IBSA 1S2NA 4RD1A 1SPBS 4LWZA 5DLDA 2FZLA 1E64A 1ISMA 4PHFA 5DTQA 2R6ZA 1JXOA 1PS8A 4XE5A 3HCPA 1G38A 3KS9A 4YT5A 1ZBQA 2MHCA 4Z4QA 2NO6A 2XWBF 3FHOA 3MTIA 4Q05A 1UMDB 3C6MA 1RDFA 3MRVA 4QUJA 1ZLYA 3M4JA 3O4RA 4IGEA 1PLKA 3LQKA 4OREX 1E6LA 3TR0A 5JPIA 5E1DA 2CXTA 2HJWA 2O1EA 5KI6A 3D5TA 3JD3A 1A9PA 4FCWA 2GN6A 1CEXA 2O8VA 2Z2IA 3H7AA 4IJ5A 4IV5A 4YLEA 3SEFA 1OX4B 1U3CA 4YAOA 1P8AA 4X41A 4U1RA 2WPDD 2J0QA 5FJJA 4B3MB 2XGSA 1L4UA 2R2AA 4DL9A 2R8PA 4FBGA 3L8MA 2RGNC 4V0KA 2K6GA 3TS1A 1MUUA 2QNRA 3AI7A 1ECFA 3QXSA 1U3UA 1GR1A 1NWHA 2FRDC 4MPRA 1C9EA 4RJLA 2BGUA 3IUQA 2FN3A 3P27A 3N3BC 4X3CA 4BUJA 4WBNB 1QP4A 4FXOA 4RKWA 3O4GA 4KHZA 5A0VA 1WVIA 5I4CA 1V8PA 5FPHA 1RQGA 5H82A 1NUUA 1YZLA 3KKQA 2QSJA 1O95A 3P97A 3T8YA 4A82A 3AKEA 5EOVA 3JATA 3ZH9B 3ZK7A 3C3YA 4GSYA 4QYIA 4DDMA 4L08A 1HYEA 1W47A 1TOAA 1NOJA 1R0LA 5DGIA 1YQ9A 4D0SA 2DYKA 1JG6A 3F5MA 2PZEA 2ZUWA 1S1MA 4P7GA 2WB2A 4ZAWA 5ADHA 3TLXA 1NRXA 3TGWA 3ZBUA 5BUZA 3N70A 2C04A 1W36C 4BXOA 2CMDA 3L84A 3X1XA 4YV0A 9LDTA 4JJ4A 2I4LA 1YK0A 5EUBA 3VZCA 3D4LA 1ESMA 3ZZMA 3VJMA 2VYVD 1KQFA 3DXFA 4ZDIA 4IFTA 1W1IA 2GZSA 2JJ2D 1C4WA 4ID3A 1BCSB 5DISB 3T7RA 4EUKA 4QVKA 3MFYA 2C7VA 3DT8A 3O73A 4TV9A 3ZU4A 3VAZA 5F51A 1OYYA 1T8UA 2BRUC 1LQUA 4TVOA 4B8YA 1CVRA 1S9HA 1BA2A 3PGJA 4XYBA 5DHPA 1NBWB 3K1YA 4I50A 2QLTA 2IUTA 4WUTA 4B3HA 2ZSAA 1UM8A 4C87A 5I4IA 2RGYA 1IN7A 4WLEA 4D4GA 1A2QA 1RWQA 4LOLA 3U7IA 2CBZA 2LKDA 2O23A 2NO7A 2W6PA 2JGIA 2GFQA 4CL0A 4B6GA 2I03A 1JDPA 4NPCA 2DGDA 3GD5A 2AFHE 3PGA1 4BMOB 4UE2A 4EY6A 2C3OA 1F4LA 2W11A 3JQGB 4ZODA 4HT3B 2UZ4A 3ZG6A 1EGMB 2Q3BA 4R8SA 1N7GA 1O94D 2NZJA 4LX0A 2C8JA 2VJLA 4YJ3F 1U9IA 4DHWA 1MOQA 4FYPA 3O4FA 4A0QA 1MZVA 1PR4A 1W5BA 1WCV1 3SN6A 3SY8A 3FPKA 3P0JA 1X7YA 3NLLA 4JP8A 2VPIA 4E4YA 1Z5ZA 5LNK1 2R6HA 2ASEA 4MW9A 1X9HA 1WQ1R 1N33B 3BTVA 4WXHA 5IKEA 2XCQA 1AM4D 2RHBA 1U7XA 4HO1X 4Y1RB 4GPEA 4MGYR 5CNMA 5TE9A 3MWLA 3F1LA 1TJ5A 1CULC 1XCPA 2C83A 2QXUA 2XV1A 3W8EA 3LBHA 3OZWA 2PS0A 3IQFA 4RPJA 1P80A 1NF2A 2FWAA 2ZIZA 4RA6B 4J0KA 2A1UB 1L5KA 3TLKA 2V7UA 1LLUA 1P73A 2GK7A 2C2OA 1KRWA 1KIFA 3CISA 5KTPA 3SQOA 4YJ2B 2JHFA 3NDRA 3E9EA 3MTEA 3VR6A 3RS4A 2B0JA 3I73A 1GY8A 2OLKA 3B7PA 2O9JA 4F3TA 2PJRA 2A5LA 1BIFA 4ZT5A 1XZ8A 2IOFK 2RCYA 2ZTLA 3K9QO 1C8BA 1QH8A 1NXTA 1JBKA 1Z4JA 1AXGA 3RT1A 2J8ZA 2Z1NA 3PQ2A 1T4CA 1A4UA 1W2GA 4JQYA 5BQFA 3KB1A 3LI2A 2R25B 2VVTA 2YMQA 4E5MA 1RI3A 4AO8A 4O3MA 4I4IA 2QLLA 3K72B 1K4KA 1B43A 4MUXA 3UHAA 5FD8A 4NJEB 2BFEA 1YUNA 3DCYA 3EAGA 3MINB 1FU8A 5LZ5A 2QS9A 3NHRA 4MW4A 1U9JA 1S3IA 1SY7A 13PKA 3OPMA 3WAJA 1M76A 2IEDA 5JNWA 2GH1A 4DC9A 1VKNA 2BVNA 5AKGA 2R7AA 3H75A 1X3SA 2X1HA 5D3QA 1W94A 1A71A 3TM4A 4DMGA 1GR0A 1ZGGA 1W46A 2DHCA 2PKXA 3AZPA 5I7HA 2R6JA 4H1WA 2ZUTA 1RIIA 3EXFB 3JD0A 2XZOA 2XTAA 3VHQA 5SY4A 1UZLA 1CUZA 1TTHA 2VWGA 2QRMA 2PJDA 1G6Q1 3JARB 4IJUA 5TS2A 1Q0SA 2YOFA 3EGOA 1B0UA 2Z43A 3GFBA 1J0CA 1KMMA 1X3LA 3PPVA 4MVWA 5L3QA 5LKAA 5LJIA 3KPWA 2H2HA 3FUCA 4HDOB 5G1NA 2D4HA 3GLGE 5SZJA 3CRNA 1NQWA 1RWXA 5C53B 2ID4A 5FL3A 1PZXA 3P26A 5AW4A 5FOWA 5DGTA 1BX0A 3OTQA 1BU5A 3OKAA 4L07A 1VJGA 2OKGA 4MA4A 3OHMA 5I7WA 3A6ZA 4PYQA 1GZ3A 1ORWA 1GGFA 3IJEB 3UBMA 3PEWA 3J7AC 3GGDA 1TYAE 2NT4A 4FFNA 3DDCA 521PA 1RXCA 4DARA 4I6JA 4KIGA 3DL2A 4E3ZA 3WLHA 3DONA 4ZU1X 2QN1A 3T0FA 3DHYA 1C3OA 2RHGB 3VPAA 4G5SA 3JY6A 1KVRA 2WFLA 3LP8A 4AX4A 5GWXA 4JY7A 3ABQB 4BE7B 2XITA 4JK3A 2A9OA 721PA 2GESA 5NULA 1ZJ5A 3FLEA 3T52A 3ETDA 4GG1A 1EVKA 2CNWD 1CG6A 2DSNA 4G5FA 4ABYA 3CUSA 2O5VA 4F8YA 3HDHA 4HUJA 2DQKA 2XHZA 3OOWA 3D1LA 3B12A 5J2UB 3RUDA 3COYA 1W49A 4MWZA 4UCFA 1X7GA 1XVUA 2ONCA 2HRDA 2JA2A 3R0QA 2EOAA 3ANNA 4D4JA 1QK3A 2ZXEA 3E2PA 1WZIA 1T1EA 5CU7A 2Q5OA 4BNWA 3U61B 1RJWA 4BO3A 3GBSA 1P5JA 2OB2A 1BMFD 3DEJA 1VQ1A 4OAPA 3TNYA 1O9GA 5D5HA 4RY8A 1ST3A 4AKIA 4IDPA 1Q19A 1XQ1A 2C5FA 4YPOA 5DNCA 5FFMA 4G1UC 4DG5A 3VR4H 3SOZA 1SRRA 4YJHA 1M1NA 2F9FA 3PICA 3O5AA 4PO9A 4EYQA 3QWHA 5IKMA 3BGWA 2Y66A 2Q6LA 2YHSA 5DT2A 2Z2YA 3QPUA 2G0TA 2QD4A 1BD3A 5AHXA 4Z9BA 5D5PA 3A9SA 1IEQA 5AK5A 3FVTA 5DEOA 3I6ZA 1B1AA 5F9HA 2BUBA 4O4JA 5IXJA 1N9GA 1NXVA 3IP5A 3MA0A 4GMDA 3H83A 4PS1A 1HT3A 2EQ5A 2JEZA 1UBHS 2Q5FA 3KNZA 2WF9A 1U3GA 2X1MA 2NADA 1K8RA 1A7UA 3Q0IA 1M0WA 5FFFA 4TTPA 3ZYCA 4BKPA 4BLSA 2IXAA 3BK2A 4G4GA 4Q9HA 2R5WA 3QVGA 3ADOA 4YJGB 1VLJA 1R37A 4ZICA 4UMDA 1DMRA 3ZKWA 1JQJC 2I29A 1K63A 1Z07A 4II3A 1HEYA 4AG5A 4EPTA 3RIMA 3OF2A 2C4NA 2CXXA 2ODQA 1V16A 4YP5A 1RAEA 4U5QA 3SQDA 4RBNA 1PNTA 2WABA 2ZW9A 3FJYA 3EXHA 4R1NA 2P3OA 2J30A 3NM5A 4LF7B 3VBCA 2E4VA 3EYAA 2NUTB 2YWCA 2P5YA 3CONA 1DC5A 1K7EB 2XMZA 5AKIA 2JNWA 5DLPA 1O58A 1CYEA 2B6HA 3LY5A 2AKAB 4YMTA 4XFJA 2FE1A 2NZ2A 1ZCBA 3FFAA 4JLKA 3V8VA 4RFVA 2P2ZA 2EL7A 4TRJA 1LV7A 1P61B 4AN0A 1XA3A 5CA0F 4PAWA 3VHRA 1GZ5A 2JEOA 3K31A 2GN8A 3EFEA 3L3BA 3EWAA 1ZGBA 4HDKA 1H93A 4B8ZA 1FBNA 3RSQA 3QW2A 4BWVA 1DG9A 3G7SA 2JFOA 3FHLA 2JLWA 4LZNA 4R1QA 1KVUA 2V6FA 4F46A 4OHKA 4HC4A 3IUBA 3GJ5A 1EFLA 2RJOA 4MV1A 3ZU6A 1JP7A 4MIKA 1LKZA 1V5IA 2JAHA 3V97A 4A0SA 2P91A 2D5BA 2G5CA 1GSAA 2VT3A 4FFPA 4F60A 2OFWA 2BY4A 2FDRA 2VDWA 5DLEA 3ITNA 5EFOA 5FNVB 1ZGJA 4A26A 4G4SP 3X1JA 4QWMA 4CLXA 3WIUA 3VKHA 3GA7A 4RLHA 2GA9A 1W0JD 3H11A 3WGIA 4RGBA 1XDZA 4KN9S 2G7MC 3GGSA 3KVVA 1FLAA 3MSCA 3T41A 1I6WA 4FFWA 1CP2A 4GVPA 5ITZA 1N6LA 3E81A 1CB7A 2C9YA 3RU9A 4F3RA 3RVNA 2GJ9A 1V8BA 3KZXA 1ZEJA 5D7NA 4OHMA 3DLTA 3LQRA 4NFHA 3H9QA 2ZDGA 1I5OA 2CVPA 2Y0CA 3L7KA 3EVGA 3COVA 5ALRA 1K27A 5INTA 4JVOA 4X3OA 4XGRA 3ZGXA 4LFAB 1BHQ1 3H1PA 4Z4GA 2JG3A 5DX0A 1C0KA 1NMQA 2WJHA 1DBQA 3KL2A 3QA3E 1J8VA 2YNMC 4HXFB 4LY6A 5E8JA 3GJ3A 1QV6A 3L06A 4UEQA 2CDAA 5CR9A 3GFFA 1IXRC 3LK6A 4KWTA 1P5RA 1L5NA 3GRPA 1U1IA 2WNIA 3EC7A 2BGTA 2REOA 3EH1A 3H3XA 2WYOA 4Q3NA 3E2MA 1BX1A 1DE0A 4MUKA 4D9MA 1I4WA 2OZEA 1DQYA 4U9HS 3LQ2A 2AFVA 4XUCA 2HA6A 5LQCA 5ARDA 1YR8A 3KUDA 3BMOA 3BTOA 3OJEA 4IH1A 4YRKA 1Q0ZA 3BGSA 2B61A 2QPLA 3HR8A 1R10A 3V7FA 1CUGA 2IYSA 3QXHA 2RGAA 2Y9MB 1IQUA 2HSGA 1DTWA 3K05A 2K5UA 4IDAA 4GVLA 3HVJA 3CR7A 3UMCA 1IM8A 4XQ9A 1JDVA 1W36D 3U3MA 1MIOA 4UEJA 2NXJA 4H15A 1KAGA 4IO1A 2QTCA 1MB3A 2WE7A 1UBRS 4NMHA 1W59A 2P4SA 3AHEA 5FWXA 3OUTA 4Q1EA 1JMYA 1JKMA 3U0VA 5L3RA 4IIDA 5IUJC 1OZFA 4RYDA 1FJGB 4RPCA 2YJNA 4JBWA 1A9XA 4WADA 1AGRA 4AJ9A 5C1DA 4ITVA 4ZYVA 1KARA 3FFWA 4QZVA 4XB1A 2A5GA 3ORRA 2IWHA 4D4KA 2HHLA 2UYYA 2OC9A 3BILA 4MV8A 1R5BA 4HPXB 4LZJA 3DSRA 3DZHA 1T2AA 3HYNA 1W35A 3CE6A 2ZYTX 2X6QA 4EUSA 2LKCA 2ZLBA 1BXRA 1USIA 2CNOA 3KQPA 4OHPA 2OXFA 3OMXA 4H1TA 4EY4A 5CB8A 3KDAA 4DIDA 4JCOA 2PGJA 1DZ3A 1AKWA 3FDFA 1JLMA 3RBVA 1EBUA 1Q1GA 3ASVA 3TB6A 3TW8B 3IBGA 4NG5A 3RWMB 3S40A 2ZQYA 2Q4RA 1KDZA 1U0OC 5AVQA 1ZCZA 3FPGA 4TWIA 1SXJE 2Q4DA 4B32A 2H1OA 1NW4A 2TS1A 4LHWA 2DJ5A 1YDEA 3WL6A 5EIOA 3R44A 4LYAA 5CT8A 1QHSA 2R85A 5DN6D 2HQ1A 3JSXA 1FYWA 1EFVA 1E9EA 4TYPA 4CF6A 4B2PA 3GLTA 4RVOA 5DHUA 3VI4B 3TSYA 1G9XA 3MJSA 3ROKA 3JRXA 3AHDA 3IC5A 4XQGA 2VNIA 3BK1A 3HJTA 4IEEA 3I2GA 1TYBE 5IMSA 4GYKA 4N39A 4G8CA 1KYXA 1RP1A 3BQ9A 2X22A 4RWZA 5EVCA 5L95A 2E5LB 1QGUA 3KUXA 4ZVSA 3AFIA 5ELMA 3I9MA 1WW3A 1Z74A 3GWZA 4DCNA 4FEGA 3WRXC 3CLSC 3ZJ4A 1DI0A 1NNSA 4FDMA 1XDDA 2OWDA 2QZZA 2WJPA 1TCUA 3KCQA 2CNDA 1U5BB 3DVQX 3LHIA 4BRWA 3LC2O 3E4CA 4JXKA 3QJGA 2BSXA 4IV0A 1DFGA 2NVUB 3B3JA 3DDOA 3Q7RA 1H5QA 1RS0A 2XVYA 2YHUA 2F6RA 3PXUA 4GOMD 3DOJA 4QDKA 4RIHA 3WDKA 4A0RA 5EERA 4YT8A 5JWRA 1HR0B 2AX3A 3NDBB 2VUIB 1HQYE 4H6PA 4YUVA 4FVTA 3ZCSA 1ZBDA 1EDBA 4FOLA 4ZI7B 1P7VA 1R3DA 3FWZA 5KNDD 3V32A 1FRVA 5CYPA 2NOAA 3FY4A 3L0OA 3Q1LA 5CW2A 2EFGA 1CIJA 1XL1A 3ICWA 3JD4A 3VYWA 2V5VA 5C1OA 2BGRA 2VPYA 4FYIA 1DBSA 5DLQC 4KYTA 3OEHA 2WHQA 3JV7A 4JLWA 2XXAB 2FTKE 1UBJS 3VR4D 3VU0A 2DBRA 3ZW7A 4PPNA 3WYGA 3AF2A 1SIUA 1UPBA 4PVDA 1PR2A 4E94A 1CUJA 3L0IB 1CNMA 1U3TA 4IQ8A 5A2QA 5K0LA 1BVRA 4KFTA 4QELA 4BGUA 4B46A 1KK2A 2WF6A 1YZGA 1E7QA 1PQPA 1RPJA 1STOA 2H1CA 1Z22A 2X5XA 2ZR9A 5MFPA 5AVKA 4D3XA 4DLYA 3CMCO 1T8YA 3IBFA 4FMCB 1FJ2A 2F3UA 4MV5A 4NL4H 1Y3DE 2W6QA 1NF8A 3N2GA 3ZK8A 4LTDA 1E9CA 4KUHA 4QU9A 1EE9A 2JGEA 3GLHB 1PI3A 2WIKA 1ZINA 5FV4A 5MN4A 3OQIB 4O2AB 1G3QA 4J3JA 2C1XA 5IDVA 1FEZA 3RS5A 2JLAA 5FJIA 1S02A 1YR3A 1WHSB 1T25A 4HLNA 2R5NA 4KFCA 3P71T 3PX2A 2BBSA 1O4VA 5JT1A 4BMZA 1X15A 5AD1A 1K98A 3WB9A 1I24A 3K1ZA 4PNHA 4RO0A 4ZJZA 1OBCA 1SG6A 4MTLA 1LH0A 3F3SA 1BG6A 4GPIB 3D6NB 3EZXA 3PSAA 1I7NA 2B8TA 2B4AA 8LDHA 1GADO 3P9SA 1JKJB 1KR2A 1A8QA 3A9CA 3V9PA 3F96A 1UMCA 3KSZO 2VR1A 2ON6A 3OURA 1K97A 1OIXA 2JIDA 3KJXA 3ZI7A 5LUAA 3AR6A 4ARZB 4WLOA 3SLRA 4EG3A 3SM9A 1H2EA 4GDFA 2Q49A 1ZNYA 3T4EA 4EVSA 3H2GA 3TDMA 2DCMA 4QPJC 1P1CA 5T8KA 2F8LA 3VNSA 1SUCA 4ANFA 3HKCA 1VPWA 1PIWA 3KUKA 3L8DA 2MOKA 3WS7A 2YWFA 1AO3A 5CAEB 4KXYA 5AKZA 4JXZA 3I58A 4D9JA 3OVMA 4KQMA 5FR2A 3WKBA 4BU0A 3C8ZA 2AJDA 1J25A 3G5AA 3OTGA 2P2SA 2Q2NA 2QTZA 3F2IA 4FJ0A 4GC5A 4KDEA 3BB4A 4ON9A 4JT4A 1VKOA 4ZQCB 1GZHB 1GWNA 4MJ3A 4K6CA 4CGYA 3K0CC 1HURA 4KVFA 4MQ6A 3RI3A 3VMMA 4I6GA 1CS0B 4EVRA 2IX9A 3K71B 3EA5A 4A27A 1F8UA 1GAEO 3EGXB 3IEXA 1EP9A 2BTOA 4QGFA 3RSGA 5LNK6 1BW9B 3ZXXA 4RZXA 4E5KA 4F9GA 1IUNA 5E4FA 2UZ0A 4H7KA 1KSGA 3PFNA 4Y2RA 3EMVA 1NJ6A 2PX6A 4WOKA 4XDHA 3BKWA 3FPJA 2XD4A 4MO9A 1EFKA 2PG3A 3WIDA 3WNQA 4B0PA 2KJQA 1EWQA 1QUEA 1G8PA 4NCAA 4IQ0A 1QK4A 2XA2A 4FN5A 4ZT7A 2HGZA 3VOBA 1Y8AA 1X2EA 1C1DA 1N5RA 4TS4A 1YI1A 3ZS9A 2J3HA 3VYVA 2PUVA 2V7QA 5E2IA 4W5NA 3QXGA 1F17A 3TOCA 1T6NA 4KQJA 5I8ZA 2QT1A 3K0FA 4TROA 1E2GA 1GYPA 4FEYA 4OJKA 3AEUA 1K08A 2EGHA 1TIPA 3LBFA 4O5AA 1P7YA 1ZM9A 4RL4A 1GU7A 4Q9IA 2ZRFA 3IB3A 3AOEA 4ZGGA 1UADA 5JAOA 3H2IA 3L93A 3WGVA 5EKTA 5JYEA 2CF6A 4DYHA 3DBIA 3FCEA 2YXPX 4JDUA 4EECA 5CDGA 3KVYA 1G20E 4ZGBA 3P2OA 3RHSA 4PAQA 1FFAA 1FUEA 5EJAA 4D8VA 4P3NA 5A6SA 3FE2A 2FN7A 4HJRA 4G8DA 3ZEAA 3LC0A 1FDVA 1IBCA 1BDIA 1RKBA 1C9MA 1FUYB 1RWWA 2EXXA 1UK8A 3A7EA 3C16C 1YAJA 1KOLA 3TZCA 4CCYB 4D44A 4EG7A 1SUIA 2XVXA 4GW3A 2QRPA 2PMBA 5ERXA 4Z4HA 1BQ3A 1P1FA 2IK8A 4B80A 1L3CA 2H4XA 2WUDA 1XF1A 4IJMA 4WZBE 4L22A 4QC2A 2HCJB 3DDHA 2FY8A 1N7HA 1ADJA 1XNGA 4K81B 1TLTA 3EIFA 4LN1A 4UHDA 3MF4A 4TKUA 4Z5XA 1R64A 4FFDA 3BSSA 1G7CA 5H83A 3D2AA 2F9LA 2C1ZA 3I0NA 3RO7A 5LMNB 1IHYA 4A6DA 2WWXA 1HSOA 3HWSA 1Z38A 2V54A 2A0KA 2CMKA 2P68A 1EEXB 4PTZA 2FR8C 1PNOA 3EVEA 3O82A 4KLNA 4BUZA 1TLFA 2DPYA 2OG2A 5DTRA 1GSIA 3T9FA 5HBRA 1RQ7A 5F77A 3FYDA 1JLHA 3GQBA 2BM9A 4MI1A 4ALNA 4G63A 3LRPA 2IYOA 2OCLA 1YBVA 1PLLA 1L7RA 5CLGA 3ANLA 4D02A 4WASA 1I8TA 4EZBA 1ZOIA 2NU7B 1VB5A 1CK4A 1E0DA 1UFRA 1NJ2A 2G71A 2QN6A 1KO8A 2V59A 2WHPB 1JLRA 2ZI3A 3DNPA 1NL3A 3N6VA 5A3RA 1ZCAA 3UMBA 4NZ9A 1IEXA 2YNMD 4LJ5A 3WGZA 1ZXBA 2V9CA 3HY3A 4AY6A 5JH7F 1R7RA 1J1IA 1QHIA 2XMCA 1VSQA 2ZBGA 3L8HA 4NOLA 3RUPA 3Q72A 4CQMB 5C7OO 1DJNA 2P40A 5LQAA 2MMCA 4DNFA 3LCMA 3W2EA 2FSGA 4QASA 2X9NA 1GUZA 3KWMA 4RHEA 1CRQA 2C31A 2J5QA 1X1CA 2YDXA 3EBPA 3HRIA 3L9WA 5KMGA 3MJ4A 1MAAA 3ETJA 5HS4A 1N2XA 1JAIA 1G8AA 2B8EA 3BQMB 2ET6A 1V8OA 3HM2A 2XT6A 4RYLA 5I9SA 2IA5A 1REQA 2A6PA 3NRJA 5AK0A 1QXSA 2ZIVB 4W63A 5KQGA 2YKGA 5D1HA 1MC8A 4DNQA 2K2WA 1T5OA 3D59A 3MLEA 3L7BA 1JEYB 2WYVA 1Q6ZA 1T2UA 4R9NA 4CF3A 2J67A 3MWGA 2H4JA 3OPXA 2UUCB 4WKNA 3GJXC 5L40A 4OHUA 4X20B 5D87A 1H4TA 4GKBA 4AC9A 3LP6A 3C41J 4OU5A 2ES4A 2LTAA 3A6EA 3U80A 3ZQ4A 3SMQA 2FWJA 5C8YF 4IIXA 4D9FA 3DVRX 5K0SA 3TGLA 3GJ0A 4JAVC 3G49A 3OETA 2AGVA 4Z8XA 4NC9A 1OWNA 4D9BA 2J45A 2GFIA 3M9WA 4XYMA 4YK7A 2HIGA 1KWKA 2X8JA 3HSKA 2GYYA 2QM3A 5EMHA 2WUEA 1YONA 3H7IA 1A9QA 1G4HA 1LPBB 1OW3B 2NO9A 3WLNA 3X1DA 1ML3A 5GP1A 4KTVE 1KU0A 2QENA 2JA1A 4DF3A 2BBTA 3GO4A 3I12A 1Y4DE 2D5IA 5FI1B 1J1ZA 3E7WA 3WQBA 5K2MA 1U5CA 4YRRA 1L4FA 2P7HA 1FRFS 2ZUUA 3LPNA 4GR5A 5GM1A 3EEOA 1YQGA 4HLQB 2VXCA 3KB6A 4DM3A 3QNWA 4NS1A 2JIQA 1GHTA 1RXYA 2FQXA 3OKFA 4EKDA 5H59A 5P21A 4KWCA 4MUIA 1UF9A 4IDCA 5LYJA 5SYMA 3HK2A 4B9EA 4BVKA 4B5KA 1EIWA 2C2MA 4P34A 1ABFA 2CSUA 1K5DA 4UE6A 2BH9A 1AO0A 1H2WA 4LV8B 4DNPA 1M34A 1A5TA 1U0TA 2V3VA 2C2ZA 2R2GA 3PQDA 4P82A 4TL8A 5BOVA 3RLIA 4LGVA 2QTHA 1QNLA 3TFOA 3G02A 1D1SA 3UJ6A 2ONKA 4CM4A 4EJSA 5A4FS 5IBRA 5EKUA 3RK1A 2GD6A 1TKRA 2A9QA 1NQ5A 1P2BA 2GAFA 4FHEA 5HNKA 1OYOA 3OU7A 2JH3A 3QOFA 5DW0A 1BN7A 4MCJA 4YTEA 2XOXA 5KTMA 5D6OA 2N0SA 5BR1A 3JAKA 2R8XA 2WJZB 3R3UA 4GOXA 4DDWA 4RTOA 1E59A 2DFVA 4FZVA 3ZWCA 2XB2A 4XCQA 3RVKA 1E0JA 4LF4B 3CXRA 2IPOA 2I91A 2XAAA 4UVGA 2C07A 3MPUA 4EF5A 2R7KA 1E6WA 2CD7A 2O4UX 1KJ9A 4U7FA 3K94A 1VTKA 3GJ8A 2LCQA 3K0SA 4M37A 3CLSD 4HDMB 4CR7A 3QITA 3EASA 3V7YA 1VKJA 1YQWA 5JFOA 4K05A 4PN7A 4RD6A 1XTVA 5GJVC 2WYHA 3FUTA 1HNZB 1UP6A 3HZZA 5JNLA 2HXGA 2DPMA 5DN9A 4EEZA 3FKSD 4G8BA 4OHOA 4DR3B 1CUAA 4RELA 1NY5A 1W36B 3NG1A 4RWEA 5LFAA 3P9NA 4G0YA 1F48A 1GNQA 5JDIA 4UHJA 1QTNA 3LT2A 1KI9A 4WT7A 2J3LA 4LY9A 5ICEA 1XCMA 1DV2A 5FA5A 5A04A 1C1YA 2BMEA 4JLMA 3PJDA 4C7JA 4LY0A 4K3VA 4P54A 1ZSYA 3UF0A 1QZUA 1UC8A 3N6RA 4Y2PA 4U3JB 2ATEA 3SSAA 2ZI4A 4O4LF 4BV3A 1LFAA 1ABEA 2JVKA 1EFHA 1HRKA 4TLLB 4JNKA 1VYHA 5DW3A 4PX5A 3UCEA 2AKYA 1E2LA 5EKDA 5F5LA 4UD6A 5FUVA 3TLZA 1W2WB 3D4OA 4UQPA 3C3BA 1QNFA 2EERA 1F2VA 3M5DA 5FI0B 1KI3A 2RIPA 3R9IA 4AMBA 3U4DA 4JLOA 2BCEA 2IDKA 3BMXA 3KM0A 4PHGA 4AZ0B 4WK0B 4YDHB 4BFTA 3N2KB 3HU2A 5BSVA 2GRAA 4UJ5A 3ZXSA 4DB4A 1QTRA 1O95C 4JB0A 5FBLB 4CMEA 2E1RA 4QGAA 3L1JA 1VHJA 4DMHA 1XGKA 2RAUA 2NXNA 2BCJQ 2AX4A 2NSYA 3G9TA 3HCCA 3DMTA 1ORTA 3NFYA 2W48A 3ELYA 3UOWA 4YQEA 4MWGA 1UBMS 2OK7A 3BTSA 3GT7A 1SB8A 4GEGA 3PNKA 2X19A 4R8KA 3HJUA 4Q3KA 3GUVA 3PDUA 4MS4A 4RZSA 4TSKA 4KXUA 1C4OA 2PGNA 5TPZD 4BL5A 1XE3A 2ACKA 2B1RA 1XJ0A 2X1VA 1P44A 3AI2A 3FDJA 3OA2A 4DR1B 1MABB 2R7LA 5DNDA 2BYTA 5H80A 1T8WA 3PT9A 1XN1A 2PLRA 4F9FA 4UM9D 3JQ7A 3JQ8A 1AUPA 2ZUBA 1RU3A 2Y76A 2A67A 2I6FA 3V6LA 4PX3A 3EZYA 3ETHA 3Q9NA 4J7XA 4HY3A 5KNBH 1YRLA 4RDIA 1OX5A 4ZZIA 4ITRC 3DEHA 1NF3A 1E1CB 3QWFA 2LUOA 4FIZA 1CUVA 3KKEA 4UDXX 1WU8A 4N8SA 1VG1A 2GO7A 3IPRA 2W8BA 4K28A 1TECE 1TYCA 4EQZA 1QZZA 5JFTA 4H7DA 4LF8B 2ZAYA 2P6NA 3NHZA 4U0KA 3DE0X 2EKQA 5CCDA 3WRVA 4DA8A 1BXGB 3AY0A 1HT0A 4OHCA 1MB0A 1VCNA 5C1IA 1JHZA 3MTAA 1QAQA 3HKEA 4PPYA 4EIWA 1ZNXA 1OPXA 4TMVA 3UMFA 1ICEA 5D7BA 4KGZA 3UPDA 3TCKA 1MHTA 4Y67A 2QT9A 1Q16A 4QYMA 5CNKA 4QQRA 3MHPA 1ECCA 1VC2A 2GK6A 2HHAA 2XQFA 4HAWA 2VJYA 1TYEB 3WXBA 1U9IC 2BBWA 2OP1A 2F59A 3PHLA 3EWNA 1EUYA 2HEIA 3VU3A 1H3EA 2LV8A 2HDOA 6REQA 2IH2A 3B1ZA 3OQVA 1B16A 1Z8HA 1EUCA 4P08A 4Z99A 5JNRA 4BRSA 5KYYA 2ALJA 4UNPA 5TQ2B 2A84A 3C15C 4CT4B 5J58A 3LCUA 3CZ5A 4LZLA 3PL1A 5AMXA 1D4OA 1ZIPA 1P6QA 3HBAA 1SBTA 3OOYA 1G3RA 1QRAA 4DIMA 3R0JA 1U90A 3CSDA 2YY6A 2W6JA 3KXPA 4F3NA 4PNEA 4WY2A 1R0XA 5JSFA 5JXGA 3LIIA 2ESRA 3CRQA 4EVIA 4RJTA 3PQ7A 4UZEA 1G17A 2GILA 2I4MA 1EUDA 5IYZF 2O50A 1ZKDA 3GDWA 3RK0A 1JX6A 4J7CA 4QPPA 3KFVA 4NSNA 1YVEI 3RR2A 2EYQA 5JFGA 3QYJA 5KYKA 1AKRA 5AW9A 1L5HA 2VPWA 3KZMA 3QEMB 4Q7KA 1G5QA 2CBXA 3PUIA 5FWDA 1WY5A 4JBXA 5CVVA 2A35A 1KXZA 3W9UA 4HAXA 1QC5A 2QE7D 1M8GA 1XD8A 4LIPD 1NR5A 1T34A 1SC9A 3S8EA 1EJ6A 2QP3A 3TR5A 3QFFA 4KLZA 1RQXA 5E4TA 3R20A 3IMGA 5BWCA 1IHDA 2W2NA 3OZAA 3UKOA 4XGKA 3ZYZA 3ONNA 2BFMA 2DUMA 4OMCA 4BTLA 2LCIA 4CLRA 3GLUA 3FUUA 3GFSA 1TM4E 4KXLA 5U4QA 5A9SB 5EJ2A 5TQ0B 3FHTA 2OUIA 4Z3DA 2QL6A 2SCUB 4NH0A 2R8ZA 3P9KA 4IHJA 2O0JA 2QRVA 3M5CA 3UO8B 5JBIA 2I2XB 2WB4A 4BEJA 2UYHA 1JJAA 5IH7A 2QJOA 3COJA 2Z56A 3BB1A 3QSYA 3TAHA 3UQZA 2R6FA 2CT8A 2ZJ2A 5ED4A 4HEA1 1K6JA 1G5RA 4OVKA 4OXRA 4RHCA 4YB8A 3UJBA 5GONA 5JW6A 2WU3A 3COWA 1Y8QA 2CKMA 1LSOA 1IMJA 1A9YA 2FW6A 2JAOA 2XVMA 3CURA 1UPFA 4UHKA 4BNZA 1KZ6A 3Q8XB 1E5QA 3UW3A 1FXUA 2OXRA 3MWFA 1VG9B 3W2TA 3ZE9A 4BKMA 1F9EA 2ENUA 3X43A 3FSJX 4IGAA 2FKAA 2YJGA 4MS3B 5AM3A 5AKJA 4MKZA 2KB0A 3UYKA 5G0TA 2DR2A 4LFBB 3VDNB 2EP7A 3ZWNA 3I3OA 5A5FA 4DKJA 1FNSA 3R74A 3PNLA 3FNQA 1PFQA 4RMIA 2XX3A 4Q9JA 1NZFA 1WUKS 3C3EA 1P2TA 4Q3CA 2ZSEA 1ENYA 4J03A 1MKYA 3HUUA 2AQKA 2OSVA 3TVTA 2X5OA 1SURA 3KRTA 4U2DA 1C14A 5LQDA 4RS4A 1Y5MA 1JIIA 3C3AA 5COQA 1SVSA 1U81A 1NIJA 5ECWA 3TOSA 1M2GA 4V3BA 4JODA 1CY2A 5CVEA 3UFBA 4KSYA 3MLAA 5GJCA 2WWRA 4ZCSA 1DELA 1RAHA 3D7LA 3LU1A 3PVZA 4OPMA 1RRFA 3SIWA 3UOAB 2OCBA 4N5LA 4X7PA 3RHZA 1E18A 5FT9A 3R9WA 4CG3A 3TZKA 2P35A 1L1EA 4U8HA 3VR6H 1Z0ZA 4EI9A 5EEHA 1P7ZA 2IFTA 2LBPA 2WKQA 4I81A 1Y9AA 1V95A 2EX1A 3K9GA 1ESCA 4WMLA 1RSZA 3P2JA 2IXFA 1M9NA 1U2GC 3CKYA 3QPWA 2CLMB 4L4ZA 4M49A 4FT4A 4ZVPA 4E12A 1E66A 1JR4A 4LMRA 4OGKA 3MUOA 3R0XA 4F12A 1PFUA 1VXOA 4YJFA 3HGMA 4F6RA 5TNXA 4OCZA 2R4QA 3D3NA 4L50A 1XHLA 4XSGA 4RVUA 3DEAA 5IUKC 1DBWA 4NR0A 3KOMA 4QHSA 3B20A 4WLUA 5EYPA 3EUEA 2ZR8A 4WNAB 4JS0A 1LJUA 3SP1A 3SZLA 5KYXA 1Z2NX 5DE3A 4WZAB 2O7NA 2I71A 1JSZA 2I3BA 3D6VA 4NEHB 1J5EB 2IUEA 2J3EA 4JI8B 1VLHA 3CXUA 3EZ9A 3HR7A 4K9OA 4BC1A 3WZ2A 5K3BA 4AKGA 2CDNA 4WN3A 2C9BA 4BV2A 4MPJA 4EFMA 3Q88A 1GPYA 2I7DA 2ODWA 5DK6A 5JI3E 1CIPA 3C14C 4DJDC 1ZO8A 5H4HA 2ID9A 4YCAA 5GOZA 3ZDYB 9MHTA 3GP8A 3FNFA 2QI9F 3OE1A 1GZSA 3DR5A 2VP6A 2ZP1A 3K9CA 3LHFA 4UULA 1E4EB 2LDXA 1H5NA 4MJXA 2C2KA 4LRSB 1ST2A 1JFVA 1YXMA 2R6DA 5MGNA 2CL6X 2JH9A 3CUYA 1Y4SA 4BZXA 2J6IA 4IBOA 4AKHA 2GCNA 3HVUA 2ORWA 3KYCA 3ER9A 4NXNB 3OQ1A 1Z6QA 2JFHA 4GZ3A 4HZUB 1TAUA 4CV1A 3R7AA 2VYND 3RGWS 4FWTA 1E62A 2OILA 1KDYA 3QF7A 4HYTA 4HGZA 3E5RA 5JAIA 2VHCA 3AXSA 2IHUA 4HH4A 4ZDJA 3U48A 3TFWA 4LOHA 2EWVA 4C08A 3BEOA 1URPA 4K9KA 4S1PA 3W8DA 4ZAVA 4CKCA 5GY7A 2QVGA 3EXHC 5EEGA 4DLXA 2Q3CA 3KELA 3DDWA 2O7RA 4OXXA 3KQNA 3A4LA 4IVNA 4N7BA 3AESB 3QUBA 2PX5A 3KKNA 3PZRA 4BO6A 2YWXA 5LP6A 1B8OA 3FCCA 1X7ZA 1ZKMA 2G36A 3TTSA 2A94A 5ECGC 1E2UA 3HKDA 2J32A 3OA0A 4XAQA 4C43A 1R4MA 3I61A 1H94A 1T1IA 1I01A 2QVBA 3CW2A 2RHRA 4LRYA 4XVCA 4JR2A 3M4YA 1B42A 1XQXA 5KNBD 1XTIA 4WKPA 3EVAA 1IXYA 2EAUA 2POQX 4O29A 3MGAA 4UBLA 3MJTA 1PEAA 5SYAA 3K2QA 4NWIA 1QTIA 1RVDA 1YZUA 2OHIA 2QN9A 3NT5A 5KTKA 1NT4A 2GAJA 3ZXYA 1J2TA 1P4AA 2GBPA 1WA5A 3T5AA 4BRUA 2ZJ8A 3G9ZA 1ZNWA 1JG4A 1H1DA 1PTJA 2CYCA 3E5HA 5ALUA 5IC6A 2YJ4A 3IDZA 4EUNA 1V0JA 2HU8A 2KMLA 4MR8A 3RAFC 2VXBA 4PCLA 3NC0C 3DA8A 1T3ZA 4QDTA 3I5YA 3LXXA 3Q9LA 2Q3EA 2YZMA 2VBCA 3WWPA 1ANKA 1GGVA 1N2SA 4I1RA 4L2IA 6PFKA 3BERA 3CSSA 4G24A 4JH0A 2QG9A 3FWNA 4O6VA 3REGA 3WB1A 1ESDA 3I9V1 4NV0A 4HBGA 4OM7A 4X8LA 4EPVA 1UOEA 1XDSA 1H8HA 5DWQA 3ONFA 3HPRA 1XWWA 5H70A 4GIBA 4C89A 2VWQA 5I7RA 1DWPA 3KFXA 1W52X 2ZJ4A 4OUDA 4BNXA 1E3WA 1SOVA 3V2IA 1KY5A 4J91A 1NBMA 1BJTA 1TZKA 1MJFA 1NE7A 1ULUA 2C84A 2J3DA 2PQ0A 3AETA 3DWEX 3FCSB 2FFQA 4AG6A 2PMFA 4F04A 3KXIA 3P96A 1TTPB 1YL6A 3SM3A 3VKWA 1QOZA 5T4FA 4FK8A 4O4LA 3V42A 1KEEA 1JZQA 1O95D 1XKLA 3HM9A 2DBYA 3IERA 3VSEA 4CL2A 3AFHA 2O2GA 3OLZA 3VDMA 2ADMA 5BQOA 3SKVA 3MJVA 1JWAB 3RGGA 3U81A 4DRXB 2VKQA 1SBZA 5KSWB 1YS6A 1RP7A 4OK3A 5B53A 2OZVA 2XYRA 2P69A 2GBIA 1V1JA 1WTCA 2XQJA 2ARKA 2M9MA 2JRLA 2APJA 2PO5A 4JUBA 4L5JA 1MC4A 4MS1A 4XWYA 3FWYA 1JFTA 3HYTA 1TM1E 3DDNA 2RE8A 3BJEA 1MT0A 2UYQA 4BNDB 2GYWA 4FE4A 3H8JA 1QBKC 3PZBA 2PT6A 5DYGA 1IN5A 1GLVA 2X8AA 4ALJA 1J0EA 4CUKA 2CN1A 1NRWA 3QW4B 2YYZA 1X1BA 4RHFA 5AI4A 5E9QA 3RIEA 3SPXA 2B7CA 4ZK2A 2WVJA 2YASA 3D4BA 1DRKA 4R54A 4C30A 3O8NA 2ZRHA 3IBCA 1W48A 4DV1B 3U56A 2Y8EA 1WMSA 3EEBA 4W82A 2NQTA 2ZANA 1VJ1A 4D1YA 5AO9A 2H52A 5I7FA 4CM8A 2WTXA 1JPUA 1AB6A 3Q5DA 4WKBA 4H16A 3DE4X 1ZVJA 2JFNA 1RVV1 4J3FA 3F90A 4LKRA 4OB6A 2XZDA 1DKUA 2XUKA 5F2EA 1MDBA 2QGFA 3QVWA 4M0PA 1VL5A 4E09A 5K9ZA 1XTRA 4MUEA 3V8QA 1T4BA 1JSLA 4XRRA 1P1BA 3MRXA 5KEIA 1GG5A 1WU7A 3B60A 3SDZA 2QVYX 4RVSA 3N86A 3QZUA 4B85A 2PUEA 5TJHA 1JXAA 2XLCA 4HNGA 2OFOA 3PD0A 1HFWA 2GX6A 1G8YA 1ZN2A 2ZSHA 3L5OA 3PYMA 4K0KB 4XX0A 3ILHA 4CNQA 1SVMA 3ML1A 4KMSA 2HFJA 4EHAA 1QE5A 3AKZA 3M2TA 2ZRBA 3LA6A 4P86A 1A76A 3U31A 2NV0A 2YFYA 3PP8A 2GYVA 2QV7A 3HADA 4LF9B 4HKTA 1JTEA 1SMKA 3TG8A 5DX1A 4MRSA 2BP7A 4EFLA 3QEJA 4PQEA 1F8FA 1QE0A 5CGZA 3IAXA 3GNQA 2R9VA 4CM5A 1JHAA 2VRBA 3MAAC 5DI3B 2KBEA 2AUTA 2WFZA 3QKRB 2JZOA 4ND8B 3U3OA 2VI5A 2PH1A 5CVDA 4CTOA 3I0ZA 3TMYA 2IZZA 3O03A 2QYOA 1AIPA 2ZM6B 1GZ4A 2ZU6A 3CF4A 3IAM1 4QOGA 4QTZA 3VR6D 2BMDA 2G6BA 3WIEA 4W6ZA 4CUZA 4NECA 4ND1A 3HWWA 3NOQA 3Q85A 3DOCA 1MIHA 1OXTA 4N5IX 1U8TA 3HJHA 4XDZA 4B3CA 2IT1A 3OKCA 4RSRA 3ZE6A 2XW6A 5F2NA 3U16A 2AZDA 4X5OA 3ODPA 2HUPA 3AHHA 1RKVA 4JJEA 4RQBA 3RUFA 4AS3A 4U39A 5EIFA 1U99A 2W9XA 4QRHA 5FOQA 3AIIA 1JI3A 2PFGA 2H1VA 2Q99A 4P81A 5A4IS 1ZJWA 1M2KA 2EZTA 1ZNZA 2Z9CA 1KJQA 1KJYA 2BTQB 2EW2A 3FLMA 1USKA 3I04M 1RT9A 2FX5A 5KJEA 1VIAA 4BWFB 4OIFA 2JH8A 1S89A 2Y2VA 3I2FA 4JEMA 1WV0A 4MZDA 3ZLJA 5AKEA 4HBZA 2ZWVA 4ASUD 4QSHA 3TDNA 3IKJA 2MJLA 4KOAA 1NJ5A 5BXYA 2Z4RA 3T94A 2I62A 4JU8A 2L82A 3ZE2B 4M98A 1B26A 4M76B 4S1OA 3BQNB 3VPXA 2PA3A 3NATA 1RBQA 1BQ4A 1XRNA 3MXTA 4O25A 5E4JA 4LF6B 3IAUA 1X1SA 3FYHA 7REQA 4TLAA 2DUNA 4Q4HA 1XQ6A 1N8KA 3FCUB 4FGZA 1ILWA 4WN9A 3TIGA 1AKYA 3SJ7A 3ZY6A 3OM1A 5JSZA 4EMBA 2PXXA 2IHBA 5HF5A 1JIVA 3M33A 1IYZA 2RB5A 4NCKA 3C24A 1II8A 4PICA 2WILA 5DB4A 2NU9B 3RNOA 3T1OA 3WV4A 4BX3A 2TYSB 3RVMA 2I4OA 2GCPA 4ZQIA 3S2EA 4UDYX 2BLNA 5LOVA 2ZCJA 1J2JA 4JT8A 5EMMA 1AB5A 4O4IB 2P7IA 2GUWA 2PWBA 2F8SA 1GAWA 4US1R 2RBKA 2C54A 3ISVA 2ENWA 5KQLA 3L18A 2QM8A 2HQSA 2W2TA 5F78A 4IIHA 1PE0A 1XZNA 3VJKA 4L0MA 3V4OA 3V33A 1GL9B 2CB9A 4MVJI 4UASA 2XGOA 3PTLA 4N54A 3MMNA 2PX4A 5BO5A 2J0SA 5FH9A 4HPWA 2GJ4A 1DIHA 3H2ZA 4DTCA 3TPZA 2JGAA 1IBKB 1YHZA 2PNFA 3NAZA 2YXLA 4OBXA 2P0AA 4QA9A 3G0CA 5K3FB 4ZI5A 1Y48E 1KZ1A 3IL2A 1RM4A 1PW5A 1ZK2A 2OAQ1 2O2CA 1MB2A 2Z3WA 2RHTA 2FFHA 2GZ1A 4I4CA 5FOSA 9GPBA 1OWMA 1GU0A 1W5EA 2ZREA 1Y3HA 3E5MA 3V2HA 2XGMA 4DEVA 3EZ2A 1TM7E 5DWDA 5E6RA 3O8OB 4C0LA 4EFKA 2XNJA 5T8KC 4ARVA 5F3RA 2C0QA 5J9FA 2D62A 3KOYA 2I55A 1X8KA 4XXHA 3NNDA 3SU8A 4XUGB 3I39X 2AN1A 2Q29A 2JAWA 1CR4A 3NM4A 4BMSA 5CM2Z 3V8BA 1RNLA 5JTTA 4OYYA 3CBQA 2W5UA 3D5EA 4B0OA 5BWNA 1NPTO 1J8DA 1C4XA 1U0RA 2WJAA 3VMFA 4KPEC 3V4FA 1GTJ1 3KZOA 1F0KA 2D74A 4M8LA 3B82A 2HU2A 2NUBA 4B47A 1WB4A 3PNBA 1E69A 2F3TA 3GZNA 3TL3A 3ZGOA 3F5QA 2BR4A 4AROA 5BV8A 4XTRA 2V65A 4OB7A 4B71A 4DSZA 7MDHA 1C1XA 1GQSA 4HB3A 5EAIA 4C21A 5K8VA 5DIFA 1IXKA 3B53X 3RUEA 1AG9A 2PZAA 4CG1A 1QGZA 3TQHA 2XCIA 1DS6A 4LRTB 5EJ8A 1GAQA 1QQ7A 1V7PC 1DKNA 4JX8A 5FTWA 1AKEA 4MAAA 4RTJA 1ESEA 3G82C 3SQMA 3OHSX 4BNHA 1O6FA 4CV0A 3JD1A 3CX3A 3WGTA 5AK6A 3F73A 5CA1F 2CDBA 4GQBA 4WBSA 4LZWA 1VRVA 1HKHA 2WMYA 5IKXA 3D1VA 2BN4A 1XP5A 4U7GA 3IILA 2C98A 3WR5A 1VGQA 2AJ8A 3FF4A 3K1AB 3DBRA 3OWXA 3KKLA 4H31A 1A7KA 2PUTA 4LI0A 3VKVA 2NP7A 3QXXA 4HWRA 2VZLA 4M99A 3T5GA 3GCDA 4Q9LA 3ROQA 1GRVA 1PJ4A 3T5DA 1PUJA 2V3WA 4PZLA 4N5DA 3SYTA 3U09A 3QE2A 2OD9A 2EDAA 5JVDA 3DEIA 1I13A 1KMHB 1ZIXA 2M6SA 1O0CA 4IFEA 1L8XA 3G5MA 1EESA 1KYYA 3X2SA 1VSVA 3AOEC 4RADA 3ZGZA 3ZGVA 3GLSA 4ZZ1A 4BKRA 2L69A 4P5PA 1YVUA 2GCOB 1YDWA 2I6XA 4YRLA 2JGDA 1P45A 5HDBB 1NDUA 3QBTA 4YP9A 3SBDA 3TTYA 3VOAA 3VNRA 5EXDA 1BEUB 4FLFA 3V34A 3U7HB 3E9RA 3LYUA 4RPIA 5LC1A 3T9EA 2MU1A 2O8CB 1L4EA 4OAOA 3LDGA 3MAJA 1PVOA 4CM6A 2VIIA 2ZRNA 3JAWB 2DHRA 4JT2A 2WWIA 3D6AA 4D0GA 1MW8X 1PUXA 3A1WA 5EWJB 4BTEA 4GLBA 1GGHA 2BDEA 1IOZA 3CPSA 4KTTE 4HEA6 2C99A 5ALIA 5EQTA 4EGQA 5KDLA 5B1DA 4HQ0A 4RORA 3D7KA 3KQTA 3URMA 3A1VA 2VBIA 2IZ0A 5HYVA 3NHFA 1M7HA 1Z3IX 2Q1TA 3GJRA 3BYZA 4D3ZA 4EP1A 2Z58A 4KBFA 1SQSA 4QDZA 4RDCA 3PKZA 4EB6B 3QLUA 4GRDA 3AHGA 4HQ6A 3RBAA 1T9BA 1YJQA 3GR6A 4JELA 1SD2A 3MIZA 3STYA 1HKUA 4PIMA 5C1PA 2HB6A 1I1QB 5CDYA 3KZNA 2CVZA 3MWDA 1JFFB 1MOZA 1R27A 1VP9A 4UVDA 4CTNA 5H1YA 2F3QA 4IF4A 3HU5A 2NG1A 3SNKA 4F85A 4UUNA 1R0ZA 3PDWA 2XNSA 1I3MA 2H0RA 4WX2B 1EE2A 1TE2A 4RMJA 5G41A 1W8DA 1ZH0A 4FC6A 1XXHA 1CKEA 1Y3CE 3G88A 5JS2A 4FSXA 2JBAA 5EP3A 3NO4A 3ENKA 1CS4C 1TGVA 2NM0A 3LDHA 1F14A 4U7HA 1J2RA 1GU1A 3AFGA 3Q3VA 2I2AA 4DLBA 2AXPA 1OH7A 4FONA 3EE6A 2A0WA 5BYKA 1CJVC 2IEBA 5HX7A 4DA9A 4NCHA 2WG0A 1HM5A 1NQXA 1R74A 2GZ3A 3DE6X 1TA4A 2D2XA 3TXXA 3SJCA 1G18A 5IK2A 3ENWA 3TOXA 5GV8A 1QBGA 1X74A 4N3AA 5ALOA 4V0ME 1G2OA 1LPOA 1H2ZA 1RWVA 2EGGA 1B2RA 2IITA 2Y27A 2Y92A 4WAUA 1S96A 2HJVA 4LDJA 2CHGA 5JS8A 2XIQA 4L3OA 4BN0A 1Q1QA 2QR3A 3IMKA 3QGMA 4IGFA 4J0FA 3RVBA 5KCZA 3KZVA 2WD7A 2ZR7A 3GRVA 5F4ZA 5IASA 1U0FA 5C46F 4C0HA 5JY1A 4CEJA 4AUMA 4GZ5A 2Z1DA 3G85A 3NBKA 1YJCA 4OLAA 1EAMA 2FU5C 2BOVA 2HLPA 2OOKA 2O07A 3KYIB 3DKPA 3MS7A 1P81A 1RI5A 2QSYA 5CM8B 5FV7A 3UN1A 5HQ3B 1DMSA 2LRHA 3UMYA 3Q8KA 5E6UB 3ZNPA 2WU8A 5B6PA 1FX1A 5LSAA 5BN4B 1Y89A 3PXAA 3IDAA 1WXDA 1HNXB 4ZVRA 5REQB 4L4UA 1VBFA 4ZVVA 3GOHA 3WA6A 2GN9A 4CF7A 2B5OA 3EUAA 2J6BA 3GP3A 1NVDA 5DP1A 4NU6A 5IM4F 1ECLA 1SQ0A 3GL9A 4Q9AA 3ZWXA 3CSUA 2F00A 3G1TA 1Y6ZA 5GINE 3WDSA 3PUVA 5CK4A 4IMRA 3GV0A 4J76A 1II0A 2NZ8A 2VTDA 4FNOA 4RA9B 4FNMA 4DIBA 5BVGA 5CXXA 1KSFX 4BNVA 3SX2A 4TV8F 1RYHA 4MQBA 3SICE 4MP6A 1R8YA 2EWWA 2R6CA 4BGEA 3GLFE 5ALJA 3OZEA 4IKEA 1NAHA 2PKYX 3LYHA 1TF2A 3T5PA 4IZIA 1L5RA 3L4BC 3RC9A 3VKUA 4BMXA 4NAVA 4E2XA 1B23P 4KQCA 1HO3A 2VZ8A 1XMJA 4COKA 1DO8A 3SQLA 1JPNA 1E9FA 5H9VA 4H4DA 4K40A 1NQUA 1XTZA 4BCCA 2HBRA 2C2WA 4DIOA 1DRWA 5DSZA 3T3OA 1OXXK 4F2GA 2GD2A 2IZOA 4URHA 4EJSC 1EH5A 3ADCA 3VUFA 4YAFA 1TO1E 4H7IA 1AC5A 1PJ8A 5C0OE 5I5EA 1HNWB 4RULA 2H5EA 5K3EA 2CEAA 4IEIA 3PFWO 4JFAA 3M4ZA 3WYBA 3O9ZA 1KO1A 1QP0A 2BZSA 3LVBA 3WWCA 2XMRA 3JQBA 3DD1A 3H5LA 3SAJA 1DJQA 1JHDA 5A3SA 3DZKA 4OTZA 3LG2A 4LBYA 1R5OA 1OI2A 4RX1A 4XQEA 3REQA 1J0XO 2WKWA 3S2IA 1Z5GA 3IVMA 5ERGB 3HL4A 3JATB 3JVVA 4OYLA 2VHVA 3RAPR 1DWOA 1TF5A 4QYIB 3S68A 1OX4A 3VZRA 1Q77A 3ZWPA 2JCYA 5FFNA 2P8SA 2ZK7A 1WZEA 3DB1A 1I33A 4CG0A 3JRNA 3O6VA 1K5PA 2WQ7A 1ZM4A 3LY7A 4LV6A 1ZOPA 4LDZA 1OGJA 3VC7A 3GEEA 1Q14A 1OB2A 1QR6A 3OZTA 2DWCA 2O2DA 1T3GA 2Y1FA 3KZCA 3WJ2A 3SYKA 3ZWMA 4WBNA 4Z6KA 1H69A 4IQGA 4JI3B 1N6NA 1NJFA 1YJAA 1FS4A 1GTL1 2PE5A 1E8DA 1JAZA 2PL9A 3L6RA 5D85A 5HWSA 5JDIC 2ZT7A 1RYFA 1TRKA 4MYTA 1G0OA 3F6SA 3H2JA 2ZYVX 3DLCA 4LCBA 4W7IA 5DOVA 3UT5A 4D79A 3BORA 1ZIDA 2C0PA 1C9NA 1JSCA 4I0WB 1SOWA 2HV9A 1HOXA 3LXUX 4J9VA 1A72A 4BNKA 1XALA 5LIPA 4DQLA 4UZSA 1GGNA 1GCOA 4M8SA 4LDAA 3DTTA 3GG2A 3JVDA 3W6UA 3N2IA 2H65A 3GFOA 2EFEB 5FQNA 3PNOA 3I9V6 1PN3A 3I5XA 3OEHD 4EGAA 3DUFB 4RIIA 2HIMA 3Q87B 4YUZA 3DLHA 4EI7A 3IPAA 1WBBA 1NASA 3WWDA 1GTG1 1VHLA 1YR9A 4M1MA 4DG9A 3NHKA 3MD9A 2BGWA 3NCHA 1PWZA 1ZGHA 1RMYA 3IELA 4M0UA 5FHRA 4GI5A 2ZULA 3BIFA 1NI3A 2A0FA 3L7MA 4CMEC 3P9QA 2QY6A 1GARA 3HSYA 3ZEIA 3JQCA 3HXMA 1BCSA 1YRBA 3DMTC 3OZUA 1Z62A 1FYXA 1FCJA 1N0HA 1QB8A 3ADPA 1RLOA 3WO1A 2Z95A 1XJCA 2IP4A 1E1LA 4YDRA 1YB1A 2PT5A 1AZTA 1LJLA 2FPOA 5DNEA 4C5AA 3DT6A 4OQMA 2QA5A 4JVMA 3LLVA 5AUOB 4KRYA 2DBVO 1TL7C 1FNMA 3DZFA 2EJUA 3LSYA 3F71A 1V8ZA 3A1EA 3VHXB 5BURA 3PFGA 2FI1A 2IZ6A 1NW8A 3ZE0B 1EYZA 2ECOA 4U2KA 2HK7A 3RFVA 5FR1A 3RF6A 4WA7A 4LS3A 3QLJA 1E94E 1TC1A 4Q1AA 1UWLA 3HKBB 3HWRA 4FOSA 2VZEA 3HMKA 1QRRA 2B4KA 5D1NA 3ZTYA 2YR0A 4BO9A 4BNLA 1NMYA 3QYAA 4KWIA 3DUWA 2G1UA 1F2UB 2DPLA 3GX1A 3PHHA 3GGOA 4MUHA 3MBIA 3USZA 5IANA 5KU7A 1R1DA 2YXNA 4HFJA 4M9RA 1G98A 5HUHA 3NTVA 4GKKB 5DASA 3CZ4A 4Y2QA 4W5RA 1ZC3A 2ZE8A 3ANXA 4FDAA 1H6AA 2C4UA 1AXRA 2H1SA 2WTMA 2XXBA 4WDQA 3RYHB 4J7UA 1XNJA 4EJMA 2ZKLA 3EVZA 5AJTA 2HSJA 4CR8A 3LWNA 4MB0A 1OLUB 2DR0A 4DQUA 4RTSA 3KTAB 2PL5A 1CCWA 4UUMA 2FR1A 3DDSA 4DLSA 1XBTA 1ZUNA 1I9GA 1XYYA 4DG8A 2WE8A 1SPXA 2CHUA 2QE6A 3CHYA 3I01M 2YYAA 2A1UA 4MW2A 1UPUA 2ZUEA 3O92A 1FP4B 1LSUA 4EX7A 4ODIA 2CLSA 3BH7A 3KJGA 4KDCA 1FPMA 4HWOA 1PG0A 4AYTA 4BP3A 1RRGA 2VOEA 4LECA 4YJ2A 5IEJA 3NYQA 2HM7A 3GIDA 1DIBA 1P9RA 4PGAA 1HF3A 5K6AA 2WD8A 2DXIA 3D6JA 1HTTA 1SZDA 4IDQA 1AUVA 3Q40A 3DHNA 4LSGA 3SNHA 3RT9A 3LDAA 3KU4A 4TTJA 4WV3A 2VAXA 3LY8A 4II7A 4G2NA 2Q28A 4TZTA 1KZ7B 2FVYA 3SGLA 5NLLA 3TBFA 4RENA 1IAQA 1HTWA 3C7KA 3LYAA 4PINA 3LUJA 1LW6E 2VQDA 4CV3A 2H4WA 3F6CA 2CD9A 3CLHA 3K5PA 2OBXA 3OOJA 3VNVA 4X45A 3SHOA 2GBFA 4ZQGA 1OAAA 2A0YA 2AN5A 3MINA 5JD5A 4O5OA 3AW8A 3JQFA 1KVTA 5HZKA 3DZDA 3TZHA 1V5WA 1B0ZA 2Q6IA 1DG3A 2HH9A 1V6AA 4C0AC 4CM9A 3FD8A 1SHLA 1YB7A 2XMGA 3V3TA 2V7QD 3G2OA 2P30A 3BS4A 4RKYA 2PFSA 2EIXA 1T9KA 1UT5A 2WVAA 2ZJOA 3IAM6 2CE2X 4MRRA 4EGCB 5IVHA 3WFJA 1P91A 2Q2VA 5K6TA 2HBYA 4FKZA 1TADA 2Q46A 1DX4A 4YMUA 1JFLA 2A8YA 5EJ7A 5BW5A 5DLYA 5BV0A 1WXEA 2O0HA 4YROA 3C45A 1XMQB 2IPNA 4DWWA 1X8XA 1A5AB 1JDBC 4CCWA 5HOEA 2OGZA 3AJAA 3HABA 5FHQA 3S81A 2C4VA 1ACMA 1PV1A 4MVJM 5CDFE 2PGAA 3Q1KA 4IOMA 4W9MC 1V96A 4Q7JB 3TE7A 4LVUA 5T3UA 3PD7A 2VK1A 4MHOA 1JWBB 2I7VA 2GBGA 2IOQA 3B52X 3SEAA 5KS2A 4BCBA 1F6BA 1P77A 2QPAA 3A9TA