2VAVA

Crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
376
structure length
347
Chain Sequence
NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 116
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vavA00
4OB8A 4I3FA 2HA5A 2PKYX 5HFNA 4U2CA 4Y2RA 2QJRA 5AM2A 4PNZA 3ZLVA 2WIGA 3WK6A 4BYMA 1R3DA 4UFPA 2CKMA 1G42A 2YYSA 5E4YA 5AKEA 2ZJ7A 4F5ZA 2ZSHA 4UPDA 1QE3A 2XQGA 1MAHA 5I8PA 3CN7A 4W1PA 4Y2VA 2H1IA 3DEAA 5K3AA 2XDWA 5ALVA 4H0CA 1WHTA 1VZ2A 1Q83A 4MYDA 2VJAA 5AO9A 1H22A 3WL7A 4WCVA 2PPLA 3C8HA 1EX9A 1ZD5A 1NU8A 1CUSA 4EUSA 2GBFA 3NWOA 3C6BA 3WJ1A 1FFBA 3WQHA 2XB6A 1LZKA 2Y6UA 1R4ZA 3L1IA 4V2IA 3RLIA 3G0IA 2PUHA 3LLCA 2FJPA 4Q34A 5AOAA 5EHXA 2XQJA 4M0FA 1MX5A 1JMKC 2VSQA 4L0CA 4X90A 2P8SA 5AK6A 5C8ZA 2RGUA 3WZMA 1R88A 3P2MA 2DFPA 5K3BA 1ZD3A 1QIHA 1EB8A 3JW8A 3MGAA 4A23A 2VJDA 2RIPA 4TVKA 2WM2A 4DLNA 4QA9A 4DM7A 4AO7A 1GT6A 3X3HA 4G4GA 2WFLB 1KU0A 4K6GA 5AKXA 5ALDA 2CBGA 5K3CA 4C4ZA 4ARBA 4EY6A 4H7EA 3D59A 2I3DA 3DOHA 4AZ0A 2Q0XA 4HRYA 2DCMA 3O4GA 3CCBA 3EF3A 4EZIA 5ALMA 4FOLA 1K4YA 5A2GA 3E0XA 2BAGA 2WSLA 2V9ZA 2Z5GA 4DNQA 3FVTA 5AM3A 5DTJA 5DYTA 4X93A 1MO2A 2OCIA 4HS9A 5HF5A 3AFIA 3WKEA 2IITA 1TKRA 2K2QB 1R1DA 5HQ3B 5CT9A 4BC0A 3C70A 3DYIA 5BOVA 4BP8A 1YCDA 4UBMA 3GELA 1R9MA 1SFRA 2AJCA 5AJHA 2CB9A 1BN6A 1LPOA 4G5XA 3G0GA 3N0TA 3FYUC 3I2FA 2E3JA 4DMFA 1YS1X 1CVLA 1DU4A 3V9AA 3WKDA 2HIHA 5AH0A 3BDIA 1DT3A 2ONCA 5JZ9A 1P0QA 4PF1A 2WJ6A 1YA8A 4E11A 2I03A 3WYNA 4Y2YA 4BDTA 1VJ5A 4G9EA 3G0CA 1XZIA 3ANSA 4BRSA 1J07A 4GDMA 2J3QA 2ZYHA 3M83A 1ZI9A 5CH5A 3STYA 4GXNA 1ISPA 2CUTA 1IUOA 3HABA 3I6YA 1SC9A 4ZRDA 3HXKA 4KJXA 1ODSA 3FBWA 1UWCA 3MUOA 4MQMA 5LYYA 3GBSA 3C5WP 3VXKA 1TQHA 3G9UA 1C7JA 4QDUA 2OPHA 1H2ZA 2QVBA 3A70A 3ICVA 3V48A 5ALFA 5HF6A 3HC7A 4NVRA 5BWCA 1J2EA 4BAGA 4FBMA 5EHQA 3GROA 3H19A 4U2GA 4RE6A 1BE0A 2VF2A 1EK2A 1GPKA 1XZFA 2WG2A 1JMYA 1WHSA 4L3WA 2LIPA 2HA3A 1K5PA 3WWDA 1ODCA 5BV7A 1JJBA 4PSDA 2O2GA 3R3XA 4MXDA 1U65A 2VATA 4W1RA 4AB1A 2WFMA 4EY8A 3KOOA 1GKLA 1L7QA 3I2HA 2I78A 2QOEA 4GHWA 5FXMA 1RP1A 1LBTA 1ORWA 5T4EA 2BFNA 1JU3A 1DWQA 4EY7A 5JZBA 4BTVA 2XUKA 3D2AA 4MYSA 1IZ8A 4RGYA 4X94A 5AIAA 4OD0A 2HHAA 2XI4A 1O6FA 2WUFA 3R3VA 2G63A 2XMBA 4N8SA 1EVEA 1J1IA 5C81A 2PSFA 3F9CA 4EBBA 2PBLA 1XZKA 4WJLA 3F67A 3B5EA 1BCSA 4CG1A 5CH8A 1CUCA 2C4HA 4XVCA 4OB6A 1SCIA 2PUJA 3QMMA 2B4KA 1BCRA 1CUWA 4FNGA 1JJIA 1EI9A 4B85A 3T4UA 2Y6VA 5AI5A 4INZA 2OCKA 5FPQA 4Y2SA 3I6ZA 1BU8A 5AM5A 4H18A 3HLKA 3O0DA 1L7AA 4B0PA 3I2IA 4UBJA 1LGYA 5EIHA 3PICA 4WDQA 4B9AA 5AM1A 1MT3A 1JKMA 1YSCA 2HU7A 1BEZA 4Q3KA 4BBZA 3IUNA 1H2YA 1QTRA 1RYYA 1TCBA 3IDAA 3M3DA 1CQWA 2WFZA 2WUDA 5FP0A 1GGVA 1GPNA 2C0PA 5D6OA 5LKAA 5FV4A 1ZGBA 1XRPA 2WU3A 5JYCA 1PV1A 3DQZA 3I1IA 4W1QA 2XLCA 3IUQA 4U2FA 1JT2A 1XRRA 2HU5A 2VQ6A 2QJWA 4B81A 4DNFA 3IVMA 4X91A 1LNSA 2IIVA 1MAAA 3I2GA 1ZGCA 5AOBA 2BKLA 1AC5A 4B82A 3STTA 1EVQA 7YASA 3V1LA 4FNMA 5ALXA 4P93A 2JF0A 4J0IA 3QPCA 3RARA 1MU0A 2C5FA 3PUIA 3BF7A 4PW0A 1JFRA 3VJKA 4KEAA 5I7UA 2YASA 2WHQA 5IKXA 3AZOA 3Q0TA 2BCEA 3F8SA 5A6VA 5A7HA 3ESAA 4J0GA 2QMQA 1CUGA 2DHCA 2OQIA 3MUNA 4UUQA 1AUOA 4DTCA 5ISMA 3BDVA 1DX4A 5C8XA 5K3FA 3L1HA 1UKCA 3VISA 1B41A 3FYUB 2HRRA 4LIPD 1QO7A 3FYUA 4PQEA 1OXMA 2AJBA 5CBKA 4X00A 2X5XA 1U4NA 5LZ4A 2EDAA 4LXHA 5E4TA 4B7ZA 1AURA 1UOQA 1AGYA 2J4CA 4P9NA 3SK0A 4DNOA 2XLBA 3AZPA 1CUYA 3UMJA 1XLUA 1YB7A 2H7YA 1H23A 4LXGA 3FSGD 4Q1VA 1Y37A 1DWPA 4GI1A 1MNAA 2OCGA 3A2NA 2XUDA 3GUUA 2VTVA 1XZBA 1UK6A 4J3JA 4ZWNA 4EY4A 1MTZA 1LBSA 3HYSA 2NW6A 3ZLTA 3AIKA 1TCAA 3WA6A 1DQZA 5ALQA 4EB0A 1HL7A 2C7BA 2G5TA 5F4ZA 3H0CA 1FFDA 3D2BA 2D5LA 1M33A 4FDMA 4OPMA 1YAJA 2WQZA 4HRXA 2PSJA 2OGZA 4GW3A 4DMHA 3BJMA 2X76A 3DL4A 3OC0A 5JAPA 1K6EA 1ZOIA 3C45A 1XFDA 5HF9A 1TK3A 1W6RA 4H7FA 2O2HA 1MJ5A 4K2AA 4ZI5A 4IO0A 5JANA 3S2ZA 5AKJA 2JEYA 2G4LA 1E66A 2RHWA 3LS2A 5CXUA 5ALPA 1A7UA 3DL7A 4MJ3A 1N5RA 3PE6A 2ACKA 4CIAA 3VKFA 4BE4A 2G5PA 2AJLI 3R3WA 3UUFA 3FNBA 2Z3ZA 5JZSA 4J0HA 5LZ2A 4CG2A 1CUEA 4KRXA 4JUIA 5HK8A 4CCYB 4F21A 2QR5A 2ES4A 4BCBA 4E46A 4IH9A 4C89A 4CCYA 5DWDA 3BF8A 4JH0A 2WUEA 5H3HA 1A8QA 3DYVA 1UKBA 2JGLA 3BL8A 2HDWA 3E1GA 3B3QA 3C6YA 1U8EA 3E3AA 4PO3X 4QLOA 4UHHA 5ALNA 2OQVA 5ALGA 1N1MA 1C4XA 4YPVA 2GZSA 3WIOA 2WTMA 1WB6A 4U2EA 5CH3A 1CIJA 2XUOA 4GWLA 5HF8A 2RI6A 5JD6A 4C87A 3ZWQA 3R3UA 2WIKA 5JD4A 5JATA 4Y7DA 3I2KA 3H04A 3JWEA 1XZAA 1BROA 1XRLA 3DOIA 4E15A 1CFJA 2VA9A 4QDXA 1CUBA 2WFLA 4X7BA 3ZI7A 3O4JA 5CT4A 4KE8A 3Q8WA 1S8OA 3ICWA 3DD5A 4Y2PA 4AMZA 3M82A 2BGRA 4G1FA 1QLWA 4X95A 2BUCA 4BTLA 2ZJ6A 1ZD4A 3H2KA 1H2XA 5FRDA 1DWOA 3K9BA 5T4HA 2GBIA 4B0OA 1LPPA 2JGJA 4WY5A 1LZLA 2DSNA 3D0KA 3G8YA 5E4JA 5HQ3A 5AHXA 5K3EA 2WHPB 1WB4A 3V1MA 2XT0A 1E8MA 2VAXA 3FYTA 4UBKA 4PSUA 5KWJA 3G0DA 3A6ZA 3F98A 2QZPA 3U1TA 4MWSA 3WWPA 5AM4A 5LZ8A 1MX9A 4D9JA 1USWA 3STUA 5AI6A 4BC1A 1CUUA 1GQRA 1YAHA 1P0IA 5A7FA 5EGNA 1JI3A 4N8EA 4OSEA 5AICA 1UOOA 1VLQA 3DNMA 5ALEA 5AM0A 5T4BA 5FDFA 4MEAA 4BDSA 4BB0A 1Q0RA 3F96A 3IULA 1ODTC 3OPMA 4HTAA 1PFQA 2HA2A 4ROTA 1EDDA 5KWIA 3STXA 1W52X 3DDUA 1ZJ5A 3WLAA 4Q82A 3I2JA 4DSZA 3KSRA 4LXIA 4Y9SA 1FFEA 4C01A 3DKRA 3LCRA 3T52A 5ALUA 4X3CA 3QM1A 1MNQA 1A8SA 3WWOA 2ZVDA 3WWEA 3FLAA 3HI4A 5KREA 4UBIA 5ALIA 5EHNA 3O9VA 4B9EA 1ZIXA 3DJYA 3O4HA 4H7HA 3C6ZA 1CQZA 4RNCA 1CR6A 1T4MA 2CMFA 5CXXA 4JNCA 2PM8A 1VE6A 4Y2JA 4HXGA 1WB5A 2WIJA 1CV2A 5C7YA 4C6HA 2HA7A 1VXOA 2PU7A 4E14A 4A5SA 3ZPXA 2J3DA 3PDCA 3R3ZA 5A7GA 4BRZA 4UBNA 1PJAA 4N5IX 1X70A 4HVTA 2W22A 3WKAA 3IUJA 2GYWA 1W76A 5CW2A 4X71A 4AXBA 3F97A 5DYWA 1AMNA 5DNVA 4KRYA 4G4JA 4ITVA 3W05A 1EDEA 2QTBA 3R0VA 4L9AA 1YR2A 4UHCA 3QZUA 3C8DA 1XKTA 3PF8A 3QBJA 4CIBA 3W2TA 3G9XA 1AZWA 5ALTA 3I28A 3KD2A 2Z8ZA 5D7BA 1P0PA 1LPMA 4X85A 4F60A 5JAUA 4CI9A 4G8BA 2GYVA 2Z8XA 3G7NA 4RE5A 1THTA 2HA4A 4XJVA 3ESDA 2VT6A 4K5QA 1QIKA 2HADA 3UUEA 2JIDA 3KWFA 4BZWA 1E5TA 1CUAA 1XZJA 1XLVA 4PSCA 1B6GA 1MPXA 2WG0A 2AJDA 5AK4A 5AOCA 1EDBA 1EB9A 3PI6A 3AIOA 4C4XA 4W63A 4FMPA 1ORVA 1KEZA 4U2DA 4RPCA 3WK5A 2HFJA 5AKIA 5ALKA 3W04A 3WWCA 4C88A 4OB7A 2QUBA 2HM7A 1P0MA 3FWHA 1OILA 5E2IA 4UFNA 5LIPA 5BWBA 3WMRA 5HFAA 1XRMA 3LIPA 2XE4A 3BE8A 1NX9A 1CPYA 5HK9A 5FOQA 2Y2UA 3WKBA 3NGMA 4KE7A 4QE3A 1TAHA 3DS8A 2QM0A 5CMLA 1E8DA 5AKLA 4JYPA 1IUPA 4BE9A 4M0MA 1Y7HA 2JEZA 2PL5A 4Q3OA 2W6CX 4BVJA 5ALYA 5FKJA 3AINA 1CRLA 1Q84A 1IZ7A 2PSDA 1XQYA 2VJBA 3IB3A 4DIUA 2I3ZA 2HL6A 4MEBA 4DYHA 4UHDA 3B12A 5DTIA 3TEJA 4CG3A 2IX9A 4KACA 4BCDA 4G4IA 3BWXA 5JARA 1UXOA 1GKKA 1FFAA 1QIJA 2DHDA 5K3DA 2OXEA 1VA4A 4N8DA 2HFKA 3BJRA 2XMCA 4JEIA 2XMRA 4J0CA 3IURA 1FSSA 3R3YA 5IVIA 3STVA 1YS2X 1QIEA 3KWJA 2GBGA 5I9IA 4H7DA 5EIAA 2CZQA 1GQSA 1FJ2A 2WG1A 4ARAA 1TRHA 5AI4A 4BP9A 2RONA 2Y1KA 2XQKA 3VJLA 1SOMA 3DKKA 3TGLA 2XMGA 1XROA 1ZJ4A 3RKSA 5EIEA 1XZDA 4QDOA 2YXPX 1XKLA 3LIIA 4X6XA 1QO9A 5AI9A 4WFIA 1UKAA 4OU4A 2XUPA 5SYMA 3WKCA 3HJUA 4AN0A 5AKHA 5IVKA 4UHBA 4LYDA 1EXWA 1SCQA 3AILA 4GEGA 2BUBA 2WIDA 1A88A 1HLGA 2AJ8A 3EQ9A 5SYNA 1ZD2P 3CXUA 1XZMA 3ANTA 3C87A 3V1NA 2JGMA 4IQ4A 4BVKA 3KXPA 1UOPA 4KYVA 1WOMA 1WPXA 3D7RA 3WL6A 2OLEA 3GA7A 3D2CA 1EH5A 3DCNA 1K63A 4J0KA 4BCCA 1THGA 3WL8A 4X97A 3U0VA 3IUMA 3PFCA 4ZV7A 3JYHA 2BJHA 3HSSA 1QZ3A 2ZYSA 1VA5A 1CUZA 1I6WA 5DJ5A 4J03A 1QIMA 3SWWA 1HPLA 5EFZA 3BIWA 5KBYA 1H2WA 2JGFA 1X2BA 5JD5A 1XQVA 3IA2A 1K8QA 4ZGBA 4W9RA 3FVRA 5LZ9A 3VDXA 1J06A 4K6KA 3QH4A 2EEPA 3O9MA 1Y7IA 3W06A 1CLEA 4Q05A 4QWWA 5EI5A 1GZ7A 4OUKX 4O08A 4FKBA 4G8DA 4I4CA 4OYLA 2EDCA 5HKBA 4FBLA 2V96A 2HA6A 5DLPA 1QFMA 4B84A 4L72A 2QUAA 1JJFA 5AI0A 4X92A 1FFCA 1ETHA 3BXPA 3A2LA 5IVDA 4S0XA 2Z3WA 3RK4A 4QNNA 4HAIA 3CCCA 5FPPA 1N8SA 2VJCA 1BEEA 3S8YA 3ILSA 1IUNA 5AKGA 1BS9A 1TIBA 4KAAA 4ZREA 5YASA 3ESBA 3WZLA 4UFOA 1LPNA 5JALA 5AIBA 3FAKA 5JASA 3H1AA 5ALWA 4UBLA 1CUIA 2V97A 1XZHA 3GZJA 1QIFA 3EIOA 2JGIA 3WYDA 3TRDA 1WM1A 3H2GA 2OAGA 4QLAA 1CEXA 2OG1A 4Y2TA 3HRHA 4I19A 4DNPA 5LZ5A 4NS4A 5J3JA 3GFFA 5CT6A 1CUVA 1DT5A 4G8CA 4U2BA 4G9GA 4YASA 2PSEA 2ECFA 5CTAA 2XQFA 3D5EA 4LHEA 5D3KA 2OGSA 3C5VA 2XMQA 3IBTA 3ESCA 4AX4A 2R11A 1XQXA 1WCYA 2XUHA 2JGKA 3IIIA 3TJMA 5LKRA 3K2IA 4HZGA 3SC2A 4YK7A 5CRIA 4GLBA 1E89A 2PSHA 5ALHA 2XUIA 2B61A 5LZ7A 4J7AA 2WTNA 1LLFA 2ZJFA 4WDRA 3PFBA 1ACLA 2QRUA 5HKAA 3OOSA 4EHBA 1VKHA 1KU6A 1VXRA 4H7JA 3MVEA 2DR0A 1UT6A 2RHTA 1EA5A 1DX6A 4XX1A 2XUQA 3O95A 2WHPA 4UBOA 2QXTA 4FLFA 4BZZA 5ALOA 4Q3LA 2AXEA 3N2ZB 1CUFA 3W9BA 5AKKA 2VAVA 4KE6A 3EBLA 1N5MA 2HA0A 4MQLA 2WIFA 4OU5A 1GXSA 3C43A 2QT9A 4P08A 1QONA 3HEAA 4ZV9A 3DLTA 4C4YA 2OAEA 5T4FA 4H35A 1F0PA 5AP9A 4QDTA 1XZEA 3H2HA 2PX6A 5DNUA 4AQDA 1G4HA 3OURA 2C58A 1JU4A 1LPSA 4BAUA 4FFWA 4DMCA 4KE9A 3RM3A 1E3QA 2FX5A 2FUKA 1HKHA 4B6GA 1XRNA 3QPAA 4GBGA 4W1SA 1QIDA 4K6HA 3H18A 1DINA 1Q0ZA 4WFKA 1SCKA 1CUJA 4H7IA 1W1IA 2FJ0A 4AO8A 5A62A 2H9YA 1R50A 2YH2A 2XUGA 1ZI8A 4AN1A 2PU5A 1UK9A 3FLBA 3YASA 4EA6A 2XUFA 1RWQA 2JBWA 3PF9A 4UHEA 5ALRA 3CN9A 1IMJA 5ALLA 3FLEA 2ROQA 2ZYIA 2CJPA 1OCEA 1NU6A 4NZZA 1ZICA 3VVLA 4LKOA 3ZV7A 4QEKA 4IH4A 3QPDA 3WK8A 2C0QA 2J4FA 2ZYRA 1IVYA 4HXFB 1LPAB 3H2IA 3KDAA 4X6YA 1MX1A 1F0NA 5FUMA 4F0JA 4QDZA 4HXEB 4LYEA 4YX9A 4JYMA 2QXUA 3NUZA 1MN6A 5CT5A 2XUAA 1YB6A 2HRQA 2CEKA 3WK4A 5AK3A 4MWTA 1HBJA 1W75A 4GECA 3WK7A 2XMZA 3E4DA 3SX4A 3QITA 4WFJA 3OM8A 4A16A 2OCLA 2HU8A 1C7IA 3R41A 1ACJA 2H7XA 4H7KA 5DYYA 2ZSIA 4Y2QA 3FCYA 5AI8A 5AKYA 4BAZA 4M0EA 4FTWA 2WJ3A 1W4LA 4J0DA 4P92A 2O2IA 2ORYA 4OCZA 1VOTA 3AIMA 1A8UA 2PVSA 3K6KA 3H2JA 2DQYA 4DMKA 2X8BA 3STWA 4UHFA 4EY5A 5IVHA 4X6UA 4DSAA 3M81A 4CFSA 3NOXA 3G9ZA 1QFSA 3EQ7A 3G02A 1DQYA 3I6MA 3VVMA 2UZ0A 4N5HX 5HCUA 1HQDA 3H17A 4IH1A 5JADA 3ZLUA 3V1KA 2RAUA 1AQLA 4Z49A 4BVLA 1BRTA 1QOZA 1XZGA 1YASA 5CT8A 4TGLA 4ETWA 4CCWA 3WI7A 3HACA 5JAOA 5FLKA 4B80A 3BIXA 1QIGA 4TPKA 3WL5A 3FSGA 2B9VA 4KR0A 4XIIA 3L1JA 1XZCA 4QWMA 2B20A 2XMSA 5LP1A 1QIIA 2DQZA 1E8NA 2O7RA 1O6GA 1VZ3A 3D4LA 2VEOA 2VT7A 5AKZA 1TCCA 3QVMA 2GZRA 2GYUA 2V98A 5JIBA 5LLSA 1VE7A 4BATA 1L7RA 1UFOA 2JGEA 3AJAA 3HZOA 2WHRA 1XRQA 2Y2VA 2WJ4A 3I1YA 4IHAA 3EQ8A 5AK5A 3FCXA 2H7CA 1D07A 3W9UA 1F8UA 3FOBA 3WA7A 4ZXFA 2O7VA 3LP5A 1EHYA 1GPLA 4KAJA 5ALZA 2QKYA 4B83A 1UK8A 1XZLA 5ESRA 1QTIA 6YASA 1AX9A 1AKNA 1EINA 1LPBB 1ZIYA 2WU4A 2BUAA 5CURA 3G0BA 3R40A 2XUJA 1T2NA 3OTQA 4NMWA 5A71A 2C5GA 4XWGA 5K3FB 3AZQA 1G66A 1DTEA 2OGTA 1U2EA 3QYJA 4Y2XA 1XQWA 4FLEA 4OYYA 2WKWA 4DGQA 2WILA 1CUHA 4FWBA 1CUXA 4WY8A 1X2EA 2ACEA 3H1BA 2R8BA 3WIBA 1BN7A 3QMVA 1QJ4A 3D3NA 5C8VA 4AO6A 4FHZA 2XMDA 2GBCA 3WJ2A 3OG9A 1Z68A 4H77A 3AUKA 3O4IA 4PV7A 5JAHA 3QMWA 5D3ZA 4Y2UA 3WK9A 5ALJA 1XLWA 1ZI6A 5ALSA 2DHEA 2D0DA 5EHZA 1WPRA 4J0JA 4QZVA 1UK7A 1CUDA 1QGED 2BGNA 1EK1A 1G5FA 2WLSA 3A2MA 1UZAA 2QS9A 4AZ3A 2WUGA 1R9NA 3C6XA 3PUHA 5DNWA 3VJMA 4FLMA 5K5EA 1YA4A 4KAFA 1F6WA 4AMYA 3ED1A 5IH7A 2XQIA 1HDEA 5HZGA 4FFVA 3G9TA
chains in the Genus database with same CATH superfamily
3EHDA 3A4VA 4MV5A 4UXJA 3G88A 4I3FA 5TRTA 2HA5A 5HFNA 5LBTA 4G0WA 1G7SA 2Z1DA 2DMRA 5HPYB 3ESZA 2VDWB 3UMCA 1GAQA 2P9QA 3WQSB 1YB4A 1RLMA 4TRRA 3LO8A 2BEJA 4R5HA 4WOJA 1DC5A 4YFVA 4OHUA 2H2IA 5L45A 2QJRA 1DKNA 5L3VA 1XCLA 1MABB 4QPDA 3W1WA 2WIGA 5HOQA 3GLHA 4IDGA 3OZ7A 4I0WB 5SY4A 4AQ7A 3KYIB 3WK6A 4AY3A 5MFPA 1LF0A 3K7EA 3ZOZA 5DV9A 4QRHA 4H6PA 2NT3A 4YUWA 4UFPA 3K35A 4JQOA 1I2CA 1IG3A 3F49S 3EGIA 4Q9KA 2YWJA 1NHGA 4ZTUB 3IUBA 2XWBF 1JPVA 4KSCA 4ETMA 1OFUX 1ZK3A 2ZJ7A 4IYRA 1GGFA 3RVPA 1C5KA 3GPLA 3RW9A 7ADHA 1TYCA 2Q07A 3P2OA 5CNKA 3QWAA 5D1NA 3PKZA 3C39A 3HKDB 3MRTA 3OTWA 1YRAA 4JHXA 3DVQX 4UU1A 4DQLA 4LY0A 3T7TA 1MAHA 2PMFA 5I8PA 3CN7A 4B76A 3HMQA 4Z3OA 4YJHA 1QWSA 2OP0A 1PVDA 3VYVA 1IH8A 4Z1MD 4KIWA 4N65A 4EI9A 4XCVA 1N25A 1P5JA 3OM9A 1G20E 4I9UA 1CK4A 3DAOA 4MVJM 1WHTA 2VDNB 2ZR8A 4NFYA 4BS9A 1VZ2A 3QLVA 2IH4A 1I4TD 4N18A 3AG5A 5KOIA 3H6GA 4HDMB 3E9CA 4XD2A 4ESVA 1EBUA 2HBQA 4XUDA 4U9IS 5A5VA 5FX2A 5IT4A 3M6UA 2VYVA 1WXHA 1YL6A 3SEZA 4MW7A 3WL7A 4AG6A 4LZLA 2PPLA 3C8HA 3OQJA 3HM2A 5K6AA 4KXYA 1R6TA 1GTMA 1L7BA 1AXGA 4DXHA 1XJWA 3A6DA 1KS9A 3DSRA 3X2EA 3WGUA 4DV5B 5C8YA 2EIHA 4EUSA 2PUBA 2HGZA 3BIOA 4BB6A 2R85A 2C8VA 1SC6A 3NWOA 1XHLA 5BNIA 1CEYA 1Z63A 3NW9A 4KFCA 1RD4A 5H9WA 4RJTA 2XB6A 3DTTA 4X61A 5JS1A 3HYRA 5C4IA 5HSGA 1WA5A 1B0ZA 3CFYA 4A5OA 3GVPA 3DLPX 2JAXA 3K1TA 4ZQFA 3SZGA 3V1TC 5JSUA 5CA0A 1PNVA 3LXRA 4EEXA 4JKYA 4ZEVA 5LQNA 2BP7A 2GPWA 3RJTA 4XGIA 5A4DA 3MINA 3X1ZA 2ZI9A 2C61A 1XU4A 3LLCA 2GN9A 2FJPA 3IP6A 1XG5A 3EEQA 2XNKA 3FWNA 2UYOA 3NU1A 4Q34A 3LTNC 1IBKB 1SU6A 2XQJA 3PTAA 1P0FA 1UUFA 4P32A 1YRHA 3W6NA 1RQ2A 3VSCA 2CLKB 4Q6BA 3G8BA 4ABYA 1Q22A 4I4IA 1UP4A 2RH8A 2XJ4A 4DMUB 2QNRA 4J1QA 4M37A 1ULAA 2B2CA 3WOVA 2FVXA 1OMOA 1DNPA 3VNBA 4QGSA 4A9AA 3JXEA 4PHGA 1A8HA 3COJA 1XR3A 4II7A 3H9CA 1UBHS 2ZUVA 5K8IA 3U19A 1DJQA 2OTCA 2R6GA 3USZA 1EUCA 1SPBS 1KBQA 2Q1TA 4OFWA 5H59A 1A72A 1EMDA 1GWNA 5KYWB 5JTTA 5FL7D 1WEKA 1NZJA 4TQ9A 2DFPA 2KLBA 4N39A 3A9WA 4MB0A 3K5IA 3ADBA 4NXMB 1JYEA 1RWBA 1U8TA 2J0QA 3MGAA 2WP0A 2ZPAA 4LCEA 4CU5A 2RIPA 1XVUA 4XFDA 1X14A 4DCPA 2R44A 3IKMB 3QYPA 4JBLA 1OXBB 3KT0A 4AO7A 5F3DA 4G67A 3O92A 1M1ZA 4JOSA 2RHOA 2WFLB 1CQJB 1KU0A 3OX1A 2OCAA 4IJUA 5ALDA 2CBGA 4PZZA 1MZVA 4O5AA 3EZNA 4WN9A 5DULA 5BVHA 3VNUA 1T0JB 1WMSA 4ARBA 5ER6A 4H7EA 1H9AA 1ZMOA 4IDCA 2I3DA 4B73A 1DOZA 1LLUA 2JHGA 2I99A 2XXBA 4KJZA 4EOGA 1L5KA 1Z5UA 4ZVKA 1WD5A 3ZHOA 5BSHA 1LF5A 1BEUB 4J4BA 4R7TA 3DBHA 3KVRA 2R1ZA 4YI5A 3AETA 3WGMA 1IAQA 4DXAA 4KSBA 3CCBA 4EJ0A 1VLJA 1UT8A 3GAZA 2VF4X 3SJ7A 1AZSC 1B8NA 1AY0A 3B53X 5C4GB 3ZGNA 3DJFA 4IY1A 3RSOA 5ALMA 4UJ3A 2QROA 4FOLA 5LD2B 3JVUA 2ECOA 1BDMA 1MGOA 3BILA 3H7IA 3N76A 3ZXSA 5HQTA 4PHCA 3OX2A 1B74A 1V9SA 4I5IA 4K0RA 1SUWA 4M21A 5EGSA 2FMHA 2HCBA 2WSLA 3R24A 1E9BA 1DIOB 2Z5GA 2FFHA 1B1CA 2GYYA 4X93A 4PICA 1PFKA 5HF5A 4BNKA 2BMEA 4C7OB 3GLKA 4YTEA 4KPFC 4E4RA 2O2DA 4RV4A 2O8EB 3UK1A 5AW2A 1FQKA 2J41A 2K2QB 3PGXA 4TWBA 2O48X 5DASA 1T9ZA 1Q7BA 1M34E 2EKLA 5DGHA 1QRRA 1KEVA 1WO8A 2VYVD 3M6FA 1YCDA 5BR4A 1TQ2A 2UV8A 3BCSA 3GGGA 4PIPA 5DN6A 2ZTMA 1YVDA 2F1IA 3GELA 2AZTA 2AJCA 1J23A 2XE7A 4XPIA 5KCMA 2FP3A 2YMQA 3D3EA 4CKBA 3AHJA 5KTNA 1BN6A 1H1LA 1R8YA 2A9JA 2N0SA 1W0KA 3DV0A 3QYFA 3N39C 1RHKA 2A88A 3DAFA 3X43A 3KQUA 3DEZA 2GZHA 2OENG 3B60A 3OY7A 1OB5A 1JPJA 2R25B 3DE4X 1H3EA 3CJTA 3MTEA 5EP1A 1EVYA 1P9NA 3F8WA 3DMFA 3QVJA 1SURA 1MORA 1A4RA 2A57A 2LW7A 4QG3A 4MAFA 2JHFA 5REQB 2HD4A 2ZWMA 5B1HA 1Y4UA 4EBFA 3MW8A 2NSYA 4EDHA 3O2NA 4IGIA 1NYLA 4X9XA 1T8UA 5PGMA 1BKYA 5LU8A 2QNBA 3ASYA 2DULA 4W6ZA 5TB5A 4G37A 5BWOA 3BDIA 4WCFA 3DV9A 1G21E 3F9IA 4FIDA 5JZ9A 3U3XA 3BK7A 1YA8A 2O8DB 4E11A 2JL1A 3IAAA 4LWPA 3WYNA 5LLDA 3I9OA 4TXHA 4KP7A 2AG5A 1P5ZB 1MP0A 3IOYA 4ALNA 3GCDA 5D2CA 1Z7GA 2YQ5A 1XZIA 3SYNA 1DP4A 5H0IA 2O14A 5IFKA 2DUNA 3A4MA 3FKJA 2GN2A 4JASB 4JOBA 4MRRA 1DOHA 1BXRA 3L8YA 4ADSG 2EG9A 4GDMA 1XAJA 7REQB 2VDMB 3OU7A 3ZXUB 4PC2A 3P45A 3STYA 4J43A 4RPGA 3BG5A 4KXFB 3V8VA 3OICA 6LDHA 1NVEA 3UJ6A 1ISPA 4ARIA 13PKA 1D03A 1E20A 4D3XA 3FF4A 3H5AA 3UQYS 1AO3A 3OH8A 2B5WA 1A4UA 1KI6A 3L0SA 4B4DA 2FZWA 1NYQA 4L7VA 5F4BA 4ZQGA 3HABA 4DCVA 3I6YA 4EHJA 5J5AA 1AQ6A 2MYNA 3OU2A 4G0ZA 3HXKA 1AK2A 1G8AA 1HR0B 4DLKA 4KH1A 2Q1YA 2XD9A 3DOOA 3GPDG 4EGQA 3H86A 3H6HA 4IZIA 3GBSA 5JC1A 3C5WP 3T7DA 2L17A 2H08A 2FSVC 4W8OA 4LRUA 4BFYA 4QDUA 1X3LA 3F1KA 3ABQB 2BFAA 3A70A 4MZXA 5J1SB 4MJ7A 5HF6A 2Q2WA 4YRZA 4IHQA 3BGWA 2BGUA 4R8SA 2B7CA 3ZBPA 3GROA 3H19A 1UEIA 1XDUA 2FDRA 3OMWA 4WKBA 2P9EA 2QK4A 5H16A 2H5EA 4TLMB 1HLDA 2AMVA 2VP6A 1NMQA 3SEQA 3VVCA 1C29B 3MNFA 4U2GA 1CJMA 3OTGA 2QGFA 1RHUA 2XKBA 1Z2DA 4RHFA 3KTOA 3R7FA 3GUHA 4X8MA 2I2WA 1XA0A 5JDCC 3OT1B 3AHIA 2ARKA 1A2QA 1HT0A 5A0FA 2DUWA 4AS3A 3X1KA 1WB9A 4I1OA 2YXDA 5JJCA 2LIPA 3AOEC 2RK6A 4HQLA 3AYXB 2VJNA 1K5PA 3WWDA 1W87A 3QGMA 4CL3A 1V4NA 4C2TA 2OV2A 4MCHA 1BYIA 3H5RA 4MPTA 4Z3DA 5GVSA 3INTA 4PSDA 4AMVA 1Y3BE 2CFIA 1DBSA 2ET6A 2H1LA 3CMMA 3TZKA 1U65A 1GNQA 4JGBA 2BI8A 2VATA 2JFXA 3FDXA 3MJHA 4DDVA 4ZHQB 2XE8A 3D4PA 3K4HA 3FBGA 1K8RA 3IT1A 5DN6D 3HBAA 2P65A 3SQMA 2EZTA 1GKLA 1KJYA 3AK4A 1L7QA 3BA1A 3OF2A 1R8SA 3T99A 2XH8A 3QUAA 4O4JA 3EQZA 2IHZA 1W0KD 2I78A 2QOEA 1P9RA 1CDOA 2W7TA 4QUIA 2P6OA 4MUBA 1ORWA 1RTKA 3KB2A 1QDUA 1E59A 1GSHA 1SVMA 2OLJA 1C2TA 2PGAA 3LSTA 2GT1A 4JELA 3EVNA 4MRSA 4BN4A 2QV7A 2Z83A 2ZBFA 3O5AA 4RA9B 1GYQA 4OHYA 1TLTA 3N2YA 4PEVA 3R3JA 1R18A 2EZ4A 3L7DA 3FPSA 4NU6A 5JI3E 2QL9A 2NZVG 4WK2B 1RC8A 5AIAA 4OK5A 4M0DA 4J3NA 5KSYA 1QMGA 1SNYA 2RGNA 2HHAA 2C94A 1O6FA 2W98A 2Z2XA 2NP7A 3R3VA 2G63A 2XMBA 2BHRA 4K9DA 1NW4A 3DDNA 3DONA 4PGMA 4ANFA 1JR6A 5C4MA 4NPCA 2P6RA 3K72B 3RQIA 4F45A 4KMRA 5LP6A 1EFRD 1N2EA 3DBVO 2YVAA 3ELYA 3JWGA 4M7OA 1AS3A 1M1YA 1J1IA 1VHLA 3FMPB 1OI7A 2V9PA 1RQGA 3PX3A 3QF7A 3F9CA 3KZNA 2I6TA 1YZVA 3ZGLA 3FUTA 2P3LA 2VJOA 2IHTA 2IGTA 2H1HA 3B5EA 4RSGA 1TUIA 2XRFA 3D6FA 2BV3A 4KODA 4HV4A 2HWWA 4ZALA 4ZT2A 1UXJA 4EW1A 4XVCA 1Z39A 3O3NB 4M9ZA 4OB6A 4DZRA 2VHEA 1A7KA 3PIIA 4P0PB 1AV6A 5EAIA 1BCRB 2MHCA 1PLJA 2ZWAA 4KWIA 3TNJA 4I50A 5DNAA 4I08A 5G1PA 3LQYA 3COYA 4PY2A 1SXHA 3PHBE 1EI9A 1NOIA 2XJ9A 3WMGA 4F85A 4UAUA 3VNRA 3RBXA 3SF8B 4F2DA 3V4ZA 3ML1A 5AW1A 2V7QA 5SZHB 1D2GA 3HXMA 3QU4A 4DCUA 1SUFA 4RHUA 4GMDA 1XWWA 3DR5A 5JNWA 3I6ZA 2VJQA 3R0XA 5AM5A 3W6ZA 1K86A 1E1YA 3HLKA 2EXXA 1L7AA 1OW3B 2CLMB 2EFYA 4B0PA 3TL6A 3RUFA 5JCPA 3Q7QA 5EIHA 3HVHA 5EWMA 1IBCA 3DKPA 2MR5A 4JJ8A 1D6MA 1JUDA 1Z0SA 2QLNA 3WRXC 5J58A 4HWTA 3R4VA 1AH2A 4HX9A 4PBRA 1BEZA 3DP9A 1WSAA 4NBWA 4ABTA 3HFJA 2LVBA 1OSNA 3ZUGA 3JQGB 4EMUA 3WLSA 2X4IA 1H2YA 2IUUA 5AW4A 1S3SA 4Z4GA 2HTEA 2UZ1B 4TV9A 2BEWA 3NIFB 2WFZA 3MCTA 2WUDA 3U3KA 3CUYA 2OORA 4JR2A 1IBMB 3EGOA 5FP0A 3ZNOA 3IO5A 4OBEA 2IPOA 3T1NA 3HVUA 2EBFX 3TG8A 3LC2O 4RGBA 1NP3A 5GIPE 2WJZB 1NW6A 2IYSA 2MYTA 5D6OA 2Y0DA 5LKAA 2CJFA 4EITA 1ZGBA 3A7EA 3QVUA 4YCJA 1L5YA 3UGJA 4FYYA 3AHGA 3GRZA 2XYHA 1L5MA 2CL0X 5JJIA 3W5SA 1C9YA 1JA9A 4K28A 1AKVA 2FQ1A 2JAUA 1X6VA 4RMGA 4W5NA 1FQWA 3VZRA 1QZUA 2WWIA 2JC3A 2IEAA 4ZEOA 2A92A 4LXXA 2M6KA 4N5MA 3WG9A 2QRHA 1WDLA 1OAKA 2NP6A 3TSZA 1L5LA 3F7TA 2VSOA 1N2CE 4ZPJA 5B55A 1A0OA 1FNDA 3LPLA 4XZ3A 8OHMA 4DNFA 3IVMA 1D1SA 2MSDB 3OT4A 2P3SA 3FPJA 1ZGCA 1D04A 1CY2A 2VK2A 2QZ9A 4IIJA 1TEHA 1X7YB 3AERB 4WXYB 3U6KA 4QSHA 1AC5A 2VP9A 3EWSA 4YLGA 1QRSA 3GJRA 3KLMX 3QKIA 2AUMA 2DGDA 1RXSA 2DPMA 2XTAA 4I1PA 1MOPA 1Y6GA 5DT9A 7YASA 4V1CI 4O8CA 2RHHA 2C8JA 3RS7A 4OV6B 2Q3LA 1YDFA 4PSAA 1L7OA 4JCOA 1XVLA 3AGQA 3K3PA 1VQ1A 4C4PA 3JU3A 4NE7A 1J24A 2Q3MA 2I4LA 4MA0A 4TT3A 2J48A 3T61A 4U5XA 1W73A 4IWNA 4HUTA 4OM7A 1BSVA 1YR3A 4ZV4A 4JY7A 3RVRA 2C5FA 3PUIA 4RVFA 4CKEB 4OA8A 3SDBA 1UJNA 1JKXA 1WCIB 4PW0A 1CJCA 16PKA 1NXWA 4J0EA 3V7YA 2ACWA 1PCXA 4QT4A 4WH0A 1JFRA 4KBGA 1SCJA 3VJKA 3VR6A 5L3RA 2Q6TA 2ZS9A 5I7UA 4I81A 2NU7A 5IKXA 4PX9A 5JPIA 2R6JA 5B53A 4EUHA 2OA0A 2DFDA 5E6RA 3Q41A 3G3EA 3A9UA 2R84A 2V7QD 1ZG3A 4QREA 2CMHA 4J94A 2CEAA 2QMQA 3TUZC 4HDRB 1CUGA 2C0CA 3E15A 2DHCA 3PEUA 4G01B 2HKIA 5J2UF 3O3MB 2WF8A 1IEQA 1W4BA 4AG3A 5EJMA 5ISMA 2YJ3A 3PNVA 4QBTA 2IU6A 1P60A 1Z83A 3WIVA 5ILOA 4QXPA 4MWOA 3U2QA 4WNAA 1V3QE 4BV9A 3L1HA 3IVGA 1ILWA 2ZWVA 3O2SB 4FIZA 3VISA 1Q0PA 2WLTA 2CNKA 3CLHA 4JC0A 4KGVA 3IAM6 3B2QA 2OPBA 3EVBA 3ZH2A 3T3PB 1IN8A 1XDWA 5K8TA 1BIFA 1N2ZA 2GXSA 2HRRA 1I9GA 2HCTA 1SCUA 2YZNA 1QO7A 3Q3HA 4QGFA 3FYUA 1XFAA 3O1LA 1U5CA 2B7LA 1OXMA 4PQEA 3GJ3A 5EHIA 5J2TA 2P90A 4KRFA 2E4VA 2NO9A 3BGDA 3Q8MA 3UY4A 4LS3A 5CBKA 1JH8A 3OP4A 2Q41A 3D54D 1DFIA 1JEOA 2LDBA 3IV7A 3AUJB 3UJ8A 3ROZA 3AGPA 1BX0A 2XLBA 4PYNA 2Q0SA 1WBDA 4FD3A 1CDDA 2H7YA 5CVVA 4RTRA 4LXGA 2PXHA 3N2LA 4DHWA 5KJ1A 4LTDA 3KLBA 1Z4MA 4GPZA 1EXVA 3GRVA 4Q1VA 1BFUA 2FP4B 1DWPA 4GI1A 1GTRA 4JI4B 1FTNA 4PFSA 3V8MA 4HQ0A 2ZRPA 3EYAA 1NIJA 1FDUA 2PT7A 4ETIA 2Y77A 2XNCA 5DW0A 1KAMA 3R76A 4BMDA 3BYZA 2B4AA 4EPYA 3G2IA 4AMGA 1G6HA 1ADJA 3P9QA 4EY4A 3JALB 4HS4A 4OXNA 3ZLTA 3AIKA 3HYCA 1TU3A 3MWLA 3HKCA 2BTEA 1ZL0A 2X0NA 1Q7EA 3VU9B 3WA6A 3AB3A 3QLUC 4GQBA 4JIMA 3RASA 4D8UA 3GOHA 4IXDA 3CW9A 1HL7A 4NU0A 3TL2A 2QE7A 4TYQA 5DM1A 5F4ZA 4DF3A 2PX0A 3TW4A 2QMHA 3DLAA 1E6MA 1FFDA 3AU9A 3E7XA 3W2GA 3ZJVA 4KPGA 4PTZA 2AFRA 4MDFA 4EL5A 4TLEA 5TY0A 3S2UA 1XL0A 3SR3A 4IILA 3JZAA 5JH7A 2IOFA 2BEUB 9LDTA 2OGZA 3BRWA 3SSNA 4GW3A 3RODA 3K9LA 4FQ8A 2XVMA 2J9FA 5EIBC 4PZ9A 3DL4A 4B75A 3PUVA 2ZRGA 3II6X 3KUKA 3JAKA 1ZOIA 4TT3D 3FCSB 1RXEA 4NCIA 1F9AA 4GUAA 3LBAA 4I9NA 1W6RA 5FYDA 1W1UA 2G0NA 2GSWA 3PPYA 5I7WA 2C9CA 5AQEA 1JA0A 2W4QA 1A95A 4AXXA 2ODEA 2Q7OE 3SC4A 1E0AA 1XTVA 3OESA 3THOA 3LECA 3B3FA 3EGDA 3UWDA 4BN5A 3VR6D 1MC5A 1MENA 1DAOA 2D74A 4ISCA 5CGQB 4JUAA 1J0CA 4TLDA 1K3UB 3RS3A 3EW7A 5FI3A 4RY2A 4D9IA 1L5NA 2GVDC 2BFCA 3RU9A 2PE5A 1UMDA 2G4LA 4MPDA 4TQGA 3SQXA 2Q6LA 2VTBB 2ZSKA 3R6TA 3NP7A 2RAPA 4UVDA 2AN1A 3DGEC 4ENRA 1K6MA 4MKXA 2FZCA 2V7WA 2W00A 2ZKLA 4ZYYA 2RGXA 4GEKA 3DL7A 1LDMA 4KQXA 4WKNA 3WSVA 1RYDA 1JYFA 2BY4A 1RQLA 3AF5A 4D4LA 3RVKA 2ATCA 4HDKB 5HKLA 5GADl 4PLTA 2QGZA 1W5SA 1JR4A 1VFPA 2QTHA 4BVEA 1BKSB 1E2FA 4FW9A 2VT3A 4GIBA 5JNRA 3RFXA 3HCPA 4MW1A 3R3WA 1NQOA 2D2XA 2WQ6A 2BGLA 1PT8A 1UWVA 2BJWA 4C0KA 3REQA 2CE2X 1ZXBA 4U2KA 1FJHA 4M46A 5TEWA 1ATZA 3JZFA 1P6UA 1AZTA 2VWPA 4C7KA 2JAOA 4K9LA 2LR0A 1TPZA 2WAOA 2ZSBA 3PENA 4LQLA 5BQ3A 3G1WA 5BT9A 2IHBA 3HSYA 3ICCA 3THWA 1YHNA 2OXFA 3M33A 3SBOA 3V2HA 2QR5A 3IMCA 1QE0A 3EA4A 1M74A 1V1RA 1G98A 3FSJX 4JT2A 4LHSA 3HYNA 4OFXA 5DWDA 5FBLB 1RLOA 3KKOA 2ZAIA 4D5GA 3FNGA 5IKMA 3FR8A 3H11B 3UAYA 2P78A 3L4EA 2WUEA 4K3UA 5LIRA 1EFLA 5LBIA 4BMOB 3UW3A 4F1WA 1A8QA 2V3WA 3CUUA 3DYVA 1OXKB 4H3HB 1ESDA 2DB3A 1EXMA 1WG8A 3MJDA 5DM60 1QG6A 1PJ8A 2H2GA 3P2IA 4JKOA 3GFGA 5SY6A 3BJIC 1DAMA 3Q5DA 4PGGA 3MWGA 5BSRA 1U4OA 4RA6A 3E1GA 3KKLA 4E5UA 4U3JB 1JG4A 1EK0A 2WSBA 3HGTA 3C6YA 1AGXA 2X9QA 5C7LO 4MV7A 4F91B 2QMUA 4WZBE 5DXJA 3P5SA 2C1XA 1IZ9A 2RH9B 4WAUA 2YIMA 3Q1KA 3TRIA 5JXIA 1X87A 3IAFA 3GLSA 1WLYA 4U0JA 2AR7A 4YPVA 1G20A 1ZGZA 1SD5A 2DOKA 3WIOA 2BCJQ 3E58A 4IS3A 1NNSA 4X60A 1WB6A 2QE7D 3OCWA 5CH3A 5CP8A 1CIJA 2I1QA 3OO0A 3G23A 1XUOA 5DXFA 3GEPA 1T0HB 3C15C 1V43A 3N8DA 5LMNB 1TF2A 2AXPA 3G5TA 2WZDA 4YONB 3LT2A 2WIKA 2IYOA 4L8WB 3N07A 3QVVA 4QU0A 2A78A 1W88A 3OE4A 4Y7DA 3RANA 3VC3A 3BRWD 3C41J 3I2KA 1LJUA 4ONEA 5AJZA 3UHOA 5IG2A 5I9BA 2VNIA 1SB8A 1WKBA 2P1RA 4XARA 4LOIA 3SKVA 1CY6A 1XZAA 3NTRA 4MJLA 3F1LA 1NY5A 2XMPA 1PUIA 2K6GA 1XRLA 3DOIA 3WLTA 1JSZA 4GRAA 1BNCA 1NVXQ 3OEYA 3P97A 4Q03A 1DJMA 1HORA 1IM2A 1YJAA 2JVKA 2OGWA 3B5IA 1A2KC 2IXBA 3H5WA 4QC2A 4BL5A 2AH5A 4GL4A 5BMVF 1PEYA 1AK1A 4HUQB 3RUHA 3BTVA 4LF7B 1NDUA 4F4CA 4W9MC 3O4JA 3F6BX 4NQRA 4XYBA 4LDAA 2ZIFA 2Y66A 5CFMA 1S96A 1PR6A 3A9SA 3T0FA 2FWJA 3PUZA 4JBGA 4LQDA 5TV2A 4OGGA 4LY9A 2A6PA 1JQAA 1J90A 3TIGA 3QFSA 3H4VA 3KLOA 1DKLA 4L16A 1U8FO 2HBRA 3JPYA 1EJ2A 1SKYB 4NV3A 4XM0A 1O54A 2APJA 4PG4A 4REQA 5HCIA 6ABPA 5CG1A 4FCCA 1MTOA 1U5BB 1WZIA 2FPIA 2KLHA 4IRXA 3O1HB 4U5QA 4BGUA 2QW8A 1U7UA 1WU8A 1ZU5A 1KKLA 3U7GA 4X95A 3KAKA 2BUCA 2REQA 3JWPA 2I80A 3E70C 3RC9A 1MFPA 3N7UA 3SZLA 1I7DA 3ZQUA 3QKUA 5DDIP 1CT9A 4QYXA 3H2KA 1PZXA 3JYPA 3IDSA 2GM3A 1PK8A 1V2GA 4QTYA 3KQSA 3SZRA 4M8SA 9LDBA 5T4HA 4DV6B 1PEDA 3IR6A 2GBIA 2R8ZA 4FNAA 3X1JA 5A4KA 3ZVMA 4ZVNA 4GMXA 2OXRA 1LPPA 2J4DA 1MJNA 3M1YA 1WEHA 1G8JA 2WIAA 4R31A 1Z38A 2G1UA 2FEOA 3BAZA 2HWUA 2H2DA 2YZ2A 3VPGA 1JH9A 3DT8A 4J0FA 3G8YA 3D0KA 3UH0A 4FFPA 4GOLD 5AHXA 5K3EA 5A5FA 2VCHA 1DQPA 1RRMA 1NLFA 1UL1X 1TUBB 1VL8A 2IP4A 5C46F 2XT0A 4TTJA 1AKRA 2ZCUA 5JLJA 3SGLA 1FFHA 3CLUD 2R96A 4UBKA 4FEGA 2X0FA 3TVTA 1AUXA 1AXEA 3A6ZA 4M2LA 4CBVA 4BX3A 2CNNA 3U1TA 4DCJA 2B25A 2P91A 4YCBA 3UJDA 2WABA 1HE8B 3R9IA 3UTCA 5FOWA 3K0HA 3VAZA 1KWKA 1IQ0A 1AS0A 1ZZGA 3AXSA 3BCUA 3P9SA 2V8OA 4TTPA 1GXSB 2YJGA 5AI6A 3FOFC 2OKCA 1E2GA 2ALJA 2REXB 1XMIA 3RC8A 2OMKA 3RNOA 4FJ2A 4PU0A 4WWHA 5EGNA 1RXYA 1YZYA 4N8EA 4FOSA 3LX6A 1P75A 1ODFA 4OSEA 3R7AA 1W1WA 2I6UA 1EDOA 3KOZA 3ZV4A 5IN4A 4JV5B 4XDYA 1LSSA 1T1SA 1SBCA 4TMYA 3BWDD 4O1HA 2BPOA 4PZYA 3D0RA 5AM0A 1PR1A 1IDN1 3H0EA 2IA5A 3BMCA 1M34A 1KYQA 2G76A 4GNRA 4IW3B 4TUYA 4YRCA 1V8FA 5GJBA 1K89A 2G1KA 3DAYA 3F3MA 3QF4B 3SVTA 3WRVA 1A5TA 3TINA 3ETLA 5DTEA 4ZIRA 1EM8B 2ZOSA 3D1VA 2RHRA 4MVJD 4HNQA 1U8YA 3OFKA 4IXNA 4NOMA 1GG8A 1ODTC 1QOQB 1UBLS 2EJVA 4YV1A 2HA2A 1DXYA 2YWCA 5KWIA 2FEAA 3DOJA 2C9MA 1HNNA 3EBPA 3LPCA 3JD0A 3ECCA 5JZVA 1ZJ5A 4FR0A 3RS4A 3PFHA 3I2JA 4DSZA 2BFBB 5IEJA 3HLTA 1YE8A 1ZUWA 4G1BA 1RIIA 1ZGHA 3KSRA 1GPBA 3KPYA 1N8KA 4KC0A 1OWPA 4LXIA 4RK7A 3PI7A 2PHZA 4GS5A 4BRUA 4C01A 1SBQA 2O8NA 3NZEA 1Y3CE 1KK0A 3X1DA 3ILXA 1QH1B 2IDJA 1E0SA 3OCXA 1U7DA 1HOXA 1ENZA 4UU0A 4X3CA 3ED5A 2DU8A 1SQFA 5MHTA 4F6RB 1G21A 1A8SA 1N2JA 3OZCA 1TO2E 2VRBA 4BMNA 1FMFA 4MSUA 4R41A 5IN5A 3K0CA 1DZIA 1D4ZA 3V1UA 5J2UB 1Z06A 4XUEA 3WGHA 1XNQB 3KE8A 2I4MA 2LIVA 3O8LA 3OSUA 2BEKA 4XJSA 3BD7A 2ZRKA 4ZGWA 4BGDA 4YT2A 3OEEA 4CKXA 5C5IA 3KJFA 5FBHA 1ZAYA 3NTLA 1FQJA 1J33A 2ST1A 4FZRA 4M53A 1NUPA 1QB7A 4MROA 4YIHA 4K9MA 1ZQ1A 5ALIA 3WDMA 1QHYA 2ZJ0A 5IXYA 3O9VA 1W85B 1CIVA 4RFSB 4M98A 1ZIXA 3DJYA 2FPPB 3O4HA 1R15A 4H7HA 2A0YA 5H1YA 1CQZA 3TLYA 1KXZA 5IM4A 2P2SA 4D9HA 1E9CA 1T9DA 4TMTA 3BWVA 4YMWA 1U2GC 5I5EA 4UCQA 3PR1A 2OK8A 2HAEA 3QV1A 1LRKA 4JNCA 2C59A 2PJDA 2PM8A 1FVHA 1V8OA 4IJVA 3U7QA 3UG7A 5CB8A 1R0YA 4M1KA 4DREA 1VE6A 2GNOA 3R5FA 4DLBA 4C5CA 3K6SA 3PBKA 1UM9B 3M9LA 1XCPA 1EE1A 2AMYA 3MT7A 2CV0A 3DH0A 1N0WA 5BNWA 2B8TA 4GX5A 4KRGA 1CV2A 2GCPA 3HNRA 3ZKWB 2PV0A 1NUSA 2JI7A 3CUTA 2F43B 2HA7A 1IAVA 3FNEA 5EMJA 3NOOA 5TQ2B 4BV3A 1E6LA 1U7XA 3Q98A 1N3IA 4GI2A 1KRHA 3ASVA 3CR7A 1VI2A 3PDCA 4L22A 4QUAA 4X66B 4RIIA 4W82A 5KTPA 2WMDA 1ZNYA 5TJ9A 4LQ4A 3QPVA 4N5IX 2BH9A 3DFFA 3ZHXA 2R3SA 1XALA 3LY7A 2WPDA 3DW1X 1Y33E 3CZ4A 3R6WA 2MINA 3WKAA 1UC4B 2P4QA 3SIPA 3DLIA 4AUKA 2J5RA 1QANA 4DRXB 3LKVA 3QIVA 4LBYA 2GUWA 3LUCA 4NESA 1NVVR 3WY9A 2DJIA 5JXWA 2CDAA 1VKOA 4I5FA 1O9HA 5CW2A 3CIFA 4XWKA 1M0EA 3G89A 1E3MA 2YRFA 3UAVA 2PTHA 1AMNA 3VNVA 3QXHA 1QPGA 3IKLA 3FXAA 3GT3A 4G4JA 2OD9A 1ZOPA 3CEMA 2RG7A 4K05A 5C8YF 3L0BA 3K9CA 5KMGA 4LPKA 1XP8A 4JSYA 3F6RA 1GG9A 4GWGA 2LCIA 3PDIA 4HLQB 4NYJQ 4YACA 1DO2A 4WNCA 4C4TA 4CQNA 1PR3A 1YR2A 3A1CA 4UHCA 3PFGA 3QZUA 4NOJA 5FWXB 1DHRA 1P18A 2E5WA 4EMBA 3MMZA 4JXJA 4OF4A 3N53A 5CA0F 5GZ6A 2HUNA 2OBLA 4OMCA 2P27A 1LS1A 3GJ5A 1HZJA 2BEVA 1P6QA 3REGA 7ABPA 3ENQA 3M34A 1AZWA 2FZ5A 4OLHA 4PNEA 1MHPA 4B3HA 2Z8ZA 4Q3NA 1UC5B 2F1HA 4YECA 3L6EA 3QRWA 1LPMA 1QFYA 1FMLA 1Q7GA 2DJ5A 4Q7KA 4X85A 4F60A 5JAUA 3L5KA 1CSEE 3FMFA 3IKTA 2J0UA 2BFWA 2Z6VA 3HCBA 4BLPA 4EG3A 5C51B 2Z8XA 4DR6B 2P6NA 3SMVA 5IS2A 3ILHA 1XCJA 4RTPA 2V9CA 3K0KA 1CHDA 2P0EA 3FM9A 2EZ9A 3GOQA 3SZ3A 4E7PA 1ZH8A 4WZAE 2P9BA 2VK1A 3KVVA 2JGDB 5E8RA 3VR5A 2PAFA 4ZVVA 5CEJA 4YP1A 2ZJBA 2W6PA 3R5KA 2ODAA 5CPFA 3WGYA 1GADO 1BXGB 1EA7A 3K1AA 1U3GA 1IXSB 1ZRNA 3QWIA 2VQFB 2CUNA 1GA4A 3ECSA 3C0KA 5BR1A 2N42A 3ABRB 3GCZA 1TB4A 2XCOA 1ZK0A 1M67A 3COWA 4BMSA 2B1GA 1E5TA 5TMDA 5TF4A 3RYCA 4JXZA 1CUAA 4AJJA 1G8KA 3WXBA 2YOHA 2JLAA 3VR6H 2FN3A 1GPDG 2HSJA 1IJBA 3OEED 4D98A 4XVRA 2FDCA 2CK3A 3B9RA 3KSDO 4XVUA 1VI5A 1XTIA 1P7PA 6AT1A 5BSEA 4M8NE 2C83A 1PJ3A 2B7BA 2J6IA 2WBLC 4Q4AB 3HO8A 2AJDA 3ZBUA 1MEJA 2IY7A 1KYIA 2QPAA 2Z1MA 3WSWA 3THXA 1UBUS 4CM8B 4EQZA 4BQPA 5KNCA 4BO5A 1YH3A 4RCZA 1ORVA 5GV7A 4U2DA 4EO9A 3EMDA 2XF8A 3DVLA 4HNGA 4Q9DA 3HEBA 4HLCA 2QRPA 4MWCA 3HS3A 2HB6A 3RYIB 4KR3A 3WK5A 5LOVA 2P5TB 5EZYF 4CI0B 1ESZA 4KV9A 4KXNA 5FUQA 3WWCA 2WDZA 2Y4OA 1DEXA 3C4JA 5A3QA 2GFQA 4OB7A 1RZRD 3ESYA 4RXMA 1P0MA 3TM4A 4ZTZB 3AUUA 3LI2A 2IUTA 4UFNA 1A69A 3PNYA 3IXQA 3LDHA 4RTQA 3WMRA 3HDQA 3KIPA 1RZVA 1XRMA 3LA8A 3CNNA 4LJ4A 1LSOA 521PA 4OJTA 1I2MA 3KHSA 4CKBB 2R7LA 3A06A 3LIPA 2O2EA 5FUYA 5JW6A 4HLDA 1JHAA 1CPYA 1GL7A 3EGXB 2A33A 3PV0A 5HK9A 3W5AA 1AHHA 1JHMA 4BU0A 5EE1A 1V6CA 4NCAA 4KX5A 2WPDD 4MZDA 3CS3A 1EX7A 1AB6A 2KWIA 2NO7A 4H0NA 1K8XB 3GF4A 1MOSA 2V7PA 3AJ9A 3IDQA 4ZGGA 5GM1A 1P1CA 5ERXA 2AK2A 2P2CA 4FE4A 1WPGA 2OB2A 3K96A 2F8LA 4H3SA 4RTJA 3PX7A 2N46A 4R1TA 2YW2A 1Y9JA 2FLKA 3PC3A 4C4OA 4DR2B 1QAMA 5LB2A 2DE0X 2JJ8A 3PFWO 4JYPA 1IUPA 4K6OA 2OBYA 2BRUA 3FMVA 2PL5A 2XQVA 3FZEA 2BD0A 1I4OA 2FWNA 3O8QB 2WWWA 3T5MA 2FPRA 4RPIA 1H5UA 3GLGA 4UEOA 5ALYA 7AT1A 4BP3A 1PU2A 1EDZA 5FKJA 2HF9A 3B6EA 3U44A 4WA8A 4BNWA 1ISGA 2QNIA 3GFBA 3GEHA 4WD3A 4D42A 1OC4A 1U3CA 1V41E 4HD8A 3WGZA 3QX9A 2IS1A 4AIRA 4G0XA 2RK3A 4WKOA 3UWKA 4EG0A 2O8BA 1ZVJA 3NV9A 2EHJA 1SOUA 2G5GX 4F7DA 1HI9A 1TD1A 2IYVA 1LB1B 4RCVA 2R2AA 4G25A 4S1WA 4CG3A 2ORWA 4E21A 4MCJA 2G25A 3VX4A 2ZP1A 4KACA 4BNHA 3P9YA 5L6LB 4HJRA 1A5ZA 3N9IA 1UXOA 2RH4A 3E81A 4K3VA 1N2CA 3RROA 4ND6A 3LYHA 1GFWA 3HZHA 1FFAA 4LDRA 4OKNA 4PG7A 4X5OA 4XE5A 3ZU4A 1QIJA 1KI7A 2FXVA 1PQ4A 4Z2AA 2AX3A 1EFCA 1HDXA 2QB5A 2EKZA 4YJ3A 2M98A 2QJFA 5BMVB 2YS6A 4C6RA 3QVGA 4E51A 2H5IA 3BHNA 1P2GA 1HQCA 3QY0A 4LBZA 4RY0A 3TLGA 2CXTA 2XX3A 2XMCA 3GDOA 4EP1A 3RR2A 2JLYA 1NPDA 2BSAA 4MNTA 5J5CA 3VR5D 4UXHA 3GFQA 3H9BA 4H6VA 2QX9A 5EE5B 3BGVA 3QE9Y 1ZOOA 2HCRA 2WRZA 3QI2A 4Z1OA 2C7OA 3LC0A 4Z7OB 2NXWA 5CFLA 4BLTA 1U2RA 1U1GA 4IDAA 1CR0A 1QYCA 2CE7A 4X1KB 3DBIA 3OPYB 1FYVA 4MQ6A 2B8EA 4YYZA 2EGUA 3PJFA 1DBVO 4ZQHA 1TRHA 4QQNA 3T7JA 1MJFA 3U7HB 1B4DA 3RCBA 3BGSA 2OV1A 2YL2A 2CK3D 1SA0A 4FMCF 3MOGA 1E9FA 2RONA 3RU7A 2FW8A 1HZZA 3VJLA 5J4KA 2QBYB 5JAMA 2UZ3A 1E4EB 2HRCA 2QAGA 3DKKA 3LUFA 1T43A 2XMGA 4GSYA 3DOEA 4C2AA 2CLDX 3ADCA 1XZDA 3IQHX 5E0OA 3LCUA 3MB8A 4QDOA 4OI1A 4BZXA 1E9DA 4J16C 4M1ZA 5IJ0A 4YRNA 4MVCA 2AZMA 5KNCD 3D5TA 2NTJA 3LIIA 5DM2A 2PKQO 4X6XA 4J2TA 3KZOA 3PFFA 4WFIA 2YVUA 4Y98A 1DAKA 1Z5GA 2BMAA 2P5YA 3GMTA 2DF8A 3CM0A 4L0DA 1DRWA 4RDHA 1KOFA 2Y0BA 3HJUA 3M6MD 3PUKA 1BJTA 4MUFA 4XB1A 4XIFA 2YCBA 3HFRA 4GR4A 2O54A 2FNAA 3AFGA 1FB5A 1IWBB 3U3MA 5COBA 4GEGA 2P2ZA 1ML4A 2BUBA 2GJ4A 2XTNA 1A88A 3R8FA 1P5FA 3T9EA 3V7UA 1TQ6A 1JYSA 1SQ6A 2FQXA 3CXUA 5SYNA 3HCAA 4R2MA 1XZMA 4XWYA 1XHFA 4GUDA 4YWHA 1W4CA 4E2XA 4RVUA 3C87A 4J7UA 4Z2YA 5IT0A 4MR8A 4DN6A 5DM4A 2PZLA 2RCYA 3O8BA 1RM0A 3O1JC 1XAHA 3G0OA 1ZH2A 4TL9A 4XVQA 1N75A 1PS0A 2X7HA 3UCEA 4B45A 5EMLA 5K01A 2IL1A 3G2NA 2CHQA 2OLEA 1BKDR 2CNLA 1RRPA 3GA7A 3K0FA 3PLRA 5EKDA 5E9WA 5HJ2A 3D8UA 4GLFA 5KSZA 5B4TA 2NUPA 3EC2A 1K63A 3F5QA 1SULA 1BFDA 3BRSA 3TNLA 4BCCA 2V59A 2G4CA 2RKOA 1VDZA 1A5SB 3AR3A 3CB4A 4OEHA 1FW8A 4O4JF 1QHFA 5DN9A 2POCA 2ZU6A 4CKWB 3UPUA 1V48A 5F1YA 4LDNA 3TLXA 2NYRA 2WYVA 2B1JA 4ND5A 1II8A 2HF7A 1N6HA 2YC4C 3PXAA 4Y6GB 2ZE7A 3OJLA 5IEBA 3PFCA 3LXXA 4UTVA 3V80A 3F3KA 3D6TB 4BJHB 1XPRA 1O0CA 4CF4A 2CB0A 3LYLA 1QFZA 2YZKA 1U7WA 3KRTA 2ZYSA 2FWRA 4QBKA 2DUJA 1W6UA 1T34A 1AHNA 5KTMA 4LTMA 1TK9A 3CX4A 2AG8A 3T3DA 3WNVA 4DDTA 4AZ3B 2GX6A 2AC4A 2XNSA 3F7NA 5H80A 1T26A 1OX4B 4O1IA 3SWWA 1ORHA 2C82A 1PJBA 3FHTA 4TROA 4R40A 1GPAA 2WWXA 1XE3A 2J7PD 4MQBA 1J97A 1YOVB 2I4TA 3KYDB 4IWXA 5F7ZA 3QVXA 2GPNA 3U1VA 4QM7A 3GLIB 2JGFA 2YFQA 1BOOA 2C2XA 4GWKA 3QPWA 3SP1A 3LGAA 2JH3A 3L7OA 3AUXA 4K7JA 3C7DB 3SJAA 5DE3A 3TB6A 1GTL1 1OVMA 2EKBA 4QJBA 3TSWA 1JI0A 4CM1A 4DG8A 2E4YA 3IA2A 2ENUA 2QN3A 3FVRA 2ISSD 4Y67A 5AQ1A 1FZQA 3P2EA 3P9XA 3VRHA 2EGHA 3ZWVA 5C31A 3PXXA 1YU9A 4I50F 4P2BA 4A4DA 1CQPA 1PQWA 1YS7A 3T5PA 1VKJA 3W8FA 1QGZA 4DIDA 4ZI2A 2A9RA 4QGBA 2GZ2A 3A1VA 3P1JA 4FU0A 4M3NA 3H83A 3K30A 1HNXB 1L7EA 1K5DA 1EFKA 1Y7IA 4K6MA 5EG5A 3RHSA 3VYTB 4J4TA 1SJ9A 2JPDA 3KKKA 2UYHA 1T3SA 3E23A 3OLWA 1GZ7A 1HO3A 2RBEA 4OUKX 3NQ41 1XDZA 2K87A 3IBGA 3ETJA 4O08A 5KI6A 4O3FA 2HV9A 3TIFA 4NF2A 4BX9A 4N4AA 2W43A 5HBGA 3TWOA 1X92A 3DB2A 4IV0A 2PRSA 1FRZA 3PDHA 3PDUA 4I4CA 4OYLA 4P7GA 4E1AA 4CEHA 5LP6C 2BOVA 2V96A 3EUWA 3LT4A 1ZFNA 3PTZA 4RMNA 3RRMA 1W5AA 3TLCA 3OTOB 3IT0A 5EIWA 1V25A 4Y9RA 1HE1C 1QFMA 3UYLA 5A5GA 2BT4A 4L72A 1V5WA 3SFTA 2IS2A 3PNOA 2BE7A 1UINA 2Y1DA 4J91A 4ZT7A 4H3KB 4G07A 2A5YB 3NHUA 1JJFA 3L8ZA 5AI0A 4L08A 2JKZA 2H18A 2ZAOA 3QEMA 3MCUA 4TV9F 5HIJA 4OIFA 1CTQA 4ZEXA 4FFNA 2E85A 2FR8A 5IC5A 4ALMA 4DLXA 1E63A 4KHPB 4S0XA 3RK4A 2ZJAA 4QNNA 4HAIA 3LNTA 2QY9A 3C5CA 3M49A 1N8SA 4CF7A 4E88A 2IY9A 4J8PA 2JLVA 3UW1A 2I66A 1QB8A 1XDBA 3S8YA 1D7AA 1O6ZA 4JS0A 1KVQA 1E5XA 1BS9A 3A6HA 4ZREA 4JJ6A 1C2YA 1V1JA 4IX9A 5LA6A 2IWHA 3F3YA 4CQMB 4BEVA 3TJRA 1PR5A 3H2ZA 3DHWC 1TTHA 1UBNA 2G88A 2GHIA 3HFGA 4UFOA 1MH1A 3CC8A 5CR9A 1JLMA 2NM0A 2ZRNA 2XZTA 3D1JA 2QGNA 4LWZA 5HE9A 5C8YB 4AS1A 4O4HA 1A98A 3DPSA 1NYRA 1IHXA 2AI1A 4HEHA 2FWAA 1I30A 3S70A 2VHJA 1ZIPA 3FPLA 3DZCA 3H1AA 4Q6WA 4TN5A 1EWTA 4W9NA 5BR7A 2X42A 4KMSA 3CA8A 2ERCA 1YIDA 3GW8A 5LP6F 1XTQA 1T8TA 5IXSA 1V7QA 5E2AA 2QDXA 2NVWA 5CA0B 2QTVA 1A9OA 1S2IA 1WXFA 3I8OA 2BP7B 3P0IA 4QBIA 1PW5A 3ACCA 4R05A 3MINB 5LN1A 3H2GA 2OAGA 1CEXA 3GBPA 1RLUA 4EUNA 1YE3A 5CYPA 1L5QA 4I19A 1JFFB 3REOA 1MXFA 1PDOA 3ZY5A 4KO1S 1PWXA 4LJ8A 1NWCA 2CMGA 4WHMA 3AW9A 3B2EA 3OZGA 3F6YA 3I9V6 3NO4A 1P2UA 1Y9AA 4NDNE 4BNVA 5HZHA 1G38A 2EL9A 3PGVA 1NOKA 4PX5A 5CT6A 4G8CA 1QCYA 3FJ1A 5F1OA 1G2OA 3HKBA 4G9GA 3VAAA 4L3VA 5M29A 5AVRA 1ADFA 1OZHA 4PVCA 1EGAA 2FTKE 1TM5E 4JI2B 5CNIA 3O90A 4UMEA 2O06A 3B3GA 4RL4A 1OWOA 4S2UA 4WZBA 4Y30A 5JS8A 3EVAA 4JI3B 4EI8A 2WJWA 1KJNA 2C42A 1EUCB 2XQFA 3ETCA 1PSDA 4QO8A 3ZY2A 2V54A 2ZM6B 2DWQA 2O7SA 4M0PA 3EWNA 2ZBRA 4WESA 1F0KA 2P4EA 2VP3A 3NBMA 5DIZA 4D9FA 4JEMA 3EZFA 4PQRA 3ZGXA 2FFBA 1QHHB 1CRQA 1TMKA 2M6SA 4HKTA 5I9SA 3RF6A 3SBXA 4D99A 2X8LA 2GD1O 2PKXA 3D4IA 1W49A 4QYWA 4QOJA 2H4HA 3QEKA 3KU4A 2B9EA 2R11A 5KDLA 1MDFA 2YICA 4AROA 5JC8A 3IIIA 1WABA 3F6EX 4K9PA 2WT8A 3RO7A 3TLMA 1HC7A 4WN9B 4B32A 1T9AA 5E95A 4RD3A 3SC2A 1RI4A 3S1AB 4YK7A 3UJCA 3O47A 1ORDA 1RM4A 1UDCA 1E94E 5JY6A 3C3AA 4BNMA 1NW8A 2R1UA 3SBDA 4Q18A 1WETA 4F04A 3ROPA 4AAYA 3GJTA 1OKKA 1UDBA 4HPXB 4NYIQ 3PIRA 3DBHB 2ZJFA 4JU8A 1ORRA 3AETB 3G2JA 2QRUA 4J75A 4JA0A 3TK1A 5HKAA 3ETNA 2YN2A 3BUSA 3K9HA 1VKHA 1ZK1A 1NXQA 5E38A 5HBRA 1RKBA 5CDYA 5IJ9A 5EZYB 2D62A 1T3GA 2CXSA 3CW8X 3B13B 4DDUA 3PHLA 1JU9A 2BFOA 2PZ8A 2Y67A 3OQPA 4XX1A 4DV2B 3N3BC 1A9YA 1MD9A 3HU1A 2QP4A 5K20A 1NQUA 5FUWA 4A0QA 4EJFA 1N77A 2E82A 4DJFC 3ZDCA 5ALOA 4XIGS 4NIMA 4Q3LA 5J2TF 5IU6A 1ILEA 1R74A 3IQGX 3AWDA 3NHRA 3N2ZB 4I6GA 1F3OA 5F23A 1E3IA 3P4YA 1UZLA 1PGNA 4ZAZA 3QOYA 1I51A 3UQZA 3LHDA 4KE6A 3EBLA 4L15A 1OY1A 1IC6A 4M1TA 1KOGA 4KXUA 4EA8A 2BR3A 5I7AA 4PLFA 4OXQA 4OU5A 1U2TA 2I29A 4W5RA 4YAWA 1M2OA 1T15A 3AEZA 1HTTA 2KPOA 3C43A 2SHKA 2Z57A 2VRCA 2PCLA 2QT9A 4CR7A 5F5LA 1YOBA 1QONA 2NUAA 3NM4A 3PNSA 3KZCA 3TLZA 3PPXA 4A92A 3DLTA 1H1LB 1JIKA 3A2KA 2FX3A 3ZK8A 3DV0B 2CNDA 3VNQA 3M5DA 3OIDA 4XWOA 1F0PA 2GZAA 1ORTA 2VNAA 3A1UA 3WIEA 2C7VA 2B99A 2RI1A 3GB9A 2GZ1A 4YIKA 1U7TA 5HWSA 5K4GA 2D2EA 3LGSA 1SAYA 4PO8A 3H2HA 1RT9A 2QYHA 3C6MA 5EUBA 5LNK6 5DCLA 1HFWA 4DLAA 5K0JA 4IIEA 2WJAA 1JU4A 5IBCA 4BAUA 1I3KA 1H93A 3FPHA 3B6ZA 2C3OA 1I8TA 4S1NA 1M6NA 1Q0SA 1TZBA 1MGPA 3IBYA 3AF6A 3RM3A 1QCZA 1M0WA 1DUIA 3HRKA 1NBOA 2FX5A 5FTMA 3SNHA 4A2PA 4DAOA 1ZWKA 1HKHA 1ENOA 3A1SA 3H8JA 4DT1A 3ND6A 2EKDA 2GF9A 3ZGVA 4E13A 1H94A 1F2TB 5FFMA 4YAUA 1VRCA 3A3PA 3ND7A 4F71A 2C4VA 1GSAA 5JH7F 4RTLA 2HSEA 1DBIA 4O25A 2H48A 1S8NA 4Z99A 4LNAA 3IODA 4XIJA 4LRQA 4PX3A 4TLLB 5MDHA 3NTXA 4NFHA 4WFKA 1BXRB 1SCKA 3FTNA 1W1IA 4R83A 2OXTA 1C8VB 1N7GA 1Z8NA 3B3AA 3E5RA 3NETA 1DUVG 1N1DA 3SKXA 2EJUA 1J0XO 3R5SA 4M1SA 4DWVA 3O1IC 1XGKA 3AMVA 3AJEA 3PRYA 4AN1A 3ZQJA 1E1NA 2IF0A 2F3QA 1YF3A 1SUIA 3ABZA 1KI6B 3FKQA 3ST7A 1MHTA 4WBNA 4LDZA 1Z2NX 4R69A 2SECE 3FLBA 5K2MA 2EIXA 3YASA 4DQUA 4P53A 4DLYA 3GWGA 1MPTA 2XUFA 4WK4B 4C07A 5J4VA 1K92A 4Q9IA 4FFMA 1SM4A 2AQHA 4TWJA 4YXFA 1F7UA 4X8HA 3SHVA 4H1TA 3PC4A 1SK8A 1QS0A 4FMCB 1KVTA 2INGX 5ALRA 5GTDA 1QYXA 3LX8A 1IMJA 2ISQA 3FLEA 2IPXA 2ROQA 2B4TO 3H5LA 4QTUB 1NU6A 5DBFA 3MSXA 3R23A 5LJLA 2H4WA 1OKKD 1PFVA 1FPMA 3VVLA 4PYJA 3OQOA 1CZOA 3ZV7A 1WMFA 2YVKA 2OYSA 4WFQA 3NAZA 1IONA 4NSNA 1V3VA 4MUAA 3X1YA 5FWYA 4JDPA 4QYSA 1XT6A 3WB9A 4EYGA 10MHA 5EQJB 4B43A 3ET4A 3R7LA 4IIYA 4Q4HA 3WYCA 3ILYA 3BJZA 8ABPA 3AKEA 3PHJA 3ROGA 4Y7CA 2CN1A 5TT0A 3GHYA 1OZGA 1BHJA 4BWFB 1GCGA 1B8PA 1VHDA 4ZC1A 4BNYA 4MV1A 4IUCS 3RJZA 4L5AA 1SBYA 2UVDA 2VLIA 4MIYA 3RIXA 3S27A 3H2IA 3NBZC 3NNNA 5KNCH 3MWEB 3OOJA 4X6YA 4M1EA 3X2SA 1WUHS 4JLKA 4E32A 2QIPA 1L7DA 4HLUA 1FOEB 2HV8A 4LZOA 4HXEB 4D9CA 5A03A 2C77A 3HJHA 3PB3A 3FB4A 4TSRA 3T7IA 4E09A 2QTCA 4P3YA 5JXJA 3VO2A 4JYMA 3AVOA 2QXUA 1T2UA 3SM3A 3RLFA 4CIXA 3NDPA 2XZDA 4FZ5A 1B0PA 3E5HA 4HAUA 4MR7A 1MN6A 5CT5A 5BQPA 3UJAA 3FWKA 4MICA 2FPWA 2RGWA 1CQXA 3O03A 4V0QA 3HUFA 5BN5A 1GKUB 4TRJA 5HHTA 5BUSA 3NNSA 4XSVA 2VPQA 2CEKA 2VRCD 4RDIA 2P30A 3SDZA 1RI3A 1FFGA 2DH5A 3GG9A 3LYUA 5AK3A 4AL4A 4BNTA 5TS2A 4O4JB 4Q3DA 3U9TA 3AJ8A 3QVLA 1KP2A 4ZVMA 4BO0A 3FRHA 3QVWA 2B34A 1TK2A 3E4DA 4GAEA 4MP3A 3NJRA 3RVOA 2L42A 1FMJA 3BWMA 4OP2A 3A1EA 3PWKA 1ISIA 1W5FA 3WDLA 4E2ZA 4EHAA 4LSMA 1YQQA 3I92A 3TIXB 3W7AA 1C7IA 1JLRA 4LA4A 3ZU2A 1JQBA 3C4QA 1LA2A 4DCTA 2WICA 1NN0A 5JQGF 3C3DA 4LTNA 7MDHA 2ZSIA 2PANA 2BDUA 4G8JA 4E5KA 3K4PA 2GN1A 1T25A 4WXHA 1TC1A 2TS1A 1E2IA 4Y2QA 4ZO4A 3IBSA 4C3UA 3FCYA 3SLKA 2G9UA 1MCZA 1Y42X 3QMPA 5JCZA 4LY6A 5BV1A 2F4NA 2YV1A 3CLUC 3HY3A 1HV8A 3OQIA 4RKEA 4IG9A 5LP6B 4MVJF 2YFHA 1QFXA 2WJ3A 1M1YB 3DPUA 4TS3A 2F62A 3DQPA 3MOIA 1HRDA 4J0DA 4RVDA 1PRYA 4NXNB 1CZKA 3O2QB 3U61B 3PRKE 3BAFA 4C14A 1E32A 4JN6B 2IS4A 5G4KA 2WYHA 3K0AA 2WR8A 4D9NA 1GEGA 1DCMA 5EESA 1Y8QA 5CLJA 1YJXA 1R4MA 5BV8A 1A8UA 2PVSA 3LBFA 1GUFA 1C3XA 4G5HA 4I50B 1U3TA 5A4MS 3ICEA 3DNFA 1SEPA 1THMA 3O8DA 2QD1A 3DMTA 4JYBA 4B2LA 4W5QA 2MSEB 4ZARA 1BMDA 2X8BA 3P71T 3ZIDA 1P5HA 3B52X 3TPCA 2IOQA 2O8VA 3L0ZA 2I6FA 2ZCJA 3JQFA 4M1QA 3SEFA 4V0RA 2IXGA 4UE2A 4X8LA 4D02A 4ZFNA 2I0FA 4WUVA 4FPXA 3Q72A 4CFSA 1BDJA 5EWLB 3EG5A 2ZWOA 2Q0HA 2IKSA 3A58B 1HYEA 2LBPA 3G02A 5EWMB 4RTKA 4BO7A 1HEYA 2UZ0A 1YZ3A 3BSWA 1GLVA 2ZRCA 4N5HX 4TKZA 4GKVA 5CCDA 5CDTA 5AESA 4WZAA 1NNLA 2OZKA 3N59A 3QUQA 4M22A 4G89A 2DYKA 2J5KA 4N40A 3MD0A 3MF4A 4HEA6 3A8TA 5ED4A 3KFXA 4BTEA 3V1KA 2JDIA 5JHHB 1TEZA 1QAQA 1FS4A 3BN3A 3LLUA 2BEWB 4TV9B 4DSOA 1I0IA 3RS0A 5JYBA 4BVLA 4MQFA 4MPJA 1BTOA 1GG5A 2XNHA 3EC7A 4LMAA 1QOZA 1ZRHA 3NI2A 4ZVPA 5JECA 4EA9A 3KWMA 1P7CA 4PC7A 1E2DA 1XZGA 3CINA 3GJQA 4OHKA 5D84A 5KTKA 5B7PA 5KTOA 4ETWA 1BJKA 2H11A 4FFLA 4HVAA 4EYKA 3U4HA 4NZ9A 1G5RA 4ZMBA 5AW3A 4URXR 5JAZA 2VSYA 3PNBA 4DDMA 1EKXA 3RUIA 4CT5A 5F1KA 5FLKA 5BUZA 1U3FA 2RGDA 3V8PA 3GRKA 5KHAA 4NBTA 1V8ZA 3OQVA 4IF4A 4XW2A 3SZMA 4G9BA 2P4UA 4KDRA 1K8ZB 1QIGA 3O31A 5E9JA 5JUWA 3ZHRA 2B9VA 4KR0A 4J7XA 2RDMA 3ZW9A 4WEQA 3L1JA 4UARA 3TNFA 1CP2A 2AW5A 2OB1A 2XF2A 1OWLA 1RP7A 1CR4A 2XMSA 5LP1A 1Q11A 3E7FA 5DI3B 5COAA 3RAFC 4HSGA 3VPAA 3D4LA 3HADA 2F4VB 3UVEA 2GSDA 1KJ9A 4I9HA 2GWHA 4CRWB 5B2FA 3KHKA 2QLBA 2VT7A 3QW4B 4X64B 4KZKA 1L8AA 2GYUA 3R9XA 1YTUA 3SLGA 2I2XB 2N75A 1K2VN 1RWNA 2XB2A 4D9BA 5BNFA 4J1TA 4DV3B 1AKQA 3AJAA 1A97A 4G5YA 1OT3A 3LLMA 1KZ9A 1MOZA 2KQUA 1QWOA 2PJRA 4PO1A 3O4RA 1HURA 4ENTA 1XQ1A 2WJ4A 4MV9A 4OQ4A 4ZQBA 5DEIA 3EQ8A 2HIGA 4C0SA 4WA7A 4TUYF 4Q7EA 1EK6A 1S2LA 2ZPUA 1P6XA 1BS2A 3WBKA 1SXQA 2ORIA 2QM7A 4DNXA 1T6NA 4V02A 2CXNA 4KQKA 3FOBA 4IVNA 4ZXFA 3ZHBA 1KFEB 3BCHA 4KR9A 2IIBA 4L4RA 5CD1A 3OETA 3EXG1 1JWBB 1M8GA 2WUWE 5D86A 1MW8X 3O8NA 1Y1LA 3ODGA 4DEXA 5BOSA 1EHYA 1GPLA 1YJCA 3WNCA 2WB2A 1LS6A 3VTZA 5ABPA 2R0QC 3TJZA 2XOKA 2ZJZA 2ILTA 3ZCTA 2IKQA 1I6KA 5CVTA 2B8NA 4L2IB 1DC8A 3ZX5A 2HMAA 1IPFA 1DEAA 4YDHB 1HEIA 4QYMA 3HBFA 4TMKA 1VL0A 4R68A 3NTUA 2YY5A 1DIHA 2D1FA 3E61A 3HZRA 3TR0A 1XZLA 4BNZA 1G60A 2ETVA 2P2GA 4QRDA 5JG7A 1QTIA 2P5UA 2V4MA 1G41A 5CFRA 3RSGA 3GP5A 2X8JA 4LYYA 2NU7B 3JASA 1RJDA 2A0FA 4LF6B 1N1GA 1O03A 4Q1CA 5E6RB 1Q3KA 1TCVA 4EJ2A 2C4MA 1KE1A 2L82A 2GAAA 3PNMA 1R6BX 2PPVA 1SWWA 2EFCB 2IEBA 3I5XA 3G0BA 2JVIA 4OREX 1E60A 4QFBA 1MB0A 3RC1A 3TLKA 1GAJA 3ECAA 1T2NA 3MTQA 3UC9A 2DR2A 4ZOLA 1RRFA 2QL5A 1L8XA 5A71A 3DWIA 1P2BA 1L8OA 3A04A 2C5GA 4CU2A 3VYUB 1ZCBA 2NTNA 1ISJA 2PGLA 1G66A 4EPWA 1XWIA 3UF0A 5LDGA 2PQ0A 4KGXA 3TOZA 1U2EA 4NOLA 4GG1A 1JDPA 1RFGE 1A9RA 4ZO6A 5E4FA 1MIHA 3JAWA 4O59O 2BM1A 1RS0A 5IM4F 1H9CA 4YDSA 1DE0A 2WILA 2JDID 2G36A 5A3SA 2BKVA 2D0OB 3OKFA 5J2TB 1N2IA 1CUXA 1G6OA 1H1TA 4FWBA 5JSYA 1X2EA 2BW0A 1U7ZA 3H1BA 3I3SR 3L7BA 4GLJA 5LQMA 2R8BA 3QMVA 1D0VA 3KKNA 1QGUA 2O57A 2IGBA 3ZJTA 3A05A 4G0MA 3V6MA 3I8XA 1JJ7A 2VNSA 4US1R 2ADOA 2WYWA 3QP9A 4FYMA 4LISA 2GBCA 4AF7A 1L4EA 1CETA 1KP9A 1QORA 1X9IA 4AP6A 3K0CC 1T1JA 4FKZA 1Z3CA 2PWBA 4P4NA 5WRFA 5BQ5A 1W9MA 1AKWA 1WMEA 3O4IA 3L4KA 1BVHA 1R16A 2R8YA 3QMWA 2MYPA 1O6BA 3PQ3A 4OQNA 4D92A 4NAHA 3F2VA 5L4SA 4Y2UA 2CNOA 5JDIA 3V8QA 4AU1A 1TRKA 5D5PA 4MGHA 5H7XA 5IUKC 2IWRA 3AM4A 1RC0A 2H3EA 2POQX 1V7ZA 3R7WB 3WWYA 2XA9A 1T9HA 1Y9ZA 2XWQA 4AW9A 2VA8A 3HKCB 3TBKA 4ECAA 4G1EB