2VAVA

Crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
376
structure length
347
Chain Sequence
NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 116
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vavA00
3AINA 3GZJA 2QZPA 1R50A 2BUBA 3AIMA 5HF6A 1EINA 4JUIA 3W9BA 2QTBA 3DLTA 1PV1A 2QXUA 4Y2VA 4BE9A 3AFIA 3JYHA 3R3XA 4B0PA 1TQHA 4KJXA 4MEAA 3MUOA 3R40A 4JEIA 1VZ3A 1XRMA 2XUIA 5LYYA 1JT2A 1TIBA 2HA7A 4LKOA 1GT6A 3ESDA 1P0QA 1XLUA 3WWPA 2I3ZA 4HTAA 4HZGA 2WFLB 3UUEA 3HJUA 1FFEA 2WHPA 4JH0A 6YASA 4UHBA 2WFZA 3L1JA 3NGMA 1JJIA 3H0CA 1T4MA 5DJ5A 4J7AA 2I3DA 4C87A 3ESCA 5AM3A 4I19A 1G5FA 2PSFA 5AK3A 4ZI5A 5LLSA 2CZQA 2ROQA 5EHQA 2WSLA 4UFPA 1W75A 4EY6A 1JFRA 1H23A 3QPAA 4H7KA 4H35A 4FLFA 4INZA 2GYUA 5FV4A 3HC7A 4KRXA 5HQ3B 3WWCA 3B3QA 2GYWA 1R9MA 3WKDA 4HXEB 1UK9A 4BZZA 4QE3A 3ZLTA 4OD0A 1XQXA 1JMKC 1JMYA 1ODSA 4CFSA 4NS4A 4AO8A 4AN0A 3KOOA 1EDEA 2CUTA 3MGAA 1O6GA 1Y7IA 4MYDA 2DHCA 4FWBA 5IH7A 3O4HA 3QPCA 3AIOA 1EHYA 2Z5GA 2O7VA 2X5XA 2YXPX 3VKFA 2W6CX 4BRSA 4X3CA 1E89A 4UHHA 4B9AA 1HLGA 3R3VA 3WZLA 1QO7A 4PSUA 4GWLA 2E3JA 4G8BA 4WY8A 5AM4A 5ALJA 2EDCA 2OLEA 1QIDA 1J07A 1P0IA 4B84A 2WFMA 1VXRA 4AZ0A 1DWPA 4H18A 4BB0A 4DMFA 5C8XA 2HA5A 3A2MA 1CLEA 5ALLA 1W6RA 1EK1A 2WUGA 4BYMA 4GECA 3VVMA 3C6ZA 4QWWA 1AMNA 1XRPA 5A7FA 4BDSA 4IH4A 4Y7DA 3C70A 1ZIXA 4EY7A 2AXEA 4ZV9A 5FXMA 3WK4A 2HU8A 1R3DA 4G4JA 4YPVA 2OAGA 4U2EA 2WUDA 1TKRA 2GYVA 2QJWA 4H7JA 4BAZA 4B85A 4UHFA 3WK6A 1JU3A 1BCRA 2HIHA 4DNFA 1E66A 2WKWA 3G9UA 4W1PA 3AZOA 4AX4A 4DNOA 2H1IA 1WPXA 5EIAA 4BC0A 3ZLVA 3R41A 4ZV7A 4G4IA 1CRLA 4MXDA 4ARBA 4BZWA 3DCNA 1QLWA 3B12A 2WIJA 1FSSA 3GBSA 2WQZA 1JJFA 5JAOA 1ZD3A 5E2IA 4DNPA 3A2NA 4BP8A 3STYA 3ICWA 1XQWA 4C4XA 1QIMA 1EXWA 4RE6A 3G0CA 2XT0A 4H7DA 1YR2A 4PO3X 5JALA 5CH3A 4Y2SA 4X71A 1XRRA 1AURA 1G42A 4EY4A 3KDAA 4C6HA 1JI3A 5K3FB 3I6ZA 4GHWA 1CV2A 4OU5A 4BATA 5EHNA 4JYMA 1ODTC 4N8SA 5A62A 3H1BA 5FLKA 1GQRA 5HF8A 5KREA 5AK6A 4H0CA 4NVRA 2I03A 1MX9A 4BVKA 1TCCA 4ZWNA 1YS2X 3DOIA 5JADA 3O9VA 4H7HA 5AKXA 5ALZA 1LLFA 5HF5A 3H2HA 3CN9A 4JNCA 2HHAA 1QONA 1VA5A 5D3ZA 1H2XA 3WZMA 1AX9A 2H9YA 1ORVA 3ANTA 5K3BA 1MTZA 4FFWA 4AB1A 3QMVA 4WY5A 4GLBA 4I4CA 3DNMA 4BRZA 1X2EA 3O95A 3G9ZA 1BEEA 3DL4A 5HKAA 1P0MA 1ZI9A 3RLIA 2JEYA 1LBSA 4KEAA 4CG3A 1H2YA 3C8DA 3PICA 4OB8A 1ZICA 4ARAA 2XUOA 1GXSA 4BTLA 3ZI7A 3PUIA 2PSEA 2WLSA 4CG1A 1QIFA 5AM0A 2QMQA 1CPYA 1DWOA 2HA2A 1UOQA 1XRQA 2HA0A 5A71A 1L7RA 2D0DA 3OM8A 3G9TA 2JGLA 2XDWA 4X91A 3O4GA 5A7HA 4CIAA 1VXOA 5AM1A 4J0JA 2IIVA 3SWWA 4LIPD 1ZGBA 1XRNA 2K2QB 4J0KA 1CQZA 4MEBA 3IURA 3T52A 4X85A 3TEJA 3PDCA 4F0JA 2DCMA 2JGIA 4FHZA 3VJLA 3W04A 5K5EA 1K8QA 2W22A 3WIOA 2RGUA 4C88A 4J0DA 2DHEA 5AOAA 1TAHA 5DYWA 5AIBA 3ZV7A 1ACJA 1NX9A 1DU4A 1EDBA 1NU8A 1AGYA 1QE3A 4Y2JA 1MPXA 1X70A 2HM7A 5YASA 3IB3A 1DWQA 2WG2A 5HK8A 5CXUA 3G02A 4CI9A 5ALVA 5H3HA 3DDUA 5ALPA 1Z68A 2XMDA 1EVEA 3R3ZA 5FOQA 4WCVA 4IHAA 5LZ7A 5AKJA 4U2FA 1AUOA 4L72A 5BV7A 1WB6A 4BDTA 4HRXA 2OG1A 3I2IA 5CT8A 1CFJA 1J06A 1ZJ4A 5BOVA 1NU6A 4DSZA 4HXFB 5K3AA 4EBBA 4L9AA 5D3KA 3W06A 3FVTA 2QUBA 3H2GA 1GKLA 2VTVA 3GUUA 1H2WA 5BWCA 4AQDA 3BWXA 5DNWA 1FFBA 5IVDA 3IVMA 1EDDA 1SCIA 1A8SA 1OCEA 3O9MA 5ESRA 4X7BA 3QVMA 3U0VA 4NZZA 3I2FA 1LPOA 1VJ5A 1BU8A 3PFCA 5EGNA 2OQIA 5AJHA 2Y1KA 3D2BA 1ACLA 3EQ8A 5AIAA 1BS9A 1MX5A 3DOHA 2FJPA 1KU0A 2O2HA 4EUSA 4QDZA 1UKAA 1HPLA 5AI0A 3IUMA 4Y2RA 5ALIA 3ANSA 4OCZA 1MJ5A 1Q0ZA 1DQZA 3STWA 1DT3A 2BFNA 5HCUA 2WJ6A 3OG9A 1P0PA 3STVA 5C7YA 2VT7A 2AJCA 1XZBA 1AZWA 1EA5A 1XZJA 2BCEA 2QKYA 3FYTA 5ALRA 4YASA 4Y2YA 3YASA 2PVSA 2V9ZA 5HFAA 1C4XA 4MWTA 2ZSIA 4UFNA 3V1KA 2JGEA 2XQGA 1J2EA 1WHTA 3I6YA 3HRHA 4U2GA 1I6WA 1CUGA 3FLBA 1H22A 2XQIA 1DINA 1UK8A 4EHBA 3I2GA 5BWBA 3FLEA 4H7EA 1DTEA 1IUOA 5CH5A 2XQFA 3IIIA 4FFVA 2NW6A 1MAHA 2AJLI 4X6XA 4P93A 2QUAA 5JZ9A 2PU5A 3C8HA 2X76A 4X94A 2GBIA 4EY5A 5C8ZA 3D3NA 1LPNA 1XZFA 3FYUA 3V1LA 1U8EA 4DMKA 1XQVA 7YASA 4WFJA 2XUQA 3B5EA 2GBFA 2PUJA 3A6ZA 1AC5A 1C7IA 1G66A 4J0HA 3IUNA 5JARA 1YAJA 1RYYA 1EX9A 4GXNA 4UHDA 5EHXA 2WHRA 1F0NA 3H04A 4G9EA 4FDMA 1MN6A 2OGTA 4M0EA 1OILA 3D2AA 4MYSA 4BTVA 2JGKA 1XKLA 4C01A 1WHSA 4J3JA 1CUFA 1ODCA 5FP0A 4QDXA 4DYHA 1SCKA 1R4ZA 5AI8A 1M33A 1USWA 4ITVA 4ZREA 1SFRA 1EI9A 3FLAA 1FFCA 3ESBA 3NOXA 5CURA 2WHQA 4BBZA 2WFLA 2B4KA 5FRDA 5IKXA 1QIHA 1DX6A 2X8BA 4KE6A 4UHCA 1HBJA 1CUXA 1E5TA 4B0OA 1A7UA 1MO2A 2H7YA 1B6GA 2XMSA 4OB7A 1MAAA 2HFKA 5FUMA 3A2LA 5A7GA 5DLPA 3I6MA 4PSDA 4WFIA 3FNBA 5LZ4A 1LPMA 1Y37A 1RWQA 4WFKA 1ZGCA 3HI4A 1SC9A 5CT6A 1YS1X 2BKLA 2ACKA 3CCCA 3QH4A 4GW3A 2Y2VA 4KAFA 1FFDA 4KE7A 3WL6A 3E3AA 2WU3A 3KXPA 1CUUA 1QOZA 1U2EA 3M82A 3HXKA 4OPMA 5HZGA 5ALSA 1CUVA 2XUHA 5J3JA 1VE7A 4PNZA 2PM8A 4I3FA 4UUQA 1A8QA 1ZD5A 5HQ3A 3SC2A 4C4ZA 2PU7A 3STTA 2QM0A 3UUFA 1CQWA 3NWOA 3RKSA 3VXKA 3ZPXA 4FOLA 1K4YA 1F0PA 1QIKA 3S8YA 3RK4A 3OTQA 4Y2PA 3SX4A 3DKRA 2PSDA 4KAJA 4IQ4A 1PFQA 4B7ZA 5ALUA 3V9AA 4RPCA 3P2MA 4BE4A 4Z49A 2QOEA 2RAUA 4BVJA 2HU7A 2XQKA 1VOTA 3CXUA 2RONA 1VZ2A 4IH9A 5JYCA 5CT4A 3D5EA 1L7AA 5HKBA 1OXMA 3Q0TA 2O2IA 4OB6A 1ZD2P 1LZLA 4X6UA 3I2KA 2C7BA 4B9EA 2UZ0A 2JGJA 4U2CA 4X00A 3FCXA 4OYLA 4BCDA 2HL6A 5DYTA 5E4TA 5T4BA 2OGZA 1QZ3A 3D0KA 1MNQA 4L3WA 2C58A 2ECFA 2JGMA 1THGA 4UFOA 4P9NA 3H19A 4QDTA 1YAHA 3G0DA 5DNUA 4E11A 5T4EA 1XLVA 4EB0A 3MUNA 2H7XA 3C6XA 4XX1A 5AKZA 3SK0A 4GI1A 5LKRA 4EZIA 1J1IA 1LZKA 2PX6A 3I28A 4B82A 4F60A 1QO9A 5AK4A 4LXGA 3O4IA 5JD5A 3VISA 2OQVA 2XUPA 3FCYA 2RIPA 3WA7A 5JASA 2BAGA 1K6EA 1QIIA 3DQZA 4XVCA 2WILA 3E1GA 5SYNA 3UMJA 2OPHA 4E15A 4AO6A 5T4FA 3HABA 5CXXA 1GPKA 5DYYA 4G9GA 5JANA 5CBKA 2OCGA 1IVYA 3Q8WA 5AKYA 2JGFA 4KACA 1XZAA 3BDIA 3G0GA 5AKLA 1EB9A 1IZ7A 2J3DA 2VAXA 4K6KA 1GGVA 5ALNA 5AM2A 2FUKA 1BN7A 3EF3A 3H2JA 3H2IA 1Q0RA 1QFSA 5A6VA 1GPNA 3FBWA 1BEZA 1RP1A 1VLQA 4Y2UA 1U4NA 3U1TA 4MWSA 1XZEA 4PV7A 4N8EA 3D7RA 2HADA 2ZVDA 4WDRA 2VJCA 3C5VA 2WUFA 5ALOA 4D9JA 5K3FA 4TGLA 4PQEA 4FMPA 4QEKA 1GQSA 4UBMA 2XUJA 4ETWA 5EFZA 5AKKA 5LP1A 4G4GA 2FX5A 2Y6VA 3F67A 4F5ZA 3DJYA 1YCDA 2EEPA 2WJ3A 3MVEA 4PSCA 3X3HA 2ZJ6A 4CCYB 2XMZA 1QIJA 2XMRA 1F8UA 2JF0A 1R9NA 3IDAA 1SOMA 3AZQA 4UBOA 4WJLA 3H2KA 3BE8A 1CUWA 3QYJA 3WI7A 1CUEA 4A16A 2XMQA 1TK3A 3DYVA 2C4HA 2OXEA 1LNSA 3DD5A 1ZJ5A 4AMYA 1CUAA 4N5IX 2B20A 5LIPA 5IVIA 1K5PA 4KE8A 4OSEA 1F6WA 2C0PA 3HEAA 2XUKA 4G8CA 4J0GA 1QIEA 2DFPA 4H7FA 4QDUA 2I78A 3O0DA 4BAGA 2QXTA 4GDMA 4YK7A 3AIKA 4LYDA 2PUHA 4RE5A 3CN7A 5JAUA 1YSCA 4OYYA 4Y2TA 5LZ8A 1UXOA 5FKJA 3W05A 1XZIA 3A70A 3BIXA 2GBGA 1E8DA 2G63A 2ZYSA 1UZAA 5LKAA 3BJMA 3IUQA 4AZ3A 2IX9A 5FPPA 1N1MA 3AZPA 2BUAA 3DS8A 4XWGA 2DHDA 1CUZA 2GZRA 3PF8A 4K5QA 5LZ5A 1XZDA 5AH0A 3V1NA 4X6YA 1W76A 3F8SA 1EB8A 1CIJA 3WK9A 1UOOA 3K9BA 2BUCA 2XE4A 1VKHA 1R88A 4RNCA 5E4YA 1YB7A 2HRRA 1CUSA 2G5PA 4NMWA 3HZOA 2RHTA 1UKCA 3WKAA 2JEZA 5JATA 4K6GA 5JD4A 3LIPA 1CUJA 1YB6A 4B80A 1WB5A 1C7JA 1LBTA 3LCRA 1L7QA 3W2TA 5ALYA 2VJDA 1XZCA 1CUIA 2BJHA 4AN1A 1AQLA 5ALWA 5LZ2A 3R3YA 4XJVA 4MJ3A 3KWFA 3LS2A 1XZKA 3WK7A 3D59A 1W1IA 1SCQA 2Z3WA 4X92A 4N5HX 3IBTA 4Q05A 2C0QA 2XLCA 3O4JA 3E4DA 5KWJA 3WL5A 5AKHA 2ZJ7A 1LGYA 4DLNA 1HL7A 2GZSA 1ZI6A 4AXBA 1FJ2A 3WK5A 2CB9A 5EIHA 1UOPA 2QT9A 1ISPA 4U2DA 2O7RA 5JD6A 4H77A 5A2GA 1CR6A 3I2HA 2WTMA 3GFFA 4L0CA 1LPAB 2J3QA 3VDXA 1FFAA 4OUKX 4A5SA 4IH1A 4LXIA 2WJ4A 2Z3ZA 5ALFA 4C89A 1VE6A 4OU4A 4G5XA 3WMRA 1AKNA 4HXGA 1XZLA 4Q34A 3H1AA 1WOMA 2O2GA 1IUNA 5AI9A 3M83A 4Q3LA 2EDAA 2CKMA 5K3CA 4B81A 2B61A 2ONCA 3WL7A 1D07A 4FTWA 4CG2A 2WUEA 2ZYIA 1H2ZA 2WG1A 4Y9SA 5JZSA 1ZOIA 3L1HA 1N5MA 2WHPB 3WKCA 1HQDA 5I7UA 3EQ7A 3F97A 1WPRA 4M0MA 5ALQA 3DEAA 3ZWQA 3KWJA 4A23A 4W1QA 1CUYA 1ZD4A 3G9XA 3S2ZA 1UK6A 1BE0A 5DTJA 1W4LA 4X97A 3WK8A 4AMZA 1E3QA 1CVLA 1QTRA 5AKIA 3QITA 2AJBA 4X93A 3R3UA 1U65A 2AJ8A 4PF1A 2C5FA 4DM7A 4FNMA 1HKHA 3WWEA 2P8SA 4FLMA 4FBMA 3M3DA 2VF2A 5ALTA 3LP5A 3V1MA 3IULA 2XUDA 3ICVA 4QDOA 4P92A 3RARA 3STUA 2XI4A 2GBCA 1GPLA 5DWDA 4TPKA 5IVKA 1N5RA 4W1RA 2R11A 4EA6A 4BC1A 3AILA 1DX4A 3ILSA 4P08A 3HYSA 4IO0A 2OGSA 3C6BA 3STXA 5AKGA 4Y2XA 5LZ9A 5AHXA 2YYSA 1B41A 3H17A 4XIIA 3C87A 3E0XA 4KYVA 5AI5A 1DT5A 3G0BA 1BROA 2CEKA 3EQ9A 3QZUA 4LXHA 4WDQA 4O08A 4BP9A 1CEXA 3PI6A 2VEOA 3HSSA 4QLOA 3N0TA 3F9CA 3EBLA 3LIIA 3G7NA 3QMMA 3QBJA 4G8DA 5AI4A 4W9RA 2HFJA 2AJDA 2CBGA 3WJ1A 5EIEA 1VA4A 3WYNA 1QJ4A 2QRUA 1QIGA 1UKBA 2XUAA 4HRYA 2WG0A 1A8UA 2J4FA 2OCKA 1XZHA 1WCYA 5EI5A 1CUBA 2Z8ZA 2WM2A 4TVKA 2WTNA 3C5WP 2WIGA 3TJMA 3WL8A 1IMJA 2XQJA 5ALGA 2ZYHA 4HVTA 2WIFA 1ORWA 2CJPA 2PBLA 3I1IA 5ALXA 4UHEA 1JU4A 2XUFA 3WKEA 4FLEA 3IA2A 4E46A 1XKTA 4M0FA 4UBJA 3C45A 3ED1A 4KAAA 1A88A 2RI6A 4F21A 5CW2A 3PFBA 4H7IA 3KD2A 4KE9A 2WIDA 1JKMA 1XZMA 4X90A 3AJAA 1ZI8A 3DYIA 3G8YA 1MT3A 2DQYA 4GBGA 4K2AA 3WJ2A 4QZVA 3BL8A 4Q82A 2FJ0A 5T4HA 2XUGA 2VATA 4KR0A 4CCWA 1EVQA 4AO7A 5E4JA 1QGED 4K6HA 2G5TA 3WIBA 1R1DA 3IUJA 1Q84A 5ALKA 4QWMA 2JBWA 2WU4A 4UBKA 3F98A 2G4LA 2ZYRA 4BVLA 2PL5A 4UPDA 3FOBA 2PPLA 5FDFA 3TGLA 2DSNA 1GZ7A 2VT6A 1IUPA 2QS9A 4HAIA 4UBIA 2HDWA 1CUCA 4J0IA 1XFDA 5C8VA 5ALDA 1XRLA 3FSGA 5HK9A 3I2JA 3WQHA 4UBNA 1CUDA 4S0XA 4Q3KA 5I9IA 5CRIA 3BJRA 4MQLA 2VSQA 4EY8A 2B9VA 5JIBA 1MNAA 5JAHA 2BGRA 2ES4A 5EHZA 4B6GA 3BF8A 1UFOA 3FSGD 4ZRDA 3VJKA 2XB6A 5D6OA 1G4HA 1E8NA 2PKYX 3R3WA 4ZXFA 2DQZA 3KSRA 5KWIA 2RHWA 3ZLUA 3D2CA 3EIOA 3FWHA 3CCBA 2D5LA 3BXPA 4N8DA 2VJAA 4E14A 3ESAA 4X95A 3H18A 5SYMA 3R0VA 3OPMA 1UK7A 3QPDA 4MQMA 5ALHA 5FPQA 5JZBA 4BCCA 2LIPA 5AP9A 5CH8A 2VAVA 5K3EA 4LYEA 1PJAA 1TCAA 3G0IA 3K2IA 5I8PA 1S8OA 4JYPA 3WYDA 4V2IA 2OCIA 5F4ZA 1BRTA 2WIKA 2Y6UA 1KEZA 4Q1VA 3WWOA 4PW0A 4DSAA 1UWCA 2V97A 2PSHA 4CCYA 2Q0XA 2VQ6A 5CTAA 1MU0A 1MX1A 3V48A 1LPBB 3L1IA 3AUKA 1XLWA 3OURA 4GEGA 2R8BA 5ALEA 1XQYA 3QM1A 1XZGA 5AK5A 3C43A 3QMWA 5CT5A 5AO9A 3WLAA 1JJBA 5C81A 4FKBA 1YASA 1QFMA 1E8MA 1HDEA 3VVLA 1WM1A 3M81A 3BDVA 4CIBA 3VJMA 4Q3OA 1EK2A 1T2NA 2V96A 2OAEA 1ETHA 5D7BA 2XLBA 3JW8A 2XMCA 2XMGA 1K63A 1WB4A 3HACA 3FYUC 1YA8A 4QLAA 5IVHA 2QJRA 5HFNA 2Y2UA 3HLKA 4FNGA 4KRYA 4QA9A 3WKBA 5AKEA 2YASA 2HU5A 4LHEA 3C6YA 5HF9A 1Q83A 5DTIA 4W1SA 1W52X 3OOSA 3WWDA 1ZIYA 4J0CA 3LLCA 3TRDA 2J4CA 4ZGBA 4DNQA 1XROA 4BCBA 4DGQA 4DTCA 4W63A 2JIDA 1GKKA 4DIUA 4U2BA 1CUHA 2C5GA 5KBYA 2QVBA 5DNVA 1UT6A 5ISMA 2VJBA 3W9UA 4DMHA 2HA3A 3F96A 2ZSHA 2V98A 4BAUA 2OCLA 2YH2A 1LPPA 3FAKA 5ALMA 1O6FA 2BGNA 3I1YA 3BIWA 2ORYA 3GROA 3FVRA 4HS9A 3PE6A 4DMCA 2DR0A 1THTA 5AOBA 1BCSA 2XMBA 3DKKA 3PUHA 1EH5A 2VA9A 2H7CA 5AI6A 1KU6A 3RM3A 1DQYA 5K3DA 1BN6A 4J03A 2Z8XA 1TRHA 2CMFA 5CT9A 3K6KA 3N2ZB 2ACEA 3JWEA 1IZ8A 3BF7A 3FYUB 2PSJA 3D4LA 4QNNA 4UBLA 4Y2QA 5AM5A 2HRQA 4FBLA 3DL7A 1Y7HA 3PF9A 5AICA 3NUZA 3GA7A 1QTIA 4ROTA 1LPSA 2HA6A 1X2BA 5AOCA 2ZJFA 4B83A 1TCBA 5CMLA 4C4YA 3OC0A 4G1FA 5JAPA 4RGYA 1YA4A 1N8SA 2HA4A 3WA6A 4YX9A 2QR5A 2IITA 3T4UA 3GELA
chains in the Genus database with same CATH superfamily
5K4AA 4PFJA 2CDBA 5EIBD 4AT1A 5JWHA 5JZMA 3VC3A 2C61A 3JD0A 3LW8A 4REOA 2VNJA 4WLUA 2O5EA 2FLWA 1EINA 4NARA 1PU2A 3W9BA 2H8KA 1JU9A 3DLTA 3ZLBA 3TSAA 2CXSA 4D9BA 1UL1X 3TW6A 1HX7A 2QYOA 1AKQA 4Y2VA 2YWBA 1EUDA 3L84A 3HKBA 4WZBE 1GRVA 4N6NA 1GCGA 5IKMA 1FZTA 3R3XA 2DHRA 1I32A 1SBIA 4KQ2A 2OWDA 4B0PA 2IDKA 3IRVA 4OOEA 3R5TA 3R40A 1JKIA 1VHWA 1HDOA 3FWZA 1WCV1 2CVFA 3CZAA 1Z13A 1LDGA 1VG0B 2Y0CA 3CR8A 2YCBA 1GUFA 2RHJA 4RPGA 1CEQA 1P9RA 2HA7A 5E9JA 4K6MA 1YZYA 4LKOA 1HF3A 3T41A 2I6TA 2YWEA 3F47A 3I83A 1SC4A 3HB0A 2HW8A 1CK4A 2FUG1 2YTZA 5FWXA 3L6EA 3ZE8A 2ZIAA 3GR6A 4G2NA 2VCEA 3E3OA 3OPYB 3PFHA 1G7CA 2BMWA 2RGAA 3MJTA 3TH5A 3TIGA 3QNWA 3RSCA 3UUEA 4JI0B 4M55A 3MJVA 4HDOB 2W58A 2WHPA 1HOXA 4Z0TA 2V6FA 4DPLA 4RLFA 2WFZA 3IRUA 3QEKA 1DEOA 3V80A 3L8CA 3U0BA 5KJEA 2BGUA 3H0CA 3KJIA 3OUUA 4JUAA 2MYPA 4JFAA 3IHLA 3HVRA 3N58A 4P83A 3K4PA 4M99A 3FJ1A 4RANA 3RRFA 2GF0A 1AN0A 2OZVA 3FNGA 2A9FA 1ADBA 1NW6A 2AQKA 2BEVB 4GPTA 1C0LA 4EZBA 1XPJA 2ENWA 4BO4A 4M8IA 3HU5A 3K9LA 1WU8A 5AVWA 4IWXA 2VPWA 4YXWA 1EYZA 3GHHA 1DRJA 3LMKA 1T0HB 2OLJA 2ZOSA 4BGIA 3K1JA 3L40A 1P2TA 2PSFA 4LHZA 3W5DA 1T9CA 2CV0A 1V25A 1NQUA 4OMFG 4WOCA 2YVLA 3M1LA 4D4GA 3FPKA 2JGDB 5B3JA 3FUVA 1N5KA 1RJFA 3C8UA 2FW9A 2PMBA 5LDDC 4TV9F 2ODEA 3DW3X 3KWMA 4I1OA 2WSLA 4M86A 4PHCA 5D1NA 4UFPA 1W75A 1K06A 5LP6A 1C3LA 1Q1EA 3PXAA 4UVIA 1GYPA 3K1ZA 3CT4A 4Q1EA 3TCNA 1IK4A 5C4MA 4ETNA 3CTMA 3JQ8A 4H7KA 1U8YA 1UDWA 2NACA 1CZNA 3NV7A 3FUWA 2ZI4A 2RH5A 1AGNA 1H2BA 4YUXA 5A5EA 3DTTA 2AUMA 2QT0A 3QIVA 2WWHA 4FFSA 4N5DA 4S1PA 1GNVA 4Z8YA 5DTQA 2HV9A 3FMGA 4AJ4A 1QTQA 3K0BA 1S8AA 2GYUA 4NNPA 4GZ5A 2XNCA 1SG9A 2QTVA 4UDYX 1BNCA 4Q4JB 1U7ZA 3DV0A 4R7GA 1C81A 1W93A 1KL7A 3UM9A 3L1UA 1JQEA 2FW6A 621PA 4X65B 1XPOA 2B0JA 5EXSA 4BZZA 2GCGA 1F9EA 2ZB4A 3VDRA 1XQXA 3AVXA 3R5XA 3IJRA 1JMKC 2G88A 1JMYA 4E6EA 3JVVA 5FNVB 3AR8A 1M1NA 2VCYA 10MHA 1KFKB 1YIDA 4Q00A 4EB6B 5B6JA 1BGXT 4NS4A 4DQ0A 1I9GA 1KYZA 1I1HA 3K96A 4WK0B 5EHIA 3L43A 3WRXA 2LD4A 1EDEA 3A1CA 3CPSA 2XSZA 2Y76A 2Z8YM 4NE9A 2QTWB 4TMKA 1HYGA 1O6GA 4A2PA 4TKZA 4PLTA 4JMPA 3D54D 3FMIA 1YULA 7ADHA 1U3VA 4HYYA 4YH1A 1MVNA 1NF2A 2OV4A 3PD0A 4WAUA 3QPCA 3WGYA 2EL9A 2K5UA 2QB5A 1PEYA 1YZUA 4KO4S 1DIBA 5KNBD 3VR3A 2QTLA 3O94A 4UM5A 1YR8A 2P35A 2IYQA 4M0CA 4UAGA 3W6ZA 1AKEA 3ND8A 2C3YA 4BRSA 4IDOA 2X23A 4WLNA 4R01A 3UATA 2QQEA 4XVHA 1E7WA 4PQGA 2HH9A 1HLGA 1WNFA 1L7DA 5K0SA 3WGHA 1YCFA 1L1EA 2JS7A 4Y9TA 2BYTA 2ZIGA 1G8GA 1XCBA 4KWEA 3D4PA 4FEYA 1OBVA 1R0KA 1N7GA 2H2IA 3NBFA 2DUNA 3P9PA 4M9XA 4WY8A 2OVFA 1PV2A 1W85A 5AM4A 3TM5A 2BGLA 4P58A 5EWLB 3K1TA 5HCNA 1NMZA 4ND5A 3T95A 5HKLA 1U0FA 3GN1A 5DMXA 5F2NA 2OY0A 3GPIA 2OM6A 3JAKA 2GM4A 2BW0A 1EG7A 2A1IA 2WINI 2OHFA 3H86A 1J99A 1E99A 3NHPA 4NX2A 5JSYA 1DWPA 2IYNA 1G98A 1VB3A 5K3SA 4GPIB 1CS4C 1LDBA 4K9NA 1VLVA 4OQZA 1H9BA 4WN3A 4C7OB 1REQA 1W6RA 2R84A 2DSTA 2WUGA 1CR4A 3TNYA 3ZV5A 3NT2A 1ST3A 3K5WA 3ZZ0A 2X41A 1UF9A 4QWWA 2V54A 5BR7A 3R2JA 1X7DA 2C1XA 2UAGA 2Q49A 1GTL1 3IP1A 1F14A 2JD0A 4DAEA 3CEHA 4IH4A 4DZTA 4YAKA 5H82A 3CBGA 1T5TA 4ZTZB 5EWJA 4BP3A 1POXA 2PKXA 5AVYA 3ZK7A 4ZV9A 4NFSA 1BW9A 3ROFA 5FXMA 2Q6KA 1WBBA 2HU8A 1R3DA 2FF7A 5SZHB 1LWOA 1OI2A 3Q6IA 4A0HA 1T26A 1SQSA 4U2EA 3R8FA 4UREA 3Q1KA 3ZDCA 3A6EA 4TYWA 3FFTA 3L6OO 1F1BA 1NQWA 2Z56A 3LYUA 2XHEA 4QBTA 4M8NE 1UPCA 4QEDA 1T2VA 4GMGA 4I36A 4XR4A 3IOEA 3LGSA 4DUGA 1PSZA 4FDLA 1Y9AA 3NHMA 4XPZA 1AS3A 1QF9A 4MVJA 1E1DA 1WVIA 1SVWA 3GU3A 4JYCA 5IP5A 3AZOA 3VR4A 3WDSA 4BO1A 3ML1A 2QZ4A 1EM8A 4O2BA 4ZZ2A 4BC0A 2GZ1A 3O82A 3TKYA 3ZLVA 5JSUA 1EHCA 1AKWA 1COZA 4PO1A 2QRNA 4QUGA 3ZY2A 5EN4A 4F45A 1BXGA 4YMWA 5KQRA 3R41A 1NJ8A 2P91A 2WTAA 2XWJI 3SKVA 2Y4NA 2XWQA 2Y71A 1TM3E 1E6LA 3PEYA 5CYFA 1HE5A 4OHZA 2L82A 2QRLA 2IS4A 3HKDB 5TMPA 3EAQA 5AVKA 4CG0A 2JPDA 1UQTA 1Z63A 1YB5A 1VPWA 3ER6A 3HDQA 4BZWA 3EULA 4EABA 1BMFD 1KYIA 2XITA 3HEMA 4L08A 4NBKA 2F90A 2NG1A 1I6LA 1XTTA 2OFWA 1XEFA 3CWZA 3G85A 3O1LA 2WIJA 1C2YA 3I09A 3KVYA 4JNKA 1QYCA 1FSSA 2RGNA 2CVHA 2WQZA 4E5DA 1ICIA 4WT7A 1XBTA 3KJNA 5JAOA 2I9KA 3GGOA 1NBMD 2HDHA 4TN1A 4JZKA 1ZO8A 4O4HB 3PLAE 4R68A 1XVTA 5DNEA 1GITA 2QNBA 2BEKA 1IM5A 1XQWA 4D9HA 2H4YA 1QIMA 5H80A 5L7WA 3KETA 3A9VA 3QLVC 1MG0A 2PNFA 1O9GA 3I2YX 4KI0A 4K9OA 4QOHA 5IM4F 1QQ5A 1R64A 2HJVA 5CH3A 1Q95A 3H11B 4XD7D 1P72A 4X71A 2VPZA 4OP3A 4HD8A 4WJZA 4YN3A 3RD5A 1XRRA 4KO8A 2E1RA 1JZTA 1BXKA 1Q3HA 2GTPA 2Y93A 3F5FA 3SBXA 3KDAA 2GASA 3WP0A 3C3MA 4C6HA 4Q9KA 1JEJA 1JI3A 2REXB 2W6JD 4AY3A 2QMEA 1HSOA 2V7EA 4PX3A 4G0UA 3PKJA 1MENA 3DAYA 2MCFA 4KXQA 2HF8A 4L5AA 3R5JA 1B42A 4OU5A 1Q20A 3P2YA 2W2KA 4C30A 4HB4A 5THKA 3RC8A 3O4RA 2R5FA 3H1TA 1SZPA 1DXOA 3HWX1 3WHKA 4H4EA 3QJGA 4N39A 3H1BA 4LJSA 1T1EA 1C1XB 1H6CA 3I01M 1X94A 3O4VA 5FLKA 2JHPA 3T0GA 3S27A 1GNTA 2P2GA 1ENPA 2CLHB 2BI7A 2JAXA 3C24A 2WLTA 1R6DA 4HYQA 1II0A 1SM4A 5CTJA 3R7DA 2LZ0A 3KJZA 4QUKA 4BVKA 3DWGA 1TADA 3SI7A 4QQ8A 5ARCA 2KB0A 4OI4A 3QP9A 5DV9A 4ZWNA 3O1HB 3NP9A 3VZDA 5DCYA 1TC1A 1DQPA 2X3UA 5E1DA 3SIRA 3WNDA 2Y1LA 5LNK1 3ODGA 2C4MA 1X7XA 1P2VA 2AVDA 5CA0F 5KU1A 3W9SA 2ZDGA 3GH3A 1UBMS 1NC3A 4PZDA 1D2EA 1UT8A 3TYXA 4LNUB 2EP5A 3CN9A 3I0ZA 3UH0A 2AR0A 3NNNA 1A5TA 1GGHA 1RD4A 5JTTA 4G07A 1JIQA 4EYKA 1XPUA 4DLBA 2O5CA 3AO0B 2Q2WA 1G0OA 1O54A 4UUPA 1Z0DA 4FFNA 3WZMA 2AI2A 1O95C 1QHEA 3OZBA 3ORYA 1MB3A 3U7QB 3ZHBA 3W7BA 3TF5A 1NV9A 1UH5A 1G9SA 3O4FA 1ORVA 3ANTA 4KV9A 4FFWA 3RT9A 4DLPA 3NYQA 4O29A 4WY5A 2WZBA 5K4GA 3BUSA 3T9BA 2PKRA 1S9DA 4EFKA 4PYKA 3LC0A 1JIIA 3PFFA 4M38A 1N7JA 2QQFA 3CLTC 4Q02A 2WM9B 4J49A 2Y1EA 2XCTB 4MUNA 1XDGA 4NZPA 2JA1A 5HKAA 4J29A 1GUZA 1XKQA 1TZBA 2W2TA 1RQGA 3GJRA 3QXSA 4M8SA 3HXQA 5EJ6A 1JYEA 4EKIA 3L6RA 3I0MA 1KGSA 1KSFX 4RMHA 4WSOA 4EL5A 4X1KA 4TYYA 3HADA 1HMPA 4JLPA 4MS1B 3IBGA 1LSOA 2LV8A 3HKCB 3O3NB 1YRWA 3PQEA 4WXHA 5G0VA 4R0VA 3VI3B 4OB8A 1J9GA 1ZICA 4JDPA 4BLUA 1NDUA 5BWMA 4HMQA 2XUOA 1NZDA 3JQAD 4F2PA 1BXZA 4JLVA 1I7LA 5DRTA 3MOIA 2JASA 3BFXA 1PNQA 3Q7QA 2PSEA 3ONNA 4K6OA 2WLSA 1Z5UA 1U8CB 3L46A 4I1VA 1K4MA 3L05A 3ZIAA 2EEZA 2GZHA 1CPYA 2J08A 3EVBA 3PYXA 5LQKA 4AQYB 3O1JC 3IVXA 3NTQA 1YHZA 4R9SA 4NOLA 5HRAA 2OXTA 4E13A 3VPDA 1I2ZA 3O8BA 4OA8A 2LKDA 2D0DA 4BWGA 2HR1A 1T15A 3FYSA 4DV1B 2JGLA 2A0KA 3QI7A 1C1DB 1H4TA 4X5OA 1QANA 3JS5A 3SR0A 4BMCA 3MG9A 1FFHA 3FZEA 1GADO 4R2XA 3D4OA 3A58B 2H57A 1TCVA 1VXOA 1Z8HA 1RQXA 3LO5A 4P53A 1G2QA 1Z5WA 2QORA 2BP7A 5HBGA 2YCLA 4JI3B 3AEKB 4OIFA 2WYWA 1WXXA 4MEBA 1Q0LA 3B6KA 3IURA 3KCQA 1J00A 5DGDA 4PGHA 1L1QA 3KC2A 3QF7A 2XA2A 3W9YA 4L28A 3UJBA 4HCJA 3ZHSA 2C4KA 3DDSA 2Q21A 4RXUA 4XIFA 1MH1A 3EGDA 1IWBB 2DCMA 2XYVA 4RVSA 2C7RA 3HGQA 4IMPA 1YMQA 3W04A 5K5EA 2NYVA 4Z4EA 1K8QA 3IPYA 3IO5A 1L6RA 1PFYA 1UJCA 2FG7C 2RGUA 1VRVA 2ZRJA 2QLLA 3QKSB 3L8MA 4UEKA 1R4NA 1FK8A 3QPVA 1SIUA 3R9IA 3KYJB 4FYHA 5AW4A 2DHEA 3A8TA 5T8KA 2DFNA 1XOIA 2X86A 3T3HA 1PLKA 1SKAA 2I1LA 4PRYA 5EIBC 2A1UB 2A9OA 4E33A 3K31A 2IV2X 1EQAA 4BNIA 4OL9A 3X44A 3NHKA 1NVTA 1TAHA 2M1ZA 3EG9A 3PA8A 4FONA 4QELA 1ACJA 1CJSA 1RM4A 2YJ3A 3PE4A 1ZU4A 5GJVC 5IK2D 1X13A 1NU8A 1IHPA 3D1VA 3DHNA 4MWZA 2AMVA 4RMNA 5G1PA 5F2KA 5D2CA 2VTDA 1AKTA 2M6LA 1P2UA 2CE7A 5I48A 4MWGA 2DWOA 4WCFC 2VRWA 2PGAA 4JP2A 1MPXA 1X70A 2YHBA 3EY9A 4P3PA 5IM4A 3IB3A 2CFSA 4YCNA 1B6RA 4X8MA 1DDIA 1PQYA 4YJ2F 3DDUA 4BTEA 3VVCA 3H9JA 1A27A 4O5OA 2WNHA 1VSQA 1H42A 1XTRA 2H1LA 3BL5A 3LX5A 4IDEA 3T9FA 4M1WA 4EW6A 3WS7A 2RGWA 4WV3A 2V6JA 5FOQA 5K6AA 4IHAA 3C3AA 1N7HA 5JDCC 4OK3A 4K03A 1FS5A 1I8TA 2BEJA 3TTYA 3ZBPA 2IH5A 5AFSA 4U2FA 2C84A 3GFQA 4UQPA 1NF3A 4YAIA 1QV6A 1EWKA 4B3BA 1YXMA 4JJAA 4GQBA 3FOAA 3BHMA 2Z4SA 4F92B 1YB4A 2W6IA 5BV7A 3DOUA 4HQ6A 3B5IA 4HRXA 2O0LA 2O48X 5CT8A 5E7IA 5BOVA 3SS8A 4GOMD 1ZY2A 1W5BA 4V38A 2I2DA 5K3AA 4EBBA 1XVAA 5D3KA 1GG5A 4ZGGA 4CMEC 4GKVA 2IXGA 2SCUA 3FJOA 3QXHA 4KKVA 3AF0A 4RTJA 3QFHA 5H83A 2O8DA 3CPEA 1NVVR 2QUBA 3KJXA 4OHUA 2RAPA 1HA3A 2XCQA 4XAQA 5F1PA 3ABZA 3DE3X 5LLTA 3IKMB 1A3CA 3EXFA 2GRJA 5FLYA 2QNIA 3CFYA 4M9RA 2AFRA 5BWCA 2VDRB 3KXIA 3BWXA 4CTMA 1H94A 1TQ4A 2RGXA 2WWVD 1HG0A 3F8WA 4UC0A 4AIIA 2I2FA 4A1FA 1J8QA 3WFIA 2BZGA 1NFFA 3QLUA 3IVMA 3OKPA 1FX0B 3UWKA 2I33A 3AUAA 1J2YA 3L8DA 5CIWA 1PR6A 1SCIA 3N7TA 1VBMA 3G2HA 3TRKA 3C6KA 1WDTA 1NVKA 4BO7A 4BP1A 1V3TA 2IEZA 2C1ZA 1JKFA 3CR7A 1N2GA 3N76A 3U0VA 3DFIA 4L5JA 1CY0A 2BGIA 1Y6QA 3C8MA 2JJ2D 4WESB 4MDHA 3PFCA 4K26A 1W2WB 5EGNA 2R60A 1F60A 1FE8A 2OQIA 4I55A 3OQJA 4OK6A 5EKUA 1YUMA 1V6SA 1O08A 4I5EA 3P96A 4MVCA 3OT1B 3TW4A 1VJDA 3NFYA 5IF3A 1SBHA 3PTAA 4U6QA 4NOKA 4NDZA 3UMYA 4XYGA 2K7ZA 5JPDA 2AH5A 4Q7KA 5EZYB 5KX5B 5AJUA 4TTQA 4MDEA 4A91A 2AFHE 3JSXA 2V3VA 4UXJA 1XG5A 3GGCA 1QH9A 4CBVA 2OCPA 4P7BA 4Y30A 3RBXA 3ZVKA 1F0YA 2ZJOA 1XTUA 5DM60 4W8HA 1A95A 1T1RA 1TO1E 2PGJA 1YR7A 1WXGA 3TTVA 3IKJA 1FXWA 4TXJA 2D0IA 4Q21A 1C3JA 3VR0A 2BFAA 3I76A 5CDUA 2GJ8A 1A2OA 4ZCSA 3ANSA 4FS3A 4HWPA 4JENA 2HNBA 4GX0A 4OCZA 4XQ0A 3MC1A 3UA3A 2QRZA 1Q0ZA 2ACVA 2JHAA 3AR7A 4JC5A 4LTMA 4YRSA 1T4GA 2X2OA 1DQZA 3ETDA 4TKVA 1TEXA 4K9DA 1IQ0A 1TU4A 4AF7A 4MKXA 1J0DA 2BFNA 2OO5A 1LEHA 2XKBA 5HJ7A 1F5NA 1RQ7A 4FYWA 3WLRA 1QKIA 4LGCA 3FPFA 3WLIA 4JI6B 2DEUA 4C29A 5KQMA 1S2LA 4YRBA 4N9QA 1JB9A 1N1EA 1NDHA 1XZBA 2F17A 2QRVB 1DWUA 4ALKA 5A6SA 2FMTA 2JFGA 4MHTA 5KQSA 2E1PA 2DU8A 1EA5A 2AUTA 2PK3A 1T9HA 1FYWA 2QN9A 4WCFB 3KT3A 2XTZA 4HADA 4E4TA 4PCAA 2Q6TA 3E9NA 5GVRA 2BCEA 2R6CA 3I9FA 1M76A 3RQSA 3RS0A 4AUNA 2QJTA 4R54A 1Q92A 4PSVA 1YBHA 1HNWB 1C4KA 4TMTA 4YASA 3RW9A 2X7HA 1MQSA 5I5GA 1UJ4A 4M88A 3COZA 4PZCA 4V0NA 5GINE 4TMFA 4GBMA 4W5NA 1RAIA 1A9OA 2GF2A 2HZBA 1UJ6A 3MTIA 1P5ZB 1VC2A 3KQYA 1JHOA 3T5PA 1SQGA 1WS6A 2ADFA 2C2YA 1UQRA 2GAAA 5CPFA 5TF4A 3TDNA 4D74A 3U5TA 1OXBB 5HFAA 1ZC3A 1JDVA 1OFVA 3ITNA 1SHZA 2ZSIA 1GAJA 3B6JA 2OV3A 3GCWA 1FTNA 4EI9A 1YI1A 3F2VA 3PGVA 1QVRA 3TAHA 5HNKA 4XPIA 2IZZA 2CT8A 2QPAA 4NBSA 1O97D 2CMHA 3LF2A 4MAAA 3T12A 3VDMA 2FVXA 1RJ9B 3OZDA 1XWFA 1CZUA 1CUGA 3BMOA 5H68A 5TQJA 4W5OA 1XJCA 1H22A 2XQIA 1ML3A 1LS1A 2ANBA 5GQSA 3CF4A 4PHFA 4RVFA 5A5VA 4JI7B 3F74A 3SMVA 2ZIEA 5B12A 4WLFA 3JATA 4X1IA 1IUOA 4C20A 5K0NA 3FGPA 1K92A 3TVTA 4DT1B 2HMWA 5JNSA 2DPHA 3MWGA 3IIIA 3HUDA 2QX4A 3O8RA 3EWNA 1D1QA 4CIVA 4NWIA 3C3CA 4PG4A 3CNEA 4OHYA 1MAHA 1KZGB 1G17A 2FB9A 3AKZA 4CODB 1RYDA 4P2BA 3A6LA 4HGYA 4MCHA 3OZWA 1PCXA 4HDQB 4ZVNA 3CJTA 1W5SA 2QSJA 1OV6A 3UH1A 3H4VA 2X76A 4EY3A 2P11A 2GHQA 4LSZA 2C59A 2C03A 1CR0A 4HPXB 3JXEA 2IZ0A 2FR8A 2ZFUA 1M1YE 3WGOA 3RYHB 3BG5A 5K8VA 3T7DA 4A8TA 1YL6A 1Z0FA 2B5WA 4E70A 1KIFA 4PC7A 3JQ6A 3VKHA 5AUQA 1CG6A 2NTJA 3UJ7A 1PJSA 3EA0A 2P2YA 4D9FA 3GOHA 1EWRA 3C2QA 3W8NA 3NQ41 1AC5A 1XI2A 4NTZA 3JWJA 1Q5PA 1J5EB 2Q5EA 4J0HA 5K3OA 2V5AA 5DLEA 3A4YA 1DLIA 3W1WA 1YAJA 5F3DA 2X0KA 3ID6C 1RYYA 5JCJA 1OSNA 4G65A 5A1JA 2C20A 1RYBA 3NB0A 4XRGA 2H5LA 1FDSA 2QL9A 1YOBA 1EFPA 4GXNA 2YHAA 2WPDD 4PWZA 1EVJA 4U5XA 1F0NA 3G3EA 1GNLA 4L9SA 1LUAA 1L8QA 2A5LA 1P1CA 1MP0A 4OX9B 3OO1A 4ZARA 4LRSB 3KQPA 3WDLA 3EX7C 1BKYA 1B93A 3QVJA 4M0EA 1T0PA 3CURA 3E81A 4O4IA 1YZHA 2ZRPA 1GD1O 4OMDA 4D5EA 1VCIA 3OCYA 5ARDA 2ZJYA 2KHZA 4B3HA 3BIJA 3S4YA 2VIIA 3K32A 4UZFA 2D8MA 4J3JA 4XRRA 1VECA 4KIFA 2ADOA 3Q3IA 2AFVA 1E2FA 1TLTA 1XD9A 3BGOS 3OIDA 3EFHA 4JBLA 4JU9A 1GL3A 3VHLB 1ZJWA 3A9RA 4BX0A 4QTZA 3OIFA 3DT9A 3LP8A 4MGIR 4MICA 4ZREA 5B6IA 4AS1A 2WF6A 1SFRA 3QVKA 2I67A 1EI9A 3FYCA 4BASA 1ZIPA 2JFBA 1PFUA 2P0YA 3OECA 1VHJA 3G8AA 4R9RA 4KSCA 5IAJA 4BO6A 4NV1A 1TYZA 1R9JA 4XOUA 3FKJA 1HURA 1Y4DE 4QOIA 5CCDA 2Z98A 3OPYA 1MHPA 3ZWMA 3EIWA 3KBBA 3W90A 3RS5A 4BBZA 3NDJA 4ZHQB 4EO7A 4TQ9A 4YIHA 5BW4A 5IKPA 3LT0A 3U81A 1JQJC 2VHQA 1HLFA 1Y3CE 3GW8A 1Q0TA 3O47A 2REOA 1HBJA 1PQPA 1R6BX 2O2YA 4YP0A 3TTSA 1IOLA 1D7OA 2P3QA 2TRSB 1H66A 3L82B 3E03A 1B6GA 3WO1A 3TUJC 5FUMA 1SGWA 4ETMA 1XNJA 2BEVA 2OD2A 4Q1FA 3SIPA 3VZPA 3SYKA 1G63A 1NNEA 1ZR2A 2OO3A 3LE8A 3UNXA 1OV4A 4CW7A 4PSDA 3HSKA 1PT5A 2BFEB 4QQKA 1CP3A 4WFIA 2OC9A 5JYBA 1VJGA 2FN4A 3SP1A 3OO0A 3ZXUB 2FSPA 4PYOA 1JG6A 2YVKA 3EN0A 4LRWA 5LZ4A 3LTEA 3BWDD 1AKVA 3FUXA 3KZXA 1T6BY 1FFWA 1SBYA 2XIQA 2QPTA 4GX5A 5F3WB 1RLUA 2BKLA 3D4IA 3CCCA 1Y7PA 1KSGA 2AZMA 4ZYVA 4QBIA 2I1WA 3ENZA 4LJLA 3PHLA 2JGDA 4QTUB 3B13B 2J3HA 3EYWA 3JZIA 3DE6X 3O8NA 5FORA 1EGHA 2WC1A 1YMVA 4K1LA 2WU3A 1TCUA 1CUUA 2JIBA 2JCGA 4F8YA 3DDWA 1B0AA 2HCJB 4R8VA 3RNOA 1IJKA 2VHZA 3IT1A 4DCTA 5BXQC 3HXKA 4K9QA 3KEOA 3X1ZA 1R16A 5E6SB 3SVLA 1PDWA 3QF4B 1W73A 3C48A 4J3NA 3W5IA 2E82A 1R6UA 5FNZA 2ZRIA 1QC5B 1PR9A 2VJMB 5GM1A 1X74A 2ZT8A 3AQ4A 4ZVQA 5JO0A 3GLIE 1SHKA 4DN6A 4F8JA 5K8JB 1MQAA 2PUTA 2PXHA 1XCPA 4JCOA 2O2DA 1GL7A 1G19A 1H8HD 2B3DA 2IYRA 4BLPA 1TAQA 5IFLA 4ZQEA 2BOVA 3CX8A 1JG4A 4Q4JA 1ZD5A 3BFKA 1WXHA 5FWDA 4B31A 2J7KA 2GTIA 3BQ9A 2X7XA 4TUYA 4C4ZA 1DKLA 2IP1A 3CKMA 4ZT7A 1I3MA 4BVBA 5DI3B 4NFLA 2QDKA 2QM0A 4CFZA 3UUFA 2AKEA 1BDMA 4FHFA 1DG1G 2WT8A 4XGQA 2BFFB 2FX2A 2C1EA 4BQEA 3FG9A 5K9ZA 2YQ5A 2A35A 3PC4A 3NH6A 4R51A 1H5QA 4TS1A 4F2GA 3LQ4A 2F3PA 5FNVA 3RK4A 3D7KA 4BEBA 4M1SA 4NMMA 4E5KA 4EB6A 2HK6A 1UDAA 1U5CA 4Y2PA 4CQJA 1EFKA 3V8BA 2FKNA 3DKRA 3FPBA 3ZHZA 421PA 4D9GA 4F4DA 2PUGA 2VNAA 4KAJA 4QYSA 2V4ZA 3Q72A 4JL8A 1VE9A 5B58T 2BCGY 3HDHA 3PYLA 5L4NA 4Z49A 5KKNB 2QOEA 1JW9B 2X8AA 3DFMA 2HU7A 3FZGA 2XQKA 3SQNA 3CE9A 3QKUA 4IV5A 1MLDA 2QUHA 5CNJA 4ID3A 2IBTA 2AC7A 1QX3A 1VPLA 1VZ2A 1Z6AA 3GQBB 4BNWA 4BUZA 1H0KA 4CDMA 1SKYB 3CX4A 4TQUS 1GQ2A 1W29A 3EMDA 4I66A 1QHXA 1DL5A 2GMWA 4TL8A 2XT9A 2QX9A 4KMRA 3DOJA 3BE6A 3LFUA 4W6QA 3RHSA 3JVUA 2ZTSA 2OGUA 1JFTA 2E4VA 1A9XB 2O2IA 1SHJA 3LLVA 2BDEA 3DBHB 5E7JA 1Z3IX 3JR3A 4RTNA 2YDYA 4YMGA 1I7QB 3NM5A 4IXWA 1ZINA 4XYBA 1MO4A 1M10A 2MR6A 2W90A 3PBKA 4C5CA 4DJFC 2D59A 4DDHA 2MYNA 2UZ0A 3LUHA 4Y9UA 1QFYA 3KE8A 5CB4B 1ULAA 4JVLA 4Q1DA 2BGWA 1IQRA 3ST7A 1PEDA 4GKKB 4Z0NA 1EFRA 5EWLA 3WQRA 4EVQA 3CB2A 8ATCA 4I2NA 3HL0A 5LDGA 4BCDA 1I0ZA 5DYTA 2EBWA 2JIQA 2VPPA 4WRRA 4F11A 1SZDA 4IDQA 4HLNA 4V0SA 4XUCA 2ECFA 4FB4A 5IULC 2IUFA 2R7KA 3B9RA 4JP1A 1THGA 1DNPA 4XD2A 3B1JA 2IXEA 3CQ9A 1XXHE 3G1TA 4LGVA 2ZSKA 4QDTA 3FXAA 3RYTC 2FZEA 1D1PA 2JFOA 2NOAA 3NDBB 1UBHS 4GX1A 3WNBA 5JH7B 3V7UA 4E11A 2ZIXB 4XX0B 1MUUA 1W4RA 2HMUA 2XCLA 2H7XA 5GTDA 3T99A 3C6XA 1JIKA 5EP2A 2XHZA 2H4ZA 2WSSA 2Q3FA 3KKOA 2Z6QA 3AVUA 2IOQA 3I28A 3WIDA 4KFRA 3PHCA 1QVVA 3ZJTA 2BSXA 2YMPA 2CFOA 4OG2A 2B4YA 5G53C 4B3IA 1K86A 4YGXB 2BBOA 4EKEA 4PC3A 4Q3AA 3V7NA 3AK4A 4OFBA 2R1TB 1K6EA 1U3FA 1YT5A 4KWTA 3GD5A 1Y6FA 4B3RB 4AZVA 2MYUA 4FN5A 4QJ4A 1Z35A 2PWYA 3DZIA 2COKA 1KPIA 2HGZA 2O7NA 3KVNA 4OAPA 1KF0A 3UOAB 1VPEA 4YTEA 2FRDA 5H7XA 2I1VB 2QEQA 2VG8A 3LC1O 3RC3A 3VOSA 5LQCA 4H4CA 1U1IA 1IOVA 1NW5A 3KPJA 1QCYA 3IVGA 5H9VA 1G6HA 4QM6A 3S7TA 2DECA 4YRLA 1P7WA 5AW3A 4Q0MA 2XKKA 1H0HA 3ITDA 4CQMD 3PFWO 4RO0A 1DAFA 1E18A 1PHPA 3VR4H 4BMOB 2KWIA 4B6PA 3ILVA 6CHYA 4C14A 3R1IA 4PG8A 4R8LA 2ZR9A 3KOXA 1JWAB 3VJRA 3IC5A 2C4WA 2J1LA 4C9BA 2RHHA 1FOEB 4KCGA 2GPAA 4TT3D 5AKYA 3CZ4A 3I9V1 3BJEA 3SM9A 3KR2A 3JQAB 3HKDA 4KACA 3ZXSA 3RBAA 5DN9A 2C7VA 4BKPA 1J09A 2GJKA 4C06A 4R8MA 3OVMA 4X3PA 5H0IA 2ZZNA 2QAIA 1YGYA 5TV2A 4ESHA 5HZHA 2DC1A 3ZYCA 4HRVA 1QNLA 2YWCA 1SPBS 5TPZA 1E2HA 3IPLA 5C8YA 1SUFA 2J3DA 2RBKA 1FNCA 2ZTUA 3HBMA 4JWKA 2VAXA 4K81B 2WIBA 5KJ6A 1NN3A 1Z4PX 2YR0A 4OEHA 1PL0A 5AM2A 5BR8B 1TTTA 2ZI5A 2WW8A 3PHIA 4I1YA 3MTEA 3VYTB 1RQLA 3VPXA 4O4HA 4D25A 4MWEA 3I4CA 2ERCA 1VRWA 3UPTA 2FSSA 3C7CB 3SJBA 1U2TA 5DX8A 4ZHSA 2V3CC 1VLQA 2ZE6A 4OFZA 4ZDWA 4J91A 3U1TA 3VMMA 4ED9A 4D8WA 3ORFA 2GM5A 2W4QA 1MORA 3BE5A 4PV7A 5FL7D 4N12A 2HJ9A 1DZ3A 1UBJS 4X54A 4XWWA 3D7RA 5F9FA 1EE9A 2PS9A 1PZXA 2ZVDA 4XARA 2FZ5A 3E18A 3PV0A 1AH2A 1T13A 4R5MA 2X2FA 1D2RA 1J2JA 1O96B 1TM4E 2PFGA 2PIDA 3DMGA 3OPXA 3QYFA 4CM4B 1ZISA 3T7CA 2JA2A 4F1JA 4D9EA 3CZ5A 2E4AA 3K5PA 4JSYA 4D9JA 1QE0A 4CG3A 5TEVA 4PQEA 5F23A 2I55A 1YZVA 4P4TA 4BQIA 4GQIA 1SC6A 1GQSA 1UPUA 1YONA 3QE3A 2YJGA 1H4SA 4UBMA 5JNVA 3GAFA 3CVYA 1ZVVA 1TUGA 1C1XA 2Y6VA 3PUYA 2DWUA 2HT1A 5ED0A 4CTNA 5CDFA 2QN7A 1YCDA 1BYIA 1DMRA 3TR5A 1TM5E 2E18A 3VC1A 1MBZA 3T15A 5LR6A 4AMGA 4S1VA 3X3HA 4FFPA 3SYRA 3INRA 4LMBA 1S89A 4ZO7A 1Y5LA 1LVHA 1QIJA 5I9TA 2JCSA 2DHQA 4O0MA 4D2IA 2XMRA 3GRZA 4I1SA 2J6BA 2WYVA 3U4MA 3N1UA 2V7QA 3A04A 3C74A 3D8RA 4G0YA 1H8EA 1OXSC 2R6AA 4LNUA 4WKPA 4DPKA 5I7EA 3L4BC 3LSYA 3HY4A 1YR1A 5IJ9B 4CQLA 3ZWBA 3JALA 3AUUA 3FTDA 3KT0A 3LPNA 3V2HA 3BE8A 5CJ2A 4KUEA 2EZ4A 2C3OA 2OSVA 2XKAA 4I1IA 1Z5OA 3P0HA 1EM6A 1QYXA 1XSEA 4A16A 2FV8A 2XCOA 4WERA 1L3BA 4DGSA 1DKNA 4YRGA 2M6KA 3URKA 1LNSA 5AW7A 3DD5A 3ADBA 4EMTA 4ND6A 1E2GA 1N2CE 1AQUA 4E7PA 2SICE 4N5IX 1BHO1 1CQJB 1J4AA 4W9NC 4L7QA 1TM2A 3NYIA 3PTZA 1TUIA 3OTGA 3DO6A 3FUCA 5T64A 1T43A 2P67A 2JLAA 3KYBA 5TT1A 1D4ZA 3GMDA 4E07A 1OI4A 1RW4A 1ZD9A 3UKJA 3OAAD 3VPBA 2XRFA 2GD0A 2R7MA 1CW2B 3HKCA 4G8CA 2Q1UA 2DFPA 3WICA 1O97C 1OAAA 1XN1A 3WSVA 3OJFA 4GDMA 3UW1A 5EZYF 1G64A 3G17A 3KT6A 3B8HA 5KX5F 1LVUA 4F2DA 3GPCA 5GJBA 1WEHA 3HCCA 5JAUA 1ABEA 1QRSA 2ZCJA 3ACBA 3KKQA 3GAAA 1D8AA 3OF5A 4QPCA 4ER3A 1XA0A 2E55A 3PNQA 3C97A 2R6HA 2FH5B 1HDCA 2P2SA 1AKMA 5KTSA 1XZIA 3BIXA 2PD3A 3AUFA 5CUQA 5K2OA 1SXPA 3GFTA 1RQPA 2NUAB 4YDSA 2B1JA 1RVV1 4N7JA 3P19A 2GSWA 2CL7X 4FOOA 4V03A 3VH3A 3MF4A 1C1DA 1U3GA 2RGCA 1CNMA 1UZAA 3TX6A 4K87A 5LKAA 3BJMA 1Y9ZA 1OFTA 3KLOA 4QFMA 4AZ3A 3COJA 2COEA 3ORQA 1P62B 2CV2A 3Q7PA 2NU8A 4UVDA 2IX9A 5CPBA 3AZPA 3AEKA 4LWQA 4WKCA 2KX7A 1W87A 4ZZ1A 2I6GA 1P45A 1C2TA 2JJ1A 3ILXA 3NALA 3TPZA 2SHKA 1Z8NA 2B2XA 2CDAA 3LLMA 4K9MA 2DHDA 1CUZA 4P5PA 3ZE1B 2C57A 3AUXA 5HUHA 3FKSA 5I7OA 5EIOA 2JBAB 1WOYA 3LDGA 4ME6A 4KR6A 3TKLA 2G1KA 1ESNA 2IBMA 3HH8A 3V1NA 4WNIA 1E7RA 4FINA 4R9VA 1QZXA 3J81k 5F7OA 3F8SA 3NP7A 3ZHXA 4LJ7A 3FSRA 3QKSA 3MB5A 1KVSA 1EB8A 4QIHA 2YOFA 3WLHA 3BYZA 1T9BA 2PTHA 4R05A 2Z43A 2XMPA 2QN8A 3F9RA 4ZN6A 4NZNA 5IH3A 4YRIA 1YZFA 2X0DA 4LYFA 3U31A 3J7AC 2BUCA 1JTVA 4C1NA 3KR9A 2AC2A 4ZCTA 4WECA 1I1OA 1WE2A 2V45A 2QG4A 4B71A 5I4CA 2H54A 4PBRA 1NATA 2B36A 2HRRA 2PT9A 2ZG6A 3H3JA 2A88A 5A4FS 1CUSA 3B1WA 1Q7CA 1NHWA 2G5PA 1II8B 2HMYB 2IIBA 4ODIA 5DHUA 4O4LF 3KXKA 5CJJA 3HCRA 2RHTA 1UANA 1GG9A 2CVZA 4CM5A 3OE5A 4JV5B 3BJZA 1Z26A 4B2LA 2GNAA 1CQPA 1YL7A 3RBVA 3NEAA 2QXYA 4N47A 5C1BA 2Z4TA 1TYBE 1XZ8A 3U9SA 1KO7A 2GLTA 3GGPA 3ZEIA 3ZDDA 1KJZA 4B80A 4Q4LA 1JE0A 5BUQA 4F5DA 1GGKA 4C5BA 3AY7A 4DYVA 3H0EA 3W2TA 1K6IA 1NTOA 3ISJA 4EA7A 1CUIA 4C0LA 4XEHA 1AQLA 3MSXA 1FQJA 2YXLA 1E96A 4JJ4A 1TGVA 4XJVA 5B1YA 4QC2A 3CYFA 1O95A 4MJ3A 3KWFA 1HORA 4E0BA 5EZQA 1XZKA 3BRWA 1WUIS 2YOHA 4OQEA 3WK7A 5D86A 3QJ5A 5G0SA 3Q9SA 4KP7A 3LT2A 2G71A 1ADYA 5F1KA 1ADFA 2Z3WA 5EG5A 3K2QA 4M7OA 3GLGB 1KQ3A 1VLJA 4J75A 4QHSA 4ZYLA 4JQCA 2C97A 3IBTA 2WNSA 2VK8A 3JWHA 2ZU0C 3SY8A 1Z4QA 3KQWA 2IHTA 4Q03A 3CRMA 4LJRA 4LE1A 3WL5A 4F1WA 2XA9A 5ELXA 4TSRA 4LC0A 3DZ8A 4LG1A 1LGYA 1MOZA 1QKJA 5DNAA 5H81A 4DLNA 2GZSA 1V11B 2NYRA 1SMKA 2JAUA 4PZAA 4IJUA 3AUTA 2AMYA 4DCPA 2FEKA 3ZNQA 3OMLA 1FJ2A 2HKIA 4E2FA 3PFIA 3TBFA 3JAMA 1DRWA 1PUXA 3H84A 1YC5A 1ISPA 4WY2A 4X44A 3ENWA 4WPGA 1FFGA 2IXTA 3UMVA 3FMVA 1FX0A 4A0RA 2O7RA 2PUVA 1J21A 5CLJA 1PUIA 1HNXB 4H77A 2XYGA 5KTOA 2ARKA 3L0YA 1CR6A 1FLDA 2EKDA 4E4RA 1F51E 3EF0A 3GFFA 5F78A 3ZE0B 2ZAGA 3SHFA 3OJEA 3AY0A 4JAVC 3OLZA 4B6JA 4C1BA 3FE2A 2Q3DA 2W8BB 1Q2UA 4R3WA 4RORA 5LJLA 4PO8A 4WESA 2FQXA 4HATA 4NCHA 5EP3A 4A5SA 4J2TA 5I8WA 1UJMA 3GDFA 3QW4B 5AVJA 3OT1A 4L50A 2NPFA 1M8KA 1ND6A 3LW7A 4OGFA 4QOGA 3K9CA 1VPTA 1OJ7A 3K09C 2XIJA 2C83A 1V47A 2FPGB 3L07A 3B1FA 5EZYA 1A9RA 4OU4A 5A0FA 1DI0A 4Y6RA 2MDTA 1ZVJA 3NPMA 4HS4A 1IXRC 5M7EA 4QECA 3OM1A 1Y5IA 3KUDA 1D2HA 3PPYA 3L7YA 4KLZA 3OWOA 4QARA 5KCMA 3LM8A 4ZHQF 1IUNA 2WTXA 4J90A 4XTRA 1VLZA 2A3NA 2G7MC 3CLSC 4OHFA 3VU3A 4CM7A 4CEJB 1EIWA 2BM8A 4G5RA 3RRJA 1G3IA 2CFIA 2IXDA 3D31A 1QRRA 3FETA 4EJ2A 2FG6C 4ITUA 2WT4A 3GA5A 2B4TO 2CKMA 5E1BA 4DV0B 3K9QO 4G01B 4D3XA 2QBYB 3AEUB 1N1DA 1NN1A 3U6BA 4CN9A 3PKIA 2WJWA 1RBQA 3OY2A 4XUEA 1UP4A 4RTMA 1QV9A 4YJ3B 1NI4B 3PPXA 1ZONA 1D07A 3W3AD 4BKRA 4YV2A 2PRJA 5CCBA 2CMDA 1JLKA 2ZCVA 1KYXA 4F2HA 4YQFA 5B4UA 2F00A 3L5OA 1GNRA 1GTG1 2Q2VA 1ZQ1A 2ZYIA 5FD8A 1IZZA 3RRNA 4DBLE 1CJCA 1PVVA 3ONFA 1XL1A 1UINA 3R0QA 4Q4DA 1OYYA 2J5KA 4ZVTA 4C6SA 3PNVA 2XTNA 5KQLA 3FNFA 3HJRA 4Y9SA 1GWNA 4TWRA 3P97A 4KMSA 3UWOA 2A5JA 4MRNA 2QRVA 4ND7A 3ESXA 1ZCJA 1CZLA 2WU0A 4FC7A 4Q4AB 1FRNA 4JVOA 5JZSA 5BT9A 1ZOIA 4FIZA 4WCFA 3RC1A 1S9HA 4NNJA 3U3DA 1G8FA 4EL0A 5AW5A 4CMAA 4II3A 4RDXA 1JVNA 1IBLB 2JI4A 3UHFA 4TXLA 5TGZA 3WKCA 2ZRNA 3SEQA 2O54A 2ZWIA 4TZ0A 2DWCA 2AIRA 4CKWB 2ZBFA 3LG2A 2ZBPA 3UMSA 2P4SA 2KSQA 3H6KA 3O8OB 3SXUA 4TTPA 4W1QA 1ZK3A 4X66B 4RABA 3GP3A 4AVYA 1QMPA 2DLNA 2VFAA 5SZKB 1KWKA 1TZ2A 5JDCA 5JJIA 1XF1A 2ZYUX 2ZYWX 3OX1A 3LFHA 1FYXA 3N6VA 4P1ZA 3D8TA 2VUSA 1FNDA 2HV8A 3ZD9A 2FR0A 2B82A 3Q2KA 4ZXPA 1WHSB 3BB1A 3TLMA 3DBOB 4AMZA 2GK6A 1RJ9A 3NASA 3D43A 5KDDA 3NXSA 3WAJA 4UULA 4CM6A 1U2RA 1JILA 1QTRA 5BW5A 3AWDA 2VHCA 3BGWA 3LWZA 4KUHA 4I6EA 3PZRA 4O6VA 1Z2PX 2HHCA 2Q1XA 4CMEA 4R1LA 3CZMA 1XYVA 4IJWA 1PIWA 3P20A 4HYEA 4DT1A 3D8NA 1HV8A 1YKGA 2GO1A 2Q3JA 4YRMA 5DN6A 1PW7A 2C5FA 3K8OE 2Q2OA 2JZOA 2X1LA 4OSPA 1HKHA 4ZO6A 3TL6A 4G0NA 1IZ9A 2YZGA 5HBRA 1JXQA 2B5VA 3K5HA 1ETUA 1VFPA 2B21A 3EEBA 3M5DA 4FJ0A 4IEFB 3WWEA 4AP5A 2P8SA 4JZYA 3GDGA 2ZETA 2R97A 4ZI7B 1K0UA 1NURA 3HRKA 3M3DA 5EIWA 5ALTA 3HKEB 4RZUA 2X1MA 5FOUA 1KDPA 2ZRHA 2YYYA 4M0DA 2R86A 5JJ5A 3B3AA 5CR9A 3RYHA 3V1MA 4ZZ0A 3DH0A 1WZIA 5F9MA 1GTRA 1N32B 4GMXA 5LUBA 5LSAA 3PI7A 3MMPA 3R0ZA 4P92A 3RARA 4TMYA 3OCUA 2IEAA 2YVUA 3INTA 3CG4A 2CF5A 1OLSB 5D3MB 1RXUA 1ESZA 1KZHA 5BNWA 4MB6A 2Q7OE 2VPXA 3D3KA 2JKZA 5DWDA 4IFIA 5UKDA 2WV9A 1JDSA 2OV1A 4RGVA 1PW5A 1QR6A 1N5RA 1NVUQ 2AUNA 4W1RA 5KOJB 2R11A 1L5WA 2MIIA 4R5HA 2QGFA 2OKGA 4N3BA 4KR2A 2IQ5A 1GZHB 2R68A 3ZU4A 5CB4F 5IMSA 5JXHA 3DWIA 4S1NA 1T1GA 5C18A 2XNKA 1X1SA 4RLHA 3MTQA 3R24A 3X43A 4F4HA 5JAZA 3C6BA 5GOZA 1BE8A 2YJNA 5AKGA 4D0LB 2UZAA 1KJ9A 4DCCA 2H59A 2PV0A 3IUYA 1XQ1A 1B41A 3WGTA 4DG5A 1S3FA 4XIIA 2ZJAA 3C87A 3KU4A 3E0XA 3OEYA 5CYGA 2QRMA 5GIOE 1AS2A 5AI5A 5F77A 4CM8B 1ZHOA 1DT5A 1T8SA 2JAWA 2N75A 2CEKA 3BIOA 3QZUA 1E63A 1DG9A 4Z4HA 1IG0A 5LD2C 4HX5A 3ZY4A 2WSBA 3D6TB 3FFWA 2N1BA 1RT9A 5JMPA 3EZ6A 2X8LA 3F9CA 4LX8A 4WADA 4XQ9A 1UPBA 2QLTA 4FYXA 3W2EA 4TQAA 4J6FA 2PH5A 2F9FA 2A59A 2PY6A 4O0LA 3O92A 5KDOA 3CVUA 3LKDA 5DULA 1UWLA 3WG9A 2JKVA 4LQ4A 2JH3A 1AV7A 3K2BA 5EEHA 1OBFO 1PJCA 4R8SA 5LPNA 1V5GA 5B3AA 4ZHQA 8MHTA 2B6HA 1ZRNA 3A27A 3LWNA 4D97A 4PTLA 3PVZA 5GONB 2PVCA 2G9UA 1DO8A 2VEDA 4RV5A 5HKKA 5ILQA 3W77A 2CBGA 3HJGA 2HEGA 1RYHA 4AZ0B 3MQ4A 2PRIA 2XB4A 1N2HA 1VA4A 3UZUA 4IR7A 1QJ4A 2ZULA 1EZZA 2XD4A 1YQXA 1GPAA 1QIGA 1U0TA 3DM9B 3E84A 2HZ7A 3QENA 1QQBA 1RPJA 1UKBA 3MJSA 4AYTA 2ZIZA 2BL4A 2R4TA 2XUAA 1CQIB 4HRYA 3TAUA 1QJCA 2IXFA 4EPVA 3FNRA 3BCHA 2G9VA 2Z30A 3WVNA 4DKXA 3FCSB 3QBVA 5SY4A 1I2BA 3NXKA 1XZHA 1WCYA 1JHPA 2OFPA 3AL3A 3CE6A 3LVFO 1QBKC 4FHGA 4ZQCB 3L4KA 1ODJA 2Z8ZA 3H5OA 3S1AA 3VR5H 4ZA2A 3NVMB 4TZ6A 2GPBA 3FR8A 1U9ZA 1VBKA 2YRFA 4LRXA 2Y1GA 3M7IA 3DNFA 2WIGA 4KPYA 1DKQA 4FXPA 1YUNA 4IDGA 2L69A 1YS4A 4MVYA 3P32A 1XHFA 2R6GA 3QHAA 3ZX5A 5C2JB 5LFAA 5LL6P 4GLJA 1RXEA 5DO9A 1OBHA 1IMJA 2B1GA 2GBLC 4GT1A 4YREA 4F5EA 1TEHA 1YDHA 5ALGA 2PH7A 4WE3A 3B3JA 5ILOA 5JY6A 2P6MA 3EUWA 2I5PO 2BD0A 3I1IA 9LDBA 4D56A 1TLLA 2XOKD 1M6EX 1RZUA 1RAFA 3QF4A 5E6SA 2XUFA 3Q40A 1DGQA 3RIXA 5J43A 1IXSB 3B78A 4NJMB 1ID1A 1R0CA 2VJMA 2YUTA 4JLKA 1XKTA 4E46A 2IYOA 5G02A 2EW8A 4IGKA 2LCQA 3ZI0A 3C45A 2H1FA 1JR3A 1HE2A 5I9SA 4KAAA 3T3MB 4GGOA 1CZOA 2RI6A 4Z4GA 1VJCA 2MSWA 4RX1A 5A02A 1JHQA 2B35A 1MA0A 4W9MC 1GNSA 2GAJA 2EKBA 3H65A 3IX7A 3LNTA 2GN0A 2D5IA 3U1BA 1QP4A 3C15C 1Y98A 5HHTA 1HH4A 1YDEA 4CQMB 3RSGA 2V9CA 4PPNA 3B1YA 2YV1A 4KE9A 2XB2A 3H75A 5BN5B 2BFFA 4DCMA 4WXYB 5CNKA 4U3JB 1LH0A 3RAEC 2GKGA 4HFRA 1M0WA 1OI3A 1QO0D 1Y7TA 3BPSA 3NOOA 3H7AA 4V1CB 4QYWA 1MT3A 4GYKA 3D1JA 4GBGA 3IPCA 3HYNA 4C7MA 5GGXA 3OZXA 3PD7A 4BB5A 4K2AA 2EF1A 2HSJA 4JJZA 4I3GA 3TRJA 2Q46A 3BL8A 3T3NA 1JN0A 2FJ0A 1SBQA 1KI6B 2VATA 2FZLA 2O1WA 2VSXA 4HFMA 3AF3A 5JZOA 2E5WA 4ZIRB 5JROA 5IJZA 3HFRA 5IDWA 1QGED 3TEMA 1GU0A 3GQBA 4KHZA 5JEDA 2I7DA 1ZVQA 2ZWMA 2IYYA 3Q85A 4K6HA 2RG1A 1X80A 5CLIA 1M2NA 4MV4A 4CUZA 2OUIA 2P5SA 4KMMA 1DFIA 4CLOA 5F3RA 1S0UA 2VAPA 3OFND 5JD3A 2C82A 5LD2B 3U44B 3G0HA 4NFYA 1A9XA 2Q6VA 3GUVA 2Q62A 3ZZ1A 5FO1A 3DBHA 1K7XB 4LC1A 2IOFK 4HT3B 2ZYAA 1JPVA 2RK4A 1OIXA 3T5MA 1Q84A 2WJJA 4G97A 2JBWA 2YWGA 3CZPA 4L8LA 1W7AA 3UW3A 1JV2B 4HAUA 3JYNA 1RABA 3KE9A 4MGHA 5CB4A 1MQ9A 1P5JA 5AW1A 2RKBA 4UPDA 1QDLB 1USKA 3H1FA 3PQ7A 4MVJE 4R8RA 4R2MA 4EEZA 5B7NA 5WRFA 2E4ZA 1YK1A 1C4WA 5IW8A 3V6MA 2OKCA 5FDFA 1QF7A 1IEWA 2DSNA 4DMUB 2JRLA 2WKRA 4KNVA 3VPSA 5L4SA 1GPBA 1THMA 2J48A 4RD3A 3S44A 4XWOA 1MIHA 5REQB 4MQ6A 1N6RA 1PGQA 4E5NA 4FUTA 3HA2A 5J1TB 5MN6A 2ZM5A 5TPWB 1RLIA 4RAQA 1NWHA 5JH7A 1JG1A 4Y1GA 4B47A 2J85A 2ZIXA 4QPDA 4XX0A 3HR7A 4RGQA 3BORA 4UBIA 2IYWA 4Q3EA 2ONKA 1JUDA 2UZ1B 3ABSB 3KPWA 1ODLA 2VHXA 1JR2A 3ZY6A 1XRLA 2WB2A 2YINC 3V7YA 3U16A 3LKBA 3RBZA 1E92A 1CUDA 4Z4IA 2PTGA 2FAXA 4Q3KA 4YAWA 5EPUA 5C5DA 1JPJA 5I9IA 1LV8A 3C3DA 3PUVA 4LJKA 3BSFA 1GZ4A 5CRIA 3OQPA 4NP6A 5IZCA 3TQFA 2PCLA 4R2WA 2G17A 3U7EB 4CV1A 4W99A 1GTSA 2VSQA 1ZM4A 4PQYA 4KN5A 4EG7A 5A5FA 2DPXA 4Z4FA 1YBFA 1NN5A 3RO7A 2VXCA 4E2WA 5JAHA 1USVA 2VYNA 4E30A 4Z86A 1E20A 1PWEA 3ZJ5A 5LWQA 4DV4B 2QLJA 3CPJB 3F6YA 4B6GA 3QUSA 1C80A 2QU7A 1H1LB 2X4GA 4TRRA 4L02A 3KSMA 4FCTA 4G0VA 2NZUG 5EPEA 2P3OA 2FN7A 3K3PA 5DOVA 5KC8A 2DTEA 3Q9UA 2Q45A 5HEKA 1R8XA 1VI6A 1UMDB 4S0ZA 5D6OA 3T38A 3DUFB 3UXHA 4DDTA 2UVQA 2P9YA 4QGFA 2JCBA 1Z4IA 5EPOA 2SKCA 3ZNOA 3R5KA 2G04A 2F43B 3KSRA 4FCVA 4EJ0A 1K3UB 1T9AA 3G2IA 3GRYA 2FZ4A 1ZCAA 2R6DA 4LYGA 1KFBB 4WXMA 5I8ZA 4EGSA 1F06A 2RHWA 4RL4A 4C2BA 2CZGA 1VL5A 2FN9A 3I04M 3FHJA 4QOFA 3EIOA 5AMXA 1EUYA 4HV4A 2W8ZA 1M0SA 4MLZA 4URVR 4KQFA 4ZYUA 4GVLA 3FYHA 3QW2A 3Q7EA 4NOMA 4XM1A 1K98A 3NCHA 4DQVA 2PMDA 5JS2A 1B43A 4N7MA 4D6YA 1S2DA 1LK7A 3PQ5A 3DYBA 3OWHA 1OBOA 1OX4B 3IAHA 4INOA 4N8DA 3PGMA 2F59A 2VJAA 4Q19A 4RA6B 4E14A 2WTBA 2DY1A 3PGJA 3QOFA 5LQRA 4GBJA 5AJXA 2RDMA 2H0QA 1JQKA 1B2RA 2FEWB 4DE5A 4PHHA 3ZGNA 3BTUA 3DMDA 5EL0A 1SCUB 3VAZA 2IODA 1F3OA 3UMMA 3QPDA 2H1VA 3G2KA 5FTLA 5J47A 1XEAA 2CXHA 2NGRA 5GY7A 2Z2YA 4LHWA 3ZH2A 5JZBA 1O96A 2JC3A 2LIPA 3NRBA 5AP9A 4CM4A 1FMCA 2R5WA 4MB0A 3GMIA 5CH8A 3ZDRA 4GL4A 5DW0A 2BFBB 5FADA 4ZD6A 1CWUA 3O3OB 5K3EA 4LYEA 1ZK1A 3F7TA 4DSTA 4PCUA 1N8KA 4O02B 4WKGA 1PJAA 2F1HA 1BXRB 2IYSA 1TO2E 4ZAYA 5AW9A 4GXQA 2W6QA 2OFFA 4DTIA 3OT4A 1F5SA 2ZTMA 3GLFB 3EXAA 4OHXA 5I8PA 1TTPB 3ETGA 3N53A 3WYDA 3LBIA 3UGQA 4PANA 2OCIA 4QTYA 2Y6UA 1OREA 3RVJA 1FQWA 1DAGA 1QHSA 3ZZMA 2ZQYA 4J8PA 5B5SA 1KAEA 2QW0X 3L8EA 3E9QA 5KU7A 2V97A 2JAOA 4EK9A 4L16A 2VQ6A 1ID8A 1MJGM 3QI2A 1SPXA 5C5EA 1CJTC 4KIUA 1MU0A 5TEWA 1HQYE 1I36A 4H31A 4M9CA 5KOHB 4ZYYA 1PG0A 1MV5A 2WSIA 1ICEA 5BV0A 3V48A 1JDBB 2JAHA 2Z5LA 3D6FA 1KMQA 3CKYA 5DKFA 5CGQB 1LPBB 4DSOA 1FLNA 3L1IA 5HQTA 1T8YA 4EAQA 4GEGA 3VX4A 1OC2A 1QWSA 2A8YA 3N8DA 4DJEC 5ALEA 5IJ9A 1FTYA 3HB5X 1XQYA 3QM1A 1NGSA 1SJ9A 3MT8A 2ZZKA 3AR9A 5FA5A 4DLTA 5HS4A 4KWIA 1Y4UA 2ZLBA 4UU1A 3X0DA 5B57C 3AHIA 3T0FA 4G1CA 4NULA 2OB2A 5FAXA 5DT9A 1B00A 5AO9A 2A86A 5FJIA 1TAGA 1DOHA 3GF4A 4GG1A 4IUYA 3EPJA 2EQBA 1J1UA 1CQJA 2EJUA 3ICCA 5C81A 2BM1A 1T3HA 2HEIA 3I6QA 4G26A 3RYCB 1JQAA 4BNDB 3I5XA 2I3GA 5JRDS 1AUQA 1JQLB 4JOCA 4BKQA 2PO7A 4CTOA 1N5DA 3RV4A 4DV6B 3AGPA 3L6UA 5FHRA 3VVLA 3M81A 1AHIA 4RHUA 5CX4A 3BDVA 3AERB 2E6KA 4NONA 5FOWA 4YB8A 2X13A 5AK0A 1ZWKA 3IELA 3LUGA 4UE2A 3VJMA 1EK2A 1SUSA 1T2NA 1VIMA 2I76A 1O9BA 4BU0A 1RZ3A 2C78A 1LLCA 2OAEA 4R8KA 2B5OA 3FHOA 1KVUA 4Q4HB 3WLLA 4DCOA 3N2NA 2ZJ1A 2AWNA 1E2MA 1DE0A 1FUIA 5D7BA 4NXMB 2MSDB 3HDJA 3F9IA 2CW5A 4D8VA 2XMGA 1K63A 1PFWA 1A8HA 2Q6LA 3P9SA 2DR3A 5U9CA 3FYUC 4KB5A 3ADKA 1P81A 2NUAA 2IP2A 3WLKX 4NV0A 2FQWA 1PG5A 4MZXA 4UUMA 1U2ZA 3ZE7A 4B4OA 1PK9A 4ZV4A 2BBSA 4HXYA 1BFUA 5HFNA 4ARSA 2EYUA 1DC7A 2APJA 1IK6A 2FUCA 2X77A 2CLLB 4I5GA 1VP9A 1V8BA 4YJ3F 3PWSA 4FNGA 3V5NA 3ZXIA 5FUQA 4NU5A 1OPRA 4DQDA 2QGNA 3ZVMA 4QA9A 5HJ5A 5JI2E 3MXOA 4OQFA 4C03A 1G8KA 2IGTA 2HU5A 2EQAA 2P7IA 4HMPA 2DKFA 5JNRA 5HF9A 1Q83A 4ZO4A 4P33A 1GKYA 5DTIA 4U4AA 5KKAA 2P4EA 3N86A 1NMEA 2G25A 1JVBA 3UY4A 4OJMX 3G2LA 4CRWB 3GDOA 5IWCA 2JBAA 4FKZA 5EMNA 1D03A 2IPLA 1ISIA 4PM4A 2Y1WA 1PAUA 3V1UA 2R00C 1EVYA 4NK4A 5L3RA 1OU4A 3IV6A 4KNWA 5CG1A 3VHXB 4N76A 1E62A 1J20A 3LLCA 2WTEA 4DG9A 4ENVA 5FO0A 1EE1A 1ZGHA 3JX9A 4FE3A 2EJVA 1W0JD 2J4CA 3LQRA 2UZIR 3S3TA 2OB1A 2XRZA 4ZGBA 2PZLA 3BWCA 4DTCA 1B23P 4ARZB 5K1ZA 4EHIA 5LIRA 2A30A 2XXJA 4W63A 4B2IA 5BNZA 3U56A 3D6HA 2ZI7A 2GN1A 4KFTA 1CUHA 1RHRA 4IJQA 4ZTBA 4WBXC 4KHPB 2E2WA 1KZ9A 1VYHA 2C5GA 3O2JA 2A0FA 3ZC3A 3EY4A 3C3YA 3U80A 5KBYA 3GJ0A 1WW2A 4U7PB 3QU9A 4Z0HO 4RVUA 1II8A 1Y42X 1K7SN 3AY6A 5FHQA 3ZQ4A 4AJLA 4B7XA 2IPMA 4K9PA 3I4FA 3T3GA 3KTAB 1G8AA 3FOCA 1KMIY 4RFVA 3QX3A 1C3OA 3OE7D 3K70C 4QUJA 4DYDA 1P1HA 3FHLA 2IZ6A 1S1CA 3K4HA 1MZVA 2HREA 3L6DA 2BH9A 4RZ2A 4U7WA 3VO9A 2FGKA 3W9UA 5JXGA 2HA3A 3F96A 2IGBA 1F3LA 4QQNA 3L4BA 4V39A 2ZSHA 3PUJA 2V98A 3RUEA 4CMIB 1H1TA 4ON9A 5LMUB 4FFRA 2R47A 3E9YA 1M1UA 5CBPB 2QMOA 3I52A 4KXYA 2HF9A 2YH2A 3HVUA 3I53A 2WYHA 3I9OA 2QE7D 1P6QA 3IVAA 3KYDB 3PEUA 3FAKA 1XC7A 1O6FA 4KXMA 1CEYA 2R5NA 1AHNA 4JUFA 2JVIA 1Y6JA 5EJAA 4J16C 4F3RA 4ZI7F 2ODQA 4ZO9A 3GG2A 1HT3A 1L6IA 1W5AA 3ZHYA 3AUJB 4RKEA 2GD1O 1D9XA 3GROA 4A73A 2RHLA 2VYCA 4ZMSA 3GLGA 1MDFA 4C22A 4W9NA 1THTA 2B3TA 2W6PA 5AOBA 4F9GA 4HX9A 4Z51A 4PPQA 2GEUA 2O1EA 4YI5A 4BLOA 3V3TA 5K03A 1NI5A 1XNGA 4EUEA 1KRHA 3OTOB 2ZJ0A 4LJ5A 4URWR 3D4NA 1E2KA 3WBFA 3QWIA 2ILTA 3ORRA 4O1IA 4H60A 2A7QA 4B3CA 4EX6A 4YJHB