2VAVA

Crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
376
structure length
347
Chain Sequence
b'NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 116
structure length 347
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vavA00
4OB8A 4AO8A 1CUWA 4CIAA 4K6GA 1QFMA 5ALNA 2J4CA 2JGMA 5C8ZA 4G5XA 4Y2TA 4GXNA 2XUFA 4BAGA 5ALHA 1Z68A 2O7RA 3I2GA 3H0CA 5JD6A 5AI4A 4OU4A 1F8UA 5AJHA 4U2FA 4MJ3A 3WK6A 3R3XA 1HLGA 1MTZA 3T52A 3V1NA 3W9BA 1GT6A 5IVIA 1ZGCA 4UHCA 1EI9A 4TPKA 1QTRA 5JD5A 5ALTA 5AO9A 3HEAA 2QRUA 2WILA 4XX1A 5K3CA 3M82A 1XKLA 4BZZA 4BP8A 4Y2JA 5ALLA 5D3ZA 3DJYA 1BCRA 1LLFA 2XQJA 5AKJA 2WTMA 1UKBA 1UZAA 2IIVA 3IURA 3VXKA 4H0CA 3DL4A 1IUOA 4U2BA 2HRQA 2JIDA 5LZ9A 4X7BA 2I03A 2QKYA 2XUPA 1QO9A 4XVCA 3EQ7A 3DKRA 2CZQA 4Q1VA 4N8EA 3I6ZA 4OUKX 1QTIA 5EHNA 3WKEA 2HFKA 1TQHA 2DQYA 1DQYA 3L1IA 4GECA 1I6WA 1JKMA 1UT6A 3EQ9A 2DQZA 2VSQA 5A62A 5DLPA 1RWQA 2PX6A 1DWOA 4Q82A 5C8XA 4K6KA 4UBJA 5CMLA 3GA7A 2QXUA 3C5WP 3IVMA 5JZSA 3WQHA 1LPMA 2ZYRA 1XZJA 1XZCA 4X95A 2GYVA 4QDXA 1W75A 1GQRA 5FRDA 5ESRA 3R3UA 2OCIA 3BDIA 3DOIA 5EIEA 4B84A 2DCMA 1JMYA 1YAHA 2C58A 2Q0XA 5K3DA 4Y7DA 4UBMA 3X3HA 3DLTA 1CEXA 3W9UA 4BC0A 5BOVA 3MUOA 3WWOA 2H7XA 3NUZA 5D7BA 4BVJA 5LKAA 2XMDA 4X85A 4KE8A 4UHBA 2O7VA 5A6VA 1FSSA 1XZDA 3FLBA 3H04A 2XUAA 5AICA 5K3BA 2LIPA 4G4IA 4QLOA 4AN1A 5JANA 5ALUA 1CUSA 3H2KA 4DNQA 1UWCA 3L1JA 1XQXA 5ALMA 1Y7HA 2V9ZA 3KDAA 1JMKC 3IUJA 3VJMA 4AXBA 5LZ4A 3ZLVA 4MWTA 2PSFA 1MAAA 5LIPA 4DGQA 5D6OA 5DYYA 1TAHA 5AM3A 4QDTA 1E3QA 4J7AA 4L9AA 1UOQA 5IVDA 3DYVA 2XB6A 1WB6A 4ROTA 5JD4A 1JI3A 1GZ7A 2WUEA 1WM1A 1DQZA 2WIJA 4MWSA 1ISPA 2CEKA 1KEZA 2J3QA 1LGYA 5AOAA 3WWEA 2VA9A 3QITA 2P8SA 1CUEA 3FYUB 4ETWA 1WCYA 3W05A 5CXUA 4Y2UA 1CUHA 3G9TA 4FNGA 1CQZA 4IH1A 1HDEA 1K63A 2GBGA 4FBLA 4N8DA 4ARBA 2H9YA 1RYYA 5ALPA 3D59A 1EDEA 2HA3A 3H1AA 2BKLA 2CBGA 3WIOA 5JATA 4PQEA 1Q84A 3ED1A 4QDUA 4XWGA 5AKGA 1AC5A 7YASA 1VA4A 2QTBA 3HXKA 5E4TA 1UFOA 3DS8A 4X93A 4B0PA 4TVKA 3I2JA 1XRRA 4U2EA 1G5FA 3G0DA 4J0KA 2AJDA 2B20A 4BBZA 1XZLA 5CT8A 3JWEA 4KAFA 1BN6A 4HXGA 5JADA 3HC7A 4DMFA 1IZ8A 1A8UA 4G8CA 1BRTA 5FPPA 5IVKA 4QEKA 1CUFA 1HL7A 1B6GA 3BL8A 3VKFA 2XLCA 5ALIA 1EB9A 2AJ8A 1QGED 4BRSA 2QJRA 2HU8A 3AIOA 4DMCA 4A23A 5AKIA 2OQIA 3A2LA 4DNFA 4FFWA 4ZGBA 2WU4A 4FBMA 3FNBA 2QOEA 4F0JA 1FFCA 4B82A 4HS9A 2X76A 3BIXA 2I78A 3WZLA 3NWOA 5DWDA 2PSEA 1VKHA 3C43A 1N5RA 1B41A 2Z8XA 2DFPA 1MT3A 4UBNA 2FJPA 2HM7A 3D5EA 3I2HA 2WSLA 5HKAA 1TK3A 1FFEA 1J07A 4H7DA 2GZRA 1H23A 5E2IA 4ZWNA 5C7YA 1CQWA 2JEZA 2WG1A 3R3ZA 3R41A 2BCEA 3HZOA 1P0QA 5DNWA 3I2KA 1DT5A 4Q05A 3CXUA 4J0DA 1A7UA 1YCDA 3PICA 1GPKA 2JGKA 1OILA 4FLFA 4DIUA 4Q3LA 1YS2X 2ROQA 3I2IA 1XROA 5HF5A 1F0PA 4ZREA 1BROA 1KU0A 4ZV7A 4WJLA 5HQ3B 3QMWA 3BIWA 2XMGA 2YH2A 4C4YA 1P0PA 1DX4A 3WA7A 2RAUA 4B9EA 4B7ZA 2BGNA 1XLWA 2RGUA 4V2IA 4X97A 1BEEA 3ZPXA 3H2HA 4OPMA 5FKJA 1QIFA 4GHWA 1YS1X 4WFIA 5A7GA 4PSCA 2Z5GA 3ESBA 3L1HA 5HF6A 3IA2A 5AKXA 1F6WA 3WKDA 2H1IA 2RHWA 4AMYA 4OD0A 2OLEA 4HTAA 1ZD3A 2NW6A 2VF2A 3V1KA 3I1YA 3WWDA 4GEGA 4N5IX 1C7JA 1XRMA 3MGAA 2J4FA 4KYVA 1AX9A 1FFDA 3NOXA 3FLEA 1R3DA 4S0XA 2K2QB 2WFZA 2YYSA 2XDWA 2HA7A 3IULA 3I1IA 4RE6A 2PSJA 1O6FA 3D2BA 4K5QA 1LBTA 4GLBA 3KXPA 3ZI7A 4B0OA 5FPQA 3FSGD 3FYTA 3STXA 4H7KA 1DX6A 4FKBA 2WFLA 1LZKA 2FUKA 3BJMA 3IIIA 1XZAA 3QZUA 4C89A 4AZ0A 5C81A 1A8QA 1ZD5A 3ICWA 4C4XA 4H7JA 2CKMA 3EBLA 1CUVA 3R0VA 4NMWA 2WG0A 4YASA 2V98A 3DQZA 3G0CA 3PFBA 4J3JA 5AP9A 5I9IA 5E4JA 4KAAA 3STUA 5ALDA 1QONA 1H2XA 1XQYA 1MAHA 3HI4A 3KWFA 2EDCA 5CRIA 2PU5A 3ICVA 4O08A 1TCBA 3ANSA 4BTLA 1QIDA 5A7FA 2HA6A 1N5MA 4W1SA 1R88A 1MX5A 2OQVA 1XZIA 4PNZA 3OG9A 3A70A 2PU7A 4Y9SA 1P0MA 3BF7A 5IKXA 2XMQA 1A88A 3HLKA 3G0IA 2WQZA 2GBCA 2CUTA 2QUBA 4BRZA 3STTA 5I7UA 3UMJA 5ALXA 3AZQA 1BE0A 4L0CA 4PW0A 2Y1KA 1CUUA 4E14A 1N8SA 2VJBA 5DNUA 1UOPA 1JJIA 3WYDA 2WIDA 5ALJA 1OXMA 3LIIA 1YR2A 3HSSA 4BYMA 3ZV7A 4Z49A 1QIIA 3HACA 5FLKA 2XQFA 4ZI5A 2XUGA 4M0EA 2JBWA 1R4ZA 1ZJ4A 3G7NA 2Y6UA 4K6HA 2Z8ZA 3WK4A 1IVYA 1WPXA 2XLBA 1QFSA 4Q3OA 1L7QA 3N2ZB 4Y2RA 2XE4A 4DNOA 5ALGA 3R40A 2HA0A 4KRYA 5HF8A 5IH7A 3WWPA 4BCCA 5T4EA 4Q34A 3DEAA 3TJMA 2B9VA 4DNPA 1T2NA 3QPCA 3VDXA 2GZSA 2OGSA 4OB7A 5C8VA 2QZPA 2G4LA 1SC9A 1G42A 4EB0A 3M3DA 1THTA 4RPCA 1WHSA 1KU6A 3R3VA 5KBYA 1CUXA 1P0IA 5LZ7A 3OC0A 3QMMA 4E11A 1CPYA 3EF3A 4HZGA 5LP1A 3C8DA 4INZA 2AJCA 2ONCA 1VE7A 2OGZA 3HYSA 4Y2VA 4UFPA 4Y2QA 1R1DA 5ALRA 1TKRA 3GBSA 1CV2A 4UFNA 2ECFA 1EINA 2XI4A 1IUPA 1WOMA 4QA9A 1J2EA 2ACEA 5H3HA 2GYWA 2VATA 1R50A 1PFQA 4DTCA 5ALZA 4I3FA 2XMRA 2QJWA 3O4GA 4CIBA 1CUBA 2X8BA 3E1GA 5HFNA 4PO3X 1W1IA 3WLAA 3OURA 1E8MA 5DNVA 5J3JA 3RKSA 1VXRA 4QE3A 1X70A 4G4GA 4RNCA 2G5PA 2PUHA 4BCDA 3VJLA 2IITA 1U2EA 1ZI8A 4RGYA 2D0DA 2JGFA 3BDVA 4UHEA 4UBOA 4M0FA 3I6MA 4UBKA 3QPAA 4H7HA 4X92A 2QR5A 3SX4A 1QIGA 1XQVA 2BJHA 3DKKA 5AK4A 4KE6A 5CXXA 4G8DA 3WL8A 5A7HA 2WUDA 4E46A 4NVRA 2XQGA 1EVEA 3O95A 3SWWA 3WYNA 2BFNA 2WTNA 1BS9A 5AM0A 1EA5A 5AOCA 4DMHA 4CG1A 1E5TA 5ALFA 2XUJA 1THGA 1ODCA 4X94A 2V97A 3WJ2A 3U1TA 4U2DA 3QH4A 3JYHA 3F98A 4CG2A 1QIJA 2QMQA 2PPLA 3NGMA 1EDBA 1CRLA 2ZSHA 2C7BA 1ZI9A 2VT7A 5JARA 2OAEA 4WY8A 3BWXA 4KAJA 1E89A 2HU7A 4X90A 1WHTA 2PBLA 2DHCA 5HCUA 2WFMA 3VISA 3DDUA 1BEZA 2HHAA 4EY8A 2WKWA 3H1BA 5AI5A 3I28A 3FYUA 4QLAA 2BUCA 1OCEA 2AXEA 2ES4A 2QT9A 4B83A 5E4YA 3JW8A 3BXPA 4BCBA 2BGRA 5ALYA 3R3WA 3CN9A 1AGYA 2XUOA 4BP9A 2G5TA 2ZJFA 2PM8A 5JAOA 4DSZA 3V9AA 4BE9A 3WI7A 1A8SA 3V1LA 1QIKA 3FSGA 1DU4A 2VTVA 2YASA 3C8HA 3WKCA 1CVLA 4FNMA 4BAZA 3I2FA 2EEPA 1UKCA 3QBJA 3B5EA 4KR0A 2D5LA 4H7IA 4X00A 2GYUA 1XZHA 4G1FA 4QDOA 2VAXA 4FLEA 1XLUA 2I3ZA 4C88A 1AURA 1MX1A 1Q0RA 1JU3A 3DYIA 4DYHA 2PKYX 3P2MA 5JALA 4DM7A 4WY5A 2DSNA 5JAHA 2WJ4A 3PDCA 4GW3A 1XRLA 5CBKA 2ZJ6A 3E3AA 3G0BA 5CH3A 4BVKA 3IUNA 1QO7A 2XQIA 1AQLA 4B9AA 5CURA 1Q0ZA 1QOZA 3W04A 3ESDA 3GROA 4BC1A 2H7CA 1QLWA 2XMBA 1MN6A 5T4BA 1XLVA 5AH0A 2RONA 4OYYA 5LZ5A 3C6ZA 4PF1A 3E0XA 3STWA 3H18A 3TRDA 3ESCA 5AI8A 1XQWA 5ALQA 5EHZA 2RIPA 1EB8A 1GPNA 1GQSA 3STYA 1BCSA 2XMZA 4Y2YA 2VAVA 1EK1A 4IHAA 5EHQA 2O2IA 1MNAA 2WHPB 4UHHA 4OCZA 5HQ3A 1WB4A 2Y2UA 5K3FB 2E3JA 4KJXA 3BJRA 3GFFA 2V96A 5CH5A 3FLAA 1LPAB 1DT3A 4J0IA 4H7FA 3IB3A 4LXGA 1NU6A 1QE3A 1ZD4A 2WHRA 1ACJA 4QWWA 4ZRDA 1CUDA 5EFZA 1HKHA 3ILSA 1LZLA 1VJ5A 1IZ7A 5AM2A 1MNQA 2HIHA 2IX9A 4X6XA 3Q8WA 3F9CA 1G66A 5JIBA 3AFIA 2XMSA 4JEIA 5JYCA 1LPOA 1SFRA 2I3DA 1S8OA 3M81A 4PV7A 4EBBA 1K5PA 4TGLA 4U2CA 1U8EA 3N0TA 3HABA 3CCBA 1UOOA 4Y2PA 2UZ0A 5AM1A 1XRNA 4CCYB 1SCKA 4LYEA 1YASA 3AIMA 1UK9A 3AJAA 4JYPA 1SCIA 4WFJA 2WIFA 2WLSA 1GPLA 5JAPA 3RARA 3S8YA 1HPLA 4AB1A 2Z3ZA 1USWA 2H7YA 3O4IA 4EY4A 1M33A 3C5VA 1LPNA 1E8DA 3LCRA 1YB7A 4DSAA 4CFSA 5D3KA 3YASA 4UBIA 4CI9A 2DHDA 1GKLA 4OB6A 3K9BA 2VEOA 5LLSA 1K6EA 4IH4A 3WK8A 4LXHA 2ORYA 2X5XA 5EI5A 3S2ZA 4JH0A 1ZICA 3H19A 4L3WA 1Y37A 4KE9A 1K8QA 5A2GA 1CR6A 1UKAA 4WDRA 2BUBA 1E8NA 2B4KA 4BE4A 3H2JA 1XRPA 3Q0TA 2VJDA 1R9NA 3DD5A 4EA6A 2QXTA 2XUDA 5SYMA 2CJPA 1C7IA 4AO7A 3F67A 2JGLA 3FBWA 4G4JA 1AKNA 1ZJ5A 4LIPD 4H77A 4FFVA 1BU8A 4ARAA 5LZ2A 3QMVA 4MXDA 5AIBA 5EHXA 2BUAA 1J06A 3B12A 3W06A 5AHXA 4W63A 5CT4A 2VJAA 1VOTA 4XJVA 4EUSA 4GBGA 3WL5A 2XMCA 3IUQA 3C87A 3K2IA 3LP5A 5FOQA 1YB6A 4X91A 3RM3A 2HA2A 1LPSA 3C6XA 3G9ZA 4E15A 2WJ3A 3AZOA 3BE8A 3RK4A 3AZPA 3VVLA 5ALEA 2ZYIA 2JGEA 5CW2A 5DTIA 1XFDA 1JU4A 1LPPA 4P92A 3WA6A 2WHQA 2FJ0A 5LZ8A 1MU0A 3D7RA 4F60A 4B81A 1TCAA 1EVQA 2HDWA 1EK2A 3HJUA 3PE6A 1GXSA 1CUAA 3G8YA 1ACLA 1CUZA 3V48A 1X2EA 3PF9A 3ZWQA 5K3EA 3WK7A 2ACKA 3QPDA 4G8BA 2QVBA 4XIIA 4N5HX 3E4DA 4W9RA 5EIHA 1QIHA 4F21A 4QZVA 1ORVA 3BF8A 5T4FA 1XZGA 1TCCA 4LXIA 4EHBA 3PFCA 4Y2XA 3OM8A 5K5EA 2C0PA 4GI1A 2OCKA 3LIPA 3PUHA 4MQMA 5FV4A 1K4YA 3CCCA 4BB0A 1UK6A 5KREA 2ZVDA 3EQ8A 3M83A 5AKHA 3C6BA 4NZZA 4CG3A 5IVHA 2HRRA 3UUEA 1W76A 4W1QA 5A71A 4MQLA 4FDMA 2C0QA 3G02A 5FP0A 1DINA 1X2BA 1WB5A 4J03A 2AJLI 3DOHA 3AIKA 1LNSA 5DTJA 6YASA 4UUQA 3FVTA 1GKKA 3PUIA 4EY6A 1W6RA 4QDZA 1J1IA 5JAUA 4AZ3A 2OG1A 1SOMA 4WCVA 2OAGA 4QWMA 2WUFA 3FAKA 2DHEA 1QZ3A 3LS2A 5CH8A 1VLQA 5AKLA 1XRQA 1Q83A 5FDFA 1N1MA 3TGLA 3HRHA 1ZIYA 3DCNA 2ZYHA 5EIAA 5LYYA 2Y2VA 1SCQA 4YK7A 2VJCA 1IMJA 4PSUA 5JASA 1ZGBA 1O6GA 5KWIA 4OSEA 5YASA 3U0VA 3UUFA 3TEJA 4BTVA 3QM1A 3VJKA 1UK8A 2C4HA 2R11A 4U2GA 2WM2A 3A6ZA 1UK7A 2HU5A 4FMPA 4YX9A 1PJAA 3FCYA 1BN7A 3VVMA 3WK9A 4MEAA 2XUHA 2HA5A 5AOBA 4I4CA 2O2HA 4BATA 3RLIA 2G63A 3B3QA 3D0KA 3FWHA 3IDAA 3QYJA 2W22A 1PV1A 4KACA 5AM4A 5ALSA 4HAIA 4ZXFA 1H2ZA 4UPDA 3O4HA 1CUYA 3FCXA 4W1RA 3H2IA 4EY5A 4BDTA 1XZMA 2VQ6A 3ZLUA 5AKEA 3OPMA 2PSHA 3WMRA 3SK0A 3WWCA 3DL7A 1JFRA 4F5ZA 1ODTC 2JGIA 3ESAA 4M0MA 3H2GA 2FX5A 3IBTA 4AX4A 3AILA 3G9XA 4HRYA 1HBJA 2B61A 2QUAA 5DYWA 4BDSA 4JNCA 4HVTA 4LKOA 2VT6A 1ZI6A 5AKYA 2YXPX 4GWLA 3WJ1A 3GUUA 1L7RA 1QIMA 4JYMA 3FYUC 4C6HA 1C4XA 1FJ2A 1ODSA 1VXOA 5ALVA 2WJ6A 2OCLA 1MJ5A 2JGJA 5ALOA 2PSDA 3G9UA 1EH5A 4K2AA 1GGVA 1ZD2P 3IUMA 5I8PA 1NU8A 5AI0A 2WIKA 4FOLA 4J0HA 4WDQA 4B80A 4IH9A 4D9JA 4X6YA 3T4UA 2GBIA 1CFJA 4MEBA 5BWBA 2OCGA 3MVEA 3OTQA 5BWCA 3WKBA 4H35A 2RI6A 4UHFA 3F96A 5SYNA 2EDAA 3A2MA 1R9MA 5FXMA 4P9NA 1AUOA 1T4MA 3WKAA 4G9GA 1NX9A 2C5GA 2Y6VA 2DR0A 1L7AA 1QIEA 1W52X 2XUKA 2OGTA 4HXEB 5HZGA 4RE5A 4HXFB 4W1PA 4ITVA 4X3CA 3O4JA 4KRXA 4JUIA 4N8SA 5AK6A 5HK9A 1JJBA 3WL7A 5AKZA 4Y2SA 4X6UA 2CB9A 3D2CA 1FFBA 1XZFA 1AZWA 1XZBA 4CCWA 4KEAA 4MYSA 3W2TA 4L72A 3V1MA 4UHDA 3C45A 4WFKA 4J0CA 5CTAA 4YPVA 1WPRA 2W6CX 2C5FA 3K6KA 5AM5A 4UBLA 3D2AA 3KD2A 5DYTA 2ZSIA 4ZV9A 4P08A 3KOOA 4GDMA 3C6YA 3O9MA 4MYDA 4B85A 2XQKA 1XKTA 4QNNA 2HL6A 4FLMA 5BV7A 5AKKA 5HKBA 3FVRA 4IQ4A 3PI6A 2AJBA 1VZ3A 5DJ5A 1CUGA 1YSCA 1YAJA 1VA5A 2ZJ7A 4UFOA 3A2NA 1DWPA 2PUJA 4A5SA 1CUIA 1E66A 1CLEA 3AINA 4AN0A 4IO0A 5HK8A 1LBSA 2WIGA 3KSRA 2WHPA 4BVLA 1HQDA 1EXWA 3EIOA 4FWBA 4DMKA 4NS4A 2XUQA 3PF8A 5AK5A 3GELA 3SC2A 2O2GA 1ZIXA 2J3DA 3O0DA 5HFAA 4LHEA 1VE6A 2OXEA 5K3FA 2WU3A 3QVMA 3WL6A 5K3AA 3D3NA 3F97A 3CN7A 3H17A 3D4LA 5F4ZA 1MPXA 1U65A 2XT0A 5AIAA 5AI6A 4DLNA 2HA4A 4BAUA 1TRHA 1W4LA 4I19A 1YA4A 4HRXA 4AMZA 2XUIA 3AUKA 4B6GA 1EX9A 4BZWA 3FOBA 3WIBA 5ALWA 2QM0A 4OU5A 1H2WA 2R8BA 1DTEA 2WFLB 1JT2A 4LYDA 2WUGA 2QS9A 4A16A 4FHZA 1ETHA 4C01A 5LKRA 1RP1A 2HFJA 4AO6A 2JEYA 1Y7IA 1VZ2A 5CT9A 1JJFA 3OOSA 4J0JA 5KWJA 5ISMA 3ZLTA 1XZKA 1MO2A 3GZJA 4PSDA 1CUJA 5JZ9A 1AMNA 3MUNA 5FUMA 4G9EA 1U4NA 5CT5A 5EGNA 1CIJA 4X71A 4CCYA 3WZMA 1CUCA 4Q3KA 1ORWA 3STVA 1LPBB 2WG2A 4C87A 4C4ZA 2HADA 1EHYA 4P93A 3KWJA 2JF0A 1EDDA 4J0GA 1H22A 1XZEA 5CT6A 1F0NA 3O9VA 3WK5A 2OPHA 1G4HA 3I6YA 4H18A 2GBFA 5HF9A 1QJ4A 1IUNA 4KE7A 5T4HA 1ZOIA 3DNMA 3F8SA 2ZYSA 4OYLA 4EY7A 3R3YA 3LLCA 1YA8A 2CMFA 1UXOA 3G0GA 5JZBA 4H7EA 3ANTA 1D07A 1MX9A 2Z3WA 4AQDA 2BAGA 2RHTA 1DWQA 4EZIA 2PL5A 4FTWA 1H2YA 2PVSA 1TIBA 3C70A 5AK3A 1FFAA 5ALKA 5AI9A
chains in the Genus database with same CATH superfamily
3QVGA 4ZI7F 4M49A 3GGCA 5HM6A 4AO8A 1FFHA 2LIVA 2G07A 2PL1A 1GUDA 3CISA 5LU9A 3K0AB 1OFUX 2NSHA 3ROMA 2Q3JA 4RUKA 1FFGA 1GRRA 2NPOA 4GLOA 4CN9A 3D54D 5ILGA 2A4MA 5KTSA 3U7RA 1Y8RA 3DTNA 5IDWA 1Z7YA 4KBFA 4EI7A 3PX2A 5C8ZA 3LUDA 4Y2TA 1U4SA 1G6OA 3R5XA 1KOGA 2WB2A 3EMVA 1G21A 2EIXA 1Q2XA 2FN7A 2QM3A 2VPQA 3EASA 4KLAA 3X2EA 3LKZA 2O7RA 3LLMA 3H4TA 5CDHA 4BNVA 3CBQA 3I2GA 4XPIA 3H0CA 3NHFA 5SYAA 1U1GA 4DCNA 5JD6A 1NXTA 1O9HA 1K9VF 5G40A 2DBYA 1TU0A 1WO8A 3T38A 2G9UA 2OZLB 3LVBA 3NEPX 3I05A 4UJ5A 5BW4A 4EI8A 5FTNA 1CJCA 2IGBA 4RTQA 1AQ6A 1N2JA 4MUIA 3RTAA 3NHYA 3QEBZ 2KM1A 1MTZA 2OFPA 1P72A 1OYVA 1U31A 2GM5A 2LRHA 2O4CA 4O2LA 2PVCA 3ZWBA 1KVUA 3CKMA 2AUTA 4UEKA 1OBCA 2GMWA 2XTAA 3HJAA 3HB5X 5TVGA 1NMEA 3UB2A 5JDIC 4URFA 3P9SA 2C98A 4RK0A 3TK1A 5J4LA 5CCBA 4MB0A 3NTRA 2EQBA 2IS2A 5DN6D 2JLXA 3KKNA 2YRXA 3IRUA 1EI9A 1RVDA 4YJGA 4ENWA 1BAPA 3H5RA 5LB2A 3T1OA 3T7DA 4B45A 4D81A 3ZX4A 3HU1A 1TTPB 4FYKA 4OP3A 4R9RA 3P27A 3ACBA 5AO9A 4ZKDA 3VX4A 5JXJA 1Q92A 2R2GA 4HB0A 4FVTA 4CM9A 5D7NA 3HRIA 2RI0A 3LZDA 4PY2A 3L02A 4QDJA 4EW6A 4EVQA 4CXMA 1D8TA 3QVTA 3B8HA 3IRVA 1QHHA 4C29A 2GCOB 5LQNA 5HP4A 4XAQA 1K88A 2R8ZA 3SN6A 4YA6A 5MN4A 1XR3A 3J7AC 4L02A 4F6RA 2YXNA 1NTRA 1Q20A 1XKLA 3P9IA 4JA2A 3VYRB 4BP8A 1CR1A 2PMDA 3FDFA 1HE4A 3EAQA 4FYIA 4I4TF 4Y2JA 5ALLA 4LXXA 4BL5A 4C0KA 3A06A 3C0KA 5BSFA 3WLJA 5TGZA 4QTYA 3ZGNA 2J32A 2GN6A 4GZ3A 4OHKA 3CRW1 5KHOC 1T6ZA 1PQYA 1Q50A 2TSYB 3HPQA 5EIOA 5FOSA 4FEYA 4YQZA 3W5HA 1NUTA 4ECEA 2DGDA 5LIRA 1LLFA 3PXUA 1DIHA 4MVJP 1EQ2A 1UZAA 3PHJA 4DEXA 4ZDIA 1SEVA 1X1RA 2G0NA 2IIVA 3ONDA 1SC6A 1W2GA 4LXYA 1V9LA 4M54A 5D3MA 1GYPA 3U3RA 2PMFA 3HWWA 3ON5A 3KU1A 4LJ7A 5BV0A 1K06A 3CF2A 3PUVA 4QXRA 4A0SA 4YCSA 1JFSA 1VL5A 1I36A 3F47A 4I6JA 1P7ZA 3B2NA 4BMZA 1RAGA 1IUOA 3AR6A 1ZITA 2Q4EA 1M8KA 3L7CA 5FHQA 4ML3A 2GEVA 2JIDA 3AERB 4YPOA 1MUUA 5IU6A 2I03A 3AG5A 3MTEA 4R7TA 3GLGA 4ZKEA 1WF3A 4MJLA 4R9SA 3RPEA 4PAMA 5D1NA 3U3KA 2VHXA 1WEKA 3EQ7A 3DKRA 1T2DA 2DJIA 3QLVA 1X0VA 3OOWA 4G1EB 3UUGA 4BGVA 3GK3A 4S3MA 2HEGA 2QP4A 1V1JA 3DGEC 2C42A 1RPNA 4Q1VA 5AJWA 1DRKA 4EMSA 3EW7A 5EHNA 1NFQA 2FH5B 3M6WA 1KZ7B 3PG5A 4P1ZA 1GLGA 3PNYA 4LZZA 2OUKA 1Z17A 1W19A 1VCMA 4JUCA 1V2HE 1K9SA 4KQ9A 4H15A 5JY1A 5CX1A 3OJFA 4XSGA 3OAAD 4XOIA 1E94E 2XYHA 3QX8A 4GGPA 1I6WA 1U0OC 2P9CA 3WRYA 3C6KA 3GOQA 1BVHA 1NBMA 4BO6A 1UT6A 4XQ0A 3BM5A 3SE0A 5HJ2A 1YI0A 3FPSA 1W0KA 4CQLB 1RCUA 1TUBB 1XPJA 1Y48E 2ILTA 2VSQA 3K5WA 2ZUWA 2Q3MA 4HLUA 2JFYA 3UV6A 3ZXIA 2Q2NA 4IIJA 3ZGYA 3ZWAA 4JLWA 5TQ0A 1K6IA 2W2TA 3RF6A 2IUYA 2OBLA 2ZRFA 4EB3A 5D2CA 5C8XA 4UBJA 1HL3A 1NF8A 1EIZA 1UOEA 1E7YA 1I80A 3ORSA 3LPNA 2FETA 4BQSA 1O95C 4UVIA 3V3KA 5HTOA 4ETMA 3UJ6A 4PLHA 3PNPA 1G8FA 2ZYRA 3AHFA 4WL0A 3ZXUB 1XZCA 4CF5A 2WD7A 4RZUA 2P1ZA 5K0FA 3O8BA 3E03A 1HFKA 3WIVA 1KBZA 2QORA 3AP3A 3MMXA 3WQQA 2M6RA 3KYDA 4P54A 4A8TA 1VHWA 7MHTA 1F20A 4H1UA 3SM9A 3LPCA 1G5TA 1HLPA 1PRYA 3IEXA 3O94A 4UVHA 3ZCVA 3CSUA 2DCMA 4B84A 3ABOB 1FU4A 1KOFA 2I8AA 2AQIA 1RPTA 2EWVA 3G68A 3HNOA 5CG1A 3HKBA 3PXBA 1ZRHA 2IHVA 1SXJE 2OBMA 4KO2S 1AXRA 2J45A 1A96A 3SQMA 3A4VA 1SRQA 2BJWA 3W34A 4V0NA 1CEXA 1W2HA 2FA9A 4W5RA 4HLCA 4QVGA 5DO9A 5EP1A 3KZKA 3QEAZ 2P0EA 4TV8A 3WWOA 3KJFA 1PGPA 3BFPA 1K7EB 4BVJA 2OO7A 2JJ2A 3CW9A 3CKKA 2GOYA 2XMDA 4GXRA 4JELA 5IC4A 3O1JC 1X19A 1KK2A 4DLUA 1AOXA 2CLOB 2I1VB 2O7VA 3AF5A 4FDUA 4BFXA 4PN7A 5A6VA 4KODA 1QNLA 5U4QA 2UUCB 1Z0UA 3RS3A 4CKWA 3ECSA 1V4NA 2JEOA 2PRJA 2XUAA 4JVOA 2VNKA 1TL7C 2ZIUB 3WP0A 1NZFA 2A1UA 4HQKA 4NG4A 1Y42X 2PUBA 1R8QA 5JG7A 2LIPA 4QLOA 4ZI2A 5KJ6A 3NDRA 1T2EA 5ICSA 2GN9A 3TDNA 5ALUA 5LYJB 3MTBA 4NTZA 1GO2A 1CUSA 2ECPA 1JVNA 3JWGA 1XQXA 4CCSA 3WTBA 3PYMA 1H66A 3LC2O 3NG1A 2OBYA 3I42A 3TQTA 1ISMA 2FFRA 2FDRA 1JEYA 5FORA 3RNOA 1G20A 1Y6GA 1RADA 1MAAA 3O9ZA 4HDQB 1YI1A 5DYYA 4DGQA 2IW3A 3LECA 3LJKA 3IT0A 4DGSA 1CZRA 2NTJA 4GPZA 4EUFA 3GWZA 2VHQA 3ISJA 1E3QA 2A9FA 2NUAA 1WXIA 1T9GR 2C3YA 4L9AA 4KQMA 1GTZA 2ZM6B 3FBGA 2OO5A 2REOA 5DHRA 4D9FA 3D7KA 4O0LA 1QQTA 3OLQA 3K9NA 1IBCA 4K9LA 5AW4A 1C3EA 2I9PA 3E22B 5JD4A 2ZUDA 1B6SA 1SCJA 3H65A 3MPOA 3V2UA 5MGNA 2L18A 1RABA 3C3EA 1B43A 3LBYA 2OQ2A 4RTOA 4FX5A 4EQ6B 2CHQA 3UAXA 1W49A 2P0AA 2QW0X 3EXHB 5A05A 2V03A 4QOEA 2FPRA 4LC1A 3OJ0A 4DEYA 5DOVA 2W42A 1UBHS 1O94D 2FSGA 3GEEA 2YBDA 1IZYA 3E8XA 3HI6A 1Z08A 3GPBA 3WBKA 5T7BA 4OHYA 1JIIA 1ISPA 1JZSA 2NG1A 2CEKA 4DDMA 1KEZA 2J3QA 4AVYA 5LL6P 3VJRA 5B1YA 1LGYA 2O1WA 5AOAA 3MJ4A 3JASA 4I2VA 5G1PA 4KRGA 1CUEA 3HCNA 3AFOA 3V2GA 2HKIA 3T4PA 2W2LD 4LZAA 5CXUA 4DCPA 2WKRA 3BL5A 3SIRA 4XGNA 1CQZA 4TMTA 5JS6A 1J7KA 1TT5B 1R74A 1C4WA 2GDJA 3G2JA 1FFWA 4MCIA 3ZDQA 4BS9A 1E96A 2IKSA 1V26A 1REQB 2NUTA 1IG0A 1BWPA 1EHCA 2FE4A 1J09A 2K87A 3AF2A 3CLUC 3QWHA 4JR0A 2Y1FA 4C3VA 1G6Q1 1U04A 3K0SA 1RYYA 5EIWA 5FBKA 3L7OA 2OFFA 4C7KA 2UXBB 3CEAA 1YVUA 4RK4A 3ZI0A 2PL3A 4BB5A 2HA3A 3MGKA 4W5QA 2JLYA 4ZGGA 4HKTA 2KLHA 3OBIA 4NFYA 1OOEA 2WMYA 2FFBA 3CTPA 1JU9A 5C51B 2CBGA 1B1AA 1Z6ZA 3GZNA 3ZEIA 3PRKE 4GX1A 2R6R1 1P1RA 1WKVA 2J1LA 3WIOA 4PNEA 4JJZA 1U3FA 4OHRA 4KR9A 1U7XA 2QD5A 4DAEA 1UBSB 5TMDA 1S2GA 2IYPA 3SBDA 3AJRA 1LFAA 4PQEA 5EVJA 5FX2A 1XCOA 1ETUA 4RHFA 1X14A 1VA4A 1KYVA 3C3KA 2Z6VA 1CZNA 3DFUA 1U6JA 3H8SA 4QUJA 2C4VA 1IEVA 2F43A 1C1DB 4X93A 1VE3A 4GKJB 2RGAA 4BMYA 2J3KA 1NW6A 4TVKA 1PJ4A 3AY7A 2PBZA 2ZSBA 2VJYA 3TVTA 3TXYA 1Y3FE 2SECE 4FGSA 3E2IA 1L4NA 1M0TA 3M49A 1WXQA 3FHLA 2LPMA 2G67A 3LDGA 2I1QA 3UT0A 1S1CA 3Q2IA 2AJDA 2B20A 4BBZA 1UJ5A 5BRAA 1VL8A 2AOTB 4LY6A 1GNLA 1JNYA 3LWBA 3TAXA 2HHCA 1IATA 2ATCA 2R4UA 2RGXA 1U8AA 4DV0B 1A97A 2OB2A 5GZ3A 2YWHA 4ZDWA 4OX9B 3IXLA 3KJZA 4ISBA 3EGEA 4EMTA 1P2UA 3B9PA 3LXMA 4QEKA 4KTTE 2CL0X 4QT0A 4QPZA 3T5CA 1GFIA 3W8FA 2B69A 2R5FA 3EWSA 1HL7A 2HHLA 1YDHA 4JLAA 4LFBB 4G01B 2VF7A 5ICCA 2IFTA 1T6NA 3MUEA 4RTPA 5BMVB 5E0OA 5AYVA 2OD7A 2C8VA 3BXEA 5IN5A 4L4UA 3WC4A 4DG8A 2PMKA 2PVPA 1P8AA 4AI6A 2AJ8A 3AM4A 1TPZA 2FW7A 1R0LA 4ER0A 4F6LA 4M1TA 4TWAA 4RTLA 3RFXA 4GNRA 1OXVA 1CY0A 3L04A 4DRXB 2BFBA 1X7ZB 2QG6A 4A23A 5DSXA 4WESB 3EGXB 2PMEA 1V16B 5BY2A 1E7RA 1JPUA 2DUWA 4PR3A 3TSCA 4N5DA 3RRYA 4A0RA 2O2JA 3OU2A 3BGVA 4V0RA 1ID8A 1JHAA 4WOBA 1DI0A 5JCZA 1IY8A 1I4TD 5C5DA 3P7MA 2WU4A 1S2OA 1VLVA 2R6ZA 2JRLA 2Q4DA 3BTUA 4GG1A 3WLSA 2I65A 4YLYA 3FJ1A 1Q1GA 4Z99A 4QC2A 2IYNA 4L1KA 1BOOA 1R8JA 1J0XO 3M34A 2JCSA 5TEVA 4E3ZA 1DJLA 4MHOA 3BIXA 1ZUD1 4M6WB 1M1UA 2SKCA 2N1MA 3PVZA 5CYFA 3BBPA 5HG0A 4OQQA 4PBSA 1YR7A 2O57A 3ITEA 3NWOA 4GYWA 3TRJA 4CFYA 2ID8A 2NYAA 4Q02A 3CZCA 3C43A 3HR4A 3KB2A 4QG7A 5T5QA 3WMEA 4MUXA 4I1YA 3NBUA 4FYJA 2WYHA 3P20A 2B4YA 5F2KA 1EVLA 2DFVA 3OMXA 4CIWA 2FJPA 3D5EA 5IPFA 3K9FC 1TQ8A 1XTTA 1RFLA 3NLLA 4G5SA 3HDQA 5C1PA 4I9FA 4KKXB 2JJ2D 4G2NA 4F2HA 4D8WA 4RTRA 4D26A 4KGDA 3KQOA 4HN4B 1DC5A 2V8BA 2HO5A 4H7DA 4WE3A 1HYEA 4J7XA 2NNLD 4NBSA 3REQA 3RKUA 4MI1A 1H23A 4OHVA 1XP8A 1KK3A 4AWXA 3Q7IA 4CN8A 2BTEA 2QBYB 1U3VA 3A6GA 3VR3A 1YU6A 2BHSA 2JEZA 1DG9A 1P7CA 2W4QA 4DBVO 2WG1A 3U40A 3L8FA 5B1IA 2VC2B 3DWIA 4J16A 3NHJA 4NPHA 1W87A 3IKMB 1PNRA 2EEZA 1Y33E 3AF3A 4L2IB 3R41A 2QYOA 1TECE 2JFFA 5DNAA 1DT5A 3SJCA 4BNIA 1F9EA 1Y6RA 4ZO7A 3ZX5A 1ANKA 2ISCA 3UWKA 3J80A 2XH8A 3LUAA 2HH9A 2VT3A 1A7UA 4IHQA 4OAPA 1BGVA 4HAUA 1JPJA 4FEGA 4K81B 2FR0A 5BSKA 3H5IA 4I99A 2JGKA 3A4IA 3PQEA 4FLFA 2IT1A 4UDXX 1YS2X 4R1UA 5HF5A 3A14A 1D3AA 1MW9X 1V8FA 2A35A 2W0SA 1KU0A 5IBRA 5LP6C 1HM5A 3WNBA 4IJ5A 4WJLA 2JAQA 2PR2A 4OVKA 1M8GA 1EE9A 1SHUX 2HZ7A 3FHJA 3PNKA 2P6OA 5CURA 4G81A 4YO8A 5BR1A 2FQQA 1A2OA 3B5JA 3DFKA 1YJBA 3UN1A 2FFAA 3D1VA 1XJ0A 2HPVA 3WQRA 4EGQA 4ZYXA 3GVCA 2E1RA 4B6SA 3ZH9B 2D74A 2HPAA 3RU9A 1E4YA 1XCMA 3LUCA 4RL6A 1IC6A 1TO1E 2X9LA 4AYXA 4TLAA 4Z3KA 1A27A 1POXA 1A5SB 1RHMA 1Y7TA 5BNIA 3MJRA 5KNCH 4CIVA 3DW1X 1IBKB 2ZS9A 1IL0A 2R00A 2B37A 2CMGA 2RHLA 1PFKA 4ASUD 5C5EA 3B1ZA 2ZGVA 4RKEA 4AJOA 1BIFA 3ICCA 4JSTA 2R7MA 4BC1A 3R7LA 3I5XA 1OB2A 3ESRA 1QORA 2D62A 4MR7A 2O2ZA 5EINA 5BNFA 4OPMA 3P4XA 3G5AA 4FFSA 2EHJA 3T54A 4JL5A 3WE7A 4PRZA 6PFKA 1UUFA 1C9NA 2VDRB 2ZXEA 4QXQA 2Z4SA 5A7GA 2COEA 2GTIA 4PSCA 4TWZA 5CDYA 3ESBA 1R12A 2D54A 1PL0A 1DIRA 1BX3A 4YJHA 4A9AA 1GPJA 3O5AA 5B1HA 2NZ8A 3U26A 4TYNA 4N49A 1DIGA 2Q6TA 1FFXB 2R7NA 3U37A 5A4IS 5AKXA 4B75A 3HK2A 3PQ3A 2FW8A 2WWWA 4HAXA 2Z2KA 2FLWA 5ES3A 3V7UA 5H4GA 3JALB 4AMYA 2DPYA 5E3HA 4RANA 4UUAA 4DHWA 2QVZX 4NZYA 4RLHA 3M1IA 3I1YA 3QGMA 3OP4A 2K5UA 3RC1A 1SKYE 1VIDA 2IWRA 3KV1A 2Y76A 2OHJA 3WWDA 3K6SA 2CL5A 5LNK1 1C7JA 4U1RA 1XRMA 4HADA 3MGAA 2DH5A 4QFCA 5BSUA 2BBSA 1AX9A 2VNAA 4R1TA 5E9JA 4M9UA 1PEDA 5KTTA 3N2GA 5JSQA 1Z6QA 2EAUA 2XOEA 2G36A 1YU9A 1L4UA 2IU6A 3AX6A 3FLEA 3NOXA 1MGOA 4S0XA 1V1MB 3ZVLA 1H4SA 2WFZA 1YZHA 4OL0A 4NOKA 4RH3A 3L6BA 3IULA 4OGKA 2VCYA 3FB4A 5EERA 1P18A 2HDOA 3EG5A 3CKYA 3COYA 4RE6A 1NV9A 1N2CE 2BV3A 3OBBA 4RHYA 4EA8A 3HM2A 3ZV3A 4K5QA 4TKMA 4ALLA 4IJWA 5B7PA 1NN3A 3F4BA 5IS2A 4OLAA 3GFTA 4Q7LA 1ZVMA 1OR8A 3I01A 1YQEA 2GEDA 3FTQA 4ZU1X 1Q1NA 2E6UX 3BFKA 3D4BA 5C35A 3LI2A 5KOYA 3DAYA 3L6EA 1TDJA 5FPQA 5CD1A 3N2LA 4QHTA 2GAAA 3FSGD 1YBAA 4LHZA 1PGNA 3A6EA 1DEAA 3LGAA 2J30A 4PX3A 2Y0DA 4WLOA 5KU7A 3STXA 1NJ1A 2QY6A 3EGVA 3KCQA 4GSYA 5FNVB 5AVRA 4U39A 5ITSA 5KYXB 2ZRHA 2OL4A 1SUPA 4WXYB 3TPFA 4H9GA 3INYA 3TWOA 5JRJA 4HPJB 3UBTA 1DAMA 1TMGE 2NTYC 2G6TA 3ASUA 3LPMA 3VU9B 4UTPA 1A5BB 1B73A 3K5IA 4K9KA 2HD4A 2V3VA 5F2OA 5I7FA 1DAGA 2FUKA 4YAJA 1ZVKA 4YGXB 3D7MA 3VR2D 4E4YA 3KXDA 1DHTA 3PHIA 3UKOA 1DC6A 2LE0A 1RCFA 5C81A 4CTJA 2PFKA 4Q4JB 1XQ6A 2VKQA 3IQGX 3ZJTA 1IN6A 1E3WB 1M5UA 3KTOA 3F6CA 4EG7A 2OM6A 4BXOA 1A4UA 4R9NA 1CF2O 2H6EA 3RFCA 7ADHA 4CNBA 3E7PA 4AZSA 2O8CA 2GARA 3VSEA 2QRKA 1M6HA 1T9AA 3AHIA 3VH4A 3C8UA 1R6AA 3FUXA 2WG0A 4FQ7A 4G3XA 4YJ3F 3G0CA 4MUBA 4F0JA 5IKMA 4RBNA 5J4YA 4PRKA 5I9IA 4MYUA 3L7NA 3V4VB 1RXCA 5IEJA 4WT7A 4GI3A 5ALDA 1RS0A 4OHXA 1H2XA 2WKPA 2D5IA 1WZCA 3IDZA 2PXHA 5C3UA 5K6AC 1ZGAA 3ZZTA 2PU5A 3K8YA 3A1UA 1TCBA 3RKRA 3PYLA 4M3NA 1KAEA 2Z9BA 1VG1A 1DUVG 3IAXA 3HFGA 5A7FA 4GI2A 3UAWA 1G18A 5T8KC 3RSCA 2NUPB 2EZTA 1SBIA 1NF2A 2GN8A 3D64A 1KMHB 4W1SA 2OQRA 1W8IA 4GVXA 1DXYA 3LBIA 4TV9A 3W5BA 3S5JA 1G8JA 3B89A 5CFMA 3PDIB 2B99A 4RHCA 3FYCA 4D4HA 4RC9A 4OQPA 4QM7A 4PFJA 2R4TA 1QVWA 1WTCA 2FN8A 2LD4A 3MJHA 3AU8A 3OICA 3NIDB 3ZDZB 3B6IA 1ZHOA 4HX9A 3KV3O 4HGRA 3MHPA 3X1KA 4AMUA 1TZBA 4J9VA 3BAFA 3F4LA 3RVJA 4UD2A 4NZ9A 2PTGA 3GEBA 4FSDA 1M2GA 1HE5A 2RB5A 4C0AC 2P0YA 3BF7A 4D57A 3THXA 3IESA 3RIYA 3FSEA 1K86A 3ZCQA 2XMQA 3N0VA 3A27A 3QXCA 4ES6A 2HWWA 4RF3A 5HFJA 3TVDA 1A88A 2D7JA 4QYXA 5FI3A 2KBFA 4HNGA 5G0WA 1UPTA 4YXFA 2PUAA 1DL5A 1UANA 2HW8A 2CUTA 3X2SA 4BMCA 3GMIA 3C3MA 4J07A 2JIPA 4WLUA 3WADA 3ZYZA 3C14C 3OIFA 1YA6A 2CJWB 1KYTA 3R4CA 4PONA 2XV1A 3STTA 3FDIA 4ZU6X 1T1IA 4MWBA 1M83A 1HT0A 3LVRE 1QRTA 2FEXA 2I2AA 4L5CA 1Z0KA 2A3RA 4XQCA 1G64A 1V5GA 5I3CA 1RBYA 5CLJA 1WDTA 4JYBA 4PLGA 4OQLA 5JH7A 2VS1A 4HFMA 4PW0A 4HYEA 1CUUA 4M88A 1QYWA 5CVJA 2EFDB 3T5AA 4WK4B 1NVTA 4LKRA 4K3UA 1OZFA 3HCEA 1TEXA 3DEIA 3WYDA 3DE5X 1J1ZA 1LKZA 1G5HA 1UDWA 4Q3EA 1C9DB 1NUSA 3FUTA 2EZUA 3HSSA 2L82A 4PIMA 4BYMA 2O0KA 5EXXA 3WYEA 3DVLA 2VK1A 3HACA 3OZXA 4FR5A 4RXMA 4BECA 4GC5A 1N77A 5AW0A 4TQGA 1K7XB 2QRVB 1FK8A 2PHZA 1WVIA 4IM7A 1RE0A 3GF4A 3K4QA 4GD3Q 4OBEA 4M0EA 4I5EA 4MDYA 4UMFA 3OCWA 3M33A 2ZITA 4BMSA 1FJGB 1KDOA 1RYZA 3LLUA 5FEUA 1ZJ4A 4B2YA 2OXTA 2Y6UA 1ZIPA 1QDEA 4DWOA 2GRUA 4B8ZA 3ENNA 2VTBA 1CJMA 2VDLB 3T3OA 1WPXA 2OPBA 2WPNA 1G4AE 1LS6A 1S2IA 3IOBA 1PX2A 4BLSA 4BNDB 2OHXA 1Q0QA 5IABA 1VB3A 3N2ZB 3TRFA 1CHNA 4HUJA 3ZWXA 1C8BA 1OI7A 3FTNA 3OF5A 3PC2A 4X54A 3SYLA 3AGPA 4NJMB 5ALGA 2GXQA 3ZWYA 2Q4OA 1CDZA 3FPGA 4HDCA 2CCKA 3DKVA 4FS8A 2J5BA 3WXMA 5JZMA 4LC0A 5IH7A 1CDOA 3GFRA 3WWPA 4BCCA 1U98A 3DEAA 1F8FA 3OIVA 2MIIA 4GSKA 3VDXA 4X41A 1JHRA 2WTEA 3H7IA 3GAMA 4US1R 2F8LA 2GBLC 1RKVA 2I2WA 4BGIA 3N87A 4C6TA 1O3YA 1DQRA 4YH1A 4CM3A 4AYWA 2C29D 1J1UA 2OBBA 3T3MB 4BEVA 4QHSA 1I3CA 4ZMSA 2YOGA 3I8OA 3R3HA 3CR8A 5EE5B 3HCCA 2AOVA 5FO1A 3W79A 2O54A 4XFKA 3W4JA 4UU1A 4CF3A 4O1MA 5TPWB 4RDXA 1V41E 2HJGA 3MCAA 3QMMA 4M1EA 1YOVB 3DMNA 3FNFA 5PNTA 3F4KA 1LRJA 1OWNA 4RELA 2CWDA 3SG0A 3AM1A 4WZZA 4Q7MB 3AUJB 5LP1A 1Q77A 3H2ZA 3BS4A 3MHTA 4JVLA 4OJTA 1JIVA 2X58A 3GFOA 4BO4A 5HIKA 2ONCA 3FWPA 3P71T 1NW3A 5CB0A 2OGZA 4X60A 1U0LA 5EZ5A 4LCJA 4NDNE 4W6ZA 1GR0A 3L8MA 3GDFA 4TLEA 5FH9A 2C7RA 4WEOA 3RYCB 1EFAA 3DFZA 2CV1A 1R1DA 3D6AA 4LQLA 2RJOA 2MSKA 4XFDA 1C50A 4IIDA 3VH2A 1W59A 1X7YB 2FCRA 2GCNA 2Q1WA 3MAAC 2VQEB 2DRIA 3RHZA 4L3VA 2RARA 2UYYA 2ZE7A 3GW8A 1TEVA 1J49A 2XI4A 3ESXA 5T6MA 4XDZA 4D3XA 3SOZA 3BZBA 1OI4A 4CR7A 2H54A 3L8HA 2ZBDA 3KDSE 2IIQA 5HKOA 2GYWA 1BX0A 2HXSA 4IOLA 5IT9A 1KYIA 2XGSA 2PLFA 2IW1A 2YZKA 1ZJJA 4EF6A 4EJSA 4ESHA 2VATA 2C00A 4MUFA 4JYAB 1SKQA 1NDUA 4DTCA 4TQ9A 4HT3B 1OX4A 3CLVA 4LQ4A 3K9GA 4RLFA 1H2AS 4AJIA 4Y9UA 5AQEA 2C03A 2QJWA 3GUVA 3O4GA 4KGXA 4RCYA 2RD2A 4JODA 1XEXB 1CUBA 2XHEA 5H59A 3E1GA 2F4NA 5KHAA 3ET4A 1JKXA 2HIMA 2QJFA 3U19A 2PKCA 5E3IA 5A03A 1JHDA 1R6DA 1W1IA 2X3UA 4L50A 4TYYA 4N40A 5J23A 1RRMA 2KPOA 3EOZA 3GGJA 3KZCA 1B0AA 2YFYA 1BFDA 5DNVA 1UP7A 3NHAA 3AUXA 3GJSA 2UYHA 2WTAA 3EISA 5J3JA 1WLSA 3RKSA 6NULA 3BX1A 1Q0LA 5JWRA 2B8TA 2P8JA 3L18A 4HNAA 1RXSA 4WZBB 5KNBH 1T8TA 1G17A 1YXMA 1X1BA 2WLTA 2QAJA 1NZDA 3KXIA 3P0EA 2WMDA 4G4GA 1JR2A 2G5PA 5HIAA 3FFTA 2PUHA 1CQXA 1Z6AA 3FR8A 4MS3A 4NJEA 3ADCA 1QJCA 1UBTS 2JFHA 2VHYA 5KEIA 2YUTA 1C9KA 1ZXBA 4O6VA 5DM1A 2FW9A 3NALA 4BVHA 4TTTS 5JV5A 2D0DA 2GPSA 4QBIA 4GP6A 3UV7A 3PQ4A 1BH2A 3BDVA 4N03A 4DIDA 2TS1A 4BO8A 1TA9A 2P9JA 3UV3A 1WKCA 2O8EA 4ND8A 1NZJA 1HNZB 1ZAKA 1GNVA 4QPCA 4JK3A 4ZCQA 1U0SY 2XEXA 4I5DA 5DW3A 2O3UA 5A3QA 4H17A 2RGWA 3A7DA 3FKJA 1EJ2A 3QPAA 4H7HA 4O4LA 2W43A 1SVSA 3A4YA 1TEZA 1E2MA 5HWSA 1BHJA 3JQFC 3NC0C 1T8YA 5FR1A 4KE6A 4W9MC 5B3KA 5L7YA 3WGQA 3CT6A 4DE5A 2FPKA 1YULA 2Y05A 2RHBA 1T5BA 4NVRA 1NAIA 4QUKA 2XQGA 1GPAA 1ZW6A 1DX9A 3DFMA 4X3OA 1SU4A 1TZ2A 5KWSA 3RS7A 1K1EA 1P33A 1A76A 2PTHA 1IN7A 1N9GB 3W8EA 3ND5A 4IVRA 3RH0A 1IPEA 2JASA 5HS6A 4S1NA 2JIQA 3C3XA 2BFNA 2WTNA 4M0UA 4MWDA 3U7QA 1C1HA 1FP4B 2G3YA 4DMRA 5E6SA 2OVFA 2MOKA 4YIHA 5JECA 1EXDA 2G9VA 3GL9A 1EA5A 4AUKA 1YNSA 3SZUA 4DARA 4Y0NA 4QYWA 1AXEA 1RACA 2C5EA 4HRAA 4UAUA 5AOCA 3HYRA 3LOUA 4TYPA 1Z38A 5K8LA 4GZ5A 5AXAA 2NPIA 1YRQA 5EQJB 2ENUA 2XUJA 2Q5IA 3Q7QA 1ODCA 2V97A 1J20A 3U1TA 1OXSC 5KC9A 2O52A 2G1JA 2WJYA 4E13A 1U2TA 3H99A 3IUPA 1P73A 1DFGA 1VKZA 1VMEA 2ZRCA 4PHGA 3SIXA 2EV9A 3TTWA 1GCAA 1K8XB 3DZHA 1QIJA 1P9LA 5D5QA 4ZVLA 3DTVA 3KB6A 2C92A 3H5VA 1GTG1 5JISA 1XCGB 3AJDA 3C8MA 2A59A 3HVJA 3ZHZA 1O4WA 2M32A 2W6ID 4K9DA 2Q9UA 3ZKWB 4NU8X 2C7BA 3C4VA 3D7NA 5C8YB 5C1DA 3GFSA 2MYPA 4HSGA 2OAEA 1Q21A 4M1SA 4JQSA 4GPBA 4G36A 2VRNA 1C9YA 4G1MB 5HDBB 4JJ4A 1IRXA 1UDBA 4KAJA 1YS7A 1XB2A 4X90A 4DKXA 3SHTA 3FLMA 1ISRA 2WFMA 3BJEA 3IAEA 3VISA 5KC8A 1UJCA 4A1FA 7REQB 1N6LA 3GRKA 4BIIA 1LW6E 3H1BA 4BV2A 4EY8A 2UZ4A 1ULZA 4QLAA 3IBFA 4GRAA 1U3DA 2Q27A 3HYLA 3ZEAA 4IMJB 1JEEA 1FX0B 1E0AA 2DG2A 2QNBA 2DERA 1OCEA 2CWWA 1UBUS 3PPIA 4OFWA 1Y1SA 1WUYA 1QQBA 3FF4A 2CE2X 2OHGA 3G89A 4HWTA 1AZTA 4U7GA 2JAWA 4C76A 3BXPA 4BCBA 2QVLA 2OK7A 1X7HA 4DR2B 3R3WA 4DMGA 3KQTA 4RPJA 1AGYA 5JC1A 1EFRA 4ZYUA 2BW0A 3DBHB 4MGKR 1HNNA 2Y27A 4KXFB 4AMGA 1GQOA 4YRTA 2QRMA 3E8MA 4XQEA 4BP9A 3VHQA 3R5HA 2R65A 1J2UA 4AJHA 1IY2A 2PM8A 3KVRA 5JAOA 1RKXA 3FCOA 4TVOA 3TGWA 1QS0B 1PO7A 3U4CA 4V24A 2BFCA 1XVLA 1THMA 4BE9A 2C96A 1FL9A 6GPBA 4QOGA 1C1XB 3V1LA 1QO0D 2IU0A 3D6MA 5KI6A 2O6LA 4XPZA 2VTVA 4LYJA 1J7JA 4HNQA 4RPLA 5HOEA 4OQZA 2P3QA 3C8HA 5AOVA 3WKCA 5L6MB 4B6EA 2CCGA 2ZCJA 3KB1A 1QZZA 3KL2A 1V1RB 4NBUA 1G2PA 2ZSDA 3NONA 1N5OX 3PU6A 1BXGB 4FNMA 4RVSA 5LA6F 4G0YA 4ZHQB 1BMFA 1JAIA 3FTDA 5FUXA 3G85A 5TSDA 3BWDD 5GV8A 4C3ZA 4MIOA 1H65A 3ADPA 2EEPA 4I50A 1VBNA 2HUNA 3QBJA 2CDRA 3JQ9C 2DXIA 4F5EA 3FVQA 2XXAA 3OIDA 1XDDA 1U7DA 3N2KB 4Z0HO 4F84A 4QDOA 2D1QA 3UMSA 1M2HA 3PENA 5THQA 1J5PA 1FYDA 4C88A 4BNTA 1WVMA 2F9MA 3WV5A 4DYHA 4KMOA 1XO1A 2PKYX 1TGVA 1XXLA 5IWAB 5KU1A 5INTA 2PXAA 3B85A 1V4VA 3CZMA 3TOSA 1CZKA 2VHWA 1XSEA 4GW3A 2B83A 1OYWA 3AP2A 3PQCA 1ICEA 5CBKA 2GERA 2DT8A 2ZI5A 4RVGA 2ZJ6A 821PA 2OILA 1PJ3A 2F4VB 3GLFA 5CH3A 1AB5A 1H6CA 2XQIA 4NPAA 4EBFA 1NYTA 1WL8A 1JW9B 4NBLA 4FEEA 2QQ0A 4NNJA 2Y66A 1KDVA 3W8DA 3PVCA 4DUGD 3EQ6A 5HBGA 3JARB 1X8JA 3EPHA 5J2TA 4HB2A 3GROA 4HQFA 1KI9A 1MVNA 3RJ9A 2PQ2A 3W04A 2H7CA 3GPCA 3OUZA 3OHSX 3LTNC 3ILHA 3KJGA 2H1FA 2GO1A 5B30A 4KXWA 4M1KA 4MKFA 1MO4A 4PAWA 3EMDA 3AW9A 3CPSA 5HRCA 5HZKA 2AFHE 5AW7A 5C52B 1E1DA 3K0HA 1DRJA 4WBNA 3NKFA 4KN5A 4X84A 3WXBA 4YWHA 4PPNA 3RU3A 1G98A 3TNFA 1G1AA 3VSBA 1Y5MA 4CR8A 4NAUA 2RHJA 1MA3A 2Q41A 2GWHA 5T64A 3MINB 3QWFA 3SXJA 4B76A 5I47A 1HQKA 2FSFA 4IR7A 5K01A 3WL4A 2ZRLA 4M7PA 1FRNA 3H18A 4MIYA 2GZHA 3M0EA 2QZ4A 4R8RA 3SX2A 4E51A 4P7FA 2RJNA 2UZ3A 1XAJA 4BU0A 3O2QB 3BWMA 5AI8A 1K7SN 2V1XA 3C7TA 1ADGA 4TLCA 2VJKA 2K7FA 1EE1A 1IEXA 4GKBA 1Z0AA 4HN2A 2JHGA 2ADMA 1GQSA 3G82C 3M5PA 2H1CA 4G9BA 3STYA 2R1TB 3RU2A 1WCIA 1ORIA 3VDRA 4WUTA 6Q21A 2L2QA 4JGGA 5EZYF 2WJWA 4Y2YA 4KLZA 1O96B 4R3UC 3ZD9A 4EP1A 2VAVA 1SEPA 1UEXC 3DCYA 4IDHA 1I4WA 1L3BA 3UHAA 4N9QA 5BOSB 3LCCA 4EELA 3THWA 3GN2A 5A9SA 2FQXA 3KIPA 4Z7OB 2GVDC 2I6GA 2IUFA 4FR2A 3UWSA 1G0OA 3EYWA 4Z7NB 4N9WA 3FR7A 3KCNA 2EQAA 2GD1O 3D3EA 4GEKA 3TZHA 4ARZB 2PA0A 2O59A 1PDWA 1ZD1A 2VYNA 3LY8A 3OX2A 3N28A 1QF6A 4RA9B 1KVTA 1OV4A 3D3JA 4F38A 5FB3A 2QV7A 3B3FA 1KJYA 3ZQ6A 1BVUA 2VXBA 2XNSA 2V4ZA 2F1HA 2HZBA 1QCDA 2PGIA 4NJOA 3JV7A 5HQ3A 1DKUA 2GHQA 4OUDA 4G1CA 4GVPA 2Y2UA 1OZ0A 1H85A 2OMEA 4M36A 2Z2YA 1SVMA 2FSSA 3ZHQA 4EDFA 1SD1A 3GFFA 2EF0A 2J67A 2V96A 3IELA 2ODTX 2XR1A 4LISA 5CH5A 3VYSB 4CODB 4DADA 3CEJA 4X63A 3WZ2A 2GFQA 2QGNA 1Q95A 5H0IA 3TLKA 3QNUA 4H7FA 1OTYA 2QB5A 4TWJA 3CMCO 4D5GA 2FMXA 1CE8B 3WGGA 3IB3A 2GJ8A 2E18A 4TN5A 1EFTA 1NU6A 3ZWOA 4PYNA 1PT6A 2VBIA 4ZQGA 3QE3A 3E23A 4G56A 3S2EA 3UJCA 2H1LA 4TT8A 1SNYA 1N9ZA 3NS7A 4OHOA 3VNSA 5JQGA 1HOXA 3EZ7A 1OLSA 4ZRDA 1RQNA 5PGMA 5EFZA 1M5RA 5F7JA 2ZUSA 3V32A 4X1KB 3BWYA 4A0QA 2WA2A 2WI8A 2H31A 2L0XA 2FZCA 1CJTC 1I9GA 3CEPB 3L0DA 3N2IA 3OE7D 3ORQA 3P9ZA 4O5OA 4EFKA 3KAKA 4AECA 5FT9A 3HSKA 3PYXA 4LRUA 4EWLA 2FEMA 2IX9A 2I2FA 3AGQA 1WQ3A 4WLFA 3SKYA 1S02A 4NH4A 5G1OA 3HKCB 4XLLA 2XCUA 2IVFA 2MINA 2HXGA 1M1YB 3HU3A 4F1JA 5BQ3A 2I3DA 4DWWA 1M72A 2ZXFA 2JIOA 2WINI 1ZMOA 1NYLA 2VBGA 3JWJA 1GGHA 1OA1A 1S8OA 3IP1A 4JLVA 4Z3OA 3LY5A 2HJVA 4GRDA 4TMFA 2C78A 3H11B 4F1KA 3AESB 4OGLA 1UFKA 1TUEA 2QYTA 4JBXA 2AN5A 3AHGA 3VBCA 2PUTA 1Z16A 1CY8A 4BNMA 2C84A 2CFCA 5TARA 1PUXA 3B1WA 3CLTD 2AEMA 1DCKA 5AM1A 1NJFA 5A3VA 4CCYB 1P9OA 2PG3A 3VNAA 4ADSG 2DOKA 4CLRB 4JX9A 3LQYA 4QVIA 2I87A 5FI1B 4YNBA 3IDQA 2B21A 3D6HA 2VQSA 1KARA 1QPZA 3VTZA 2YJ4A 4JI3B 3VHRA 2WPDA 3B5IA 2SICE 1D04A 3C7CB 4EM6A 3NVMB 4YIKA 3RARA 3OIGA 1ZHFA 4RS4A 4XI9A 2EJUA 4I46A 1WLYA 1USWA 3U3XA 3O4IA 3UXHA 3FN4A 1XAGA 3IAS6 1OD6A 3C5VA 1Z7WA 3IPXA 4QPNA 4TT3A 5CVCA 5EZSA 5ERGB 4I3HA 2IH5A 1U5BA 1E8DA 2VBFA 3ICOA 4NENA 3RRFA 1TB4A 4GKKB 4Q5IA 4U7DA 3GAFA 4WRRA 4CFSA 1M1XB 1NMZA 1N7IA 4TLDA 2X4DA 5D3KA 1RQGA 1ZH2A 2XGGA 5LBIA 1KE1A 3QMPA 3YASA 3BMOA 2E5LB 2E4WA 1W8DA 3FWKA 2DHDA 2BKEA 4RA6B 3LE8A 4LF5B 4OB6A 4HX2A 3K9BA 3R0ZA 1WQ1R 2D1RA 2IZ5A 5IM4F 2A78A 4TX1A 4C5CA 4IH4A 3NEAA 2BL4A 2O8NA 2YHIB 2W6NA 2XWJI 4TKUB 3UJPA 1MJGA 4CW7A 4LXHA 2ORYA 1L5YA 2AG5A 2ATEA 2O48X 2X5XA 4NMLA 2B30A 3NASA 7GPBA 3OQNA 2QRJA 2W70A 4ENTA 4W7SA 3CQ9A 1LSOA 2C9MA 3S2ZA 1RFGE 3H19A 1U7PA 1MLDA 3NV7A 2IUTA 3EVGA 3HKDA 3RHFA 5L3QA 4QELA 5A5GA 4LZLA 4AXXA 3V4FA 3U44B 1CR6A 3EOAI 1UKAA 3R6WA 3WIEA 3HJFA 4LRYA 8OHMA 5KOHB 2BUBA 3K1TA 2B4KA 1OFHA 3FG9A 4DCTA 4NOJA 5IDYA 2PNJA 2WY2D 3Q0TA 2QM7A 5E6RA 3T9AA 2WU1A 3O73A 2E4YA 1JRLA 2HLNA 4ZVOA 3S1LA 4Q1EA 4EA6A 1S96A 3DD5A 4MGYR 5CLHA 3P0IA 3RJ5A 1KO1A 3HP4A 4PYLA 2IEIA 1M7BA 3N8GA 3EE6A 2B7LA 2Q99A 3Q41A 4QO7A 5B7QA 2HJWA 3CUYA 2QRLA 3F67A 1DOAA 2JGLA 3PGVA 5TT1A 5DNCA 2A84A 3R8FA 4G24A 4RCVA 4P36A 2PMCA 4M87A 1QFJA 3IPAA 1U8TA 4GX2A 2P7HA 4H77A 1KI4A 4O4JB 1HDGO 5EMJA 1F5NA 4MXDA 5HZHA 5F7ZA 2FRXA 4PGFA 3PITA 2W98A 4JN6B 2BUAA 2R4QA 1O4VA 2OV2A 4HGYA 4Y2GA 1PS8A 1XRSB 4WCDA 4L4YA 3SJ7A 4MVJM 5K2OA 3FWZA 1ZZEA 3IHKA 3RV3A 1PP4A 4G37A 3FHCB 1Y3CE 3R1IA 1OWLA 2JZNA 3K2BA 4I14A 2ZB2A 4KQCA 4D74A 2H07A 4G26A 1WY7A 4CT0A 2C31A 2R6FA 3DE3X 3C74A 3F3MA 3OY2A 1NI5A 2X7JA 1MC5A 1DEKA 2EFHB 3BWBA 4YUWA 1OFUA 3THSA 1ZJYA 1E7WA 2XMCA 1C3XA 1N75A 1T35A 2CYCA 5F4BA 3VU8A 2GSWA 2Y0BA 4JU9A 1VLMA 4Q7KA 1AHHA 3AO0B 5TQ2B 2P4QA 3LY7A 3OT1A 2QV0A 1E9AA 1SURA 1YNOA 4C0XA 3LP5A 4LGVA 3D31A 3EW9A 4BPBA 1QK4A 3C1UA 3K7EA 3KT3A 2EGUA 4X91A 1Y3DE 2KX7A 1TZJA 4PQYA 1TXGA 5CNKA 4I8DA 3LCJA 4I3GA 5EA2A 2QGFA 5ECGC 2EBWA 2R84A 2REBA 1I7NA 3PTZA 4D0LB 2R25B 2OCAA 3JAWA 2SBTA 3LWNA 4OHFA 2CFTA 2WJ3A 1MP0A 4E15A 5I5EA 3AZOA 2QQGA 4MRMA 2YW9A 3T15A 3REGA 4Y98A 4IXNA 5KNCA 2Z2JA 5I7RA 1VG0B 3ZGLA 4D1YA 3WP1B 4X6LA 3VVLA 3U4QA 1VL2A 1J0CA 3I12A 3PE4A 3DDSA 3GFQA 2K4MA 1Z18A 4K8OA 1QYCA 2BF7A 2YJGA 4GX5A 4A1OA 2V7TA 3ZHVA 4CMIA 2W2QA 1ECJA 1FTSA 4L15A 4OF4A 3QPUA 4LRSB 4O59O 2NU9A 5KOIA 4LOHA 1LPPA 3QLTA 4WEQA 3PWSA 3RSQA 3AV0B 1LDMA 3ZTYA 1MFPA 3Q10A 3O0TA 4KWHA 3CLSC 2J5QA 1LTKA 2ZIXB 4EENA 5LXTF 2PFSA 2WHQA 2R8OA 3HCFA 3PKZA 4O2BA 3RIXA 5LZ8A 4BZXA 1CF4A 3T61A 3ML1A 4L4XA 2AOXA 2J5KA 5LJIA 1JPVA 2FZ4A 2WVAA 4OI1A 1NP7A 3V7YA 9MHTA 1T8SA 4N5MA 3D7RA 4RY9A 3KVOA 1AV7A 3Q7SA 1VL0A 4O2AF 3U39A 3V8EA 1KOJA 2F2TA 2XNHA 3GVIA 3W5IA 3COPA 1F9AA 4P8RA 2CDCA 4MPJA 1GL7A 3RUAA 3TOXA 2BSAA 3ITNA 4HQ6A 4P33A 3KJQA 5EXEA 3VR6H 1BMQA 4KIJA 1QH8A 4CDGA 1F8XA 1Z2EA 1GXSA 4MPRA 2XKAA 1CUAA 2Q4TA 3G8YA 3U61B 1ACLA 1CUZA 3Q3EA 3CZQA 4D56A 3ZWQA 1LU9A 4NNPA 1E4OA 5K3EA 4HDSA 1EJ0A 2HF2A 3VX3A 4TLBA 1IEQA 4ZRNA 2PEZA 5KAMA 4C5AA 2WU8A 2XBMA 1H0SA 2HK7A 1EE2A 4CKBB 5BWNA 4HX5A 2QN6A 3E4DA 3QLJA 4P3YA 3LVQE 3GRRA 4OXKA 3T7KA 2D5CA 3BF8A 3QLVC 1VC2A 4YV0A 4KSYA 5HR5A 5M34A 2WJGA 2CD9A 4B31A 1HV8A 4E21A 4XYMA 4IMIB 3OM8A 2W71A 1I4LD 1TD1A 2HBZA 1ENPA 2HLPA 2QUJA 1K4YA 3MW8A 3ZUPA 1KJZA 1E99A 1I32A 4F91B 4DWVA 2V5AA 1GP2A 2VKTA 4JQYA 4B3HA 4CQMA 3BGIA 2H52A 3CCCA 4V1CB 1NLUA 1LD3A 4BLTA 3EQ8A 3W2GA 1VJ0A 2BF4A 2MWMA 3A3KA 5AKHA 3WRYC 1F17A 4F3YA 5F1OA 3ZZUA 2WZCA 1C0LA 3FGOA 1QAMA 4H3SA 1ULSA 2AEJA 3GCZA 1HTWA 2NXCA 4WECA 5HGJA 4ZEWA 1JR3A 2ZIZA 4WZAA 3WL3A 1ZN2A 5D5HA 1PR5A 2IF2A 4FDMA 2P9QA 3GBPA 4HLUC 4KWTA 5AUPB 2D2FA 3MOGA 3VR4H 3IPRA 3IP6A 2X3YA 4URXR 2MR5A 3IIEA 2M1XA 3I9JA 3KXLA 4JUFA 3MF4A 4N01A 4UM5A 5EMLA 5CA1F 5JFTA 1C9MA 1E1CB 2PKQO 5A5FA 1GA4A 3OM0A 3DOHA 4L08A 4QPJC 5BV8A 2B3TA 4LF7B 2I3AA 4XTCS 2JFOA 1OT5A 4E6EA 1I7LA 3AIKA 4M76B 1ZMBA 3MLBA 2DAPA 3QELB 2VEDA 1GKKA 4WV3A 4QO8A 4EY6A 3UAOA 1W6RA 3ONVA 3TKLA 1Z4QA 4AZ3A 3BMQB 1OT3A 2OG1A 1SOMA 5AW5A 1J24A 3ZHBA 4ZTUB 4WCVA 1UXGA 4MUGA 3ROFA 2GKGA 3LUKA 2OAGA 1DBRA 1UAYA 2PWZA 2VXCA 3OH8A 1F7VA 4DXDA 3NHLA 3KEQA 3FTFA 1SUIA 1NPDA 1Z2CA 1PFWA 3GNQA 4XGIA 4OXRA 2C9DA 1W47A 3RUFA 4AJLA 1OTHA 3MWEB 2BGMA 4GBMA 4UUMA 4ZJUA 1QZ3A 3BEOA 4EHAA 1EPUA 5EPUA 2F1KA 1ZN8A 1EK5A 1XU7A 4QTZA 3H2BA 5ICFA 1EQAA 3AL0C 4JFAA 2CLMB 2J59A 2ZYHA 3KOWA 4FZJA 1G0NA 1JQ3A 3DG9A 3ABSB 2BFDB 4MZDA 4WWHA 4FGUA 2OSVA 4IDCA 1U94A 3AUFA 4HBZA 4DL9A 4G5QA 5GONA 1Q7BA 5IJXA 2OFOA 1JQLB 3HSYA 3JQBA 4QTUB 3LHSA 4Z9BA 4A6XA 2XB2A 4G5RA 3CRVA 1Q1BA 3RYTC 3RR2A 3LKVA 5KWIA 4MW2A 2P62A 4R2IA 2DMRA 3D8BA 5EXDA 1SOWA 1TUIA 4JP1A 4XIJA 3QOYA 4FCWA 4E2YA 1NLMA 4HDNB 4ZPXA 4BTVA 3QE0A 2GZDA 2HDHA 3PDUA 4PCUA 3ZWKA 3KOYA 1UK8A 2IXEA 1NATA 2R11A 3C3JA 2M6LA 3T7RA 4M53A 1OPXA 1N33B 2DLNA 3FMPB 5AJVB 4U2GA 4MPDA 4ZTBA 5CPFA 1QHYA 1ESEA 2QX6A 2HU5A 4YX9A 4NAHA 1OZHA 1U7WA 3VVMA 3GC6A 2VRCD 3K9HA 4ZYZA 2C3MA 4RLQA 1J5EB 3O7WA 2BM9A 4MROA 2NZ2A 1ZXXA 4XVRA 2O5VA 5AOBA 1NN0A 2JZCA 3SR4A 3HFSA 4C4TA 3HKEB 1TNDA 1X8KA 3LHIA 4PWYA 3TNDA 2ZS8A 3KK0A 4NI5A 1J2RA 2P2NA 3VQTA 4TUYB 3VR2A 1RDFA 3V8PA 2GJ9A 2OO5C 3ZDYB 4M7OA 2H57A 4PZ9A 3CWCA 4CTKA 1XTUA 1ZG3A 2XQVA 2W22A 4GF5A 3LH5A 3E9CA 4L16A 4MICA 4BV3A 3RK0A 5DBIA 2I91A 3AFGA 4RSRA 1JBEA 3GZ4A 1IWBB 4RV5A 4B1FA 4FM9A 1NVFA 1KAOA 3DXZA 4MV9A 2JIMA 1A9OA 4QREA 1C7EA 3N07A 4W1RA 4OLHA 2PT9A 3H2IA 4QUAA 2NWQA 5BWOA 4MINA 4Q9KA 4ERXA 4ZA2A 4ENQA 1XZMA 1J6UA 3KBOA 3IO3A 2EKQA 1AKYA 4KIUA 5F1PA 2PSHA 5B2ZA 4HLDA 5EZQA 2P3LA 4MYHA 4RQAA 3NJ8A 3WWCA 1QGAA 1R0BA 3TNLA 5JXIA 1JFRA 2H2DA 2MSDB 2NUBA 1ODTC 3DE0X 4P32A 1U8FO 3H2GA 4Q3DA 2FX5A 2QSUA 3ZCRA 4DY6A 3KE9A 2P40A 1ISHA 2C07A 4Q93A 1AHNA 1Z7EA 3AILA 3G9XA 4RZIA 2QRGA 2QMHA 2WW8A 4QTXA 1WEHA 1XVTA 5CVDA 2QPOA 5IT4A 2B61A 4FCCA 1JDBB 4LF6B 3ZU5A 4LDZA 3IT3A 1E6EA 1UJMA 4BDSA 1HZZA 1KAGA 3BRCA 1ABFA 1D4FA 2AR7A 3BRWA 4JNCA 3C1OA 1MTOA 1F6BA 1JHXA 4QOFA 3OJOA 2IIBA 5CIYA 1ULAA 5FA8A 1F3LA 1NVMB 3BD8A 4GWLA 4OSPA 4N3NA 3ZNQA 4DLZA 1E77A 1GNPA 5JY6A 3NAGA 4NV3A 3ZY6A 1L7RA 3AEYA 3B3JA 3MSXA 2FF7A 1JJAA 2QPTA 5CPBA 5ERYA 3DLHA 3O92A 3GYGA 1L0BA 1DC3A 2B3DA 1ISGA 1R4NA 1W85A 2RK6A 3BQNB 1NVVQ 3KQSA 4GSLA 2P90A 5C1BA 5AVTA 3HJCA 3RYFB 5IHPA 1MJ5A 2NX2A 3B78A 2IQ5A 2ONKA 4UKDA 4EL0A 1XI2A 1H1TA 3B1FA 2JGJA 4U3JB 3OOJA 3TG2A 2PSDA 3G9UA 3IQZA 3U09A 3JZFA 4CMEC 1U3CA 2Y67A 5G53C 5I8PA 3S2IA 1V8PA 3QBTA 3ZGOA 2YY5A 5BT9A 3WLPA 3C15C 1JDNA 3KOUA 5AI0A 4NCKA 2QTRA 1PT7A 1Z4MA 2LCFA 3DDHA 3E3LA 4ZRMA 1FVHA 1PYDA 4FOLA 3CG0A 4Z4EA 5DMHA 2H92A 2IZ0A 2YXEA 4ZN6A 4Z1OA 4EVSA 3T5TA 1G3MA 1ZK1A 4OQMA 1JAZA 4HLNA 1YFKA 4IFEA 3K94A 3SNHA 5A5EA 2D13A 4XDYA 5EJFA 2X6QA 2BLLA 1DRUA 4CQMD 1S2DA 3B1XA 2TMKA 4B4DA 1G291 1PGQA 2B4RO 1J90A 1NIPA 2I7TA 2Y1XA 2YWXA 2RI6A 3H42B 4UHFA 2KMLA 4FFRA 1D5CA 5BW6B 3KSAC 2NQ8A 5SYNA 1R9MA 3NBAA 3Q5EA 4NYIQ 2AC2A 3GUYA 4W5OA 3CLRC 1AKQA 1SXQA 5LOVA 5FBZA 3IKTA 3R3SA 1RR6A 1JH9A 2Q1YA 1ZRNA 3KZVA 4ZJPA 1T4MA 3WKAA 2MR6A 3IC5A 1NX9A 3GJRA 3OQJA 4R1MA 3PQDA 1D0SA 4WA7A 3KWMA 2Y6VA 1QG4A 3GWGA 3MQ4A 2DR0A 2C77A 5COQA 3VOSA 2FPMA 1Y3IA 2J3MA 1E0JA 1EG2A 4M8IA 1VP3A 3STWA 1L7AA 5JO0A 1UBEA 2W8ZA 3ECCA 3R20A 3RD5A 4D3SA 2O8BA 5ITVA 2A5LA 1W52X 2DR2A 1NVKA 2OGTA 3F6PA 4HXEB 2X9QA 4N7BA 1GGNA 4JROA 3GD7A 4WXEA 1XD2A 2A33A 4KLNA 2AMYA 4IMPA 3ZC3A 5DRYA 4EG6A 5FBVB 3L4JA 1LQTA 4B6PA 4ON9A 1XMQB 4HDOB 2P7IA 3ETLA 2GT1A 4M37A 5EMNA 5JC8A 1K0FA 1Z6YA 3QKIA 3VHXB 4UJ3A 1WIWA 4KRXA 1F2VA 1PHPA 2J09A 1DJOA 2RHGB 3FKQA 4UUNA 1YDWA 5EMMA 3V33A 4C1NA 3JPWA 2YKGA 3DAFA 4N8SA 5GP1A 2FPPB 3PNMA 3E7WA 1SRRA 2VHJA 4GBED 4YN3A 5M5BA 1ECGA 3W5JA 1B23P 4E4TA 3O31A 2JI6A 3S7ZA 2RGYA 4MUAA 3SDSA 3GGGA 1YFLA 1ODJA 1Q2UA 4B34A 5AKZA 3FTEA 3UY4A 2WJPA 2EYUA 3WGMA 1FQJA 1JR4A 1B0ZA 1P4GA 2ZVJA 3GV0A 4DS3A 4Y2SA 3TZQA 1NSYA 3ZLBA 3LUFA 2CB9A 3DONA 3ELDA 1J8FA 4F5DA 3HB7A 1XZFA 5P8WA 4MA0A 1AZWA 2C2HA 1VDZA 2IYQA 4FX2A 5KNBA 3VR0A 4JSYA 4KEAA 2GAIA 4RETA 1Q11A 4UHDA 4LOLA 1NVEA 2HV9A 2ZOSA 1ZLXA 3HEBA 1ULHA 1SBNE 4J16C 3HUEA 3VPAA 2W6MA 221PA 5KSPA 4WFKA 2I4IA 3QV1A 4ALNA 4B8YA 5GWXA 3WFIA 5KB3A 5CTAA 2EF1A 4TWIA 2IXGA 4PC2A 1WPRA 4P4TA 4U8HA 2C5FA 2DY1A 4OG2A 1SVUA 4REMA 3P97A 3WGJA 5FQNA 1Q7EA 3DBRB 3SP1A 1L6RA 1PL6A 1IY0A 3KD2A 1GKYA 2AV6A 2ZSIA 2DWPA 4C78A 1KZHA 4MUYA 1EDZA 2UVPA 3SF8A 2W2NA 3WHIA 1R0XA 1ZBQA 3N70A 3CX6A 4ND4A 2ONJA 1CJSA 4F86A 1Z75A 4K88A 4Q4CA 5G0UA 4RIIA 4B85A 2XQKA 1AGRA 1VYTA 2ZTSA 2C2OA 4QNNA 1WNFA 1JFFB 3NIFB 4Q6BA 5TMPA 2G28A 5AKKA 1QQ6A 4IYRA 1YCGA 3FW1A 3GT0A 4FOOA 4BO9A 1Z47A 2CYAA 2FSHA 4DDHA 5JCJD 4IQ4A 5JXWA 2G9QA 3E27A 1II8A 1G9XA 5JS2A 5GJWC 5ICMA 1UPAA 2BR3A 1Z8FA 1IOLA 2I3BA 3SY8A 1VZ3A 1H8HA 3D0RA 2R00C 4MWCA 4TSRA 4CV0A 4LXQA 1ECBA 3CWQA 1P19A 2G76A 3UK2A 3WGHA 4DXHA 1L1RA 2YC2C 2HBQA 4ZAGA 4RZ2A 3MOIA 4FGWA 2Z5FA 4MMXB 4YMSA 3A2NA 1DWPA 2XRMA 1FDWA 5CNIA 4M0PA 1HXHA 2ETXA 1DDOA 2LKCA 1O8BA 2E4AA 2EJWA 1MO3A 2PBRA 2QTAA 1E66A 2XRZA 1CLEA 2D2VA 4KW7A 2OHOA 2ZPUA 4QICA 5F21A 5B1SA 3W5VA 1X1TA 2GESA 1ZUNA 3CUVA 1J0EA 1KO8A 4F9GA 1VG9B 5CJ2A 1KFKB 3O4RA 5HK8A 4ZYLA 2P2SA 3KSRA 1P77A 2R6GA 1Z73A 2OVBA 5DSTA 3T5MA 3IT1A 1Q1ZA 4RVUA 4YCLA 5BNTA 5L9AA 5L3RA 4DMKA 1DQPA 3PF8A 5AK5A 3HJRA 2O0MA 1R8YA 4RO0A 1JIKA 2EFCB 4LZOA 4RGVA 2XOXA 1KO4A 2BSQA 5TT0A 2N75A 2XHZA 4Q3NA 2PRIA 1VE6A 1NNUA 2OXEA 2ST1A 3ZQJA 5K3FA 4UUOA 5JBIA 4B71A 1N92A 1PK9A 3SS8A 1J5XA 3L46A 2NSJA 4FW8A 1D6JA 1IEWA 4PLFA 1MO5A 1LH0A 2E7ZA 4QG3A 1JMVA 4I55F 5CLLA 3TD2A 1PSZA 2ZR9A 3AEQB 3AFNA 4YDRA 4YP6A 1OLUB 4TTSA 5F4ZA 1L7OA 1EFHA 1U65A 3QW2A 1RLUA 1BS2A 4O4IF 3FHTA 3VZCA 5AIAA 2UZ1A 5CXSA 3T0IA 2QW8A 5AI6A 3O38A 1EVIA 1MPTA 3I04M 3P9KA 3Q1LA 3QF4B 3OM1A 4WOCA 2DEUA 3SC6A 2JB9A 3TL6A 2FAXA 1YA4A 2OK8A 2X2FA 2JGAA 1U2GA 4PNPA 5I4KA 1FJHA 1TYCA 3GLGE 3L7LA 1E1RA 2XF2A 3P8ZA 4NHOA 1C7RA 3K1JA 3W3AD 3V1TC 2NV6A 3CX8A 2VPZA 4MR8B 3ZJ4A 2X4LA 3I6IA 2IYRA 3SR0A 1JHYA 1W6UA 4KQEA 4DRZA 2G1KA 4JFRA 1JQ5A 4LWPA 1QQAA 2QM0A 1GYQA 5AVXA 2JFUA 1S89A 3J81k 4LYDA 4V02A 4LYGA 3K9CA 4KQXA 4C01A 1Y34E 1RP1A 3I2YX 2CKDA 4IHJA 4G97A 1ENOA 1HQCA 4LX0A 4R8KA 3I9FA 3EA4A 4IDBA 2ZDGA 2ZE6A 1X1EA 3RSZA 3IJPA 1N2GA 2V4MA 3M70A 4FD2A 1DKNA 1W88B 3MRTA 2YZMA 3OJLA 3SAJA 4J0JA 2UYOA 1QKJA 1XZKA 1MO2A 2FLVA 3UEOA 3K4PA 3E15A 3UJ8A 2XE6A 4L8WB 4AZ0B 4GOOD 4Z86A 2H0AA 2R7AA 1WZNA 1U81A 5DBFA 4H6VA 1C81A 1NE7A 1AMNA 1UBJS 4G9EA 3CE6A 3KJEA 2KW5A 5K05A 1KJ8A 1W48A 3HH8A 1GRNA 1Z83A 2AL7A 4HRVA 1CEQA 2AR9A 1T0JB 2A86A 4E5YA 5KS2A 1CIJA 1WV0A 3A6JA 3CVVA 1GDTA 3E5MA 2Y9MB 5KYXA 1Y8QA 1Z3IX 2PUVA 2X8JA 3I1JA 1CUCA 1FTWA 3PI7A 3OCJA 4R1LA 5CVEA 3TQFA 3WZMA 3A6KA 1BXRA 2QX7A 4D0GA 3GFPA 2VSXA 3QHAA 5FFMA 3X1DA 4FB5A 5L45A 3BKWA 5C0OE 2DF8A 1J8QA 4PX5A 5GZ6A 4C3OB 4C87A 4D98A 1HF3A 1EHYA 2HADA 3UNXA 1QRRA 3AJ8A 1NDQA 2Q50A 1QGOA 2KS6A 5FTJA 5A3JA 1MJFA 2QVCA 4JOSA 1NQ5A 1PJBA 4KQHA 3P2YA