2VAXA

Crystal structure of deacetylcephalosporin c acetyltransferase (cephalosporin c-soak)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
376
structure length
346
Chain Sequence
b'NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDARPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The Last Step in Cephalosporin C Formation Revealed: Crystal Structures of Deacetylcephalosporin C Acetyltransferase from Acremonium Chrysogenum in Complexes with Reaction Intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 123
structure length 346
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vaxA00
4C87A 1EK2A 4RGYA 4ROTA 5ALUA 4XVCA 2B20A 3AIOA 4Y2VA 3HJUA 2BKLA 1CUAA 2VAXA 4WFKA 5IVIA 3V48A 5I9IA 4U2DA 3AINA 1L7RA 3FYUC 1ORVA 2JGLA 4HAIA 2WG1A 2XUHA 2AJ8A 5ALSA 2XQIA 4HZGA 4MEBA 1O6GA 2PSDA 4GXNA 1QLWA 4MWTA 5AI0A 1ODTC 4UFOA 3R40A 1XQVA 2DQZA 5JARA 4KE6A 1THGA 3HZOA 4U2BA 3R3VA 1WB5A 5HK8A 2FJ0A 3NOXA 4UFPA 1TK3A 3DL4A 1UOOA 5T4EA 4OYYA 5DNVA 2G4LA 1UKBA 5JAHA 3DYIA 4X3CA 3AIMA 4F60A 5AO9A 2D0DA 1IMJA 1JU4A 3C5WP 1P0PA 1CUEA 3G0BA 2RHWA 2PSFA 5CMLA 1UKCA 3PFBA 1DQYA 4UHBA 3F97A 5HQ3A 1W76A 2HA3A 1H2YA 1LBTA 4GHWA 4BYMA 4ZWNA 4G9GA 3T4UA 2V97A 4Q34A 4JH0A 4QEKA 1XKLA 1S8OA 4I3FA 5FOQA 2VF2A 5CTAA 2HFKA 5HFAA 4UHFA 5FDFA 5HF9A 5AICA 2JIDA 5EI5A 4PF1A 1ISPA 1QFMA 4J0CA 2WSLA 4WDRA 1SC9A 5ALOA 1QIFA 1XQYA 2XUDA 4AZ3A 1DX6A 4WCVA 5ALMA 1JJBA 4LYEA 2XMZA 1EDBA 2ZVDA 3PFCA 4KAFA 4WY8A 4UBMA 1XRLA 1ORWA 5CRIA 1BN6A 3HACA 1ZIXA 3ANTA 5FPQA 1EK1A 5IVHA 1LPNA 4Y2TA 4N8EA 5LZ8A 5DYTA 2FX5A 3DQZA 1GKKA 4FDMA 1H2WA 2WTMA 4QZVA 1M33A 2GZSA 1UT6A 3V1NA 4BRSA 1QE3A 1TRHA 3I2JA 1EH5A 4H0CA 3GUUA 5HCUA 4Q3KA 1YB7A 2PSHA 3R3UA 4DNOA 2WHPA 3O9MA 4CG1A 4GBGA 4DNPA 1T4MA 4S0XA 3E4DA 5AK6A 5JADA 5AK5A 3I6ZA 2GYUA 2ONCA 1XZLA 2QMQA 4HXEB 3B3QA 4D9JA 1YA4A 1XZAA 1FFCA 4O08A 3OPMA 3M81A 1DWPA 2ZSHA 2CZQA 4BCBA 3CN9A 2BUBA 1CUHA 3AIKA 4C4ZA 4P9NA 3STTA 2VT7A 3DKRA 2X8BA 1PJAA 2QXUA 1PV1A 1U65A 3YASA 4J0JA 4X6UA 4BAGA 3QMVA 1XROA 1SCKA 1MPXA 4YASA 3MUOA 2HU7A 4Q05A 5AKEA 2O2HA 1BEZA 3BIWA 4G4IA 1G42A 1YS1X 5AP9A 5AOBA 2WUEA 6YASA 3QMMA 3RARA 5AOCA 2D5LA 1FFEA 2BUCA 4DSZA 3D59A 2GBFA 2VJAA 3FYTA 4WFIA 2H7CA 2XMSA 3G8YA 4DM7A 3PE6A 3ZI7A 5E2IA 3FVTA 3WA7A 4W1RA 1BCRA 5HQ3B 4MQLA 1A8QA 1UXOA 5C8ZA 2HA2A 4N5IX 3TEJA 3WKAA 2CUTA 2QZPA 3BIXA 1GQRA 1WCYA 3H19A 5EIHA 1N8SA 1AGYA 3IURA 1USWA 2ZYRA 4H7EA 2XQJA 1H2XA 3RK4A 5AKLA 1LGYA 3WK4A 4BZZA 3EBLA 2Z3ZA 2PL5A 2GYWA 4V2IA 4A5SA 3CCCA 1IUOA 2XT0A 4Y2XA 5A71A 4F5ZA 3G9XA 1CUSA 1QJ4A 3QMWA 4MYDA 3H1BA 2Y1KA 4AXBA 1IUNA 3L1JA 3PDCA 2XQKA 2YH2A 2JEYA 2JGIA 5BV7A 3Q8WA 5DTJA 5EIEA 1F0NA 5BWCA 2XUIA 2HHAA 5FRDA 3I2FA 2J4FA 2ZYIA 4MEAA 5LIPA 4MWSA 4EY7A 2O2IA 1IZ8A 1MT3A 1UZAA 1E3QA 4Q3LA 1QIJA 3AILA 3LIIA 2XLBA 4C4XA 4CIAA 5JALA 3WK6A 5FUMA 3GA7A 1PFQA 4QWWA 1AQLA 2ZSIA 4WJLA 2J4CA 2XE4A 2PU7A 2HA5A 4LXIA 1CQZA 2PX6A 4AZ0A 3WL6A 2WU3A 4ZI5A 2H7XA 5SYNA 5AJHA 2HM7A 2JGMA 3D7RA 4HTAA 3AZQA 3LS2A 1TKRA 2VJCA 3LP5A 5FKJA 2Y2UA 5AM2A 2BJHA 2I78A 1G4HA 5SYMA 2WHPB 4AN1A 2OAEA 5D3ZA 4KR0A 4X90A 4A16A 4K2AA 1VZ2A 1ACLA 3G9UA 4QDZA 3F67A 2OPHA 3WL8A 3DCNA 5A6VA 2OCGA 4M0MA 1XZCA 1CIJA 1A88A 5AM5A 2HA6A 2R8BA 2WIGA 5DYWA 3WZMA 1CR6A 3ESCA 5ALJA 3RKSA 4IHAA 1Q84A 4DMHA 3MUNA 5HZGA 1CVLA 3D2AA 4TVKA 4BVJA 3IIIA 3I2KA 3OG9A 4M0FA 2XI4A 4OU5A 5CT8A 3PICA 3K9BA 1QGED 1TAHA 1XLUA 1ZD3A 5DWDA 4B80A 1K6EA 1W1IA 3BF7A 4OPMA 2G5TA 5AM4A 2R11A 4DTCA 3I6MA 3WWPA 4Y2SA 1DU4A 4I19A 3CXUA 4UUQA 4B85A 5CURA 5CH5A 1D07A 5ALYA 4CCWA 1ETHA 5LKAA 3PUIA 3G0GA 3FCYA 1CRLA 3M82A 3WJ2A 1FFDA 2OCLA 1QO9A 3WK9A 3EIOA 5LLSA 1W4LA 1ZI9A 1XZIA 1VA5A 4JYMA 2JF0A 2OGSA 4WFJA 5BWBA 4IO0A 4U2GA 4X00A 1SCQA 2H1IA 3D2CA 1AMNA 3C5VA 2PUJA 3FOBA 3ZLVA 4EY6A 1GQSA 4G8BA 1CUZA 5FV4A 3SC2A 4BTLA 4DNQA 2OG1A 3Q0TA 3WIBA 3F98A 3WK8A 1LPPA 2G5PA 3DD5A 4DIUA 4IQ4A 2C4HA 5AIBA 1ZICA 3I1IA 1X70A 5AKJA 3FCXA 4FBMA 2JEZA 5EGNA 5ALEA 3WKBA 1J2EA 5AH0A 3HEAA 5A7GA 3KWFA 4ZRDA 3DDUA 2VAVA 3A2MA 2VEOA 4G1FA 1LLFA 5H3HA 3WL5A 4ZV7A 4W63A 3O4IA 4Y2RA 2WG0A 4QE3A 1AC5A 2QOEA 3D5EA 2Z8XA 1BU8A 2XMGA 1KU6A 4U2CA 4PSUA 1K8QA 4EY8A 4PW0A 3UUFA 4GW3A 5ALGA 4RE6A 1ZD2P 5D7BA 2AJDA 4MYSA 3FLEA 5KBYA 4H7HA 1UOPA 2PVSA 1CUUA 4RNCA 3ED1A 5JZBA 4QWMA 2DHDA 5JIBA 4H7FA 5C7YA 2XUFA 1XZKA 4EA6A 3AZPA 4UBIA 4BVLA 1MJ5A 3IA2A 3O4HA 5C8XA 1KEZA 1WB6A 4L3WA 5CW2A 5ALIA 4QLOA 2W22A 4BRZA 4CIBA 4A23A 1EINA 2GBCA 1YR2A 2ZJ6A 4XWGA 1QOZA 1QIGA 2VSQA 2J3DA 2HFJA 3GZJA 1EXWA 4QLAA 2QXTA 3JW8A 5LZ7A 4LXHA 3B5EA 4FTWA 2WHQA 4QDOA 1B6GA 1E8MA 3D2BA 4FLFA 3P2MA 2HU8A 3WQHA 1CEXA 4C4YA 1JI3A 5K3CA 4FHZA 3HC7A 4I4CA 3WIOA 1GXSA 5JATA 2VJDA 3I2HA 1N5MA 5CT4A 3OTQA 4BBZA 1UWCA 1WPRA 2ACKA 3BWXA 2OGZA 1SCIA 3WL7A 2XMCA 1O6FA 2X5XA 4BTVA 2Q0XA 1YSCA 3QYJA 1XZJA 2WHRA 2ZJFA 3BXPA 1MU0A 2H9YA 4LKOA 5T4FA 2ROQA 2BGRA 1CQWA 4KEAA 2WFLA 2Z3WA 4K6HA 5A7HA 2IITA 1R3DA 4X93A 4KAAA 3H2JA 4OD0A 2FUKA 1LPAB 3DKKA 1MNQA 3A6ZA 4OSEA 1YCDA 2O7RA 1C7JA 4NMWA 3VJMA 1EA5A 1OCEA 4X85A 3QH4A 4QDXA 4IH4A 5A62A 1AKNA 4PV7A 3E3AA 2DCMA 1HDEA 1MO2A 1MX1A 3LCRA 2ZYSA 4KE7A 1EVEA 3SWWA 3EF3A 4CCYA 4C89A 2XMRA 1WOMA 5AK3A 1P0MA 3O4GA 1IZ7A 1XZHA 3VKFA 4BE4A 3D0KA 1K5PA 3PF8A 1YASA 3AZOA 4PO3X 4K6KA 3UMJA 1EDDA 1CUIA 1G66A 3WWDA 2C0QA 1XRMA 1NU8A 5YASA 4H7IA 4BZWA 1T2NA 2VQ6A 2BUAA 4BATA 1E89A 3R3ZA 3DOIA 3M83A 5HK9A 3ESAA 4MJ3A 1GZ7A 1ZI6A 4X71A 1ZD4A 2HRQA 1IVYA 4EY5A 4JEIA 5A7FA 3FAKA 4P08A 1EX9A 1N1MA 1WM1A 4G8DA 1E66A 3ZWQA 5CH3A 1QONA 1XQXA 3R0VA 3RLIA 1SOMA 3A70A 5HKAA 3O0DA 4DMKA 3TRDA 1AUOA 5EHXA 1FSSA 4B7ZA 1YAHA 4K6GA 1XQWA 4EZIA 3OC0A 3SK0A 1CUBA 4FWBA 4KJXA 2Y6VA 1XZFA 5LZ4A 1OILA 3TJMA 3PI6A 1H23A 5ALQA 1ODCA 5LZ5A 4BDTA 3EQ8A 3DYVA 1E8DA 1QTRA 5AM0A 3CN7A 3R3YA 1VE6A 3T52A 1H22A 4FLEA 1YA8A 5HKBA 1ZGBA 3A2LA 3U0VA 2JGEA 4W1PA 1CUXA 3W05A 3FSGA 3O95A 3CCBA 2XMQA 4DGQA 1BN7A 3HABA 3NWOA 1MNAA 3WI7A 4Q1VA 2WFLB 1DWQA 3E0XA 3WA6A 2BAGA 4X92A 4NVRA 2GYVA 3H17A 4E14A 1TCAA 2HU5A 4N8SA 4CG3A 5LP1A 1K4YA 3HXKA 3O9VA 5D3KA 4B9AA 5HF5A 3HRHA 4Y7DA 3WK5A 2V96A 3GFFA 2OGTA 2XMBA 3H0CA 3OM8A 1E5TA 2I3DA 3ZV7A 2BCEA 4XJVA 1LBSA 4N5HX 4CCYB 3PUHA 2HL6A 5K3EA 2XUKA 1QIDA 1EDEA 2XMDA 3VISA 2AJBA 4N8DA 2XQFA 5IKXA 4UHDA 4OB8A 3L1IA 4HVTA 4J0DA 4UBKA 3C45A 2ZYHA 3STWA 2PUHA 2PBLA 5AK4A 3WKDA 3ILSA 1J07A 4ZGBA 2EEPA 1GPNA 1VLQA 2OCIA 4Y2UA 1QTIA 2RI6A 3I1YA 3WK7A 4UHCA 1MAHA 1LPOA 4Y2YA 5ALHA 2WILA 1GKLA 4P92A 4DNFA 1ZIYA 4LYDA 4UBOA 2WIDA 2RHTA 4FNMA 2B61A 5EHZA 1UK8A 3IUQA 4AO7A 5ALNA 1EVQA 2GBGA 1X2EA 5AI6A 1DX4A 4UPDA 4GWLA 2H7YA 3R3WA 5T4HA 5HF8A 1QIMA 2XUJA 4BCDA 4F0JA 4TPKA 1ACJA 4B0PA 4ARBA 3FVRA 2JGFA 1BRTA 4IH9A 1HBJA 3WLAA 3BJRA 1WHTA 3KD2A 2WJ6A 1J06A 3QZUA 3GBSA 4UBLA 1AX9A 4CG2A 1WHSA 3IUMA 3UUEA 1ZI8A 1N5RA 3KDAA 3C6ZA 3G0CA 1TIBA 4OB6A 4E15A 1VOTA 2FJPA 5ALZA 1QO7A 1UK6A 4BDSA 4C6HA 3ICWA 4F21A 2WIKA 5AKGA 1C4XA 4QDTA 5KWJA 2AJCA 2RGUA 5ALTA 4L9AA 3H1AA 5K3BA 4J0IA 1FJ2A 4FLMA 3HI4A 5ALVA 4Y2PA 1R9NA 3BDVA 2V9ZA 3RM3A 1BE0A 3D4LA 1XLVA 3I28A 4DMFA 1CUGA 1U4NA 3WWEA 1JMKC 1F8UA 1HQDA 4X95A 1GT6A 5DTIA 4KYVA 5A2GA 1BROA 3WWOA 3ESBA 4YK7A 1VJ5A 2IIVA 4OB7A 2XLCA 4LHEA 2WFMA 2B9VA 3G9ZA 5JZ9A 4WY5A 4UFNA 4AQDA 3MGAA 5JZSA 4FFWA 3C87A 2OQIA 3PF9A 4HXGA 1GPLA 3VJKA 3IUJA 4INZA 3FLAA 5LZ2A 4UBJA 2C0PA 3BL8A 2JGJA 5EHQA 1YS2X 2HA0A 4G9EA 3S2ZA 3V1MA 2UZ0A 1ZGCA 3FLBA 3BJMA 4GECA 5IH7A 2PM8A 1LPMA 1VKHA 4QA9A 3DNMA 1C7IA 5AOAA 4UBNA 2PPLA 2Z8ZA 4B6GA 5DLPA 2CKMA 4J3JA 3ZLTA 4E46A 3B12A 3W06A 3KSRA 4DLNA 2PU5A 4CI9A 1BS9A 1R88A 2QR5A 4LXGA 1DQZA 3NUZA 4IH1A 3FYUA 5AKXA 4G8CA 1DT5A 2Y2VA 2XUOA 5IVDA 4W9RA 1XZDA 1KU0A 1LZKA 2WKWA 3EQ7A 5LZ9A 1U2EA 1NX9A 3E1GA 4RE5A 3U1TA 1Q0ZA 5CT9A 3GROA 3QVMA 1R4ZA 4Q3OA 2OCKA 3BE8A 4UHEA 1XZGA 4AMZA 1GGVA 4BVKA 2WM2A 5I8PA 3JWEA 4GEGA 4BCCA 1XRQA 4ARAA 3BF8A 3I2IA 2HDWA 4B81A 4X94A 2WU4A 2QTBA 4L0CA 5LKRA 2VATA 4Y9SA 3V1LA 1W75A 3ANSA 1J1IA 1WPXA 4FKBA 5D6OA 1R1DA 2DFPA 2WUGA 1X2BA 4H7DA 2CEKA 5FPPA 3DOHA 2HRRA 1VZ3A 3MVEA 1QZ3A 3WYDA 2CMFA 1ZJ5A 2V98A 3FBWA 1AURA 4PSCA 2AJLI 3FWHA 5JAOA 1L7QA 4FMPA 5AI5A 3H2IA 5JD4A 5AKKA 1Y7HA 4JYPA 4H77A 5J3JA 5ALXA 3WKCA 1XRRA 3SX4A 1R50A 2YASA 4FFVA 3WMRA 2RAUA 2QKYA 4EUSA 3C43A 2ES4A 1B41A 1QIHA 3JYHA 2P8SA 4YPVA 2O2GA 3AFIA 5JYCA 1JJIA 3HLKA 4G4JA 3HSSA 5JANA 3K6KA 2OLEA 3STVA 1E8NA 3IDAA 5ALLA 2WQZA 5IVKA 4GLBA 4UHHA 2W6CX 4X97A 1RYYA 1ZD5A 5AKHA 2I3ZA 2WIJA 4OYLA 1TQHA 1WB4A 2DQYA 3F96A 4G4GA 5JD5A 1Z68A 1EHYA 2VT6A 4Y2QA 5AKZA 2QJWA 5AM3A 4XIIA 2DHCA 4BAUA 3W9UA 1CUJA 1HPLA 1IUPA 2Z5GA 2C5FA 4C88A 4U2FA 1ZJ4A 3IB3A 5ESRA 3QITA 4AX4A 5JASA 2XB6A 1G5FA 3A2NA 2HA4A 2GBIA 1ODSA 1LZLA 1GPKA 5EIAA 4XX1A 4FOLA 5AKIA 4BB0A 2J3QA 3H04A 4HRXA 2C5GA 1JMYA 3KOOA 4JUIA 5E4YA 4GDMA 2WJ4A 4BE9A 1A8SA 4KAJA 1VXOA 3STYA 1SFRA 3FYUB 1ZOIA 1DT3A 4B83A 2GZRA 1LNSA 4PSDA 3VXKA 3V9AA 4HXFB 3C6XA 3G0IA 3HYSA 2LIPA 1MN6A 1A7UA 4ITVA 4G5XA 2X76A 4EB0A 5K3DA 2HA7A 2QUBA 4AO6A 3NGMA 5EFZA 1CUYA 1UKAA 4EY4A 2WUDA 4PNZA 5ALDA 4Z49A 2XDWA 4DSAA 4KE9A 3KXPA 3WKEA 2VTVA 2DSNA 1THTA 2K2QB 4FBLA 5FP0A 1QIKA 4NS4A 1RP1A 3W2TA 2IX9A 2WUFA 4KE8A 5CT5A 2NW6A 3VJLA 3DL7A 4Q82A 3H2HA 3F9CA 2WG2A 3M3DA 4H18A 1MTZA 2G63A 4C01A 5K3FA 5KWIA 1VE7A 4B9EA 2EDCA 3TGLA 1DTEA 2QRUA 3I2GA 4NZZA 4PQEA 1A8UA 4YX9A 3DEAA 4HS9A 1YB6A 4ZREA 3H2KA 3STUA 4MXDA 5HFNA 2O7VA 2HIHA 2XUAA 2WFZA 5AIAA 4ZXFA 1TCCA 3IUNA 1CFJA 5AI8A 1BEEA 1CUVA 2XQGA 3C8HA 4B0OA 4AN0A 3GELA 3LIPA 2YXPX 3QBJA 3WJ1A 4BAZA 3C6BA 4BC1A 5HF6A 4OCZA 1CV2A 4E11A 1TCBA 3QM1A 4H7JA 1P0IA 1OXMA 1YAJA 1HL7A 5I7UA 3G0DA 4MQMA 1LPSA 1JFRA 2QM0A 2PSEA 2BGNA 2ORYA 3WYNA 5BOVA 1UK9A 2XUGA 3O4JA 1F0PA 3K2IA 1W6RA 4GI1A 3EQ9A 1XRNA 5EHNA 4CFSA 1Y37A 4QDUA 4ZV9A 1I6WA 3C8DA 2QS9A 3R41A 1CUCA 4ETWA 1QIIA 4K5QA 4M0EA 4WDQA 4H35A 1HKHA 4RPCA 2CJPA 4FNGA 4TGLA 3BDIA 2E3JA 2OAGA 2DR0A 5DNUA 2VJBA 4X6XA 3F8SA 5LYYA 2CBGA 2WIFA 1XZBA 2WTNA 3ICVA 1AZWA 3G7NA 3C70A 3FSGD 1CUFA 3ESDA 1JKMA 2QT9A 1FFBA 2C7BA 2OXEA 3DJYA 4J0GA 1H2ZA 3VVLA 1FFAA 4KRXA 5ALWA 3V1KA 3I6YA 4H7KA 3IVMA 3G9TA 5C81A 3W9BA 5ALFA 2CB9A 5JAUA 1F6WA 4QNNA 2XUPA 1LPBB 4EBBA 1Q83A 3STXA 2QVBA 2ACEA 3FNBA 2Y6UA 1JT2A 1XLWA 3WZLA 5AM1A 1CLEA 4EHBA 3KWJA 3X3HA 4J0KA 1P0QA 5F4ZA 1UOQA 2YYSA 5DJ5A 4JNCA 3OOSA 5K3FB 1UK7A 5K5EA 4W1QA 1Y7IA 4HRYA 2ECFA 1K63A 3IBTA 1DWOA 1CUDA 1MX9A 4AB1A 3DLTA 3QPCA 1DINA 4KACA 3H18A 7YASA 3QPAA 4KRYA 1CUWA 5AI9A 2PKYX 1RWQA 2WLSA 1XKTA 2B4KA 5T4BA 3ZPXA 4P93A 4W1SA 4LIPD 5K3AA 4DYHA 2EDAA 5ALKA 4BP9A 3VDXA 1U8EA 1VA4A 3C6YA 2HADA 3QPDA 1MX5A 2BFNA 2QJRA 5AKYA 1EB8A 1XRPA 5AHXA 5CT6A 4AMYA 3VVMA 1JJFA 4DMCA 3AJAA 3IULA 1VXRA 5FLKA 4OU4A 2JGKA 5DYYA 5ALRA 2WJ3A 5ISMA 1XZMA 5E4JA 2RONA 1NU6A 1MAAA 5ALPA 1Q0RA 4B82A 1EB9A 4U2EA 2XUQA 5JD6A 3LLCA 5DNWA 4J03A 2AXEA 3R3XA 4X91A 1QIEA 5CH8A 2RIPA 2C58A 4B84A 1QFSA 4OUKX 5E4TA 3OURA 3WWCA 1W52X 4BP8A 5JAPA 3DS8A 3G02A 4AO8A 3L1HA 4X7BA 5KREA 2I03A 3S8YA 3H2GA 1BCSA 4J7AA 3N2ZB 3ZLUA 4J0HA 5CBKA 5AI4A 2ZJ7A 1XZEA 1L7AA 5C8VA 2PSJA 1HLGA 2JBWA 1R9MA 4L72A 3W04A 3N0TA 5FXMA 4BC0A 2DHEA 1EI9A 5CXXA 4Y2JA 2QUAA 3D3NA 2OQVA 4X6YA 1CPYA 1XFDA 3AUKA 2VA9A 5CXUA 1UFOA 1JU3A
chains in the Genus database with same CATH superfamily
2ECPA 5JHGB 1LTQA 4BASA 3WRXA 4D9MA 4EHJA 2GWRA 1DDOA 3PTLA 4GVXA 4RGYA 1HZJA 2OCXA 4BGVA 2B20A 5ELLA 4XVCA 1Z2NX 4MVJG 3N2LA 3RIHA 2K2WA 5E0OA 3PEYA 4Y2VA 2GBLA 1ONPA 3HJUA 4BMVA 2CY0A 2BKLA 2G25A 2NO9A 2XKAA 3H5VA 3RSZA 3IIMA 1LKZA 3M89A 5EJ8A 3V48A 4E3WA 1FYXA 4JL8A 4U2DA 3ROKA 2E89A 3AINA 4BJ5A 1Q15A 1ULHA 3BGDA 1L7RA 4KVAA 2QLNA 1ORVA 4O2BF 4HAIA 4JQCA 4YIKA 3BCSA 2PGOA 3IPLA 3KS9A 4NH0A 4X1IA 5ALSA 4LXXA 1W35A 4GU5A 2BY4A 4CLXA 3RROA 4Z7NB 1JFVA 4IJUA 4LGYA 3AEKB 2BEVB 4YV2A 3OQOA 1YFLA 4GXNA 4N82A 4G86A 3SYMA 2Y71A 3UJ3X 2I1WA 4WXHA 5D51S 2PLAA 4KV9A 5AI0A 4TMZA 1TJPB 2WHYA 3HA3A 4FZVA 1XQVA 1T10A 1YQXA 2QY6A 4HX2A 3SMQA 1Q22A 5KHAA 4OSPA 1TDJA 4PWZA 5AHWA 5IT5A 1UQUA 3BXXA 1UWVA 1HMPA 2CCGA 1BQ4A 2EGGA 2JFOA 1GL7A 1PE0A 3ENQA 3EGIA 4KOEC 3IP9A 1F2VA 4D6YA 2WFAA 2QN3A 1ATIA 1TK3A 5KWEA 1F8GA 1NHWA 2Y4NA 1GAXA 3WHKA 3S1SA 4DR7B 1O58A 5T4EA 4OYYA 2CVFA 1N6HA 3OJXA 2V59A 2HMYB 3LGAA 3PPVA 4CI0B 4WXMA 1E7WA 1E92A 1RAHA 1VJCA 2R6JA 3DBOB 4QOEA 4WPGA 1W34A 3L4BC 3O38A 1TFUA 3VR2D 1G5QA 2BTOA 3F71A 4KZKA 1IXYA 3BIFA 5DOZA 5IXYA 1MB3A 4CMKA 1JR3D 5KTKA 4E12A 1DKPA 4F60A 3UHOA 3OKCA 4KV7A 5I45A 5CLIA 5IZ4A 1QQBA 3JQBC 2PRSA 1RPAA 5KTTA 1IMJA 4LOKA 4OH7A 4PLPA 4FMCF 1QHXA 1H6CA 2CL5A 2ZSEA 1W9HA 3KG2A 1ZM7A 3NC0C 3A1UA 3TFOA 1A7AA 4K6CA 4N3GA 1XVUA 4MV4A 2ZTUA 1IZYA 1RYZA 1TT5B 2I2WA 2PA3A 2ZRQA 2Y1CA 2BHRA 3WXMA 2HWWA 3R8XA 2JFZA 2IDKA 3IEKA 4XGRA 3RK1A 1MDFA 4UE2A 5HQ3A 1W76A 4CFYA 5KCZA 2BP7B 3AVOA 1U2DC 1DTWA 4OXRA 1V8BA 4MRSA 5LA6B 4DM3A 3UGTA 2O8CA 1H2YA 3QTTA 1HE2A 3FNHA 2P68A 4LECA 3SE7A 5J43A 1NJFA 3NBZC 1H42A 2WT8A 4ZWNA 4R9RA 2DOKA 4O2RA 4BP3A 2YXEA 5IC4A 3T4UA 1YL7A 2V97A 4COKA 2XYVA 1KPIA 1P2GA 1TL7C 2OOKA 4IZHA 4YO8A 1A9XB 4JH0A 4DJEC 4DLWA 3BWVA 1RXWA 3CU5A 1XTQA 1SK8A 5KAMA 1SMKA 4ITRC 5A06A 2P6MA 1YQ9A 2E1RA 2VF2A 4W5WA 5FOQA 1TYCA 2A1TR 1NVGA 5JSKA 3NHWA 3EGOA 2GASA 1ZIDA 5SZIA 2AN4A 2FU5C 3A9WA 4HQLA 2OENG 3B70A 3KPJA 4TN5A 5THKA 2JIDA 3PEFA 4GKBA 2Q7DA 3NBAA 2WWWA 3ZK8A 1MT0A 3RASA 4N76A 4PF1A 3CUUA 1L7MA 1ZVMA 3QBVA 3ZDDA 1XRJA 5ALOA 4BLOA 3FNGA 1QIFA 1SOVA 2XUDA 3EMVA 4NENB 5JDIA 3GJ6A 3DEKA 4J1TC 3PRKE 4KHPB 2Z09A 1JIXA 3SHFA 2HLDD 3U7JA 3VR3A 3ZNQA 3ZYCA 4AUNA 1QRAA 1ZZGA 1KFBB 1TM2A 1TTHA 5DTEA 3UA3A 2X5JO 4ZZ0A 2JH9A 1VHLA 1SOWA 3JQ9C 3PFCA 4HAXA 1ESDA 4WLEA 3D31A 2EZ4A 4RTKA 1QP7A 1YTUA 3UOGA 5CRIA 5I5GA 1VI5A 4AXXA 4CRWB 1BN6A 1NF2A 3C5EA 3Q6NA 3QFRA 2Y3IA 5LJLA 3VVCA 1GDTA 3VZBA 4C0JA 4CNQA 1CQIB 4D57A 2FPPA 3KXKA 4ALJA 3VR5D 3V2HA 1E1CA 4Y2TA 4N8EA 5JJBA 1RJDA 4D3FA 5H3LA 5LZ8A 4S04A 5DYTA 5B7QA 5JAQA 4D3XA 2QV7A 3EEFA 3P9CA 2Z5VA 1FB5A 1VPDA 2O2DA 4HZUA 4IG4A 5IRCD 3HVRA 4EG1A 3EBPA 821PA 3BTUA 4IIYA 1RQXA 5F52A 5JCJD 3KSAC 4RSGA 2WUWE 4IOKA 1JIUA 1R8SA 2Z8YM 1IUKA 3DHWC 4J1SA 1M33A 2UKDA 3QX9A 4IJ6A 1WULS 4IDGA 4RVFA 3CE6A 3LFHA 4ZK2A 1DAEA 3EEIA 1BYUA 3GQBA 4H6PA 4RTRA 2AI3A 3NBQA 4Q03A 4Z9FA 3RE1A 1PJ4A 5SY4A 1X39A 4BFWA 1QE3A 1RT9A 4YO7A 1EH5A 1XNJA 4YRJA 3IAS1 3X1ZA 2JH8A 1PR9A 1W96A 3CY6A 3MBOA 1XQ9A 3N2NA 2H07A 4MQFA 5JXIA 4Q1DA 3MHPA 3AR7A 4JDUA 3R3UA 2HDHA 1MV8A 2OV1A 4O4JA 2AC7A 3ETGA 3RTEA 4B4VA 1WV0A 1ECLA 1UC4B 2EZ8A 2FG6C 3HPRA 3IJRA 3PD7A 5KVCA 2PMDA 3E9YA 3PGMA 3ELBA 4QRIA 1N9ZA 2VZ8A 4CG1A 4GBGA 3UAOA 2QUIA 5A0TA 3W1VA 3B6ZA 1FYEA 3EA0A 1CYDA 1P2DA 2G28A 2OQRA 4DA4A 1I24A 1SU7A 1FU8A 4AT1A 4R69A 3COJA 2R00A 3MB8A 2NM0A 2WJAA 2EKDA 2ZRMA 3PGXA 5E8JA 4EHKA 2PUBA 3DOJA 4EW6A 3ZE9A 1CR1A 3GLVA 5KYUA 3ZDFA 2VO1A 3MJSA 1E2PA 3GT3A 1HLFA 4M1TA 3HO1A 1NXXA 4JBIA 3ZY2A 1OYOA 3PHJA 3B3QA 1F2TA 1UUFA 2JAWA 1XWIA 4FIZA 4DDKA 3KJIA 3PHLA 1RNLA 1UMCA 1Z7BA 4AF7A 2FMFA 3M81A 3EDMA 3N9IA 3CMMA 3N7UA 5FOSA 2X8LA 2DX7A 3INYA 3EIUA 1EXDA 3CN9A 3CRW1 4L75A 3G2OA 4C4ZA 3MLBA 4GI2A 3BAZA 3AP1A 1DIBA 4NY1A 4YC7A 4YMUA 4ZJPA 5DGTA 1JSCA 4L4XA 4M4SA 2X8BA 4YH1A 4FQ5A 5K0ZA 2MR5A 3UB2A 1U65A 1A2QA 2FPGA 4QT4A 1U2RA 3WRYC 1RBZA 1KSJA 1TQ4A 4BRUA 4FXPA 4IDDA 3RNOA 5FFNA 3YASA 1QWOA 4MCHA 4J0JA 1UJCA 1KK3A 1WDMA 2EZTA 4P0TA 4X6UA 1QB7A 5IUNC 1JYSA 3ZTTA 1DAIA 4DCCA 1R6DA 5DM60 2D6FA 3AM1A 1VYHA 4RK4A 1PV2A 1XROA 3BK7A 1MPXA 1JHRA 2I87A 3E84A 4P2GA 3HU2A 5FWYB 4EDHA 4UEQA 3ZE1B 1S96A 2HU7A 3HR4A 5EQJB 2DJIA 4Q05A 5AKEA 1BEZA 3OOHA 1E7RA 1JXOA 1UPCA 5G1PA 5DSXA 2Q7XA 1CCWA 1R5OA 2EKQA 4PTZA 4RELA 2MYNA 4GQAA 5BT8A 1DAPA 1GRCA 2D7JA 1TF2A 2HMAA 3LF1A 3VC1A 4X61A 2GJ4A 3L6UA 5AOBA 4Y8VA 1PJ2A 3QMMA 4F2DA 1ZH0A 1AMUA 1GZUA 1Y3BE 3UWSA 3F2VA 3L7OA 3FYTA 4TKUB 4JNKA 3G8YA 4ZD6A 1KIMA 1Z22A 5FBHA 2EHDA 3FPHA 1WMBA 1IC6A 4RQBA 1FMFA 3H4VA 3NKLA 3OPXA 1C4WA 2MHCA 4LDPA 2QAGC 4BIMA 1SBZA 2J7PD 1I1QB 4FSHA 3A6DA 3C4JA 3FWKA 1UXOA 5J2TA 3KK0A 5C8ZA 4N5IX 4TTQA 3WKAA 1GM5A 1RWXA 4WESB 1NURA 3DTVA 2KS6A 3ROPA 1WDWB 5FTLA 1GQRA 3EVCA 1MZPA 3D1JA 1CHNA 3H19A 3EOBI 3LCMA 5EIHA 3DE0X 2IF2A 1U0TA 3BTSA 4KYIB 2ZSUA 9GPBA 3FCCA 4JBLA 2XNCA 4GKJB 3C6MA 4LVOA 2F67A 5H8WA 1QJCA 1USWA 1GL3A 1GCUA 1UDWA 3BFPA 3CH6A 3UK7A 5L3SA 1XMQB 5AKLA 1FUEA 2ZAOA 4MUFA 4MGZR 1P29A 2BMDA 4E2YA 2B69A 1CNMA 1JPVA 1R0SA 5LYJF 3X2SA 4KQWA 1P19A 1KR2A 2H85A 2L2QA 3RU7A 3EMDA 5AW5A 5IKEA 1WF6A 1V8FA 1ZK4A 3TQOA 1YA6A 2EBWA 1IUOA 3H84A 4X0EA 4Y2XA 1HE8B 1DCKA 1ZVVA 1T8UA 3AR4A 3KBBA 1CY4A 2EAUA 1ACMA 3G9XA 3PYLA 4FC6A 4O25A 1CUSA 2I6QA 2YY6A 1PNOA 4JJ6A 5JWOA 3QMWA 1LF0A 3GZNB 2LGJA 3H1BA 3AKCA 1KERA 4WN9A 5HG0A 3QE9Y 1J22A 1DKNA 1G38A 4EPXA 4FEEA 2NVWA 4O8ZA 2AMYA 1F8XA 2ISCA 4TWRA 2Y1KA 1YJ5A 2GPSA 3ZCXA 2ZP1A 1E1MA 3PDCA 3R77A 3SHQA 1X94A 1RKVA 3CVOA 1UJNA 2WUVA 4HWGA 4R1TA 5IFKA 5ITZB 2XQKA 4LXUA 1C9JA 4I6GA 3IOEA 4YONB 5KTPA 2JGIA 3TOCA 5BV7A 1W36D 5UKDA 1TQ8A 2WZQA 3Q8WA 4NCJA 4M0CA 2JDID 3L8ZA 2JJ2D 2Y1WA 1F1JA 2IODA 1T8RA 2ODWA 1E4OA 2KE5A 3I0MA 3ID6C 4FUQA 1AA6A 1UKEA 3I2FA 4KR3A 1ECCA 1UKZA 2RHOA 4S24A 4AP6A 4KDRA 1A50B 4Q7JB 1EGHA 1XAJA 2DPGA 2EJCA 4JT8A 4RMJA 3FTQA 4TKVA 4YRIA 4X3PA 4EMSA 4X62B 4EY7A 2JC3A 5HGXA 2AMFA 2O2IA 3R24A 1IZ8A 1KWKA 2C8JA 3MT7A 1LLCA 1UZAA 3DFZA 4LJRA 4V24A 4UTPA 3JYQA 1MP0A 3AILA 4WLFA 3UOAB 1K6MA 4CIAA 2POCA 2H0RA 5EHGA 5FO1A 1I7DA 1P77A 4HUJA 3LT1A 2RGAA 2KMLA 4RSHA 4QM6A 5SY6A 1PFQA 1W88A 4QWWA 1WUIS 1E5XA 2O07A 2WA1A 4OI2A 1UBOS 2G71A 2J4CA 2XE4A 3K9CA 2PU7A 4OJKA 3E58A 3ND5A 3OZEA 1CQZA 4LXIA 2PX6A 5LB4A 3B89A 3WL6A 1XZPA 2H7XA 4F06A 5IDYA 2JGMA 3WBBA 2FWAA 3D7RA 5JO0A 2B8TA 1S7GA 3GGOA 3EY9A 4KWTA 3MWJA 3PX2A 4K9OA 1QUEA 5EMNA 1OKKA 2VJCA 5FKJA 1BDJA 2Y2UA 3L02A 4MK4A 4XYLA 4JA2A 1G4HA 2Z4SA 3OTWA 4AN1A 4F45A 1NNEA 3FDZA 2C96A 1BC5A 5BO5A 2JFGA 3IQDB 5I7WA 3BA1A 3P5SA 3DE4X 1N75A 1KO8A 2AFHB 4XCXA 4KKVA 4KR0A 3HA5A 5BSUA 4CQMA 4UUOA 3ZGVA 3AGPA 2JZOA 5KOJB 3H65A 4Q19A 2HHJA 3ZWAA 1TVMA 3G1TA 5EE0A 1ZAKA 1U98A 3TBFA 2QZ4A 3GU3A 4RDIA 1XALA 3K35A 3PCTA 3KXIA 5A6VA 2OCGA 4C4SA 5BV1A 1WV1A 1N1EA 4LKRA 4M0MA 1QVVA 1W2HA 6REQB 3AWIA 1M2FA 2DUNA 2ZRLA 5SZHB 3REGA 3P2OA 5GWXA 3N3BC 4AMVA 2WIGA 2R8BA 3JYOA 4QTTB 5DYWA 3RREA 4W5TA 4K3UA 5JBQA 2J07A 4WNIA 4O4HB 1E0KA 2YJTD 3ELDA 3JWGA 2ZXEA 5ALJA 1WZIA 4OQ4A 3RKSA 1EUCA 1PD1A 4RPJA 3O82A 4UEWA 1V5IA 3DZIA 3MUNA 1MJFA 1A9ZA 3ROTA 7REQB 4B6RA 3AGQA 4DJDC 3U4GA 3D2AA 1GD1O 1UBNA 1I4DD 2A86A 2JIOA 2QNRA 3NVDA 3FDXA 1ZG3A 3R0IA 3VHRA 4BVJA 3HTXA 5A4IS 4M0FA 4QBFA 3GT0A 3DVSX 2XI4A 5CT8A 1L6IA 1JTVA 4F3YA 3P45A 1C8VB 2NAFA 1LTHR 1XLUA 1RXSA 3AVPA 4B80A 3GLIA 2CVPA 3A1WA 1L5HA 1W1IA 4HYTA 4CKWB 5IYZF 3BRWD 4C0BA 3K8OE 2CLOB 5EZYB 3P26A 5AM4A 4F3NA 1BH6A 2PKWA 3O8OA 3EG5A 4QHTA 2VDNB 5EXXA 3I6MA 4CKXA 3WWPA 3NHSA 3ETHA 4I19A 3CXUA 4CL0A 4JI8B 3JWHA 3K73O 2LCFA 1AUXA 3P0JA 1U63A 1PTJA 3FUWA 3UMRA 1NYRA 1A9TA 4JKYA 4M0UA 3WDKA 2NU9B 3MPOA 1R4MA 1DOZA 3R7NA 4KQ2A 3G88A 4M1QA 1KO5A 2FN8A 3EYWA 3OQMA 1CRLA 2I2DA 1JZSA 2FOXA 3AJ9A 3WJ2A 1FFDA 2FPIB 1DAMA 1X3LA 1XMSA 1XXHE 1MEJA 1QQ7A 2UUOA 3C1OA 2AW3A 3MMSA 4KDCA 3V7YA 3ZU6A 3GYGA 1C3JA 5CB6A 4PRYA 4DMMA 3TPFA 2XE8A 2DSTA 1IQ0A 2CLHB 1NDQA 3HYCA 5JS1A 1SA0B 2W2QA 2W70A 4R40A 1IQUA 1VMIA 3WK9A 4L0MA 2BDUA 3AESA 4MI1A 1ISGA 4PZDA 2IS1A 1FMLA 3LWBA 4GOOD 1G5RA 4IXDA 3TLXA 4OP2A 3THOA 1J9GA 2JF0A 2OGSA 3B60A 4PIPA 4WFJA 2NIPA 1SD2A 3A28A 3C7TA 3GUHA 1KJYA 1E2KA 1DE0A 1FZQA 4GKAA 4KOAA 3CJRA 2OA0A 3RUAA 2QW0X 4GR9A 5JCXA 1JQJC 3SR3A 3TUJC 1RPTA 2RKBA 3C5VA 3BH6A 5CCEA 5C1DA 4MHTA 2ZI4A 4G8BA 1IM8A 2IK8A 3CEPB 2Z8YA 4BTLA 2BFFA 3L6RA 4DNQA 2W6QA 2ZUDA 3Q0TA 1WRBA 1JPNA 1R16A 1BXRA 1U02A 4ZRNA 4PO8A 3M4YA 3V33A 3PXEA 2IV7A 2PIDA 1PWZA 2WR8A 2Y1FA 4FT4A 1DPFA 4B2PA 3RFUA 2H4HA 2W6JA 2ZRNA 3BFVA 4OTZA 4DIUA 3UN1A 1V1MB 2QG4A 1P5HA 4H60A 1C0PA 2RCYA 2ZBPA 1R8XA 2VDVE 3TOZA 1ZICA 3OY7A 3DUWA 4R2LA 4Y2GA 2JEZA 1RLIA 5EGNA 4LWOA 1BDHA 2SECE 3T1HB 3GDGA 1J2EA 3IAM6 4HMQA 5AH0A 3BWYA 3M49A 4Q93A 4ZRDA 2PX4A 4BLWA 1ZM3A 3B13B 3G5UA 2JKZA 1X80B 3NANA 1QP0A 2M1ZA 5EIFA 1Y1QA 4ZV7A 1CDDA 9ATCA 4CM4A 1XCMA 4Y2RA 4DFDA 1AC5A 2QOEA 1BU8A 2XMGA 3R3HA 3NTQA 3CRRA 4PSUA 2ISSD 5G0TA 2A1TS 1K8QA 2W9XA 3AHGA 4PW0A 3UUFA 4Q7KA 4KPUA 1GWNA 2ZIXA 4GW3A 4OHCA 1NBOA 3KP1A 1TC2A 1L8AA 2YUTA 2W11A 3ZWBA 4PGGA 1UMDB 3WYBA 4ZZIA 5EQDA 1ZD2P 4MVJH 1GCGA 1I36A 1FXSA 2HQBA 2R7AA 2C2HA 2M6SA 3IIEA 4K87A 3ZGOA 1KZ7B 1AXEA 2AQ8A 1M6VB 3F6BX 3WIVA 1OT5A 2WMYA 2XB4A 2ZRPA 2G77B 3PA8A 4EL5A 5FNVB 1FP1D 3HUEA 3K3PA 5JIBA 1N2GA 4UE3S 4WLNA 1GGMA 4LFAB 3EVFA 3OF5A 5LBTA 5C7YA 1DKUA 2H1CA 2G09A 5L3ZA 4IRUB 4DCNA 5JLJA 4RIFA 1QE0A 1I2DA 3E48A 4OXYA 1RI4A 1I2BA 3AZPA 2M2IA 3JD4A 4JSTA 2ZITA 5F1OA 3JAMA 3TWOA 5DCLA 5HMMA 1QOPB 1J9EA 2BONA 2NT4A 1IK6A 3EMKA 2YV4A 2I9PA 3NXKA 4OHFA 1FTSA 4R2IA 2GK4A 3NT5A 2CFCA 3AJDA 4F1KA 5CW2A 5AJUA 4L8WB 4C08A 5KYWB 3K9WA 3V1TC 1MRZA 3VO9A 2QQGA 4A23A 1FLNA 2OLKA 4RKEA 3TW4A 3CKKA 3LKZA 4LGVA 4LHZA 1G1AA 1HV8A 2R6FA 2IELA 1PIWA 3IALA 2WDZA 4QXMA 1A8PA 2W2NA 1PCXA 4MYRA 4TVSA 5BNFA 2VSQA 5KJCA 5FA5A 1YIOA 1ZN2A 3S29A 1U4OA 4TYYA 1P73A 3CWQA 3TR6A 3HQ4O 3ZBPA 2YCBA 3I01M 4CVNA 4LHYA 5L4SA 4NBTA 4Q21A 3N0WA 4AULA 2PUDA 2O5EA 1JDZA 2QMUA 3GFGA 5A1TA 4BFTA 4P58A 4RPKA 4ZC1A 3B5EA 3H5RA 2WHQA 4FTWA 4DRXA 3AOEA 2QP9X 3IH5A 1B6GA 3B9QA 2GEVA 1X7XB 2CBXA 8AT1A 3NC4A 1US8A 1UEXC 3PUVA 2HU8A 1BJRE 1Z18A 1AGNA 4RL6A 4FI3F 5AESA 2Z1DA 2YJ4A 4YAEA 2ZCVA 5K3CA 4J6FA 4CV0A 4HVCA 1GFIA 1II8B 2NO4A 1QUFA 1QZZA 4C0XA 3KFXA 3A6PC 2ZDGA 4AQYB 4QU0A 3ASYA 4YMVA 3IUYA 1SBIA 1KK1A 3JZMA 1W5FA 1GFSA 4TWBA 1AH2A 1E1RD 2I6GA 1V1RA 3NORA 5KO2A 5CT4A 2ZBQA 3ER9A 3HV0A 4IL5A 4CKCB 3OTQA 5FOXA 1WPRA 3QPVA 3G2JA 3ED5A 1XMXA 2O2JA 4YTEA 3IQGX 1G2QA 5CCBA 4G81A 3HL4A 5IXSA 4IICA 2Q45A 2V9CA 1YCGA 2VNJA 2XMCA 3B2NA 3C98A 3MRSA 3U3DA 4BN5A 3TH5A 3GLHE 2AEFA 3IXQA 1HSOA 3PHBE 4CMCA 3U80A 3RV3A 1SC4A 1YSCA 2G67A 4GZ3A 4HDNA 3E7FA 2R1VA 2VAWA 4YJ2A 2R5WA 3VGJA 3A4MA 1L5QA 1Q1AA 5LB2A 1EM8A 3W7AA 5EA2A 2E9SA 4LKOA 4RULA 3HKDB 4H3VA 4MJLA 5A0FA 5C53B 1O96A 1RMTA 1RWKA 2J3JA 2LP4Y 5CFRA 3B36A 3TBHA 5E6SB 1TEZA 1E3WB 2A5LA 4H6VA 1EZ4A 2BGRA 3SJBA 1VE1A 1CQWA 2WFLA 4M9RA 5F23A 2DE0X 3RYCA 1RKUA 2YV3A 4L85A 4ZI7B 5KNCA 2P2YA 3BJZA 1E3SA 1R3DA 2B7CA 1JJAA 2I4IA 1P44A 2D5IA 4X93A 5DGHA 5JCPA 4KAAA 2ZR7A 1NI4B 1BQEA 3WWYA 1TYDE 3IQEA 4Q9NA 2ZRDA 5AW1A 2IOFK 4GMDA 3U62A 2WSSD 3A6ZA 4OSEA 5EIBD 1DHRA 1QV9A 2IUSA 2W8ZA 3I45A 4KRGA 5FA6A 5DSTA 2O7RA 1B0PA 4DV1B 4GE3A 4HB3A 5T5QA 5LD2B 4NBNA 3ZZ1A 3P4YA 3ZV3A 3TW8A 3GNTA 4OVKA 4JUBA 3GRYA 2AOUA 1JDUA 3OMLA 2P6NA 3JATA 1SQ5A 3DWFA 4X66B 3UK6A 1QCZA 4IH4A 3HGTA 2C9MA 4P4LA 1EVLA 1GPDG 2XTAA 4GC9A 3FHLA 3IOMA 3WB1A 4BQSA 3L92A 2V1UA 4OREX 5P8WA 3H5NA 4R8SA 1MO2A 2VF8A 4FDVA 1Z3CA 2ZUCA 3MWKA 3QVGA 2JD0A 2WHXA 1T4GA 2P2SA 2VHWA 4TZTA 4M60A 3W5AA 4JYAB 5DW0A 4ZCSA 1D09A 3ZU2A 1R2QA 3HCAA 3UT5A 4D5EA 5LQDA 4JUAA 1SVWA 1C30A 2YV5A 4I4LA 3M9WA 2D0OB 4OH1A 5GIPE 3MTGA 4HCJA 4IMIB 1T3LA 2PKEA 4WBXC 1UWKA 3NEYA 3GJTA 3QNMA 4HLUC 1Z45A 2H29A 4RKFA 5E9WA 4DTIA 2XE6A 4F6LA 2XV1A 1NJ1A 2RHMA 4RVCA 3ROZA 2V7TA 1KO7A 2W98A 3F74A 4E4RA 2ZIAA 3A3YA 3JTEA 5FBWB 3UMJA 3UWPA 1EDDA 5KNBA 4AI6A 5DHQA 1SKQA 4RKYA 5B1YA 2ZUBA 3I92A 5CXSA 3B1WA 3PZRA 4NECA 1N57A 5D00A 1M1NB 4CM6A 4OKSA 2EZUA 4RD6A 5HJ7A 2OD7A 3G5MA 1NU8A 4XM2A 4NCNA 1MO5A 3HWRA 3HKBA 3K4PA 1G2IA 3LG2A 2I66A 5CJJA 5EVCA 1KAMA 4G23A 2QTNA 4EJMA 2BUAA 2DWQA 1E89A 3KQSA 4YNBA 4GYKA 3TB4A 5EXTA 1NQVA 3R3ZA 4BECA 4A6XA 1NM5A 1U3TA 5F33A 4RF2A 3WAJA 5ENVA 5HK9A 4IYJA 8OHMA 3NATA 3LQYA 2IEBA 2MMCA 1B76A 4L57A 3OZCA 4C6TB 1KQ3A 3WLRA 4QAQA 3CH5A 3OE1A 4KN9S 2LV8A 3Q4GA 2ONYA 2PVPA 3N5KA 3JXEA 1L7NA 1R6AA 4URXR 3BOSA 3H1TA 5T67A 1NLFA 3KUKA 2FETA 3RYHA 3V8QA 5JBIA 1ZEJA 1ADBA 2IUYA 2VYCA 3QENA 1L9KA 3ONNA 1XDBA 4YJ3F 1E9RA 2I55A 3H05A 1I32A 1O94D 3PS9A 1M34E 1KKUA 5IK2A 2HRQA 1W5SA 4OGWA 2YOGA 4YMSA 3L7CA 5E2AA 5FV7A 3DMFA 1SG6A 2Y0PA 1RWOA 2OL4A 1NBME 3IDOA 4P08A 5KX5F 4U7DA 1OH6A 3H5LA 4BNVA 1ADFA 3AEUA 1U3DA 5FL7D 1RBMA 3ZHXA 4RK6A 2X3UA 2OV4A 3ZWQA 1MRSA 5DX8A 1YRAA 1D2MA 1SBTA 2Y0BA 4MUNA 3GHYA 2PEYA 1WUHS 3OLXA 3ZCQA 5LQRA 3KX2A 3C1TA 3R0VA 3DMPA 2Y1EA 4D6PA 4FB5A 4Q9DA 1SOMA 2DH6A 3IP7A 5JOQA 1N6KA 2VUUA 5HKAA 3O8RA 1OTYA 4PR3A 3UJ9A 2G1JA 2BLNA 1IBKB 2OORA 2GJ8A 5EHXA 5HTOA 2POQX 4M8LA 2G07A 1EEXB 4F9EA 4JD5A 1E3LA 1I2MA 2BMEA 4L5BA 4D8WA 5B55A 5JNVA 5JSFA 4Y0VA 3U4AA 3G6WA 1UC8A 3AERA 4JCOA 5LNK1 3PC8A 3GH3A 4X1IB 5IKOA 4PBSA 2XYGA 1O95C 4GPZA 4JVLA 1OI3A 3A37A 2Q5LA 3ADOA 3H6GA 2BMFA 5LZ4A 3TJMA 2YYAA 3V3TA 5GGYA 3Q7IA 1L7PA 2IH5A 1COWA 1WKCA 2W2LA 4S1NA 3H42B 1U2PA 3G17A 1FUKA 4GX0A 5JAMA 1L6RA 4Q00A 1DOAA 2WABA 2P9ZA 2QYSA 4ZYZA 4L07A 1E8DA 2J9GA 3G59A 5AM0A 3AWDA 1Q16A 4Y1GA 4BLRA 1T9GR 3N0VA 4W7IA 3WMXA 1VE6A 3GEBA 2ANBA 3L18A 4HPXB 4L4UA 2VH2A 5JFTA 1Q19A 2EOAA 1V4BA 2BBWA 4RZ3A 3MG9A 1H22A 4E94A 1Z2CA 2ST1A 1XP8A 4FLEA 1R0ZA 5HHTA 1U8UA 1TTQB 4P83A 5KKAA 1YA8A 5FUYA 4CM9A 2FF5A 5KAPA 2EW1A 3ZU3A 1NSTA 4K2HA 4DWWA 1NP3A 1U9IC 2GN1A 2IYAA 3VZDA 2MINA 2BSXA 1YD7A 2B8EA 4A8JB 1XTVA 1GTSA 1Q3HA 2JGEA 3TEFA 3JAKA 1F48A 1DV1A 1L4NA 3O95A 1H1DA 4KXLA 5BYBA 3TZEA 3VR3D 1ZEMA 3B82A 4ZCPA 1JNYA 3C3EA 5E6UA 5HIIA 2IHUA 1CZKA 3I30X 3OIYA 4GGOA 5EMKA 1PV4A 4ENQA 3D6NB 4PVDA 1C0KA 1YKGA 1UXHA 5CAEA 2XKBA 1VKOA 5GVSA 2Q1UA 1CYEA 2AMVA 4Q1VA 3IODA 1SKMA 3AF4A 4Q9HA 2C3YA 1DWQA 3CUSA 3I9FA 1GCIA 3CUYA 4P7FA 3ACBA 5KTRA 3E8XA 3GCGA 2YWEA 2EGUA 1TJ5A 1QANA 3EG9B 4GPEA 5EINA 1E2UA 4AECA 1EYZA 4EKDA 4F2PA 3FUXA 4K86A 4K03A 2H5JA 4MLPA 4DDVA 1JTFA 1XHFA 4JQYA 1ELOA 4N8SA 4PLYA 1U1EA 2BKAA 4R7TA 3TVTA 3MLAA 2PL1A 5DZSA 5L9AA 2H7VA 1M2HA 3EVAA 3HXKA 5C31A 3RHSA 2O8CB 1HDYA 2ZETA 3HRHA 1KOLA 3CLSC 4Y30A 5I7OA 1YJCA 2A1IA 2Y0DA 4NJEA 1YONA 4IEEA 1Q0HA 1M2KA 3GFFA 1E2LA 2OGTA 4NK5A 1PKXA 2EXXA 1ECGA 1H0SA 2XMBA 4LY9A 5FUWA 1U8AA 3DXYA 4OJYA 1TJ3A 1P4HA 3JZFA 2Y76A 1JTEA 1XI2A 1DQRA 4UOZA 4JX8A 2X15A 4XGKA 1T36A 3ROGA 2FLWA 4J0QA 2J41A 1LBSA 1TJ4A 1WR8A 2ZI3A 3HY4A 5HCIA 4TL6A 5JMOA 1SN7A 1M6YA 2A9KA 4RZUA 1P60A 5C1IA 4DC9A 4DMUB 4FGZA 2W4IA 3PWTA 3PUHA 3LP6A 3EGCA 1DDGA 2CHUA 2Y0EA 4GI5A 2IH2A 2QN1A 2O8BB 4RZ2A 3TJRA 2NLOA 1IPFA 4K46A 3NP9A 1EDEA 2WJIA 1JE1A 4RHUA 2C7GA 2HWYA 3T1OA 3ZKWA 2AJBA 2MSCB 4R1SA 3TNJA 1Z28A 2B2NA 1NNLA 3RVKA 2PFSA 3NTRA 3N6RA 1N3BA 1M83A 5B58T 3CEMA 3LT5A 4ZVPA 3ROEA 4CTJA 4J0DA 4EVRA 5I9MA 4O8CA 4AJ9A 1L3IA 5JXWA 2C1ZA 1NIPA 3RSHA 3G82C 3HP7A 5KNDA 4DR2B 4UMDA 2AQKA 1XMJA 2ZB8A 3IQXA 3FRJA 5ELXA 2P9CA 4YV0A 1GPNA 3A7DA 1RJGA 4HAWA 4LX8A 4EUKA 2OCIA 3I01A 4FYVA 3W6ZA 2NZVG 1ZN9A 1QTIA 5KDLA 2J3LA 3G2LA 3IAS6 1O9BA 3QTBA 3QLTA 1K8XB 1E1CB 1JSZA 3N2KA 3RJ9A 1E9EA 4UMFA 1E2DA 1ZITA 1OAOA 2HBZA 1GDDA 4NV3A 1NBIA 5A4JA 5HUQA 1GUFA 4H4CA 1TC1A 2RHLA 2XQVA 3TTSA 3TL6A 1TTTA 4V0SA 2WILA 3JQRA 2GLUA 1SUSA 2IY7A 2QE7A 4YRRA 2EFGA 1Y5IA 3G2PA 3KT0A 3CC8A 2WIDA 3ECAA 3KVYA 2B61A 4HAUA 4WK4B 1UK8A 4WUTA 5GZ3A 2FFAA 3IUQA 3LWNA 3WSVA 2IU4A 1R12A 2JIRA 4UU7A 4X3OA 4C9BA 1SELA 5JT1A 2WJHA 3HFJA 3VDRA 5BOSB 3UPUA 5MGNA 4UJ3A 4IS2A 2II6A 2XTMA 3MSCA 3V8BA 5HUHA 2V45A 3KE8A 2QZZA 4OJQA 2JIQA 3HJCA 4M1YA 1P80A 5KSOA 3PXGA 2IPMA 2ZUSA 2E21A 2WDPA 4H3KB 3FWNA 4F5YA 4FBGA 2IYTA 3T7RA 4DADA 4NJOA 2NQ2C 4EYOA 1EDZA 4R1NA 5I7FA 3L07A 2WWTA 5JNLA 3IE1A 3D2LA 4EYEA 3OBBA 4BCDA 3ZVRA 3SBXA 4F0JA 4CEHB 1EGVB 2H6EA 3KJFA 1ZWLA 4B0PA 1BJTA 3MWLA 4EFMA 3PWKA 4GPIB 1GAJA 4IP0A 2CT8A 3PFNA 4IIHA 2YW2A 4IH9A 4UTZA 5FI1B 3ZE0B 1RQNA 5ILQA 4Q3BA 4EHLA 4G6ZA 5KOYA 721PA 4BKUA 4WVLA 1HBJA 2WF5A 3BJRA 3WLAA 2ZUUA 4KPEC 4AWXA 4ZEWA 3KD2A 1V43A 4IZIA 2WJ6A 1XX6A 1CVRA 1LWNA 4FSXA 5CW1A 1RC8A 1ULSA 1I7LA 4BVBA 2ECKA 1AX9A 3KTAA 2IZ0A 2JFBA 3OIDA 4I55F 4UNQA 2YS7A 4HJXA 4CG2A 5BMVF 3ISJA 5I47A 1PR0A 2I54A 4QODA 3EXEA 1WXWA 1UMCB 2R7LA 4HBGA 1IBMB 2H3HA 5EKDA 3C3DA 1U8CB 3VNVA 3KDAA 1XMPA 1B3RA 1W0JA 2PY6A 3C6ZA 1GU0A 3W7VA 4AJ1A 3G2HA 5CYOA 4LCJA 4PPGA 4OB6A 1ADGA 1JYEA 4NEHB 3RSFA 2J3EA 3S8EA 3DEHA 2X4DA 4XEUA 4BMYA 3LW8A 1K3UB 3F6YA 4EWLA 3FPCA 2YRXA 5CDFA 4NXNB 1NFFA 4BDSA 1CTQA 3OJLA 3UJNA 1X0XA 3DOOA 5J1SB 3O4VA 4R3NA 2P77A 2WIKA 4QUEA 3B3AA 1YTLA 1U0SY 3S27A 4QDTA 5KWJA 3PGKA 1E69A 3MOIA 2FHSA 1ZLXA 1Y98A 3GMDA 4JQOA 1C3EA 4EYQA 2P6OA 3KWMA 1O54A 1Y8QA 4FLMA 4E3ZA 2JZNA 5ALVA 1XBTA 2Q8NA 5FD8A 4CM3A 3I9KA 3IUBA 5IJWA 1DJLA 1FLAA 2C2KA 3STHA 3KV1A 1L8XA 4FEGA 4BO9A 4PFKA 3BGOS 4IV0A 4GT1A 1H8ED 1PS0A 5J9FA 3T7DA 1W2WB 3D4LA 1DFHA 3DV2A 3QHPA 3A32A 1YQWA 3LECA 4HG2A 1SKYB 2AFVA 2Y27A 1IDN1 4I9HA 3NDPA 4RJJA 3CZPA 2ZJ5A 3ETLA 5FBLB 3MERA 2C4NA 1AT1A 3SIXA 1LJ8A 1VTKA 3KKQA 1SPBS 1YZGA 4CM8B 2BFBB 4YMGA 2WKSA 3SFZA 1F8UA 1HQDA 1XL1A 3BD9A 4UVHA 4X95A 2R2GA 4WT7A 1GT6A 3DZHA 4PYLA 3KOYA 1ORHA 5C0OE 2F9LA 3II6X 1U31A 3L6OO 3AKDA 4W9NA 1HYBA 1TADA 2B1JA 1DC7A 1XD8A 5JYBA 2HJHA 4EFKA 1SC6A 3GUZA 4JUCA 3AG6A 4DVJA 3M6WA 4IHKA 1ZVKA 5C3UA 3QKSB 1UJ2A 2R85A 4JU9A 3QKUA 2ARKA 1Y5MA 3CX4A 3OAAA 3DTVB 1V5FA 3IEPA 2DFTA 2WHEA 4IZOA 3K0BA 3TIIA 3ZVLA 5IDVA 3K0HA 1VJ5A 2IIVA 4AJEA 4DCPA 4NBVA 3F4KA 5BW4A 1OLXB 3E3OA 3D5QA 3S40A 4LHEA 2WFMA 4WBNB 4AKSA 4NH4A 1FDIA 1NW5A 1W46A 5JZ9A 4I81A 3UW3A 3HS3A 1PI3A 2VDPB 3JYLA 4WEQA 3UWKA 4FFWA 2ZR8A 3R0JA 3F0TA 1NQXA 5L3SB 1G0OA 2NGRA 4HXGA 4HZGA 1KYZA 1W48A 3OA0A 3HV2A 4OX9B 2Q1XA 3FLAA 3SQOA 4KQHA 4RV5A 1P9LA 3OZXA 3KPWA 1G8HA 5DIFA 1MQ8B 3P4XA 1U7HA 2JGJA 5I4BA 2P65A 4JX9A 5MF6A 2XIJA 5CTJA 4E5NA 3DLAA 3DBVO 2P9JA 4G9EA 3T1TA 2YFKA 4TS3A 1P45A 3KQWA 2V6JA 5AMXA 3PUKA 2QD2A 2V7XA 4GS5A 2WC1A 3U4DA 3MINA 5IH7A 4IZ6A 4UCFA 2YNMC 4YA6A 4KIUA 2BH9A 3VO8A 4FVTA 1KEKA 4OBWA 2JGDA 3VC7A 3T3OA 5KQMA 3TTYA 1IVSA 3NRJA 4ZI2A 1QGUA 3C5CA 4PFQA 4XIYA 5AOAA 2ZWOA 1QH8A 4QFCA 4PAWA 2YJZA 1PFGA 2PPLA 3E61A 4K8RB 3NAGA 3G5AA 2Q50A 3L0CA 2N0SA 2NOAA 1WMFA 2UZIR 1FA9A 4PTYA 3K1TA 4EGFA 4EG3A 4RJTA 1J7KA 1G21E 3A9VA 4J3JA 3EMBA 4MINA 1GUZA 1GA4A 1XOIA 2WSBA 2B1GA 2PU5A 1P5RA 2CUNA 1U7OA 2QR5A 2ZRJA 3I64A 4ZTBA 2Z30A 1E7YA 4ARVA 3SLRA 1OFUX 5G1NA 2O3QA 4H0FA 1N0IA 4FUTA 4NBSA 5D3MB 4CL8A 1DQZA 4NYIQ 3USCS 1VCNA 5F1PA 3N2IA 4WECA 4JIGA 4DA6A 1H05A 1Z0FA 2WAAA 3U7QA 4A0QA 2XUOA 3OE4A 4ROSA 1DO8A 4W9RA 3IJEB 4I5FA 2G36A 1P1FA 3SSOA 3WFZA 1EZ1A 1KU0A 4R41A 4D9CA 2HK6A 4JODA 4KH0A 4NF2A 2BHSA 1NX9A 1BMFD 4AM8A 3SEAA 4RE5A 1L7DA 4DA0A 3SZLA 1W4ZA 2WWYA 3UMYA 5CT9A 5DT9A 1BHQ1 3OU2A 5COBA 1NF8A 1HFEL 1UBCA 2DRIA 4LQDA 4CN9A 5HBRA 3CINA 4R1LA 1FYVA 3BPSA 3PC7A 3QU2A 4A73A 3GFOA 1U0BB 1GTJ1 2WE8A 8ATCA 1XZGA 3RAJA 2WM2A 2VRWA 4MQ4A 4PZ9A 4RM3A 1L4MA 3TNYA 3KQHA 1PEKE 1VJ1A 3O91A 1G5TA 1TZCA 2IZOA 1A1VA 3H2YA 2AOWA 2EWMA 1IJBA 1RMQA 1TUGA 3BF8A 3FDZB 3GDHA 1E0JA 5ESWA 2PS9A 1I80A 4YXWD 4F38A 5E6RB 4I3HA 1NLMA 1K3TA 1EVIA 1ZFNA 3PQ8A 2ZIFA 5DIZA 1W59A 2GJSA 1TZ2A 3CJQA 2OM6A 1A5AB 4QC2A 3KUDA 2QTHA 1Q0LA 1RIFA 3EW9A 4WTOA 3U16A 3ZU4A 4RADA 3ADDA 4G1BA 1G8PA 1GTL1 4BZXA 1PYDA 3CZAA 3JAWB 3L4BA 3IVAA 4X54A 4J76A 2VQEB 1AQ6A 4PCLA 4XJTA 1OFHA 3GEIA 1AG9A 4IIXA 2P40A 2JKVA 4MP8A 4BEVA 3WADA 1L4KA 2FQYA 4KLNA 5FPPA 2PGIA 3O5AA 4B35A 4C0AC 3TOVA 1I0IA 4JEUA 3QE3A 1QZ3A 1I3NA 3JQBA 1ST3A 2CMFA 4I5DA 3QXCA 4MW0A 3SCZA 1VE3A 1B6SA 1SHUX 1PLLA 4WZAB 4HAOA 2XGJA 4MVJM 1QQTA 4MR9A 3CONA 2C2WA 3RS2A 3ZXUB 5C7OO 4L7VA 2HBYA 5JAOA 4YRDA 2FWJA 4IDPA 5T57A 4HYYA 1Q6YA 3DA8A 3HCBA 1VCIA 3FUCA 2FPOA 5EJFA 4HFRA 2JFQA 3Q87B 2EFHB 3NAZA 1ONOA 1Y1LA 2RKOA 3PDJA 3U1BA 2WPDA 1U2DA 4YWHA 4FE4A 5DP2A 5A4AA 3SMVA 2JIZA 3A1EA 3M3PA 4YRNA 2IW1A 3FNFA 1HT3A 1GPMA 1OBOA 1TM3E 2WSYB 3LYLA 4R01A 5DV9A 2E82A 3A27A 1W5BA 5KCMA 3DBHB 3A9TA 4L5JA 2BEWB 1FK8A 2AXQA 2QGFA 5KSYA 4Z4QA 3P19A 1NE7A 4ZAGA 5EUMA 3B3FA 2A9OA 5B36A 3RRNA 4F5DA 3UUWA 2QKYA 2B34A 2QRZA 2XCOA 4OFWA 2VS1A 4WXYB 3VV3A 1T9GS 3C43A 4K9LA 1DBIA 2NU8A 4E1VA 3TF5A 1B41A 1QIHA 2VJMB 2VYVD 1CY1A 3Q6IA 1V37A 5CIQA 3PRHA 3RUPA 4YPVA 2I9KA 2BKVA 3RUFA 1RAEA 1NAIA 3AFIA 3K7EA 4B74A 5IJ9A 1U6KA 1D7AA 3K9FC 3M1IA 4POAA 3SJ7A 3UO8B 1N6OA 3WLOA 3TZKA 3OKPA 3MFQA 1Y1SA 3CGWA 4RMIA 3SKVA 3B2EA 4CIXA 2IEDA 2C4VA 4IV8A 2XCUA 4WQMA 3K6KA 2J46A 2I4OA 1O4WA 4HNVA 3KQLA 3HCWA 4YHHB 3STVA 3HXTA 4KQXA 2ZT6A 1KPGA 4C04A 1A5BB 4J1TA 5IN5A 1HWYA 5ALLA 2UZAA 3QVKA 5THQA 3T3EA 1JLSA 3QLEA 5CX1B 4QLBA 4FB4A 1FTQA 1U4SA 1P6UA 4RA9A 1PFWA 4X97A 3TLGA 4MDFA 3L3BA 3ANYB 3W0LB 1J25A 3JQ9A 4G3XA 5NULA 3LUHA 2FX3A 1J33A 1ZD5A 3OCZA 4ED9A 4F12A 3ZY6A 2WIJA 3NI2A 4Q24A 3C3BA 4CMEC 4EY3A 2IOYA 3D8UA 1C9MA 1K7FB 2AW5A 3ND6A 5FBQB 4ZMBA 3DVLA 1LQTA 2AVNA 2LUOA 2FZVA 2QRVB 3UXEA 1ZUWA 4HDQB 4UC0A 1BNCA 4F7WA 4HGRA 1OBFO 2P1RA 3HDTA 4LXQA 1NT2A 4MWZA 3ZHRA 4YMHA 2E18A 3J7AC 2Q4DA 2YHIA 3BXGA 5B5SA 4PC1A 3MQ4A 1NW8A 1KSHA 2AV6A 1KVUA 2CW5A 1BEUB 1PUJA 3FZQA 3K32A 4FW9A 2N47A 4P36A 2QMZA 3IMFA 4DCGA 1IJFA 1YL5A 3OE5A 3TTWA 2R5NA 5KTSA 2O8FB 2ZUVA 3GAFA 5ESDA 5CDTA 2IP4A 4EI7A 3U48A 4M8KA 3NHLA 3IB3A 3E18A 3PCRB 1Z3IX 5EYPA 3USZA 4GH5A 3AW9A 1QVZA 3V2IA 4KMMA 1L4GA 1XTRA 2AI1A 2E7ZA 1RHRA 3A6LA 3OCWA 2QUZA 1AUVA 1N2CB 1ZM2A 2XB6A 5JASA 2RGXA 3V9PA 1DP4A 1G3RA 2HA4A 3EF0A 1ODSA 4KQ9A 4KX5A 4OLHA 5KMGB 3LCVB 5I48A 1UBEA 4YRZA 4DV4B 3BB4A 4MV6A 2JAUA 2J9ZB 1TZMA 3EXIA 2CYCA 4XX1A 2PFKA 2BPOA 2H06A 2ZJAA 1E20A 1T4CA 4TWIA 5AKIA 1H5QA 3AUYA 4HRXA 2C5GA 4I1IA 1V9CA 4JUIA 4GUDA 3K09A 2MSLA 2GTHA 4INJA 4KPFC 2RGYA 4FP9A 2JCYA 3G1WA 4B76A 4YS6A 4RLQA 4P0QB 1SCAA 3ICPA 4HH1A 2CV0A 3T5TA 3NJ4A 3IILA 5HKOA 3UJHA 4JLAA 3EC1A 1TQ6A 4FCWA 1DT3A 1ZH2A 4B83A 1KQGA 4ZTUB 3IMKA 1PWHA 2GT1A 4ZOQI 3EPPA 2YUIA 2GZRA 3JR7A 4PN3A 1LNSA 2VTBA 1FSGA 2OHVA 4B6FA 4DIBA 5JMTA 3P96A 3V9AA 1W2GA 1JS1X 3HVKA 1BFKA 1JHUA 3QBTA 5K4HA 1NATA 3NTVA 2BI7A 1JFLA 2BFOA 2FMXA 3DZGA 3F9RA 3HYSA 2H2WA 4OFBA 3TZ6A 2V4UA 2VP9A 3CZQA 3RWBA 4HKTA 1A7UA 1E1LA 4NJMB 3ZD9A 2O48X 4G5XA 5EE3A 5BSFA 1PVDA 1P2UA 1H2HA 3EZGA 3OM9A 1P3Y1 3ZHTA 2OHOA 3KR2A 1BU5A 5T3UA 3ZW9A 5H02A 2A59A 1DKOA 1Z6ZA 3A26A 4AO6A 1GCOA 3ND8A 3PNVA 1KMMA 3KYDB 3V32A 5M7EA 3UGKA 2XCRB 4O4JF 2F4NA 1B16A 3WRYA 4EG7A 5KNCD 4P35A 2MTBA 2WP8J 2ZS7A 1HKUA 1OT3A 1UKAA 2ZSBA 3ETJA 4EY4A 2PZFA 3ZX4A 3KEMA 1T5OA 2PMFA 4Y6GB 2P9QA 5ALDA 2JI7A 3L82B 1FXWA 3KQNA 1IULA 1C3LA 1PX2A 5A4DA 4GLOA 1WW8A 5EP2A 2VPXA 3KXPA 1T9BA 4DA8A 3PNSA 4I50A 2A3RA 2DSNA 1YE5A 4UTRA 3OP1A 1THTA 3G2IA 1NXOA 2W43A 1T3ZA 1AV7A 2GH1A 4Y6LA 2WKPA 3QUAA 2OBFA 2F8SA 4OAPA 5FP0A 1QH1B 3P71T 1S2IA 3W2TA 3NOVA 4ECAA 1YE3A 2IX9A 5D8DA 2ZJ8A 2R79A 4H1UA 5HGJA 2OV8A 2VSXA 4AJIA 1OXBB 4ZYXA 1MA3A 1G7TA 1TD1A 2HNAA 3HO8A 3FH0A 3H9BA 3R8FA 4ZO4A 4XEHA 3EWIA 3T4XA 5C8XA 4R0VA 1QM5A 2HTEA 1GFZA 1DRJA 2W6ID 4G5FA 6CHYA 5K3FA 3GN1A 3RB8A 4FMBB 5GZ6A 3K6SA 3R7LA 3UAVA 4DIKA 1KXJA 1I14A 1V1RB 3SKYA 1Z07A 3EAFA 2EDCA 5T3YA 4NZYA 1Y8ZA 1DKMA 5DO9A 1V1JA 2TYSB 1T0JB 2QAGA 1P2BA 4CLDA 3SF8A 2NV6A 4MEJA 3OA2A 3KAKA 1F38A 1G8MA 4FOTA 5D6NA 1FTYA 2HCJB 3RIYA 2V8OA 1KBQA 2P69A 4OXKA 4ZREA 3FCUB 3I8XA 2X4IA 4M7PA 3UV6A 1SUWA 3I9NA 4D9EA 3SHVA 3T5CA 1G8GA 1BMTA 2AKEA 3GUVA 4XQCA 3VR5H 3NV9A 5KNBD 3GRAA 3GGGA 1T8PA 1C9KA 3RJMA 2AZMA 3DUFB 1U90A 3P52A 3BD6A 4YP1A 1OJ7A 4DLYA 4L76A 3TVYA 4EJ6A 1G9SA 3ICCA 4IYRA 2XUAA 5TV2A 3FBGA 2W6ZA 5AIAA 2O57A 1TCCA 3BMCA 1W9MA 4MKHA 2ZULA 4FJ2A 3B8HA 3I53A 4EX6A 4YCNA 3URKA 1T3TA 4TUYA 5B7PA 3RYCB 3A06A 1I0LA 4HATA 3LGXA 4IGEA 3ZHBA 3FWYA 1NKTA 3NTOA 2Q1SA 3RSGA 2X58A 2XJ4A 3QBJA 3LHFA 4MTLA 4C7VA 4Z4IA 3CISA 4D9BA 2ZB7A 4US1R 1DRWA 3R0ZA 3VR1A 3AF1A 5HF6A 1E79D 3WC4A 4HSGA 1YOVB 5TPZA 3RD5A 3VR4H 1PG0A 2G72A 4UJ5A 2Q5EA 3IBCA 1WW3A 3NIGB 1A76A 2P6UA 3W1EA 3QM1A 1GY8A 3E1SA 3EJWA 1P0IA 3EZXA 1YR8A 4L4SA 3E9CA 4BLVA 2NP6A 1HLPA 1TUIA 4MW5A 1D6SA 4Y3UA 3TW8B 4DDWA 4KUGA 5J2TF 2Q5FA 3HCOA 1KKMA 1NVUQ 4DC1A 3FYSA 3JATB 1LPSA 1YZUA 3F7OA 4D4HA 1ZNZA 4LOHA 4F72A 1FP4B 4YPOA 4CEJA 2QM0A 2ZIEA 2PRZA 5DN6A 1K1EA 3MHTA 2BGNA 1DC3A 4O4IB 5KOHA 5K01A 4ZT2A 2EX4A 1K7EB 1L7VC 4KH1A 3MAJA 4BMOB 4RTSA 3O4JA 2QTFA 5THXA 1L5RA 4H27A 3GLRA 3HK2A 2P62A 3D7SA 4JJZA 1F0PA 5ITVA 1KFJB 3L5KA 1W47A 3TXXA 4CIDA 3W8NA 1QE5A 1E1DA 1LLQA 4GI1A 3EQ9A 3RKRA 2BRUC 2X5NA 3PR2B 1PRYA 2GJKA 1DUSA 1WU7A 2F90A 4NFYA 4EG5A 4BKPA 4CFSA 1RD4A 4XQ0A 2FUNB 4WCFC 4ZV9A 5IVPA 4A36A 2MYTA 1I6WA 4QICA 4NU6A 4AS2A 4XOUA 1EVYA 2WE7A 3C8DA 4AF6A 1MO3A 1X14A 1GRQA 4MVJI 2HY7A 3QJGA 4PVCA 4NDAA 4G5GA 4CTKA 3NP7A 4D79A 3C2QA 3F4LA 3K70B 4B4OA 5LMUB 3HKEA 2YCLA 1S1MA 4PNEA 3QGMA 4UREA 3WGZA 4MUEA 1XA3A 1WVMA 3E22B 4I14A 2BFAA 3K2QA 4R05A 2QX4A 5JW6A 2VDWB 3LUFA 3FF1A 1LDNA 3B9PA 2IIPA 2Q0SA 4M0PA 4TGLA 1CS4C 4XVQA 4CIVA 2E3JA 3KZOA 3S44A 1J1UA 4HQOA 4N0PA 5EVJA 2O5VA 1RZRA 1N5KA 1E2FA 1JXMA 2ODNA 1SGWA 3AHJA 3EOAI 3Q7EA 4LS3A 4AJJA 4D8YA 2V6GA 3CZRA 1Z8FA 1KBOA 4MV0A 2BT4A 1T2AA 3F8SA 1WVIA 4V3CA 1VGVA 3ZHQA 3WLSA 2WIFA 2OCYC 1NPYA 5J5VA 3WKBA 4M9CA 2QL7A 4RUKA 4BX0A 1QRTA 2WTNA 2XTJA 4D74A 2FNAA 3IJPA 3LYUA 4U8GA 4ETNA 4KO4S 2HMTA 1YIDA 4MVJA 1NN5A 2NPFA 1JH8A 1SOUA 1FJXA 1HRDA 1NDUA 3IIJA 3K4HA 4YLYA 1YRHA 3L4EA 4J0GA 3GLFA 1XTBA 1FFAA 2JVIA 4TT3A 3AY6A 3P9PA 5IAGA 2OAP1 4H7KA 2B3DA 4PQFA 5DBEX 1RXUA 2GFIA 3IVMA 5EMJA 3CW9A 4EDFA 2PZGA 2RHBA 1YFJA 3HFSA 4PPQA 3GC6A 4FNAA 1DMSA 3JY6A 4FSDA 4MV3A 3MRXA 4GSKA 1KMCA 2VNHA 4WD3A 5ALFA 3EA4A 5C81A 2CB9A 4QO8A 4RM2A 1YULA 2ORWA 1PS9A 4KSCA 1H4VB 5DW3A 4JXKA 3VYRB 3LBIA 3W06A 5AW4A 4LV5B 4N47A 4YRKA 4U7PB 4HQFA 1OFUA 4G0NA 1IZ0A 3LUAA 4OBEA 1UBJS 2Z9BA 3PC2A 1LK5A 4OHUA 4EB6A 3STXA 1QPGA 2QVBA 2VIIA 3AF0A 1BDBA 3NT2A 4HR7A 3VSDA 3ZE2B 1MENA 4U9UA 3DGFC 5TT1A 2HAEA 2O3JA 4A92A 1KZ6A 4CHGA 2IHBA 4CWAA 2FE1A 1NULA 2MMGA 3DLPX 2AYZA 4EHBA 2ZKLA 3RRMA 1OQAA 1NP7A 4J0KA 3ECCA 3EZLA 5AUQA 5IMBA 3ZDQA 4UAJA 1PYGA 4JNCA 1YQQA 1CNFA 3LJKA 3T3MB 4CTNA 5DLYA 3S2EA 4C29A 4CBVA 3HJFA 1K7YA 4U63A 3WMFA 1DLIA 4P3NA 1LV7A 1E9AA 1T2UA 1SIUA 2FLVA 3LXUX 4TLEA 5G1OA 1Y6GA 5DLQC 2AN1A 2C5LA 4JJGA 1UH5A 4P80A 5DM70 1JHPA 3V6MA 2CFOA 2WTEA 2AFHE 2JAOA 3IBTA 2H9AA 4F4HA 1NR7A 2IYXA 2OAQ1 4KIFA 2UYHA 3CEAA 1GUYA 3LBNA 1BG6A 1MX9A 4LRWA 5D87A 5C9ZA 5I9NA 4E5UA 5J63A 5CFQA 1QORA 1T3GA 3QPCA 1F6BA 2QAJA 3SG0A 3ONFA 4Q4AB 3GCDA 2O50A 1WX1A 3GEEA 1WF3A 4KACA 2CWDA 4LXYA 2DBZA 4R1OA 5EP3A 1T8WA 1FFGA 1T9ZA 5JVDB 2MINB 3EGXB 1P7CA 4N0EA 4ZOCA 2GAIA 4EABA 2PUVA 3O3MB 3JAKB 3WGJA 4EL0A 2DTDA 4N41A 4EA9A 2A5FA 1PL0A 1E7MA 3T12A 1XTJA 2ZIWB 1SVLA 2PQ2A 2WZCA 4C6RA 5FX2A 3P9RA 5HRCA 2V65A 4CR8A 2XCSB 4QYMA 5T4BA 2VYQA 4CM1A 1EDOA 3KKZA 4MQEA 4YBRA 2HO5A 1N8NA 5KNDD 3DZJA 4OQDA 4P93A 3U4QA 3A2KA 1WLYA 1PLKA 3H87A 4BRWA 4DUGD 2PUEA 4PZYA 4W1SA 4US2R 4L7QA 4LIPD 1FQOA 2JLQA 1ZLYA 1OFGA 3N8IA 4M83A 5IF9A 5JXGA 2X0NA 2HNBA 3VDXA 1BWRA 3EUEA 3QVTA 4IOLA 1OXUA 1XNGA 3KLOA 3T3HA 1W85A 3FOCA 3FZNA 3MCZA 4H0NA 1C1DB 4WJZA 4QQ8A 4Y1RB 4UNRA 3HN7A 3C7DB 2Z2IA 4IHJA 3A6HA 3HBMA 1HOXA 2QE7D 4QPZA 1K2WA 1KS9A 1FL9A 3QPDA 1FVHA 1MX5A 2Q3EA 2QJRA 3KZVA 3WGVA 2JD1A 4G1VA 2X9LA 1YUNA 3LPDA 1GAWA 1FUIA 1GADO 3PEVA 4KXVA 4Z86A 3TR0A 3U4CA 3WIEA 3ZWYA 1YQTA 2ZJBA 2M1XA 1M6HA 3TRFA 2ZR0A 4YJHB 2GEFA 3DB1A 3VVMA 1JJFA 4ZHQA 5ILOA 1EFAA 4CKBA 4YUWA 2J33A 1V8OA 4QFBA 1VLLA 3OJOA 5IW8A 2DWPA 5ULLA 2CD9A 4X1YA 1HURA 2FPWA 2W93A 2XTNA 1N6RA 2DBYA 1U04A 4B43A 1L5KA 5A4MS 1M2GA 5HTKA 3U56A 1X9GA 1YZYA 3D1LA 3LX4A 1LDBA 4OJTA 3V5NA 5JWRA 1GSOA 5DYYA 3JZAA 3WB0A 2IZ6A 3F4BA 1VHTA 2F3UA 5ISMA 4XB2A 3SXUB 4AZTA 3DDWA 1M5TA 2CL7X 4JJEA 1GYQA 4M9XA 2LPMA 4YEDA 2HKIA 2QBYA 3ZCTA 1TEHA 1NNSA 1PVOA 4HGZA 4JR0A 3DV0B 1FEZA 4U2EA 1N1GA 2B98A 2GETA 5JD6A 2WWGA 3L4JA 2IXGA 3H11A 5DNWA 3FW1A 4RANA 3NBFA 2QG6A 3NO4A 4J03A 2YC4C 3T9CA 1QGDA 4URYR 3AHIA 1PT6A 2XNDD 4FC7A 5L53A 2VQDA 4RLSA 1FP7A 1S3SA 4Z8YA 2BBSA 4ICIA 3D3KA 3DFFA 4O02B 5H16A 1QIEA 3EVZA 5L6MB 3LH5A 1GSIA 3KJHA 3LPAA 3AJ8A 2ZE7A 2AYXA 3PC3A 3L5OA 4FD3A 4X7PA 4B84A 4CIWA 3PB3A 4UEOA 4WERA 4OUKX 5E4TA 4MB2A 2HZ7A 1W0JD 4E1AA 4YALA 1RC0A 4ZKEA 1SQFA 3BVPA 3NV7A 4YIHA 2H5IA 1USKA 3BGWA 3L05A 2OBLA 1GTMA 4KQ6A 4MPJA 4U7HA 5JAPA 2FSFA 3OIUA 1ZCZA 3DS8A 4AUKA 1L4YA 1W29A 3KSMA 3U7HB 1N3IA 1ESCA 4X7BA 1JSXA 3FCOA 1L4UA 3NUQA 3U40A 5DYIA 4DLPA 4OY3A 1E77A 2HF7A 2I03A 3OESA 2P5UA 3S8YA 5BSHA 1FQKA 1KZ4A 1PFVA 2DUWA 3FCAA 2CXPA 1FJGB 3LVQE 2DBRA 4IS3A 1ZIPA 5C5IA 2ZIUB 4J7AA 3TMAA 3PEWA 2JFUA 2ZYVX 1YCFA 2D4HA 5B6JA 3O26A 2RH8A 3QUTA 1EFDN 4JI4B 3ZLUA 2OUIA 1U9JA 3MJFA 4QOJA 1RWMA 5TDHA 2IGBA 3KC2A 3B1FA 3INTA 3MB5A 4M55A 3VPBA 4KC0A 4M0LA 1TKAA 2ODAA 2QTWB 4ZYLA 1D2GA 4AJPA 5BURA 1KRWA 3ROMA 1A2OA 1V4NA 4R98A 1OV4A 2G0AA 2JBWA 3SIRA 2R86A 3VC3A 2BMAA 2PH3A 3OY2A 1CZOA 1UBSB 4I36A 4RETA 4TL8A 3UUGA 3V34A 5FAKA 3H7IA 3ADBA 4OL0A 1EWTA 2QN6A 2ICAA 3DLIA 1VRCA 2PAFA 3N0TA 2A9RA 1IOZA 1JLHA 4CMHA 1OVMA 2IUEA 4RTNA 1Z6GA 5HVNA 4O2AB 1EI9A 1ZUHA 4W5QA 2YKGA 1ODLA 4Y2JA 2WVJA 1ILEA 4QNRA 4Z9AA 3EZ6A 4YGXB 3D3NA 4N6GA 1B0UA 3QYFA 2OQVA 2XDAA 3P94A 4OA5A 4OQYA 4X6YA 4WA8A 2CK3D 5JSQA 4B4DA 4PBTA 1CPYA 2WWHA 3W5CA 3UG7A 3AUKA 4NEQA 3PRYA 5IN4A 2QZJA 2O5CA 2VA9A 2JCGA 3WSWA 1R5BA 2UUCB 1QOQB 4MTCA 1ZD8A 1I4TD 2BCJQ 5CPFA