2VAXA

Crystal structure of deacetylcephalosporin c acetyltransferase (cephalosporin c-soak)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
376
structure length
346
Chain Sequence
NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDARPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
publication title The Last Step in Cephalosporin C Formation Revealed: Crystal Structures of Deacetylcephalosporin C Acetyltransferase from Acremonium Chrysogenum in Complexes with Reaction Intermediates.
pubmed doi rcsb
source organism Acremonium chrysogenum
molecule tags Transferase
total genus 123
structure length 346
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vaxA00
2R8BA 1E8NA 4FMPA 4Y2PA 3FNBA 4KRXA 3HC7A 2HA5A 3VXKA 1LBTA 4FTWA 4UBMA 1LPMA 1P0MA 2JEZA 4X00A 3KOOA 4J0KA 4IH9A 4UHHA 2OQVA 5ALTA 1XZAA 5CW2A 1LPPA 1MTZA 3WWOA 3I2JA 1AX9A 1XZEA 4BBZA 5BWBA 3IUJA 4NVRA 1ZOIA 4J0JA 1JJBA 4UFNA 2CBGA 4JNCA 2C7BA 1DT5A 2AJLI 1CLEA 1QIFA 4DNPA 1TAHA 1MAAA 3H18A 3F98A 4ZXFA 4G9EA 2JGKA 1FFAA 4X3CA 4ETWA 1CFJA 5AK6A 3G8YA 4KAJA 5K5EA 3FYTA 4Q1VA 4H77A 2VEOA 1R9NA 3NGMA 1EHYA 4XVCA 1DINA 3E1GA 3AIMA 5E4TA 2PUHA 4G1FA 2PU7A 3WLAA 1U8EA 1GT6A 2I78A 1WOMA 3D2CA 3JW8A 3BL8A 5SYNA 1TKRA 4EBBA 2XLCA 1IUNA 2BGNA 3HEAA 4QWWA 3GROA 4BZZA 2C0PA 5JAOA 4FBLA 3WIOA 4B81A 2HADA 1IMJA 1E8DA 1HKHA 4MQLA 1BROA 4GBGA 4AO8A 3WWCA 3ILSA 1ODSA 5A71A 2X5XA 4F60A 4AZ3A 2DFPA 3H0CA 1X70A 2WHPA 4DM7A 2PSEA 4Y2XA 1OXMA 2WUGA 3WL8A 4HS9A 5CT4A 3F8SA 1LPBB 2ZJFA 3I2IA 2XUPA 4X95A 3WKBA 3NUZA 4ROTA 1LLFA 3AINA 3EQ8A 2CB9A 3WJ2A 4B7ZA 4EB0A 1GPNA 2C4HA 3D3NA 3U1TA 1T4MA 2RHWA 1CIJA 3UMJA 1MX1A 1J2EA 4CIAA 2ZYRA 5AM5A 4OB7A 3IIIA 1JFRA 1XQWA 2JGJA 2PUJA 4JYMA 2VT7A 2WFLB 2WUFA 2HL6A 3QPAA 5HF9A 1H22A 5CH5A 4RGYA 1FFDA 5AK4A 4GW3A 1UFOA 1HL7A 1Q84A 1MNAA 4HVTA 2QZPA 1UK7A 1XKTA 2WTMA 1EK1A 1YR2A 2I3DA 4UBKA 4BVLA 1UT6A 3WK7A 3C5WP 5A62A 3I28A 4GLBA 1BEEA 4J0HA 4GI1A 2QOEA 4IH4A 3RLIA 2G63A 2R11A 2ACEA 5JD6A 1CVLA 2PM8A 4JH0A 2ZSIA 1BRTA 1XQYA 1ACJA 4BAUA 4BC0A 3FWHA 3DJYA 3CCBA 1TCBA 3DLTA 1UK9A 4GECA 3HRHA 3W06A 5LZ5A 5ALFA 2O2GA 2RAUA 1CUXA 4PW0A 4CG2A 4U2GA 1CUHA 4N8EA 1AKNA 1CUYA 1E3QA 1A7UA 2ES4A 4UHEA 1CUVA 3O9VA 4WDQA 1QIMA 4KAAA 3KWJA 2ZYIA 5KWJA 3EF3A 1EVEA 2BKLA 4RE5A 4EY4A 4H7FA 2OGZA 2OXEA 3ZV7A 1ZI8A 1E5TA 3D2BA 3W9UA 4MJ3A 1USWA 5CMLA 4QA9A 1L7QA 5ALLA 4H7JA 4AO6A 1EINA 4FDMA 1P0PA 3VJKA 1GGVA 3BJMA 3RM3A 2X76A 4PO3X 2VTVA 4TPKA 3DEAA 3U0VA 3DL4A 1B41A 2HRQA 5CT5A 4FKBA 3WKEA 2Y6UA 2C0QA 5FV4A 5K3CA 2W6CX 4PSDA 2XQFA 1UZAA 1WM1A 4W1RA 1DQYA 2VT6A 1O6GA 2XT0A 2W22A 4XJVA 4C4ZA 4CG3A 3ICVA 3HZOA 3QMMA 4NZZA 3EIOA 1I6WA 1VA5A 1EH5A 4G5XA 2DQZA 2NW6A 3L1HA 4CG1A 4FNMA 2BJHA 2PBLA 1XZIA 1W4LA 5AM3A 4WCVA 2DHDA 4KAFA 4EUSA 3G9UA 3WK6A 5AH0A 5EHQA 3AZOA 4AN1A 5KREA 2QJRA 4J0CA 3ANSA 1QIKA 4M0FA 1AUOA 4BAGA 3D4LA 1XZMA 1VZ2A 4DIUA 3GFFA 5AI8A 3TEJA 5JZ9A 2Y2VA 1LPNA 2HA2A 1CRLA 1QIEA 5DYWA 3R3YA 2UZ0A 4FLFA 4EY7A 3ESCA 1GQRA 1ZIXA 5LYYA 1F8UA 2HA4A 1QO9A 4GDMA 6YASA 1CEXA 2VJCA 3FLBA 1U65A 1BS9A 4UFOA 5LP1A 7YASA 3DKKA 1Z68A 2WFMA 5T4BA 1EB9A 3QMWA 4U2DA 4QDOA 2Z8XA 3O0DA 1NX9A 4NMWA 3ZPXA 4WFKA 3VVMA 4MWSA 2XMDA 3R3ZA 2V96A 4RPCA 3MUOA 2PPLA 2AJDA 5AJHA 2XB6A 1QLWA 1R3DA 2WG2A 2GBGA 3GUUA 4Y2QA 3I2HA 1YASA 2DHCA 5CT6A 2OGTA 1KEZA 1ODCA 4GEGA 3HI4A 1QIIA 2OCIA 5AI4A 3EQ9A 3G02A 2XUHA 3STVA 4L9AA 3E4DA 3QITA 1WHSA 3G0CA 4WDRA 5HKAA 1XQVA 4AXBA 4BCBA 5BOVA 1EI9A 2H7CA 4EY8A 1DQZA 1JJFA 4H7DA 2RI6A 1G66A 3STWA 2WQZA 2GBCA 2XUKA 3IULA 5CH8A 2J3QA 1FFEA 3G9TA 4J3JA 5EIEA 2C5GA 1CV2A 5HF8A 3HXKA 5FPQA 2BCEA 5DNUA 5HZGA 1YCDA 5AKHA 1PFQA 3VJLA 4KRYA 1DT3A 2BUAA 1CUEA 4N5IX 2WU4A 5ALIA 1CPYA 2G5PA 3STUA 3M3DA 4K6HA 4X94A 1UKAA 4CI9A 1VE7A 4WFJA 2GBFA 3WWDA 5HK8A 3CXUA 4DNOA 3H1AA 3IUQA 3MVEA 3H2HA 4OYLA 4X90A 4LXHA 3F67A 4QEKA 2WIDA 5DLPA 1X2BA 1MT3A 4F21A 5JYCA 3EQ7A 3OG9A 4C89A 2LIPA 4BP9A 1XRRA 1BN7A 5A7HA 5ESRA 4C88A 4E11A 1L7AA 3DCNA 5FOQA 1D07A 1JMYA 2Z3ZA 3O4IA 5LZ2A 1BU8A 2CZQA 1WB4A 1JU4A 1QIJA 3VKFA 3E0XA 4QNNA 3HABA 3N2ZB 4UPDA 5AM1A 5A7FA 3KDAA 4Y7DA 2HFKA 4ITVA 3I2KA 3M83A 5J3JA 1ZD4A 4H35A 5ALJA 3C43A 1YS1X 3C6ZA 5AKEA 4A16A 4OB6A 1K8QA 3WK8A 3LIIA 1EB8A 3Q8WA 5EGNA 4LXIA 4ARBA 4LKOA 1H2WA 4QDXA 3VJMA 5IVIA 3IA2A 3WKDA 3RKSA 3QVMA 1IZ7A 1E66A 5FXMA 5EHNA 4OCZA 2BUBA 1SCKA 1UKBA 1O6FA 5CRIA 2WKWA 3FCXA 2HU8A 4DNQA 5IKXA 5CURA 5EIAA 4Y2SA 1SCIA 3O9MA 2JF0A 4EY6A 1WPXA 2XMBA 2WG1A 3I2FA 3GA7A 1R9MA 1UOPA 3LIPA 2OAEA 2VSQA 4E15A 1QONA 3C45A 1CUBA 5AOCA 5E4YA 4E14A 5LKAA 1CR6A 5I8PA 5AICA 3MGAA 2O2IA 5ISMA 2QM0A 1CUJA 2ACKA 2GZRA 5HK9A 4Q05A 4WY5A 1LPAB 1VA4A 1FJ2A 3AZPA 3G9XA 3VISA 1UWCA 4G8BA 4YPVA 5JAHA 2XMCA 1VXRA 4G4GA 1FFBA 3QYJA 1TCCA 4X71A 4U2EA 5DTJA 1QE3A 1TQHA 4C87A 3P2MA 1XRMA 1N8SA 3LLCA 2CUTA 1J1IA 2K2QB 3ZLVA 5ALWA 4X97A 3A2MA 5AKJA 4H18A 5IVKA 4UBOA 1LPOA 2E3JA 3FLEA 3FLAA 3VDXA 1VXOA 4P93A 2WFLA 3FOBA 5IVDA 5AKYA 1XZJA 4X6UA 1MX5A 4MYDA 4CCYA 2QTBA 1ETHA 2H1IA 4QDUA 3D2AA 3H17A 3PUHA 4MEBA 5LKRA 1XFDA 4UBLA 3R3WA 4K2AA 4K5QA 4OU5A 5HFNA 3K2IA 5HQ3B 4ZI5A 4V2IA 1R88A 1XZDA 2WHQA 1Y7IA 1CUFA 5LZ8A 2QUBA 3C5VA 2BAGA 4AMZA 1ZD3A 3WKCA 3BDVA 4FFWA 1VLQA 3D0KA 1G42A 2WHPB 4BZWA 1QOZA 1BEZA 5C8ZA 3CCCA 3R3VA 3OOSA 4HRYA 1LZLA 1U2EA 4PSCA 1CUGA 2JGIA 2PSJA 4J0DA 4KE7A 5K3DA 2XMZA 5FUMA 3GBSA 3WZMA 1U4NA 1UK6A 3R3UA 4G4IA 4N8DA 2P8SA 2WLSA 1CUZA 5HF6A 4HXFB 3G7NA 3I6MA 1JU3A 2WIKA 4YX9A 3IB3A 3PFBA 4BVJA 4H0CA 5K3AA 3R3XA 2DR0A 4GHWA 1R1DA 4B6GA 3IURA 5K3EA 5ALZA 4I3FA 4DTCA 4B9EA 2GYUA 4G8DA 3IUMA 4GWLA 5C8XA 1WB6A 3WL7A 1ZGCA 4Y2YA 4J7AA 1H23A 3I6YA 1XQXA 2C58A 3OM8A 3G9ZA 4P92A 3FVRA 2VATA 5K3BA 2GYVA 1BCSA 4FNGA 5FP0A 3UUEA 5BWCA 5JANA 1F0PA 4ZV9A 4UHDA 4Q82A 1P0IA 1FSSA 4FBMA 1XRLA 2QS9A 2CEKA 4F5ZA 3YASA 1YA4A 3EBLA 5AO9A 1XZLA 2J4CA 1VKHA 1MAHA 3M81A 3V1NA 1JT2A 4XWGA 3E3AA 4UFPA 3DQZA 2FJPA 5AOAA 1W6RA 2XMQA 1CUCA 2XMRA 2XUIA 4U2BA 4GXNA 1EA5A 3DDUA 4B85A 1AGYA 4Y2JA 3WYDA 3BIXA 2ORYA 1DU4A 2GYWA 2AXEA 3C6XA 1EVQA 3DS8A 2YYSA 3WWPA 4KE8A 5CXUA 1A8QA 5AK3A 4DMCA 4S0XA 5DWDA 3G0DA 2O2HA 4Y2TA 3AILA 4ZRDA 3GZJA 5A7GA 1G4HA 5AP9A 3QBJA 1BE0A 1QZ3A 3C87A 3I1YA 1HDEA 1ZD5A 3CN7A 4PV7A 1E89A 2PSFA 4MQMA 4UBJA 3C8HA 4AZ0A 1N5MA 3ZLUA 2DSNA 4U2CA 4BC1A 2H7XA 4OU4A 4U2FA 5DJ5A 1NU8A 4CCWA 4X92A 5CT9A 4DSZA 4W1PA 1DWQA 4YASA 1YAHA 4BRSA 3C6YA 1DX6A 3V9AA 4H7IA 3G0GA 2BUCA 3TJMA 4I19A 1J06A 2Z8ZA 5CT8A 2JIDA 3C70A 1MU0A 3HACA 5E4JA 5C8VA 3W05A 4M0EA 2Q0XA 5JD4A 4KE6A 4X91A 2O7RA 4BYMA 1ORWA 3ANTA 2WILA 3DL7A 2VAVA 4HRXA 3R40A 5AHXA 3LP5A 3X3HA 1IZ8A 3A6ZA 2WJ3A 2XE4A 4UBNA 1HLGA 3IDAA 4HTAA 2B4KA 2ZYSA 1ZD2P 4X6YA 1XZBA 2QVBA 1GZ7A 4L3WA 3VVLA 1N5RA 2XI4A 5ALDA 2VAXA 5D3ZA 4QZVA 4FLEA 3BJRA 1YB7A 4HZGA 4H7HA 5DYTA 2EEPA 5E2IA 4PF1A 5DNWA 1B6GA 1UKCA 4D9JA 1EX9A 1AQLA 5LIPA 3H2GA 3ICWA 5K3FA 4H7EA 2G5TA 1CUUA 1L7RA 4ZREA 1LBSA 1WPRA 4QWMA 2BGRA 1K4YA 2QJWA 3FYUA 4WJLA 5HCUA 2XMGA 3WK4A 5CH3A 3OC0A 2WUDA 2RGUA 3JYHA 2XUFA 2HDWA 5AM4A 1GXSA 4Y2RA 3BF7A 1UXOA 1QIDA 4LYEA 1YS2X 5AOBA 2PU5A 3PF9A 2HHAA 5ALRA 2HRRA 2OLEA 2WTNA 2DQYA 1EDEA 2GZSA 1C4XA 4O08A 1R4ZA 2XMSA 4KE9A 3H2KA 2AJBA 2H7YA 1RWQA 1A8SA 2DHEA 3PI6A 2J3DA 2WIGA 3G0IA 1LZKA 3W04A 2B9VA 4E46A 4FLMA 4BDSA 1JI3A 1DWOA 1IUPA 2XUQA 1W52X 5F4ZA 2RIPA 3KWFA 4HXEB 1A88A 1EK2A 4I4CA 4ZV7A 4BB0A 3C6BA 5H3HA 5ALQA 4AX4A 3FSGD 5AK5A 1R50A 4W1SA 4N8SA 5ALNA 3D5EA 5IVHA 5AKGA 2FJ0A 3O95A 5KWIA 3OPMA 5YASA 2ZSHA 1XROA 3DOIA 3QPDA 5LLSA 5EIHA 1BCRA 1X2EA 1CQWA 2ZVDA 4EY5A 1FFCA 2D5LA 4HAIA 3PF8A 2ZJ7A 4MEAA 4B80A 5T4HA 4WY8A 1ZI6A 2WJ4A 4QE3A 4KYVA 3W2TA 4Y2VA 3B5EA 3H2JA 3I2GA 3KD2A 4B83A 1TK3A 1KU6A 4QLAA 4B0PA 1JKMA 2PSHA 5JZSA 3PE6A 5JARA 2O7VA 1YA8A 1RP1A 2JGLA 3BXPA 3H2IA 2XUDA 1ZICA 4K6GA 5EFZA 4MYSA 4B82A 4C4YA 3DD5A 4DMFA 2V9ZA 4Q3KA 4TVKA 3L1JA 1XRPA 2WIJA 4N5HX 3BE8A 4DMKA 5CBKA 1XLUA 2QT9A 2Z3WA 2HA3A 3QMVA 3R41A 3AIOA 4FHZA 4BP8A 3D7RA 2QUAA 4Q3OA 5CXXA 1EDBA 5D3KA 3O4JA 4OUKX 3SX4A 1ISPA 5FLKA 5EI5A 1W75A 2ZJ6A 4QLOA 2HU7A 2J4FA 5FRDA 4MXDA 2XUAA 1ACLA 4X6XA 3H19A 2WIFA 3V1KA 4W63A 3HSSA 4IHAA 2RONA 4G9GA 1N1MA 4DLNA 1Y37A 5HF5A 1HQDA 4KEAA 4BATA 4FOLA 5SYMA 5ALGA 1MNQA 4W1QA 1LPSA 3G0BA 1VZ3A 3WQHA 1AZWA 3A2LA 1TCAA 4DMHA 5HQ3A 4A5SA 4AMYA 3M82A 4IQ4A 5FDFA 5AM0A 1C7JA 3S8YA 2XUOA 5ALHA 5AKKA 2VF2A 2WG0A 4Y9SA 2OCGA 1AC5A 4PQEA 2EDCA 1JJIA 1HBJA 1PV1A 3STYA 5AI9A 1LGYA 1M33A 2XQGA 2QR5A 4OPMA 3NOXA 4RNCA 4A23A 2V97A 3F9CA 5ALVA 4Q34A 3HJUA 5JIBA 2WM2A 2QXTA 5I7UA 4F0JA 1UK8A 3T4UA 1ZJ4A 3QH4A 2IIVA 1E8MA 5ALXA 2WSLA 1XZHA 4LXGA 3V1MA 3WL6A 5C7YA 3QPCA 1CQZA 3QZUA 1C7IA 5ALKA 3SC2A 3FBWA 3RK4A 4G4JA 2YXPX 1XKLA 3I1IA 1QIHA 1KU0A 1NU6A 3B12A 2VJDA 5A6VA 3V48A 3AZQA 1Q0ZA 1ZGBA 2HIHA 5AIBA 3RARA 5EHZA 4Q3LA 2BFNA 4LYDA 4CCYB 1QFMA 1MX9A 4L0CA 5LZ9A 2OG1A 3FVTA 4J0IA 2ROQA 5ALSA 3AUKA 2XQKA 2Y1KA 2PVSA 4EHBA 2Z5GA 1XZCA 3WL5A 2XLBA 3AIKA 4DGQA 1PJAA 4QDZA 3DYIA 2IX9A 1QGED 3ZWQA 1ZIYA 2GBIA 4DSAA 5JATA 2HA6A 3DKRA 2CKMA 4BAZA 2OPHA 4UHCA 1ORVA 2I3ZA 5AKXA 2VA9A 4K6KA 5ALYA 1XLVA 5DYYA 2WHRA 4WFIA 4ZWNA 4BDTA 4G8CA 1THGA 3ESAA 3WWEA 1DX4A 3Q0TA 4X7BA 5I9IA 5JALA 4BE9A 1W76A 2FUKA 4AQDA 2XUGA 1YAJA 3FYUC 2JGEA 1EXWA 1S8OA 5JAUA 1MO2A 1WCYA 2ONCA 3ESBA 1BN6A 3PICA 1IVYA 3A2NA 4IO0A 4PNZA 4JEIA 4W9RA 3ZLTA 5FKJA 2OGSA 1VJ5A 4B84A 2WJ6A 1TIBA 3NWOA 4TGLA 3UUFA 5AI0A 4OB8A 2JGMA 4CIBA 1ZJ5A 3BIWA 5ALPA 3HLKA 3R0VA 5FPPA 2XDWA 3HYSA 1IUOA 1QFSA 1RYYA 3BWXA 3V1LA 3OURA 3S2ZA 3O4HA 2PSDA 1XLWA 1MN6A 1XRNA 5HFAA 4AN0A 5IH7A 5AIAA 2XUJA 5DNVA 2YASA 3WKAA 3FCYA 4PSUA 1QJ4A 2WFZA 3SK0A 1K5PA 1P0QA 3CN9A 1H2ZA 1W1IA 2HA0A 3FSGA 5T4EA 3LS2A 5LZ4A 5HKBA 2JGFA 4EA6A 1J07A 3WK9A 3H04A 2WU3A 4C01A 5D6OA 4P08A 5ALUA 3SWWA 1F0NA 1ZI9A 1WHTA 3B3QA 3L1IA 5AKLA 1OCEA 4B0OA 1DTEA 5JAPA 5JZBA 5A2GA 5BV7A 2HFJA 2OQIA 4JYPA 5DTIA 1Y7HA 2YH2A 2AJ8A 1YB6A 1SCQA 3AJAA 5ALMA 1XRQA 4YK7A 2OCKA 3PFCA 5JD5A 4AB1A 4J0GA 2VJBA 1UOQA 4OYYA 3PUIA 1VOTA 2CMFA 3F97A 3WK5A 1GPLA 1SC9A 3ESDA 2PL5A 3STTA 1H2XA 2D0DA 1SOMA 2B20A 2DCMA 1MPXA 5JASA 4XIIA 1T2NA 1LNSA 1QO7A 1CUIA 3K9BA 4BVKA 4AO7A 3T52A 1GPKA 3A70A 1QTIA 4ZGBA 3DNMA 5AKIA 1WB5A 2ZYHA 3W9BA 3ZI7A 3C8DA 3JWEA 3DOHA 2G4LA 5ALEA 2X8BA 5AM2A 4BE4A 3WA7A 1CUAA 5LZ7A 3IBTA 4KJXA 3N0TA 4BTVA 1CUWA 4RE6A 1Q83A 5C81A 4LHEA 2QXUA 4OD0A 3ED1A 2VJAA 4MWTA 4L72A 2AJCA 4C6HA 3BDIA 4BRZA 3TGLA 4FFVA 5AKZA 2OCLA 1MJ5A 2XQJA 2OAGA 1HPLA 1G5FA 3BF8A 4UHBA 2HM7A 2QRUA 3WYNA 5ALOA 3KXPA 3GELA 4KR0A 4Y2UA 1TRHA 1A8UA 4X93A 1VE6A 5EHXA 4UHFA 4C4XA 3WMRA 4IH1A 4NS4A 1XZGA 1GKLA 2Y6VA 4P9NA 2QKYA 5JADA 4BCCA 3AFIA 1CUDA 1THTA 2CJPA 1SFRA 3O4GA 1H2YA 2EDAA 2VQ6A 1K6EA 4KACA 1K63A 2C5FA 4XX1A 3WZLA 1Q0RA 3OTQA 2Y2UA 1QIGA 2RHTA 3MUNA 4H7KA 2WUEA 1CUSA 2I03A 4INZA 2B61A 3LCRA 5K3FB 2QMQA 1F6WA 1ODTC 3WIBA 3I6ZA 4OSEA 3WJ1A 3IUNA 2XQIA 4BTLA 5CTAA 4LIPD 3F96A 3FYUB 5AI5A 1XZKA 1AMNA 4EZIA 4UUQA 2JBWA 4BCDA 3TRDA 4CFSA 3WI7A 4UBIA 2IITA 4ARAA 2PX6A 3H1BA 2ECFA 3KSRA 3DYVA 1AURA 5KBYA 1XZFA 5AI6A 2PKYX 2V98A 4JUIA 4B9AA 1OILA 3QM1A 5T4FA 1EDDA 4FWBA 2HA7A 5D7BA 4DNFA 4M0MA 1GKKA 3PDCA 3FAKA 3D59A 3K6KA 1JMKC 4J03A 4HXGA 1DWPA 3IVMA 2JEYA 1QTRA 2HU5A 1UOOA 4DYHA 3STXA 1YSCA 2FX5A 4X85A 4Z49A 2H9YA 4QDTA 3WA6A 1GQSA
chains in the Genus database with same CATH superfamily
2AFHA 3ZQJA 4QBGB 1JG1A 1FMLA 3TZ6A 1VPTA 3U4IA 2P9JA 4HGOA 2BI8A 4FMPA 4IXTA 3DZIA 4MPTA 3F47A 5EIBC 3FNBA 4KRXA 6ABPA 2C00A 1YUBA 5MGBA 4P3NA 3C5HA 4MKIA 1XCMA 1LBTA 3ANLA 3I72A 4FTWA 2P5YA 5K0CA 3R5TA 1MOPA 3KJGA 2JEZA 4Z9XA 3ILYA 2P9QA 5HE9A 3UW1A 3KOOA 2PL1A 4A0RA 2PJUA 1KOFA 1EUDB 2V45A 2IUEA 3A4IA 2W11A 4QXMA 5EZ6B 4A4DA 4DXAA 1SUBA 2Y67A 5B58T 3R7LA 4AJKA 3ECCA 2PFKA 4PIPA 1W85B 3NAQA 4K0KB 4R05A 2IP2A 5LUAA 1O77A 2E7ZA 1I4DD 3N39C 2PR2A 4FT2A 3UFXB 3UK1A 1MTZA 4UNPA 5BSMA 1I3KA 4WJZA 5A3SA 4BFCA 3I37X 1D1PA 3I2JA 2YHBA 5KNBA 3A9WA 3WNZA 3ISTA 3I62A 2Y77A 2ZWPA 4YJGA 4OM8A 4C0KA 5AQ1A 1N2IA 4PY2A 1O95D 3QE0A 1BCRB 2CHQA 4Q0MA 1ZVMA 4REMA 2YDYA 4J0JA 4OKSA 1ZD9A 4HEA1 2IY8A 5FTNA 3RUHA 4GOJA 5A9TA 1IEWA 3G5UA 3E3NA 3FFXA 1L5OA 4RGBA 4EL0A 4ZQHA 1SQ0A 2FE4A 5EFOA 2BY4A 1RRGA 2YRWA 3VU3A 1PNTA 5F9FA 4LQ4A 1UANA 1W48A 2I4OA 4JUCA 4QSMA 3W6OA 5JVDF 1ULAA 4F71A 3HXTA 2FVYA 3OKPA 4W8OA 1HSOA 1P29A 2IXTA 1EQ2A 2M6SA 4U9HS 4ZO4A 4X7MA 4B40A 1CLEA 2QD5A 4TWJA 1HF3A 3JASA 1ZHOA 3LY8A 1KERA 4HADA 3A6HA 5H70A 1N2GA 1NASA 1NNSA 1HG1A 4WBXC 3ZY5A 3T0GA 3U3OA 1BS1A 1QHYA 2WJYA 3AXTA 4G26A 4HQLA 4ENRA 1FFAA 1DC7A 3H42B 5U9CA 2ZP1A 3FNEA 2AFVA 4JQSA 4RJ2A 5J4YA 1CFJA 3EIEA 3IVGA 2MSCB 3HUUA 5AK6A 3PQDA 5F3DA 2IRWA 1E96A 4KAJA 1J39A 2SCUA 4Q1VA 5CCDA 4MWZA 4D79A 3L4KA 1GIAA 1R9NA 1KIMA 3OHMA 3KK0A 4M0UA 2O5EA 2XRYA 1B0PA 2IEDA 2A7QA 4QU8A 3E1GA 1QYVA 3QXJA 3TTVA 5AYVA 4F12A 3BMXA 3K0FA 2NT4A 5LU9A 2I62A 1B8UA 1R0ZA 2ZSUA 3QJGA 4GL4A 2PU7A 5EUBA 1NN0A 1OWLA 3AQ4A 1Z36A 3M5PA 1CJKC 3D6MA 1U8EA 3I1JA 4HWOA 4KN9S 4YQZA 4FKZA 4JUAA 4UM9B 4Q9IA 3NWPA 3G2HA 4RHYA 5EE1A 4DVJA 3GT0A 2CK3A 3RBAA 1DL5A 1UZLA 1D03A 2VAPA 2C3MA 2XLCA 3GGDA 3GZTB 1IUNA 1N5KA 1H6CA 1JHVA 3HEAA 3QKRB 1V35A 1FBTA 1JAZA 1YBVA 2CNNA 3AJ9A 3EWNA 4PAOA 3UOWA 2J0EA 4Z3OA 5JNTA 1RI3A 4FBLA 1M1NB 1Y81A 2G5CA 1JWAB 1MX3A 2JJYA 4TL9A 2UZ1B 2HADA 1SD1A 3SHVA 1N2OA 1IMJA 2PD6A 2RHJA 1FS4A 4DLUA 2A58A 4URHA 1E8DA 1VSVA 1U9CA 3LGSA 4BVGA 1TM3E 3TOZA 1HKHA 2RD2A 1ORTA 4C4PA 1O57A 3FAZA 3BICA 3L7JA 4EJSC 4B3MB 4Y6QA 5FBRB 1A5BB 1ISIA 3ILSA 1PVOA 4FUTA 4LFBB 4R2IA 4DLXA 4UCFA 3K9LA 4F60A 2A5LA 5JSKA 3IL2A 2C2WA 4UAUA 2Q2VA 4GR9A 1NP7A 2IHTA 1V3VA 2QPTA 3H0CA 3PTZA 3U80A 4UNSA 2DKOA 3SS7X 3UWSA 2VPQA 3PVCA 2O4UX 5ADVA 4F2GA 2WD9A 3PBKA 2X2FA 3PSHA 1JF8A 3BXHA 5LBTA 3E61A 2IVZA 1RJEA 1CDOA 1P7YA 1Z7YA 2GM3A 4E30A 2C57A 2ETXA 2OZLA 5H59A 3S7TA 3OKCA 2VHEA 4JI1B 1V1RA 3TN7A 3ZS8A 5JS7A 1ZN8A 2NU6A 4R2XA 1J22A 3ITNA 1JHPA 1H8EA 3AV0B 4QO7A 2RHHA 3PE4A 1W46A 3A1UA 1KY4A 2IBMA 1SUWA 4P3PA 3NUZA 3ZWYA 5ECDA 4H27A 2FOIA 1QRTA 1LLFA 3C16C 3ZI0A 1AGXA 2ONYA 2CB9A 2QM3A 3EQ8A 4IV8A 2GN2A 1RLMA 3EZGA 1E2GA 4QFDA 2O6LA 3RKUA 2I66A 4MVJM 1OBOA 4FFBB 3QLVC 3HV0A 5GGYA 1LSSA 1T4MA 3ASYA 4TVOA 3OOJA 2GETA 3G2OA 3KZMA 1CIJA 1MX1A 3LO8A 2R96A 4R1QA 2VHJA 2QX6A 3R6WA 1XL1A 2C03A 3QU4A 1D0VA 1DAKA 2BMFA 2ZYRA 5AM5A 5ESXA 4YWHA 4ZCTA 2H1OA 2ZK7A 5JQGA 2XGMA 2IOFA 3QXXA 3EOAI 3V00A 1FDVA 2C97A 5AVWA 1I2AA 4FIDA 4MR7A 4ALJA 5A9SB 3NJRA 2YHIB 4RTPA 5GIOE 2OHXA 4LBZA 3K31A 4KYUA 4YQYA 2ZTLA 2FTKE 3VUFA 5LQUA 4Q4AB 1UXKA 3QPAA 2F3UA 1H22A 1MGOA 1Y7TA 4CLXA 3PWKA 4RGYA 3TQQA 3ZBPA 4FGJA 4XD7A 4GW3A 5C9ZA 1QH8A 3F4BA 3EHEA 4DJAA 2F8MA 3UA3A 3Q6IA 3CZRA 1JZTA 1P60A 1VJGA 3MGGA 2IEAA 4WCFB 3OIWA 1ZM7A 3UBMA 2FUG1 4PSVA 5T8KA 3J81A 1U4OA 1HL7A 2Z95A 4H15A 1Q84A 2G7ZA 4WOPA 4XA8A 5BN3A 2DPGA 2XMPA 2FPXA 1EK1A 1YR2A 2H1SA 1DKUA 2RH9B 3QY0A 3QVTA 2HXGA 1WEKA 2XYRA 3UMVA 2GX6A 1FU8A 2AFRA 4UBKA 3DZFA 3HXOA 4HN2A 4PR3A 2J45A 4V0QA 1FCJA 1YIOA 1A95A 3GGJA 2F43B 3WK7A 3H3XA 4PLWA 3A9TA 2X9GA 3C5WP 3KKNA 3J80A 4M1YA 4ZOAA 1BEEA 5LC1A 2C2OA 4MGIR 1I1OA 5KTYA 2G63A 1ABEA 3HJRA 2R11A 5F2EA 3ZXSA 4ALLA 3P4YA 5FWDA 4X45A 3RS2A 3KUUA 4JH0A 1ZK4A 1OBVA 4QREA 3Q3VA 5FHRA 2YBEA 3LLSA 2CUNA 3PHIA 4NMMA 3G2NA 1PWYE 3N8GA 4OK3A 4R9UC 3T41A 1ACJA 1QMGA 3JR3A 4UEOA 4P4SA 4WKBA 2P3OA 4S0ZA 3SGLA 3SHOA 2HF9A 4GM0A 1KO7A 4DJFC 4BC0A 4IEFB 4TYQA 3CLTD 5HBRA 3FWHA 2PGNA 3QNWA 4KV7A 4MRPA 3F73A 3DJYA 1P9OA 3O3NB 3V5NA 4D74A 1G9SA 3OD1A 4W6QA 2EW8A 3RBVA 2HSZA 2Z2KA 4E94A 3CY6A 3DSRA 3W9SA 4RSGA 3T3NA 2P5TB 1MJFA 1V8ZA 3L9XA 2M6LA 4RK1A 1YZGA 3I5UA 3CLRD 1U3CA 3DBIA 1OC4A 3MB5A 4PW0A 1HDGO 2HMSA 1SUFA 2P3QA 3U4QB 4OLJA 3HKDA 3OOYA 1AKNA 4UHEA 4UMVA 1SQFA 4RDCA 5TY0A 3TQSA 3AOGA 3OTWA 4JGIA 2BFDB 1OTHA 3H5RA 4OQ4A 5PGMA 1A9RA 3LQQA 1UKZA 3NJ8A 4J0QA 4XEHA 4Z6KA 1VCOA 5THQA 2WA2A 4CKEA 1YR1A 1Z88A 1SVLA 3NYWA 1YZLA 1TYCA 1Z4JA 1LD3A 5KWJA 1M34B 2QUHA 1G21B 1JYFA 3EF3A 4R6WA 4RE5A 3X1DA 1PD1A 4BWYA 5K8VA 4H7FA 4EG3A 1U3GA 3L79A 4FYYA 2DPLA 3VH2A 4CMCA 4CM7A 4D92A 5KTTA 1N36B 2FRVA 1RBQA 3DR5A 1UJBA 1ZI8A 3QE2A 1G8GA 3ZV7A 1GPWB 2IPXA 4IIFA 4DPLA 2DHQA 2Q2NA 1OBHA 1UBRS 3AXSA 3THYB 1Z6YA 1USWA 3REQB 1O08A 4QA9A 1PG5A 3LQ4A 4G56A 3LZ6A 5K4AA 3VZCA 2QTVB 4K1XA 4MARA 3VTAA 3G0HA 2ZJ8A 4F9EA 3V46A 2JJMA 1XEWX 4FCCA 3BULA 2R60A 1FTWA 4E31A 2C98A 2RDMA 3HDVA 2Q4DA 3NHAA 4KRGA 3A4LA 3DLAA 4QOEA 1DKMA 2HWXA 4L95C 4TROA 3LZCA 4ND7A 2VA8A 3GDOA 1YJ8A 2C29D 3WYBA 4BJ1A 3NRBA 2C31A 3L18A 3VPSA 3OZUA 7REQA 1GVNB 1W1UA 4LHVA 3WL4A 4YAUA 5CT5A 2P0YA 3V55A 2VXCA 3GT4A 3NHLA 4DLBA 3MJHA 3ESXA 3VU8A 1ML4A 1NHWA 4ZGGA 3PHLA 2JAPA 4UAGA 3X1KA 2AA3A 2I2AA 2NU8B 4IWNA 2OZKA 1E1QA 2WE7A 2XSZA 1WUIS 3OP4A 3U48A 2W6CX 1ZFNA 2BJWA 5JNVA 4L02A 2CV0A 4GMFA 3FWYA 1GRRA 3MBOA 4NATA 2W2KA 4RIFA 3RF7A 4IF4A 2FOLA 3Q5GA 1EA7A 4RU1A 4BNTA 1SOWA 1U1IA 3R9KA 1R3UA 2ZS9A 2O8FA 3RYCB 4ZEOA 2BSAA 2FPWA 2XJ4A 3JYLA 1AXRA 3FPLA 3ND6A 4X1OA 4EJ0A 1Z6QA 2KWIA 4HNAB 3THXA 1Z26A 4C4ZA 3IAM1 3ND9A 1EM8A 4YCSA 1H2RS 2RI1A 1U5BA 1EFPA 2FG6C 1N34B 3D8RA 1XN1A 3MA0A 5E1DA 1NXTA 2VG8A 3QLUC 3MJRA 1EH5A 2EFJA 4ENTA 5IU6A 4WZAB 4YRBA 1R4MA 3C74A 4KO2S 3FOAA 3BL6A 4YAWA 4C0BA 1U28C 4XIGS 5EIXA 2IELA 3I9V6 1XZIA 4MAMA 3COSA 4UC0A 2YV2A 5AM3A 4N5DA 2AN3A 5TIIA 5LL6P 2YXDA 4NZYA 2XCLA 4RWZA 4WKPA 4XE5A 3G9UA 1ZJWA 2XQVA 1W4BA 2O2DA 3N8IA 1SVKA 2P91A 1Y4SA 3G2QA 2OMKA 3B6ZA 5AH0A 3QPVA 3A1DA 1C0EA 2YWGA 3F3MA 3HJAA 5EHQA 4ZHQA 5KCZA 2BFFA 1M10A 3HG7A 1GSHA 2FPIB 3KZOA 4QUIA 4QOGA 5BUSA 3EIXA 1H1LA 4ROSA 2HJGA 4O25A 1E2HA 4CDMA 4EDHA 1M54A 1QR2A 3TR5A 3RFCA 4CMEA 5IH3A 4U63A 1QV7A 1GYQA 1ZAKA 3H8JA 4UVEA 3TK1A 5B3KA 3WAGA 1QIKA 2CNWA 1AUOA 4QRHA 1P7WA 3D4LA 4LOHA 3NQ41 3O82A 4EJSB 4EF5A 5C35A 2P6RA 4RV9A 4DIUA 1KDTA 1EPUA 3GFFA 1EDOA 3DC7A 2RHBA 3H1FA 3LF2A 3PIDA 4Z0TA 5EMKA 3I5XA 5JZ9A 2QYTA 3D02A 4UJ5A 5IDVA 3HDGA 9LDTA 1QIEA 2FWNA 5DYWA 3PNYA 1ZG3A 2WWXA 4HWRA 5BXQC 4NEQA 3CKYA 3GBPA 1G7TA 4PFKA 2UUBB 1VYHA 1USGA 3ACBA 4A9AA 4EAAA 4BRWA 6YASA 1CEXA 4E3WA 2FPLA 3K32A 4OAQA 3QU9A 4TXMA 3WMEA 1AHHA 5LU8A 2CYCA 1X8LA 2QX8A 3JD0A 4EH1A 5EAIA 5AJTA 4YP9A 2XZTA 4KTTE 1Z68A 4AJIA 2WFMA 3JD2A 5T4BA 5TPZD 4N41A 4BTEA 4I1SA 2V9PA 1XNGA 2JI6A 1DCMA 1IN6A 3HR8A 3O0DA 1NX9A 3ZPXA 4XUGB 1LEHA 4IFTA 4R2MA 1LSUA 4M99A 5LN1A 3GYBA 4MTLA 1UIMA 4X8HA 2AXNA 4YI5A 2EF1A 3T61A 3UYKA 2XMDA 1JECA 4IJWA 4RF4A 3HEBA 1Z2NX 1IBKB 2DBVO 4FFSA 2HJ9A 1ISGA 2XXBA 3AESA 1EGHA 3MUOA 3VOSA 2O8BA 2JI9A 2AJDA 3FUTA 3U1VA 1GRQA 3QI7A 2FZGA 1F48A 3D6HA 2XRZA 1IQRA 3DHYA 4PGFA 2WG2A 4UZEA 5BN1A 3T9CA 4JA0A 2G5GX 2CLIB 4M36A 1NG1A 4U8GA 1HORA 2PRSA 4EHNA 4Q3NA 2DHCA 4ZVSA 3RRNA 5K6RA 5EQDA 3ZQ4A 1P9RA 4LOLA 4ESEA 1OLOA 3EPKA 2IDJA 2Q3EA 2QDKA 4IJ5A 5KTPA 1L5SA 3AETA 5KC8A 5CX4A 5LQNA 2GXAA 4Z54A 1L8AA 1PGJA 1QIIA 2KQUA 6REQB 3G2PA 5AVTA 4RD6A 3C1AA 5AI4A 2OFXA 4P3OA 2O2XA 1FW8A 3KTAA 2XUHA 2HCBA 5IAOA 3W2FA 4L9AA 4PANA 5MF6A 3DLBA 1TW3A 1YDGA 1WHSA 4DW8A 1N6HA 4G5OA 3R3HA 1CVRA 3FJOA 3SIRA 1SZJG 1XQVA 1R6VA 2VNHA 5A5FA 3FOCA 1NJFA 4RA6B 4NE9A 1WUKS 1QYRA 2BEWB 4I9HA 1XP8A 5EERA 4TVBA 2QAGA 5C5CA 2CXRA 2AH5A 2A86A 4Q4DA 2PH5A 1DQZA 2R7NA 5DHAA 4ZCPA 4EY8A 2B1JA 3CURA 4C7XA 2FSGA 3NALA 5BXYA 1Z62A 1G66A 5CK5A 3AM4A 1RZRA 1RKVA 2QROA 3CKMA 1FUKA 3RABA 3SQXA 4AKIA 1ZY2A 1NOKA 1SC1A 4TN5A 4ND8B 3COZA 5CH8A 5IKOA 1FFEA 1TM5E 3ESZA 1DO2A 4MV9A 3A8TA 2YIVX 4AZSA 3OU7A 4XYMA 2V9CA 1UXIA 1VFPA 1CV2A 2QSUA 2VYND 1LXCA 5M3BA 1YL5A 4IW3B 3LW7A 5DNUA 3OT1A 3ETEA 1BOFA 2W2VA 2XCOA 2X23A 3GVPA 3HBFA 3PHCA 2W6JA 4MNTA 3VKGA 1YB5A 1ZOSA 4Q1DA 3VJLA 1JI0A 4BNDA 1RLUA 1XOIA 1LBQA 1WUJS 4GMXA 1IOWA 4ID9A 2OV1A 2YWRA 3E5NA 2OPBA 2BUAA 4JMLA 4IGIA 1NZJA 2B94A 4O4LB 4N5IX 2ZRQA 2J5BA 2WKRA 1TVKA 2MYNA 3GLQA 2ZPTX 1II0A 3N5KA 3Q0EA 2QAIA 1P17A 4FEGA 4HNGA 4A3SA 1DAHA 1U4SA 4G24A 1GZ4A 4O2BA 3P19A 1DB3A 3EZFA 3FPAA 1UKAA 2CXUA 4QJIA 3IDOA 1IN8A 4G5GA 1V6CA 3ZCTA 4E4TA 3HKCB 2GBFA 1GA4A 3KLNA 4QVKA 3B13B 3C97A 3E2PA 1CY2A 5KYUB 2NO9A 3E9YA 3CXUA 3M6MD 1E7YA 1NBMA 4RCYA 4EMTA 5H8WA 4DR6B 2HQ1A 3CLSD 3EG9B 3ZIDA 5CEJA 4BVBA 3RJTA 5KNDH 2RGWA 3NR2A 2D1QA 2PGXA 4G97A 3H2HA 4NDNE 4X90A 1W5AA 4DV0B 3EDOA 1NC3A 4GKBA 2ZBVA 4DV2B 1U9IA 4KN5A 3BXEA 5F4BA 3AY6A 2WYOA 2AOTB 3EPPA 4X8MA 3FMGA 4DUPA 1X2BA 4EW1A 2ZRGA 3QEOA 1CJTC 2F3QA 3G2KA 2FY8A 4OXYA 5CVVA 3RADC 3KM0A 3K6SA 2Q6KA 1SC6A 4C89A 2Q0QA 3IAS1 4HAXA 5KIAA 1SVMA 2ONZA 3DE4X 8ATCA 1JFLA 1XRRA 1SEVA 5JMWA 4DA9A 2Z5FA 1BN7A 4ARZA 3JWPA 3T6KA 1KAQA 2VH2A 2QI9F 4ZAFA 3B5IA 4C88A 1FX1A 1KZGB 2H8GA 2PWPA 3ZZ1A 1L7AA 1T6BY 1ZEMA 1RZ3A 3LLVA 3Q98A 1Y89A 2HB6A 4JFRA 1XD2B 5FWYB 4DE5A 2H2DA 4FK8A 5KOYA 4DIKA 4P5EA 3SYNA 4LYHA 2OCYC 2F1IA 4ZXPA 1I9CA 2Z3ZA 3UICA 4F96A 2OKCA 5TT0A 1BU8A 1I13A 1LFDB 3GZNB 2CZQA 1SHUX 3AV3A 5A4JA 3VR6H 2VUHB 2DT8A 2B7BA 1QIJA 3LVQE 3VKFA 3E0XA 1Q3TA 4XASA 1GL3A 2NZ2A 2GF0A 2NYAA 3HABA 1M0TA 2FW1A 3N2ZB 3ETCA 3ROKA 3KDAA 2JKYA 3UUWA 5CEFA 3N76A 3MEQA 4OGGA 4DG8A 1R0BA 1XDUA 3IO5A 4OLAA 4M46A 5HSGA 5IJAA 3RC2A 2V55B 1E61A 1U0SY 1R7RA 1T3ZA 1G2QA 2FR0A 4H35A 4Y6PA 4PCVA 1FQWA 4E12A 1ML3A 2ZTSA 1PT9A 3N8NA 5ALJA 1D1SA 1YS1X 3L5OA 5GM1A 5IT0A 4XCVA 2HMUA 4OQZA 2ATCA 4YJDA 1V9SA 5T8KC 5C4MA 2VK2A 1MKYA 2H8KA 2WP0A 4AVYA 4PXSA 5EHGA 1Y42X 2WUVA 4AWAA 4MRAA 4D5EA 2NO4A 1J7JA 2HK9A 3RAPR 1K92A 2J67A 2NO0A 1H2WA 3ROTA 3D3WB 4G2NA 4QDXA 5FO0A 1E1YA 4DLVA 2O2EA 4OJKA 3OLYA 5BVHB 3EZNA 1UJ4A 4FEAA 4JX8A 1A5ZA 1SIWA 2D00A 5H4GA 3CLUD 2PLFA 4PWYA 6ADHA 1JR3D 3UMYA 3EYWA 4UNIA 2Q1WA 3KKEA 4I5IA 1IZ7A 1E66A 1KJQA 1L4NA 1VCMA 1XX6A 1Y1LA 2H51A 2ID4A 3I83A 4ON9A 5E9QA 3GXBA 5EHNA 2CV2A 4ZOBA 2Q5IA 2VQSA 3UYLA 3OJLA 1SCKA 1G3RA 1MRSA 3A3KA 3ET4A 4FJ0A 1T25A 3KXLA 1GG2A 2JBAA 1JQDA 1TYAE 1DDIA 1X8XA 2HF2A 5CITA 5IKXA 3PXGA 2SBTA 1MD9A 1JLMA 4INJA 5IMBA 4GMHA 5BWNA 2V5VA 5BQFA 5A3QA 5JCPA 2BH9A 5F35A 5GZ1A 4LISA 4AS3A 3O9MA 1N2JA 1GCGA 4QTXA 4BNVA 4RIHA 1DXOA 2ALJA 3B2EA 1S9DA 3CPHA 3IBSA 4J2TA 4M7WA 1D5WA 1ZPDA 3O2SB 4EKIA 3FMVA 3EH1A 1H5QA 4OYRA 1OZ0A 4HWTA 1KZ1A 4GKAA 4EPWA 2QG4A 2IYWA 2FVXA 1MORA 1EMDA 5B4VA 3IAAA 2XMBA 3AYXB 3HUEA 3IPAA 3DTNA 1YI8A 4KITB 4D9MA 1XVUA 2BEUA 3VPCA 5HOEA 3TQTA 3DTVA 4WGGA 4BPRA 2W2NA 4UOEA 3F7MA 4HWPA 3MOGA 5FFNA 1EXDA 4NX2A 4X1IB 5KINB 3LBYA 3IOMA 4J16A 4YV7A 2WW8A 3SE0A 2QPAA 1NXQA 2GF2A 2Z57A 2DZDA 1VKJA 1LDEA 1SIUA 1R8QA 1T9DA 2ID9A 4Z0NA 3D7MA 4P4NA 1FTSA 2NP7A 1S1CA 4C7JA 2HDOA 2IYVA 2KM1A 3KOYA 2NP6A 2OYRA 3HWRA 5EVJA 3N9IA 2QVYX 5JAQA 1JGTA 3PXEA 2PCJA 2GPTA 2B7CA 3LDUA 4COKA 5H9WA 4Q4HB 1C1DA 4Q4CA 1SXIA 1VIAA 1OIWA 2IZ7A 1XGKA 2EP5A 2Z58A 4DEXA 2GZRA 2EEZA 3M9LA 3ZTTA 4GX0A 4QYIB 4F92B 1VA4A 3E6AA 1X15A 1Y1KE 3CUEF 2OECA 3QF7A 4X7RA 3TOXA 3U7RA 4G8BA 3VISA 3PNLA 4YPVA 2CXQA 3R0JA 3VHRA 1S96A 4NL4H 1OKKD 1G63A 3MN1A 4EKGA 3HDJA 1Z4KA 4PYMA 4G4GA 2OD2A 5C8YF 4CNBA 2ERXA 3WS7A 1ZNYA 4K6MA 5EKXA 3GPBA 1ADJA 1IXZA 4MSUA 1QHNA 1T15A 1VLZA 4EHHA 2PWAA 4BJ3A 2BE7A 1TQHA 4IRUB 3N5CA 4XB6B 3FGZA 4C87A 1G5QA 3IP7A 3N2GA 4FW8A 2QTHA 3GHYA 3IPXA 1Q6YA 4UOZA 4A91A 3UNXA 1RBMA 3JASB 4FPXA 2GS9A 3IP3A 5K03A 3K5HA 4RAQA 4D7AA 1MB9A 3P0FA 1PL6A 5AKJA 1KQGA 4AJ1A 4CT4B 4GNKA 3I64A 3BD6A 4I99A 1QUFA 3IMEA 1ZWKA 4UBOA 4DIDA 1H2FA 2DTEA 4GO1A 4LXXA 4KUHA 3GAMA 2EFDB 5KJEA 3CLKA 3N2NA 3C3EA 3QU2A 5CDGA 3FLAA 3AB3A 1GM5A 4PNEA 3H2SA 5TMPA 2ORIA 3HMKA 4L08A 2W2QA 1T9KA 1JTFA 2WFLA 5TLSA 5EESA 5BYJA 1MOZA 3FD8A 4BP3A 2AC4A 2POQX 3IHLA 4PC6A 2XKJE 4CCYA 1DCFA 2ISCA 4RKRA 3K0FB 1ZAYA 3H5TA 5J4HA 4TYYA 1O9HA 4XGQA 3GEEA 1WV1A 4JWKA 3R7FA 5LKRA 3R24A 1GFIA 5CIYA 4ZI3A 1DKLA 3KFVA 3X0DA 2REBA 1I24A 3N7AA 2BMWA 3H1EA 4K5QA 3RSLA 3TOSA 1MO3A 4C4RA 1KJ8A 1TFUA 2A57A 2PMBA 2H57A 2B36A 2BW0A 4WASA 4X9XA 1E32A 1XTBA 2B5VA 4ZI5A 3IIEA 4JJAA 1R74A 1XALA 4V2IA 4FDAA 4H3KB 2RKWA 3N0WA 2I0FA 1QPZA 2PZGA 1Z4OA 1K08A 2Y1LA 2JIRA 3DPIA 3OIVA 1VJTA 2A5JA 4JVLA 5LZ8A 3RHZA 4CMEC 4KH1A 3TB4A 5JSFA 4AMZA 3D4OA 2B1GA 5B36A 1YVUA 2IOYA 4QT0A 4MW0A 3NAMA 4B47A 5I4CA 2I34A 1EWKA 2BRUA 3TZQA 3BDVA 2P2SA 1ZM2A 3GQBA 4FFWA 1BH6A 1Y5IA 1OZHA 1YL6A 1TPYA 1SBNE 4C3VA 1KI9A 3TW8A 4M7RA 1QOZA 1SVWA 2JAOA 4JDUA 2JLZA 2C92A 1CF4A 3LPAA 4Z53A 3KOUA 5EINA 2QTCA 1YVRA 5E6RA 1N3LA 3AUYA 4F6RA 4KRFA 3KQLA 3S40A 1PT8A 2V7UA 1ADFA 5GWXA 4CIDA 2OZLB 1G21E 2JGIA 3DMTA 3S99A 5K3DA 5FUMA 2WKQA 3QU7A 2L42A 1V1RB 1XTZA 4J1SA 4QQFA 5G4KA 4ENPA 2FLVA 2VSFA 3F6EX 4PGAA 5EOVA 2NU6B 1RACA 3WZMA 1HYEA 1UBGA 1UK6A 2Y66A 3WP1B 1BMTA 4BKRA 1LS1A 1MJHA 3DGEC 2VC2B 3HP7A 1ZVQA 3MILA 2A9FA 3L0IB 1JSZA 1K0FA 4N8DA 4US0R 4LHWA 5I7RA 5LNK1 3QJYA 1SVUA 2WHEA 3N2LA 5IARA 4J0FA 1W9HA 3VYTB 3FF4A 4Z4GA 1PG2A 1EGMB 1QFJA 2I6QA 4A82A 2Q8NA 2IF2A 2YTZA 4LA4A 4HXFB 1ODFA 3BEDA 4LMRA 3HXLA 4YRAA 2XHEA 1KWGA 1YDMA 4OIFA 5JSZB 4YRPA 4UNQA 4LJLA 2NG1A 3HWX1 3O8BA 4JQZA 4OQFA 3ZHZA 4CM8A 3OTHA 4DIMA 1N6PA 5DP1A 2QF7A 4H6VA 4ZU6X 3HJBA 1K66A 2P9TA 3EVCA 4RF5A 4UU0A 4YONB 1FVXA 2C2YA 3V2UA 4IX9A 1KI7A 4KK3A 3T3EA 5F98A 4I1VA 1WLYA 5B7NA 5JT1A 2VP4A 1NVVR 4L7QA 5IBRA 3PITA 4YV1A 5FJIA 4WY2A 4DTCA 4WHMA 3UKJA 3MJVA 1U6JA 2GYUA 5ESDA 3ROXA 4GWLA 4CM5A 1NC1A 2D8AA 2J9XB 2NTYC 3T5DA 5A06A 1A4XA 1QH8B 5C8XA 2JLRA 1MB4A 4B7CA 5H5JA 4DOMA 5K7SA 3PLRA 4C2TA 3SJZA 1KBQA 3OM9A 3DDSA 4G81A 3QWIA 4LW8A 1YJCA 1XQXA 4HFRA 4WLNA 5BN3B 2CMGA 2N1MA 2J9FA 5F51A 2H4FA 4R54A 3K8YA 1Z73A 2QAGC 1U0NA 4ZVNA 4MRVA 4BX0A 3ENZA 3BGSA 3OEWA 3ENKA 3KR9A 2REQA 3FVRA 4OGFA 1QQAA 1A50B 1RPAA 3F3SA 3PHGA 4WZAE 5KTMA 5KTOA 4QGAA 4RM2A 1HZZA 2GYVA 1BCSA 3CX4A 5HG0A 2WAYA 3E7XA 4FNGA 4LDNA 3UUEA 2V58A 1PYGA 1Q12A 4J0EA 4JXZA 2RK3A 2LZ0A 3LHKA 5IM5A 1QQBA 1MC4A 1FSFA 4DV5B 1EIWA 1O94D 3P9IA 1XG5A 2JHCA 3SQOA 2WK1A 1I5EA 4FBMA 5T64A 1OFUA 2CEKA 4F5ZA 3YASA 4NWIA 1RR6A 3I92A 5DMHA 2X0KA 3VNVA 5LQJA 2VF7A 3KU1A 5EJMA 1DKQA 1PLJA 1RLIA 2PQMA 1MAHA 1FDWA 2R62A 2BP7A 3MS4A 4IDNA 1J8VA 2OCPA 3AP2A 5GMOA 4XLTA 1LDBA 5DYGA 3RSOA 3R23A 4O4LF 5AOAA 1EHIA 4DUGA 3G7SA 3ORYA 1W6RA 3WBJA 2HK6A 2XMQA 5DM70 3SKYA 2XNCA 3EXEA 3NO4A 1RHKA 1KE1A 3ASVA 1ONPA 5HZKA 3HCFA 1VE1A 3NBQA 4GXNA 3WLRA 3H97A 3K92A 4KR7A 1EA5A 1U0BB 3DDUA 1LDMA 4D9KA 2K2WA 5CVDA 4L6CA 2NO7A 1E1NA 3MQFA 3BIXA 3P32A 2ORYA 3PEUA 3PEVA 1HEUA 2A1UA 2GEUA 3I45A 3IMKA 4H3SA 2MMGA 4XWTA 7MDHA 3K9WA 4YV0A 2AR0A 2AUMA 2QTTA 4H7PA 2C61A 3GRUA 3HYCA 5CW1A 5K09A 1K97A 2BBTA 2O1XA 2VHXA 4WKCA 4GPBA 1IY2A 2ZSKA 3DPUA 3VZSA 3WGYA 4LC0A 3WWPA 3WZ2A 1ZC3A 5A4KA 4KE8A 1R8YA 3ZDZB 2QVXX 5IJ9A 3AFGA 2GK7A 4PNPA 2I8AA 2B21A 4S0XA 1U9IC 4GP7A 3CEJA 4GRAA 3LUJA 2O2HA 1ZGJA 4J7UA 3OWOA 1B42A 3C6KA 3LOPA 4NOMA 3KV3O 4Y2TA 1DS6A 3RYFA 4EBFA 1HGXA 4MVJG 1QMPA 2ZT5A 3AHCA 4ER5A 1V5WA 3NHWA 2WWHA 2G1PA 1X1SA 2BV3A 2XEDA 4ZEWA 1T91A 4JI0B 5DGTA 4H1TA 3QBJA 1QZ3A 1ZISA 3R6TA 2ONJA 4HEJA 3GVHA 4BV8A 2VT2A 4NK4A 4HK4A 1E89A 4FJ1A 1F12A 1OH5A 2VTDA 3C8HA 3RFTA 2PH7A 2OHIA 5MDHA 4RS3A 3LAWA 5L7TA 1NDUA 4PZ9A 3E9NA 3D1JA 4IEEA 4ETNA 3OZSA 4EECA 1ZD1A 3Q7QA 1VHJA 3BGDA 2EHDA 1B4DA 1ZR4A 1LKZA 2CFIA 1ZHFA 1N1EA 3DMFA 2X3FA 5J2TB 1X7ZB 4N0MA 3CVUA 4ESVA 3C8MA 2FWBA 2G4CA 3KXIA 4RO0A 3WQQA 5T6BA 3I52A 5JLAA 5JMTA 3C3BA 3P2JA 1AB5A 2ADOA 1HC7A 3K6JA 2AOVA 5CT9A 4YAJA 4CCWA 5BURA 3K0BA 1RQXA 5TR9A 2QVZX 4E1BA 3QFCA 1NNLA 2R751 4KR2A 1SM4A 4OLHA 3DO6A 5F5XA 4B76A 4YASA 1U2TA 2JHAA 1C1YA 1I3MA 1LDYA 4KFTA 3C6YA 1WXIA 1DX6A 3L0SA 4IFBA 5H0IA 2C95A 4OX9B 2W2KB 1IWOA 5I9TA 3T5MA 2PCLA 4YROA 4OHFA 3V8RA 1EFKA 4UXJA 3W1VA 3ZHSA 1T1GA 2OEPA 2ZSDA 1JIXA 3SYKA 3UVEA 4I6GA 2FOXA 4R0MA 3H8VA 4NDAA 3FDIA 2INGX 4S1OA 4YECA 4CU2A 4DABA 4RENA 3OZEA 1YQXA 5C5IA 1Z45A 1HEYA 3JTMA 1YZYA 2Z8ZA 2ET6A 2RHGB 4RK0A 3C70A 4UASA 4KWCA 5CT8A 2ZJZA 3TTYA 2F48A 1EFPB 3FGOA 3HACA 4X64B 1OB2A 4HUQA 1T13A 3UK2A 4AJOA 4DDTA 1R4MB 1GCUA 1T5SA 3HKEA 3OSZA 3W05A 4CHTA 3U4DA 4UE6A 2LWIA 4U02A 5LXTA 2Q0XA 3RYHA 2JLWA 1OI2A 3NC4A 4LJ8A 1EX7A 4KK4A 5JTTA 3ADKA 221PA 4XSGA 5JD4A 4YRLA 2YMPA 3CRMA 2OQ2A 2QUKA 1L1EA 3SLRA 2DFVA 3GH1A 2O2SA 4J8PA 4C6SA 2NSLA 2QAJA 2P4QA 3ANTA 3WSWA 4UCWA 4ZHQB 3RS8A 5LM3A 4WFQA 1CCWA 4MH0R 1ICIA 4G4SO 4HRXA 1M1UA 1NW4A 2JAUA 2NTJA 5D8DA 1U0OC 3PR3A 5AHXA 2C78A 1CEQA 2Q4BA 1NSFA 2W2LA 3DEKA 2JAXA 2A14A 1KJIA 2UDPA 2X1LA 3CPEA 3OAAD 4MLDA 1PEAA 3Q7TA 4C3OB 4NCAA 2XCTB 1JEAA 1AKRA 3NHPA 2K7FA 2O8CA 2HSDA 1QDUA 1TMYA 2PXAA 2ZRPA 3FNQA 4LYGA 4TX1A 2ZYWX 4HTAA 3A4NA 4JOSA 1GUFA 1ZSVA 1K7CA 3OUTA 2QVBA 3D4PA 4L3WA 3IJPA 1D0IA 3VVLA 1N5RA 1K68A 2DFLA 4NSNA 3ZD9A 3ZHUA 4YMLA 4BKUA 3G1WA 3K09A 1G8SA 1OFUX 3QE3A 1C7EA 1XWFA 1XZNA 4MUAA 4G5YA 1T9ZA 1WMAA 2AQKA 1LW6E 3GLUA 2VZ9A 3PYMA 4OKIA 2Q7DA 3M4JA 4B3HA 621PA 4YCBA 2XIJA 4QQKA 1Q6ZA 2ZXFA 3QX3A 3VPFA 2PUCA 4RJLA 4YFVA 1F0YA 3BSSA 3D4IA 4PF1A 4JLUA 3FCAA 3H1GA 2A5FA 2HRZA 2NWQA 2E4XA 2SICE 1UKCA 2WBLC 5JZOA 2OB2A 1V11A 1EX9A 4MW6A 2FFBA 5PNTA 4D9JA 5LIPA 1UIRA 5BSHA 1J0BA 3SXUA 1ZLXA 4DXHA 4QDKA 3KWLA 1GGJA 1L7RA 3HKBA 1KC3A 4ZREA 3SHQA 3MT8A 3LFHA 4KB5A 3B9QA 4QU5A 2W83A 3DR3A 4TSFD 3U49A 1ZX1A 3L0DA 2LVBA 4UMFA 1PJ8A 2QJWA 4OP2A 1HNWB 2BFBB 5HCUA 2XMGA 3CG4A 3AESB 1C3OB 3DOOA 2O8BB 2WUDA 4AY6A 4TTTS 1ZJYA 1VIVA 4ETIA 2E1RA 2UXCB 4CCSA 1T8SA 3T5TA 4C2AA 4WK6A 1GXSA 3N07A 1XT6A 4IDGA 3BZBA 4YT4A 5GINE 1NI5A 5KNCH 1WQ3A 2RHMA 1VBMA 5COAA 1NW9B 1KI4A 4C4AA 3ZIAA 1E3DA 4MUHA 4IFEA 2R6JA 4B6EA 5G0UA 2XZDA 3AETB 4C0SA 1LBEA 2SKDA 4QGHA 3DNFA 4FD2A 1J8DA 2AVNA 5EPUA 5KTSA 3MCWA 2QVLA 1R18A 2CNLA 2ZRKA 4O08A 5DE3A 2VJPA 4F46A 1AKQA 1JXMA 3IKVA 4C29A 3V97A 4JJ4A 4RUKA 5HKKA 2L82A 2A3RA 3EODA 3KTAB 5AHWA 4CKBB 3JV7A 1HURA 4AZVA 1IHXA 1B3BA 1G291 3AR4A 1IDOA 3KFXA 3U7QA 1WHSB 3PVZA 5G53C 1RWQA 2Y05A 4LVOA 4ECAA 3MZ0A 4B43A 4QNMA 5LJLA 4NXMB 4Y6RA 2GPSA 5BYKA 1FMJA 2AGVA 2YWJA 4Z4FA 5EWMA 3HBMA 3KOXA 3OZFA 3HHEA 4ZYXA 3CJQA 4DDKA 2QAGB 2IS2A 2LGJA 2Y27A 1FXWA 1ND6A 2ZYAA 4BDSA 2XADA 4LJAA 1FDTA 4MAAA 1A1VA 2AMLA 3T3DA 2ZJBA 1KKLA 5EMJA 3UJAA 2CZCA 2JVKA 3DAGA 3RRFA 3WC4A 1SEPA 2IIPA 3HS3A 1W52X 3L7DA 2YVQA 4K9SA 3HEMA 2Q99A 1UPXA 5EYPA 3TMAA 3ZJ5A 4HO1X 2YFYA 3KWFA 3RAJA 1D7AA 1LC0A 1A88A 2EWVA 1QGAA 4DQVA 4A6DA 3V4ZA 2E4ZA 4OLBA 4OBBA 2PT9A 2YY6A 4WADA 5A4MS 1NUPA 1L7EA 2YOFA 3R7WA 1L9XA 1QP7A 2ZBPA 5JJKA 4ZAGA 2D2IA 5AW2A 3EUEA 4KXUA 3PV0A 5AK5A 4QHTA 4QO8A 3A6KA 2PX5A 4O8ZA 4M37A 1HYQA 1C4WA 1TUBA 1VMDA 3T5PA 4KFSA 5LDGA 4TXJA 2VPZA 2KS6A 3TR0A 1QHGA 4QJ5A 3O95A 1X8KA 1G3MA 3E18A 4BNDB 3QK7A 5E0KB 3VX3A 4QBKA 1RRCA 2JLCA 5C3UA 1TA9A 5I7HA 1EESA 1JPVA 2F1JA 4BRUA 1CR0A 4ZT6A 1BDIA 4ARCA 3QPDA 4MYTA 5LLSA 2Z04A 4V0ME 3SC4A 4OQPA 1FFCA 3C7TA 4Q9KA 1YQWA 4HAIA 4U9IS 3ZWWA 4EA7A 2BRUC 1HTBA 2OBMA 3L7OA 3LRPA 3N8KA 5B3AA 2ZJ7A 4NYJQ 2Y0DA 4O2BB 3UA4A 3WO0A 2P4HX 5T4HA 1XWIA 3U7IA 1Z34A 2ECQA 3P9NA 4WY8A 4M55A 3FPKA 1X1CA 1K7SN 2LKCA 4DMLA 4MVJF 1OJLA 4EKEA 2G8NA 5FX2A 4IKPA 1NUAA 5ICEA 2YWEA 4ND1A 4LFCB 1KEUA 1GN8A 1FB5A 2H9IA 4K28A 5L53A 4IS2A 3RSZA 1WBDA 1AZLA 3S8MA 1DBWA 3B5EA 1BYIA 3OFSA 1YB4A 1W1WA 2JFWA 3DMTC 4B83A 1NWHA 2FYTA 2ZWIA 2FMFA 3BZUA 4G8JA 1TK3A 2YVAA 4FHFA 4LY0A 1Z18A 2VUUA 3GLHA 1EEHA 2ENUA 5G0WA 1QRAA 3K6SB 3I9FA 1WMBA 1JKMA 3IUEA 4OF4A 3FOFC 2PSHA 3LTNC 2O7VA 2QTGA 1J0DA 3U60B 1I51A 1BA2A 1XXLA 1Z08A 1T2CA 1ZW1A 3O5AA 4OK6A 2QNBA 2XUDA 3B70A 1EVJA 4ARZB 1U5CA 2FXIA 2CNBA 4WINA 3AEYA 1DZIA 4KXWA 3T4EA 3K1AB 3WXMA 1CRQA 1OREA 1WE2A 1XKQA 3M6XA 1OUMA 2OUIA 3GLIB 1RZUA 3N75A 4F2WA 4XWAA 1YRWA 4TVKA 3PUYA 2IXAA 3L1JA 4IHKA 4R98A 5ADUS 1NVTA 1PQYA 3QFFA 4FE7A 4JBGA 1I7NA 2ZBQA 3UAZA 4YP5A 1XRPA 4C05A 1LW7A 4ZKDA 5EZYA 5LOVA 1I80A 4G0NA 1TTTA 3BE8A 1AOXA 3RROA 3NKFA 1BX0A 2R97A 2V59A 4QG7A 4Q1FA 4B46A 5FNVA 4AMGA 1UXGA 1LUAA 1EJ0A 3OE5A 5L7YA 3MD9A 3TQOA 2JGDA 3LFTA 2QW0X 1DWUA 1E5DA 2IIBA 4IDEA 2P40A 3AIOA 3IVAA 4FHZA 4BP8A 4BYGA 3UUGA 2IFTA 3FMPB 3M6IA 4MLZA 3TF5A 2PT5A 1NXSA 2CY0A 1VRWA 1WCXA 2AMJA 6AT1A 2QD4A 4DEVA 2ZRNA 5HM8A 3O3MB 1R8JA 1TLFA 4TLLB 4QRDA 2CBZA 2FXVA 4REQA 4WXPA 3MXTA 4DBZA 1ISPA 1JIJA 1QLHA 1STOA 4L28A 3RU7A 4KXQA 1E1DA 1W75A 5EI5A 3T1OA 2ZJ6A 4P98A 2GVZC 3UWMA 3D7SA 3E3MA 1JDNA 1SN7A 2HU7A 2ZKLA 2YQ5A 1CDZA 3Q8MA 3T7JA 4UNNA 2JAQA 4I5DA 2X42A 1U81A 3K72B 5JCZA 2EBWA 3S1SA 4MKZA 3SVTA 3S55A 2N46A 1T8RA 4JJKA 4M9CA 1HZZC 2BHTA 1GG8A 1X74A 2B0JA 1YFZA 1TO2E 3B9RA 2BLNA 3H19A 3Q3IA 3QPWA 3ZU4A 4BUZA 5JEEA 1RWNA 1NMEA 4W63A 3RRBA 2GZAA 3BCRA 1AN0A 3AKZA 3QPBA 4XIYA 4G9GA 3EPLA 5B3JA 2IDKA 2BDEA 3G82C 1LJUA 3LRXA 3OA0A 4KDEA 1Y37A 2J59A 3MT9A 4H3VA 4PG4A 5HF5A 4YAGA 5ES4B 3GARA 1NNI1 1F6DA 4LXQA 3L0CA 5G2OA 5HQTA 3L05A 5F1OA 3G3EA 4HPXB 1RHMA 1V1JA 2NSDA 1F06A 4H59A 1RWBA 5C2JB 1OGIA 4RLSA 3TWOA 4CM4A 4F4CA 4HAYA 1NTOA 4O33A 4RMIA 4GX5A 1EGAA 2JK0A 4RC9A 3MIZA 1BW9B 5FOSA 2BKEA 2NU7A 3L7MA 1XMSA 3TL3A 5JZVA 4RFVA 3JAWB 2VF8A 3A2LA 3KKMA 1ACMA 1TCAA 3OIUA 2IQ5A 4I9FA 3RHFA 2YCBA 3ZIAD 5JXHA 5HQ3A 1VHDA 4RY8A 3A2KA 4KPGA 3MCVA 4FFOA 2HWWA 1OXTA 3IRUA 4MGEA 4Z1MA 2RI0A 4V3CA 5AM0A 3WHPA 3S3TA 5DFAA 3GG9A 2BEUB 3NW9A 3DTVB 2QD2A 3DBRA 4MVJE 4DZRA 5IYZA 2PGJA 4IZHA 5JISA 2ZBRA 4PBSA 4RX1A 3S8YA 1E3MA 4RD3A 1NQAO 3FZGA 1A27A 4J29A 3UPDA 1TVEA 3ZJYA 4YRGA 1Z07A 5HKKD 2IHVA 5EA2A 3EVAA 4DA4A 4NZNA 2ZRLA 2R48A 1KEWA 3WB0A 1R00A 2G82A 3E58A 2E87A 3HU3A 1YO6A 1AC5A 2RC5A 2Q4TA 3NBUA 2NUAA 4TL7A 4KQWA 2X5JO 3VQTA 2HD4A 3Q72A 1BGXT 1JJIA 4DMMA 4TM8A 4HFNA 5AW8A 4YRDA 4AY4A 2DBRA 3AB7A 4CKWA 4AG6A 3HSYA 5K6TA 5EJ8A 1LGYA 4CM3A 4DCGA 1G0NA 2FSPA 5HS4A 1RQLA 3PL5A 3LVFO 3ZY3A 4QIHA 3VGPA 1S2NA 3NOXA 2GPWA 5CLJA 4K9MA 1HNXB 1RMYA 2F1HA 4JXXA 3T34A 1Z17A 3HN2A 5JI2E 1J90A 3CZAA 1GCIA 1FK8A 5ALVA 3QHQA 1Z4NA 1O9GA 4YAEA 3HJUA 4PRYA 3CEAA 3LCVB 1NJ2A 4ZAYA 4BO8A 4G1BA 2D4HA 5DT9A 2H5IA 1RXYA 3WLMA 2QXTA 5I7UA 1YQEA 2P2NA 1SQGA 3LP6A 3ITEA 2XNSA 3AO0B 3LBAA 1XTSA 1DQPA 3HA3A 4LSZA 1LDNA 2PUFA 1XVIA 5IFLA 1J7KA 3SICE 5EJEA 4OSPA 1ELOA 4E22A 1YXMA 3LPCA 5INTA 5J2TF 3KEGA 4HJRA 3F8WA 3LF1A 4BNLA 1E8MA 3I32A 2C54A 3DD1A 5ALXA 1V71A 2GAOA 2QRVA 3O26A 4DARA 2JH9A 3ZWCA 2Q8QA 1FJHA 1P1HA 1XZHA 2ASEA 3N2GB 1RPNA 4RACA 4WRRA 1EBBA 1RW4A 3KXKA 3TTUA 3ZWPA 4BVEA 5KEIA 2R4UA 2KLHA 4XSHA 4EITA 5DNAA 4YCCA 1VL5A 3AOEA 1UDWA 3U7FB 3GL9A 1ZMTA 3MQ2A 1SXHA 2AR7A 1YH3A 2WLTA 4MUJA 3QZUA 4P5DA 5FOVA 2H0AA 1CB0A 3BWDD 1KRWA 5HJEA 1AXEA 2GEVA 1P6XA 1Z0DA 4RSMA 2B83A 1YJ5A 3ZWAA 1CDDA 3WGQA 2OXRA 4E2XA 4LDQA 2QG9A 4LCBA 4YPOA 5B53A 4EPXA 1QIHA 2O8EA 4JLAA 1RLJA 2D7CA 2IOFK 3DUWA 2VJDA 2WZBA 4NIMA 1ZGBA 2AE1A 3Q2IA 3NC1C 2XYVA 2BF4A 1EFLA 2VWQA 3ENNA 3PX2A 3ILHA 1RHJA 2IBTA 2I7DA 2GHIA 1GR0A 3JQQA 2CLDX 2PEYA 3IB6A 3WRVA 4CCYB 4O4HA 4NNOA 5TV2A 3A6PC 3BVPA 4D1YA 3FCCA 1Q22A 4M1KA 4B2LA 5I8ZA 5JBIA 1PK9A 2TMYA 3CNHA 1MCZA 4R2LA 5AESA 1RABA 2XBLA 4RKYA 4TMKA 5K51A 2ZUFA 2AKAB 2A1TR 2XCIA 3AHFA 1GZDA 3AUKA 3PK0A 3QVWA 1Y4AE 4HMOA 4L4RA 4PLTA 4Z7JA 3J81k 5CB4A 4PQFA 3BRWA 1TEXA 2E0IA 3E15A 3GCWA 1RRKA 4QELA 2ODNA 4C14A 2JJ1D 1NMXA 2W8BB 4DLZA 1XZCA 3ENWA 2CJWA 3OX2A 2QTAA 4ZHQF 5B2ZA 1GRVA 4TKZA 4BKQA 1ZD8A 4P33A 3TQHA 3UMGA 2GH1A 3NORA 4DGQA 4HP8A 3JATA 4DSOA 4YRKA 2Z2JA 3KHTA 1EFCA 3Q10A 4WE3A 5D00A 5E8RA 5HJ2A 4BLOA 4E5DA 3ELWA 5HUHA 1KL7A 2MSNA 3V7FA 5AVVA 5J58A 5BQ5A 3I58A 5LIRA 2Z0MA 1RHUA 3G6WA 5KX5A 5EWJA 4EI2A 1EUCA 1HO3A 2A84A 3PR2B 3PDJA 5CX1A 1S4QA 2ZRBA 5EG5A 5FA6A 3TZLA 5BWMA 2C59A 4MR8A 3ABSB 4I1RA 2FP4A 2OYSA 3GQBB 3OQNA 1NW7A 4M21A 1WY7A 3G2MA 3DKRA 4AJ4A 3K09C 4QJBA 1Q0QA 3OLQA 4R8MA 3DT8A 3LDGA 3TW8B 1GU1A 1VCIA 2QENA 2YYYA 3U7JA 4ICIA 1RI4A 2EARA 3C7CB 3WL3A 4BAZA 4UHCA 1NV9A 3KKQA 3OH8A 2OK7A 4RWEA 2LCQA 5IWCA 5E6RB 4EG4A 2R3SA 1T4CA 4F6RB 2YZKA 5A3JA 4P83A 4FFNA 1DG3A 3AR8A 4OHBA 2VTBA 4LYJA 3CR3C 4MAFA 5DYYA 4EELA 3D0RA 1QBKC 3VR4A 1O54A 5B57C 4H4CA 3UPUA 2PHZA 3QYAA 4ZVUA 2OXFA 5G4KB 2ZB2A 4KBFA 3RH0A 4CTMA 4ZWNA 3PL1A 1FTGA 4U3JA 4HQ0A 5CFRA 1NW5A 2VF4X 3Q87B 4B8YA 4OFZA 1R64A 2V4ZA 4MYRA 4QYMA 3WWEA 3AI1A 3KQPA 2R0QC 3Q0TA 3UCEA 2EERA 4OHKA 1YCFA 3HVHA 1V41E 1XA3A 5BV0A 4LJ7A 5IAAA 4BE9A 1W76A 4TLEA 1PLKA 3T7DA 3FW1A 5KZMB 4PTLA 5G0VA 3RASA 1NUQA 5C3MA 2Q5LA 1M73E 2CFSA 1EXWA 2EG9A 3DBLA 4KXFB 5A0FA 4TTPA 1MO2A 1WCYA 4M38A 3T9EA 1BN6A 1NX6A 4MUBA 4OBXA 1IVYA 5TEWA 2G9ZA 1RI2A 1T8TA 2O14A 2O8VA 3KU4A 5A5EA 3PA6A 5FKJA 1P5JA 3ZLTA 5A4FS 1MVNA 3NDJA 1IHUA 4RD4A 3QXHA 1TPZA 2XOKA 1BZYA 4NTZA 9ABPA 3FVWA 2IXBA 2B8WA 2IU6A 4IG9A 2NPOA 3KE8A 3VJRA 4C5AA 1YQTA 2HPHA 5TXGA 3UUFA 2PUDA 4Z8XA 3RCBA 2BBWA 4N01A 2OILA 2IYFA 4WBNB 1ULBA 4CIBA 5L4LA 1ZJ5A 4TWBA 2Y1CA 3OU6A 3BIWA 1UBOS 3RRZA 1V16B 2BELA 2J8ZA 2ZJAA 3F6SA 3OIGA 5FPPA 1KH1A 3W79A 1OA0A 4UVIA 2EC5A 2HMYB 1W88B 1F3LA 1HMPA 1R0XA 1KYXA 3HYSA 4AS1A 3MCTA 4RDXA 1PR0A 5JCXA 1YU9A 5JXWA 1A5SB 1H1DA 2Q5HA 5CXSA 4ERXA 3O4HA 1Q15A 5CCEA 1JAYA 3H1TA 1GL9B 1XLWA 2R1ZA 1SQ6A 1SCUB 3FUUA 2A59A 5AD1A 4ITUA 4NOLA 4WKOA 1CX9B 5IDXA 4GUDA 3KBOA 4TMYA 4YP6A 3AW9A 4IKEA 5TQVA 5IH7A 1SD2A 2OO5A 1DSSG 2FDXA 3B1XA 3FRIA 3OFND 3DOJA 5CIQA 5BP7A 1ZM9A 4JEMA 4NMXB 1KNQA 1B26A 3FXAA 4P2GA 2WFZA 1HDYA 3JYPA 1Q1ZA 4WNAB 4HH3C 5JC8A 1K5PA 2E5WA 3HUTA 4UE2A 4MVCA 4YGYA 1ORRA 4Q1BA 1HYGA 4UTVA 4YAIA 3FSGA 2HA0A 3L01A 3LS2A 3LQRA 4ZYVA 5LZ4A 5HKBA 2JGFA 3U31A 3GIDA 1GA1A 2Q5CA 3D5TA 4LMAA 3SE7A 2WU3A 1NNUA 4KVGA 2QM7A 2J3EA 4C01A 5J5CA 3JWGA 4GGMX 3Q7PA 4R3NA 1RDFA 3VMFA 1R27A 2X5KO 1M6YA 1ZHHA 1N5OX 3QOFA 3GGSA 3VRHA 2VYQA 2BP7B 1WHTA 3W5VA 2RHLA 3W9UA 3VAAA 3L1IA 1F8GA 5AKLA 1IBSA 1HSZA 1M2HA 1OCEA 1DTEA 3H84A 4QLBA 5JZBA 3FJYA 1DAFA 4YN3A 4M98A 4TWAA 2DLNA 2YIDA 3ZNQA 3BGOS 4J3FA 4TT3A 1CEEA 2O5VA 2WJZB 4WLVA 4N1AA 1UKEA 4O2BF 3JQ7B 4TTSA 2YH2A 3WLEA 4C21A 2D7JA 2O52A 2D0PB 1RWPA 1U11A 1SH7A 2REXB 1SCQA 3K1JA 5IF9A 2OZEA 4ALNA 1EGQA 1KFBB 1XRQA 3Q2KA 3ZKWB 4EUNA 4NQRA 4ZI2A 2OCKA 16PKA 2AW3A 2Q07A 3GH3A 2WF9A 4DNXA 2BJVA 5JD5A 1NF8A 1WOYA 2F17A 3IERA 4F06A 5K8UA 2IH5A 2XECA 4MHTA 1E2JA 3LCMA 4NH0A 4NI5A 3V1YA 1EEXB 1X87A 5FO1A 1JKXA 4IUDS 2QY9A 2NSHA 1XMOB 5IJ9B 2OYCA 3QPUA 3NZEA 1GZVA 4TN1A 3P52A 1VB5A 1VOTA 4DTIA 2GR9A 1QQ5A 1T5BA 1PNQA 2PZFA 1SC9A 2AOWA 2VRNA 3A37A 1HDZA 2JFBA 5FL3A 2D0DA 3DWEX 4YXWD 1Z3IX 1E0JA 1WTCA 4KBYA 2DCMA 4A6XA 2W42A 4HQOA 4OHVA 3ZDQA 3TUZC 2QMUA 2P1RA 3MRSA 1Q7GA 2P65A 2WV9A 4UTRA 3IEIA 2R8RA 4M0LA 4II3A 4BQOA 5AJWA 1P1KA 1YB1A 3K6RA 4IDPA 4DILA 1FLDA 3LY9A 3O8CA 4KHZA 1RWXA 2GK4A 2QRHA 2VRWA 3C8ZA 4ZPXA 1I0LA 4AO7A 3T52A 2HT6A 4XUEA 1OWNA 1C4OA 1QTIA 1TQ8A 4HYEA 4LHYA 4ZGBA 3A1FA 5LQAA 4LE0A 3DNMA 1Z16A 4QL3A 3ZI7A 2B8NA 1E4YA 2PIAA 3VH3A 3DHWC 4MWBA 2G4LA 3QIVA 2V4UA 3KS9A 2HUNA 5REQA 3ZHBA 5D01A 1KEEA 3E1KA 4TRJA 5ALEA 5ECGC 2ZKIA 3NT5A 4INOA 3ZQUA 4HAWA 4BE4A 3F1LA 3KOMA 4GSLA 5LZ7A 1KFJB 2FEPA 3N0TA 4MB6A 2OVBA 3OBBA 4YI3A 3O47A 2Q6OA 3OFKA 1CUWA 5DBOA 4BMDA 4WOBA 2RHRA 5JDIA 1NZDA 3CVVA 3ADPA 1BQ4A 1VSUA 3KLOA 5KYVA 5B1YA 2AWNA 1EDZA 2B2XA 1V45E 3ED1A 1N7GA 1VLMA 2YUTA 3BSFA 2FB9A 4UXHA 4D41A 2NPFA 5B1EA 1WBJB 4L4SA 5DTEA 3VMMA 4EJFA 1NLFA 1J5EB 1H0SA 3W78A 3F49S 3GJ3A 1SHZA 1WSDA 5HJ7A 2DTXA 1S2MA 1R0KA 1UXHA 1FRNA 4WK4B 2OTCA 2XQJA 3PTLA 4JC0A 1QRSA 1U8UA 5BMVA 1K2WA 4KLZA 4IUCS 5D3MA 4B8WA 5HJ5A 2HM7A 1UJ5A 4XKJA 3NP9A 2FFRA 3FNIA 4FX2A 4Q1AA 3QV1A 4L7VA 4ZO7A 4E6EA 3IDQA 3TMYA 2G80A 1VE5A 4V03A 3RYHB 5CFLA 5LXTB 4YV2A 2W4QA 2P68A 4R69A 5FTLA 4RTKA 1U7TA 1O6ZA 5EP3A 5B3JC 4Y9UA 2C9BA 2YXEA 5E1OA 4W5TA 2R1VB 1RADA 5JJIA 3AGQA 6CHYA 5KNLA 1A8UA 1UBUS 3EGWA 4YDQA 1E2FA 3NYQA 3OI7A 5COQA 4XQ9A 4DCVA 1P5RA 3H87A 4UHFA 4B8ZA 2Y9MB 5I3CA 3LBIA 1HRKA 5ENZA 4IH1A 2HWYA 3LKZA 1OZFA 1MMFB 3S2UA 1L5WA 1BX3A 2D06A 1GKLA 4CUKA 1H3NA 5F73A 4QOSA 3BSWA 4JR0A 3PCTA 5KTRA 1UM9A 4RKFA 4AG3A 1CUDA 2VDNB 4PRLA 1SFRA 2O8CB 3O4GA 5KWEA 1B8VA 1ZUNA 2HU2A 2VQ6A 3SZUA 1WMEA 3MFYA 5FF9A 4E33A 3DF7A 3FB4A 3WZLA 1V7CA 3U3XA 5GGXA 4CT5A 4JI4B 2GJSA 3FETA 2XXJA 4GOMD 3HCOA 1Z0UA 5LQMA 2RKOA 3MUNA 4H7KA 1TZKA 1FC0A 1B43A 4BASA 3LC7O 5HX7A 3CKLA 4P6VF 3VKVA 1WIWA 3NT2A 1DBQA 1OASA 2BM0A 3NBYC 4INZA 4JQOA 4M49A 4CIXA 2CDBA 2QTNA 3INNA 2ZLBA 2RGXA 2OE2A 3WBFA 3V8PA 2IBSA 3FFWA 5AK0A 3RSGA 3HADA 1N2CB 5FFFA 4M1SA 3RC1A 1XDBA 3ER9A 1QHXA 3JWJA 2I4IA 4H9GA 1G2PA 1H5UA 1KR2A 2AF3C 4EG0A 3UJNA 2CNOA 4E1VA 2Z8YM 2FAXA 2GWRA 2YN0A 3DZJA 3GO4A 1V11B 4XPIB 4D9CA 4NS1A 4D42A 4LVCA 5EIWA 3RS4A 4OMDA 2QMQA 1JKIA 1Q3KA 3AP1A 4KIGA 4PAWA 3SXUB 1F6WA 3VVBA 2J9YB 3DNPA 3VV2A 4PTZA 3HKBB 3KEFA 3WIBA 2E89A 3I6ZA 4OSEA 3EPHA 1Q7CA 4NE2A 2XQIA 4JJ7A 3VZBA 3LWBA 5CTAA 1XTKA 2XEXA 4CTNA 4HNHA 2ZZNA 3FHOA 1U8TA 1X42A 3LLUA 1M2WA 1OLXA 2XNHA 3WWYA 1CJUC 2C2HA 5BVGA 3GLIE 1XZKA 4MUXA 4LYYA 1AMNA 2AI1A 1KJ9A 2OBBA 4EZIA 5LJIA 4UUQA 1PFKA 3TNYA 5JNLA 5LMCA 5GAJA 1A8PA 3WADA 3LSTA 2R8YA 3ACDA 4LRUA 4IBOA 1IXRC 5LYJA 2F8LA 3S29A 1SUDA 3EVDA 3JALA 4BGDA 4RHEA 1IULA 1DC6A 3DDCA 2XZLA 4AZTA 3F5SA 3H5IA 4RGQA 1PL7A 1SUPA 4JBWA 3QE9Y 1OILA 1N5LA 3IESA 2GWHA 4BFVA 2EG5A 4LJYA 3AOEC 4UAVA 4DG5A 1K4KA 4FWBA 4LTMA 2EOAA 4ES6A 5AVXA 3ZVNA 1MBZA 2ISSD 3PHJA 2HA7A 5D7BA 1L7VC 1WKCA 4JZKA 3DVLA 1V3QE 1XZ8A 4TLAA 4RHTA 3VZPA 5A6SA 3FWNA 2IW3A 2FA9A 3Q9SA 4C30A 3U7QB 1FNCA 4LRXA 3SXJA 2LXNA 3QVSA 4LE1A 3D4BA 3BPSA 4JLPA 3PGLA 5B55A 2C7GA 5AHRA 1QTRA 1T9AA 3LYAA 2HU5A 4HC4A 4MR9B 2X6RA 3F1KA 5EWMB 4DYHA