2VAXA

Crystal structure of deacetylcephalosporin c acetyltransferase (cephalosporin c-soak)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
376
structure length
346
Chain Sequence
b'NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNYLGSPFGSAGPCSPDPDARPYGAKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGAMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGVGQPIEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA--DEACETYLCEPHALOSPORIN C ACETYLTRANSFERASE
molecule tags Transferase
source organism Acremonium chrysogenum
publication title The Last Step in Cephalosporin C Formation Revealed: Crystal Structures of Deacetylcephalosporin C Acetyltransferase from Acremonium Chrysogenum in Complexes with Reaction Intermediates.
pubmed doi rcsb
total genus 123
structure length 346
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.175: Deacetylcephalosporin-C acetyltransferase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vaxA00
2QOEA 1JT2A 1J07A 4BE9A 2WIKA 4YX9A 5ESRA 4BAZA 3QVMA 1JMYA 1YSCA 1JI3A 5ALFA 3ZV7A 3DOIA 4X6XA 1H2YA 3E1GA 1S8OA 3CCCA 4A16A 4U2FA 5I8PA 5JAUA 5E4TA 3F96A 5J3JA 3EBLA 4OU5A 1XZLA 1ODCA 4Q34A 3E4DA 3WK9A 4BCDA 5JAHA 5AKHA 3C6ZA 4BCCA 3R40A 3HYSA 3WKAA 4RPCA 1T2NA 5HCUA 3A2MA 4MQMA 5HQ3B 2WM2A 4HRXA 1THTA 5ALTA 1UK6A 3MUOA 3W06A 3ANSA 2WUEA 1E5TA 1VZ3A 1UOPA 2ES4A 4X7BA 1LPAB 4YK7A 5HFAA 4FBMA 1ZIXA 4MEAA 4G8CA 1ZD4A 2WSLA 1R4ZA 4DLNA 4ZV9A 1P0PA 1QIKA 3S8YA 1U4NA 5DYYA 4ZI5A 1DWOA 5LZ2A 4DMFA 1DT3A 4X91A 4FHZA 4WFKA 1QO7A 3R3YA 3K2IA 3OM8A 3RLIA 3R3WA 1GPNA 4JEIA 1M33A 4J0DA 2O7RA 3WKEA 3KXPA 1YCDA 4BVJA 4X90A 2XUHA 1C4XA 2J3DA 1YB6A 2RGUA 1ORWA 3F98A 5JD6A 4DSZA 3G0IA 4ROTA 1VXOA 4DYHA 3G9UA 4HS9A 4EZIA 5EIAA 2HRQA 4EY7A 2XMZA 4EY6A 5JADA 5AK4A 2H7YA 3F67A 5FXMA 5LZ8A 4BAUA 2HM7A 3ICVA 1ZGCA 2R8BA 1TRHA 2WFZA 3D2AA 4ITVA 1SOMA 1CUAA 5AOAA 5FUMA 4Q82A 3G0DA 4X94A 2O7VA 1QIDA 1QJ4A 4F5ZA 5LZ9A 4ZGBA 1SFRA 3ZLUA 3G02A 1MJ5A 4LKOA 1LZKA 2O2IA 4BC0A 4UBIA 4XJVA 3E3AA 1TAHA 4GBGA 2O2HA 1F6WA 1VXRA 3MUNA 3K6KA 4K6KA 4DNPA 2JGMA 3FBWA 5AI4A 3IA2A 2YXPX 4KRXA 5E4JA 5ALNA 3LIIA 3VDXA 4GEGA 3H2JA 4CIAA 4HXEB 4H0CA 3L1HA 2FJ0A 4UBLA 3OG9A 5HKBA 2WIDA 1QGED 1EX9A 1YS1X 1XZMA 2ZVDA 4QLOA 5IVIA 4G9GA 4ZXFA 1KEZA 4FNGA 3STYA 2HDWA 4AO8A 3GA7A 1Q0RA 3OOSA 4UPDA 2OXEA 5T4FA 3KSRA 3ESBA 3AFIA 4NS4A 3FYUB 3HEAA 5AJHA 1BU8A 2J4FA 5CH5A 5JYCA 1GT6A 1L7AA 3G0BA 5EHXA 4DIUA 4J0KA 3U1TA 1B41A 2GBCA 3I2KA 4M0FA 4B6GA 3H1AA 4Y2RA 3ILSA 1XRQA 3BL8A 3RKSA 4QWMA 1GPKA 2ECFA 1IUOA 4LYDA 4JYMA 3GBSA 1LGYA 3QPCA 1P0MA 2WFLA 4W1PA 3A2NA 1MO2A 4Y2PA 4KYVA 3PUHA 3H0CA 4J0CA 2EDAA 4TGLA 5AIAA 2AJBA 1QIIA 2H7XA 1XZFA 1LPSA 4F0JA 4BVKA 2RHTA 2C0QA 3OPMA 5AM5A 4JYPA 4DNQA 2WHPA 3D0KA 4OB8A 4JNCA 4W1SA 1JU4A 2GZRA 3T52A 4UBMA 4Q3LA 1JJBA 1IZ8A 5CTAA 5ALHA 4G5XA 2XE4A 4H7JA 4CCYA 1YAHA 5A7HA 4AX4A 4KJXA 3O9MA 4WJLA 2DHCA 5E2IA 5E4YA 3W05A 1WHSA 3WK8A 1A7UA 2IIVA 3V1LA 4C4YA 3H2IA 1CUZA 4WFJA 1QIHA 1IMJA 2QJWA 5JASA 3FYUA 1E66A 3QMWA 3I2HA 2OCGA 3IUMA 1LLFA 5HFNA 1AQLA 2XUQA 3G9TA 1MU0A 1TIBA 4DNFA 4G1FA 4AQDA 1CEXA 3PUIA 1USWA 3X3HA 4IHAA 1JU3A 5AHXA 2HA6A 2DFPA 3V1MA 2WUGA 4EY4A 1Q83A 4L3WA 1WB4A 4J0JA 1BROA 5AI6A 4MQLA 4FFWA 2QTBA 3T4UA 2XMSA 3FSGA 3G9XA 2JF0A 3M81A 1MAHA 4H7IA 3QPAA 4XWGA 1DX6A 4O08A 5IVHA 2B9VA 1QIJA 3H1BA 3FVTA 3WWEA 3ZLVA 1U8EA 5KREA 5DTIA 1HDEA 4DSAA 1JMKC 2OGZA 1MX9A 5FPPA 4OB6A 1H2ZA 1TKRA 3DS8A 4QDTA 4I19A 5DLPA 5FV4A 1XZCA 1G66A 1CUWA 3PE6A 3DQZA 3H19A 2RI6A 1EXWA 5F4ZA 1RYYA 4HXGA 1CR6A 5JD5A 3H17A 2XUDA 3C5VA 4XVCA 3WL6A 3PFCA 1EINA 4CG3A 3VVMA 3C6BA 1SC9A 5IKXA 1OXMA 3FWHA 3IURA 2JGJA 1UKBA 1CUDA 2HA3A 3FVRA 4OCZA 2BUBA 1A8QA 4CG2A 5AM4A 1A8UA 2GBIA 4H18A 1VLQA 1VOTA 5ALDA 5K5EA 4WFIA 4B85A 2DQYA 3DD5A 3ZWQA 1CUUA 1BRTA 1EDDA 5EHZA 2ZSHA 1QIEA 1FFDA 3QPDA 3C45A 2C4HA 5ALVA 3C43A 1W76A 4M0MA 1K4YA 1I6WA 2Y6UA 5DTJA 3EF3A 5LZ7A 5AOCA 3V1NA 4CFSA 5ALRA 1IUPA 2I03A 4IO0A 1K5PA 4B81A 4UBOA 1VE7A 5K3DA 1K63A 3QYJA 1CUGA 1EVEA 2WG0A 3WL5A 4AMYA 2D0DA 2FUKA 2WG2A 3WL8A 5EIEA 4H77A 4X6YA 3STWA 2OGTA 4G8DA 1AMNA 3E0XA 3M83A 1ACJA 1CIJA 1JFRA 4QZVA 5AI9A 4LYEA 3H2GA 3N2ZB 4QNNA 3GROA 1CUSA 4Y2YA 3FSGD 3I6MA 5JAOA 2ACKA 2B61A 5HK9A 1ZICA 3BDVA 3O4GA 1XLUA 4HXFB 2JGKA 2Y6VA 5AH0A 4GHWA 4AMZA 3OC0A 2WU3A 2AXEA 3SC2A 3GFFA 4X95A 4BB0A 2CMFA 3VKFA 1FFCA 4W63A 5D3KA 4C4XA 2Y2UA 2JGEA 2X76A 4ARAA 5BWBA 5HZGA 4XX1A 3I28A 4CIBA 2C7BA 2XMQA 2XQJA 3WMRA 1XZBA 1Y7IA 2XMCA 4Y2TA 4JH0A 3V48A 2QUBA 1THGA 2ZYRA 4AO7A 5ALLA 4QDOA 1PJAA 2XLBA 5KBYA 2AJDA 6YASA 5K3FB 4L72A 1VA5A 3BF7A 2XUKA 4KRYA 5AI8A 2HL6A 2W22A 3R3XA 5IH7A 2I78A 1XZDA 5ALIA 5IVKA 2DHDA 2C0PA 4P93A 1PV1A 4WDRA 3WIOA 4K2AA 1CUYA 3MVEA 4Q1VA 3VJLA 2OGSA 1UOOA 5CT4A 1OCEA 5KWIA 2RAUA 2B20A 3PI6A 5LIPA 1RP1A 4KE7A 4P92A 4FFVA 1Y37A 2XLCA 4EUSA 4EA6A 5A62A 1LPNA 1EVQA 3F8SA 1J2EA 2WG1A 1H23A 3HC7A 3HRHA 4OB7A 4L9AA 5JAPA 1DU4A 3OTQA 4QEKA 5CT8A 2BGRA 2GZSA 3C6XA 2HA7A 5K3AA 4FNMA 2G5PA 2X8BA 4OD0A 2XUJA 1E89A 3I2FA 1CUHA 4H7HA 1FFAA 2V98A 1XZEA 1BS9A 3FLBA 1A8SA 4OYLA 3EQ7A 3H2HA 1Z68A 2PSJA 2IX9A 2G63A 2QR5A 2VTVA 2I3ZA 5DNUA 2PUJA 2QXTA 3WQHA 5BOVA 4UHCA 1GQRA 5DJ5A 3AUKA 4Y2JA 5HK8A 4RE6A 1P0QA 3B12A 1WHTA 3M82A 4S0XA 2HA5A 4CCWA 1EA5A 3F9CA 4UFOA 5C8XA 5BV7A 3QBJA 4MXDA 1MT3A 2X5XA 2XB6A 2J3QA 3WK5A 1CLEA 2VT6A 3IIIA 4EBBA 5LKRA 3AINA 4EY8A 5D6OA 1XQXA 4BE4A 4FWBA 1KU6A 1E8DA 5AKYA 1EHYA 4BC1A 4UBNA 1CUXA 5FP0A 1QLWA 5C8ZA 3HJUA 3I2IA 1TCCA 3DYIA 3G0CA 5T4EA 1UKCA 1R9MA 2DHEA 4BRSA 1BN6A 5DYTA 3D2CA 5AKGA 2BGNA 4UBJA 3C5WP 2XUIA 1XRRA 1YA8A 3QM1A 2K2QB 1HPLA 2ZSIA 3VVLA 2O2GA 4H7KA 1EB9A 4DMKA 4OYYA 1H2WA 5FDFA 1ZGBA 4E15A 2I3DA 3SWWA 1BEZA 3LLCA 3VISA 3DL7A 2XMRA 1P0IA 4ZWNA 1VA4A 4B82A 4D9JA 2Z3ZA 4MYDA 4OSEA 1GZ7A 2PL5A 2GBGA 4BTLA 1MNAA 5JZSA 1LPPA 1TCAA 2XT0A 4K6GA 3DL4A 2OG1A 1U65A 2ZJFA 3G8YA 2QS9A 5D7BA 5ALPA 1XQYA 4ARBA 1UOQA 3ESDA 2VJAA 2WQZA 4J0IA 1DQYA 4HRYA 1R9NA 3O9VA 2XMBA 1QFSA 5AIBA 3KWFA 4FDMA 1LBTA 1ZOIA 4PSUA 2HU7A 1UZAA 2ACEA 2W6CX 5C81A 2J4CA 2PVSA 1H22A 3IULA 4UHFA 5JARA 3RARA 2QRUA 4RGYA 4CCYB 5KWJA 3B5EA 1QO9A 5T4BA 3WA7A 3D3NA 4Y2SA 3D59A 2PSFA 1CUJA 5AK5A 2PUHA 1QTIA 1DQZA 3AIMA 1AZWA 5ALMA 4PO3X 4AXBA 5FLKA 1WOMA 1D07A 2WTMA 4PW0A 1B6GA 1K8QA 2QKYA 1XFDA 5AKLA 1E8MA 4J03A 3I2JA 5SYMA 4K5QA 3R3VA 2D5LA 4Q3KA 1XZJA 2HFKA 4WCVA 4WDQA 5CW2A 5AM2A 1RWQA 5DNVA 1GXSA 4RNCA 3HZOA 2BUAA 2VT7A 4KE8A 3L1IA 2BCEA 4C87A 5ALYA 3BIXA 1EH5A 4LHEA 1ODTC 1HLGA 1LBSA 5ALXA 2QM0A 3WIBA 3PF9A 1CUFA 4ZREA 2XUPA 4QLAA 3HXKA 4BDSA 2OCKA 3D5EA 2VATA 3TGLA 5FRDA 1O6FA 5AM1A 1MN6A 2C58A 4MEBA 3OURA 3WYNA 2JEYA 2Y2VA 3FLEA 2CEKA 4A5SA 5ALJA 2GYUA 2HRRA 5K3EA 1MNQA 3C8HA 3TEJA 4Q3OA 5A2GA 4KACA 4EY5A 2RIPA 5JD4A 5AO9A 1YR2A 1UT6A 1YS2X 3NGMA 3WJ2A 4GWLA 2JGIA 5YASA 4C4ZA 3M3DA 2EDCA 1CUIA 3FAKA 1UWCA 1BEEA 2OAGA 3AZPA 4QDUA 4INZA 5LYYA 1G5FA 3WKDA 1JKMA 5FKJA 4IH1A 2QUAA 1ZI8A 4U2GA 1DWPA 4Y2QA 2CJPA 2YASA 3UUFA 4E11A 2C5GA 4N5HX 1HKHA 4X6UA 4U2CA 4AN0A 1IZ7A 3DKKA 1CFJA 5CBKA 4Y2UA 2DCMA 2WIJA 2WKWA 1XLVA 5AKEA 2JGLA 5C7YA 4A23A 1W6RA 1XQWA 2HU8A 1SCKA 2WIFA 3HSSA 2ZYHA 4LXIA 4H7FA 2CZQA 5JATA 4FBLA 4W1QA 3IUNA 2PX6A 3FYUC 4FKBA 2VJCA 3CXUA 1NU8A 1BN7A 1ISPA 3AJAA 4DTCA 1CUBA 1CV2A 3ZI7A 3P2MA 3G0GA 3RM3A 1BCSA 2WLSA 2OQVA 1N5MA 4MYSA 4L0CA 3R3ZA 4QDXA 4X3CA 4PSDA 3N0TA 4J0GA 5ALOA 2FX5A 5EFZA 4BDTA 3R3UA 3GZJA 4FLMA 1MAAA 4UBKA 4G9EA 1W1IA 5CRIA 4G4GA 3BDIA 1YASA 4Q05A 4XIIA 1UKAA 5AICA 3LS2A 4KAJA 2VAVA 4X93A 2LIPA 1GKLA 4P08A 1WB6A 2DSNA 2ONCA 1L7RA 5K3CA 3A2LA 4FLFA 4BRZA 1ZD2P 3ESCA 2WHQA 3JW8A 2G4LA 3NWOA 1LNSA 3W9UA 2OCIA 2XQGA 1JJFA 4C89A 4FLEA 1VZ2A 4PQEA 1F0NA 1AGYA 1G42A 1AC5A 3ZLTA 4MWTA 1BE0A 2WILA 3KOOA 4FMPA 1ZD3A 4IQ4A 4B84A 2GYVA 4H35A 2OAEA 4C88A 2XQKA 1JJIA 1W4LA 3STXA 3STTA 1F0PA 4C6HA 3BWXA 1VE6A 4UUQA 1IVYA 5CH8A 1X2BA 4WY5A 4EB0A 4BP9A 2XUGA 2XQIA 1UK9A 3HACA 1VKHA 4J7AA 4BZZA 2CB9A 3W2TA 2VQ6A 4HVTA 1LPMA 4AZ0A 3DDUA 4B80A 4LXHA 4YASA 1L7QA 1ORVA 4GXNA 3LIPA 3LCRA 2R11A 2PSHA 3DYVA 1QFMA 2P8SA 3MGAA 3L1JA 1UK7A 3WLAA 5ALZA 5HF5A 2OPHA 3PF8A 3I1IA 1QONA 3IB3A 4NVRA 4GDMA 2HA2A 4UHBA 4QDZA 5AI0A 4GW3A 2HIHA 1T4MA 4CG1A 2B4KA 2AJ8A 4G4JA 4N8DA 3WK7A 5T4HA 4HTAA 2DQZA 4OPMA 3ICWA 1CQWA 4ZRDA 5A7FA 3QMVA 4BATA 1CVLA 3Q8WA 4X85A 5BWCA 5EHQA 3AILA 1XRPA 4Y9SA 3G9ZA 2ROQA 1C7IA 4NZZA 2AJLI 5CXXA 3FCYA 3RK4A 2BFNA 5AK6A 2WU4A 3Q0TA 1CQZA 4X97A 5IVDA 3EIOA 2Y1KA 1W75A 4KEAA 4BZWA 1QOZA 2PSEA 3YASA 5JZBA 1TCBA 4FTWA 3W9BA 5HQ3A 4WY8A 5LKAA 1E8NA 2VA9A 4TPKA 4OUKX 2JGFA 2E3JA 2NW6A 4N8EA 3DKRA 4PNZA 4N8SA 4M0EA 3VJMA 5JALA 3V9AA 3DNMA 5HKAA 3CCBA 2RHWA 2Z5GA 5EHNA 2Q0XA 3QITA 5AKIA 1LPBB 1N1MA 1ETHA 1VJ5A 1QIGA 2GYWA 4TVKA 3S2ZA 5AM0A 1UK8A 5CURA 4AB1A 3AIOA 5K3FA 3DEAA 4K6HA 1QIMA 1YA4A 3FLAA 1HL7A 1CUVA 3IVMA 4OU4A 3IUQA 4UHEA 3H18A 1QZ3A 2BJHA 5EI5A 4BVLA 5ALWA 3GUUA 1H2XA 1SCQA 5ALEA 3DOHA 3STUA 1XKLA 5I7UA 1ZD5A 1R50A 4BP8A 7YASA 2H9YA 2HADA 4GLBA 5CT9A 2XMGA 4RE5A 1GPLA 5ALSA 4B7ZA 2CKMA 1XLWA 3DJYA 1XZKA 1ZJ5A 2PU7A 2ZJ7A 3I1YA 4ZV7A 2BUCA 5LZ4A 5HF8A 4J0HA 1MX5A 3H2KA 2EEPA 1WCYA 3K9BA 5AI5A 3R41A 4LXGA 1Y7HA 1DX4A 1SCIA 3ANTA 2QT9A 3WWDA 5LP1A 4BCBA 1CUEA 5JIBA 1F8UA 2HHAA 4Y7DA 3KDAA 1J1IA 1W52X 1WPRA 3PICA 2WIGA 3LP5A 2H1IA 5JZ9A 2XDWA 3C87A 3FNBA 4C01A 1EDBA 1EDEA 3C6YA 2WJ3A 1DT5A 1MX1A 2HA0A 3WA6A 4B0OA 1XZIA 1GKKA 3QH4A 1X2EA 4B0PA 2IITA 5SYNA 5AK3A 5H3HA 3D4LA 3AZOA 1Q0ZA 2HFJA 2QXUA 5HF6A 3B3QA 4V2IA 3WYDA 2WTNA 4IH9A 2XMDA 3SX4A 3EQ8A 1FJ2A 1XZAA 5AKXA 1GQSA 2JEZA 1LZLA 4PV7A 4KAFA 1UXOA 1ODSA 3BJMA 2RONA 4UFNA 2PM8A 3VXKA 1QE3A 2ZYIA 4U2EA 2JIDA 2Z8XA 3WJ1A 2C5FA 4DMHA 1ZJ4A 2XUFA 2BKLA 3WZLA 4U2BA 3O4HA 3CN7A 1OILA 4MJ3A 4E14A 1IUNA 2OQIA 2ORYA 2QMQA 2XUAA 1XRLA 2CUTA 3O0DA 4F60A 4FOLA 1FFEA 1UFOA 5JANA 5C8VA 2YYSA 2V9ZA 3AZQA 4X00A 5ALQA 3WWOA 2QZPA 3PFBA 3BF8A 3C70A 5LLSA 2XUOA 5DNWA 1XZGA 1MTZA 3I2GA 5DYWA 5AKZA 4P9NA 5CT5A 1O6GA 1WPXA 3A6ZA 3CN9A 4GI1A 1K6EA 2WHRA 3STVA 3WZMA 2WUFA 2QVBA 4IH4A 3FCXA 4DGQA 4W9RA 1J06A 2ZYSA 2VJBA 2GBFA 4BAGA 2HU5A 4H7DA 1LPOA 1XZHA 4PF1A 4N5IX 4LIPD 1FFBA 1EB8A 3BE8A 4AN1A 1AX9A 3PDCA 2VJDA 3BIWA 5CH3A 4QA9A 1XROA 1AKNA 4QE3A 5AKKA 4DNOA 4QWWA 5LZ5A 1HQDA 1DINA 2PSDA 3I6ZA 2VSQA 3EQ9A 5I9IA 2XI4A 2H7CA 1ZI6A 2UZ0A 3IUJA 4EHBA 2G5TA 2YH2A 1R88A 2WUDA 2ZJ6A 2VAXA 5AP9A 4HAIA 3VJKA 3HI4A 3UUEA 5AKJA 1C7JA 3O95A 1EK2A 3V1KA 4W1RA 1DWQA 1YAJA 2FJPA 2VEOA 5DWDA 1CRLA 3JWEA 1ACLA 3SK0A 3G7NA 3WL7A 1WB5A 5ISMA 5FOQA 3FYTA 3D2BA 4DMCA 2VF2A 1NU6A 3WWPA 3TJMA 1Q84A 1BCRA 1TQHA 5A71A 1XRNA 3A70A 3FOBA 3UMJA 4PSCA 2Z3WA 5A7GA 3W04A 2WHPB 4F21A 5CT6A 5ALKA 3DCNA 4JUIA 3R0VA 3HLKA 4DM7A 3D7RA 1DTEA 4I4CA 3BJRA 4ETWA 1CUCA 2PU5A 4MWSA 3NUZA 3KD2A 3BXPA 4BYMA 2Z8ZA 5A6VA 4U2DA 1X70A 2DR0A 5FPQA 5EGNA 3ESAA 4J3JA 3WI7A 1N8SA 2WJ4A 1U2EA 4AZ3A 1FSSA 3IDAA 5EIHA 4E46A 4UHHA 4CI9A 4X71A 4HZGA 4YPVA 1GGVA 2WFMA 3AIKA 5AOBA 1E3QA 3WKBA 2HA4A 1XKTA 3QZUA 3QMMA 3KWJA 4GECA 5ALGA 1XRMA 1AURA 3WK6A 3I6YA 2AJCA 2CBGA 4UHDA 2BAGA 4Z49A 4KAAA 2OLEA 2WJ6A 4B9EA 2JBWA 3HABA 4G4IA 4KR0A 1ZIYA 5D3ZA 1HBJA 2V97A 1AUOA 3WK4A 3O4JA 3TRDA 4NMWA 2XQFA 3U0VA 2PPLA 1XQVA 1A88A 2WFLB 5ALUA 3C8DA 4KE9A 1YB7A 2PBLA 3GELA 4BTVA 1NX9A 5CMLA 3WWCA 3NOXA 1WM1A 1R3DA 3H04A 1TK3A 4Y2XA 5CXUA 5AM3A 1G4HA 1KU0A 3IBTA 1QTRA 2QJRA 4KE6A 3ZPXA 4B9AA 1MPXA 4BBZA 1PFQA 4H7EA 4X92A 1EI9A 1ZI9A 3F97A 1N5RA 3WKCA 5HF9A 1QIFA 1CPYA 5K3BA 3JYHA 4G8BA 2PKYX 4I3FA 3O4IA 2V96A 4UFPA 4AO6A 4Y2VA 1R1DA 2OCLA 4B83A 3ED1A 3DLTA 1EK1A
chains in the Genus database with same CATH superfamily
1U3CA 1U6IA 2C96A 2QOEA 5BW6B 4EWLA 4DUZB 1JT2A 3IOYA 4Q9HA 4V1CA 3AHDA 4BE9A 3U60B 1RXYA 4UU0A 3FSJX 4TOIA 5E8JA 4FMCB 3TRJA 3TIGA 2XPCA 3PNPA 3PRKE 3JRXA 4S1TA 2EP7A 4IHQA 4BAZA 3DLBA 1A9SA 1QU2A 3ZTYA 2LV8A 2W6MA 1GG9A 1WPQA 3HQ4O 4FYXA 5T64A 3TIXB 3ZV7A 3F49S 4CLRB 3DOIA 5H9WA 5HIKA 2HRBA 1HQKA 2B82A 1L1RA 4X1YA 2R1ZA 5M7EA 1YCFA 3NEAA 3ZV6A 2P4SA 2BFEA 1PZNA 2C61A 2WQ6A 1F7UA 1U9JA 1Y6ZA 2ZWOA 4A16A 4V0KA 4BFLA 3MWEA 1Z63A 4PN3A 1G5TA 1YV9A 3I61A 4BNWA 3UV6A 1PFVA 2F1IA 2G71A 3K7EA 2QLTA 4XDZA 2V7EA 1VCIA 4OP2A 1KIAA 1R6UA 3BS4A 4OU5A 3VR4D 3W5SA 3B1YA 2ZXUA 4M1OA 1ODCA 2I6GA 1D3AA 1DJPA 1M6VB 3LLMA 5EQJB 5TGTA 2PEZA 1OU0A 4YAEA 5D3MB 4AF7A 1KYVA 2D5IA 3BMQB 2EFHB 2JAQA 3C6ZA 4OK6A 1X7XA 5AKHA 1TVMA 4CGYA 2BKVA 1QKIA 4BCCA 1FQWA 5BV2P 1XALA 4X20A 1C4KA 2I6UA 2B1GA 5LD2C 3WKAA 1UZUA 5JW6A 3B6MA 3TJRA 5HCUA 3DEHA 3N3AC 1S01A 4MQMA 3ZZTA 3GJTA 2J0QA 3MGKA 1YIAA 4POAA 5HQ3B 1LBIA 4GMGA 4JP3A 3UK7A 2OGUA 2BEVB 2G76A 3GRPA 2WE7A 1TEVA 1BH6A 2C29D 3LWZA 3ZE8A 5JALA 3DT6A 3PQCA 3WGUA 1HURA 1LS6A 2WSMA 4J0EA 3W06A 3ANSA 1NLYA 2Z5FA 4B2IA 1OKKA 1UOPA 3N28A 5C46F 3NH9A 3OX1A 2CLIB 4YTEA 1RHKA 4XIJA 4HVCA 1R66A 1ZIXA 1QSGA 1Q91A 1RPAA 3NJ8A 1ZD4A 6ADHA 1D2NA 1R4ZA 3EYAA 3H1GA 3CLUC 3O1IC 1P0PA 3D02A 2ZTUA 5KVSA 3S8YA 4CYMA 3VKHA 1U4NA 2RH8A 3U09A 3VAAA 1R6XA 1JALA 3FMVA 4FYJA 4ZP1A 4MMXB 4R2XA 4WFKA 5F5XA 4LOIA 3GNQA 3ADDA 1GL6A 3FLMA 3OPYI 1Z7GA 2FPGB 3RLIA 2BFFA 4F4CA 3NAZA 1GPNA 2J48A 1YNOA 4JEIA 3SJ7A 1N9GB 3HDJA 2O7RA 4B4KA 4O2BB 2BBOA 1PT7A 2NZXA 1UJMA 2QP9X 1M1YB 3PSHA 2V0GA 3P0RA 2R1VB 3C5CA 4BVJA 3EG5A 1P7CA 4BMVA 1NN5A 1NXPA 5KYTA 1R7RA 2XUHA 4IICA 1UBFA 1UDWA 3GLSA 3OZEA 1C4XA 2J3DA 1CY1A 2RGUA 1QE5A 3HXPA 3MCVA 4DSZA 1JR4A 3G0IA 4EGQA 4DYHA 2WSIA 3LYAA 3U39A 2HHJA 1SB9A 1YVEI 1FRVA 1RYNA 3CUVA 1GLVA 4F2WA 2Q99A 3GAZA 1LQ2A 3TE7A 4MR8B 3SR0A 2HD4A 4JYBA 1ZGAA 4KV9A 1EFLA 1MA3A 4FOPA 2PUAA 3DUFA 5EJ7A 4M2LA 2NLOA 4Q21A 4PSKA 1K5HA 4Z0TA 5BXYA 5HXAA 3ZU6A 3FCOA 2XWSA 3H13A 2VT3A 4PLWA 2Z1DA 5FXMA 3LHFA 4V3CA 4BAUA 1P17A 2B8NA 2DM6A 2Q5LA 4EMTA 5KKNB 3NT4A 2IPNA 1DB3A 4K81B 3DTTA 1LV8A 5IVPA 5JQGF 2ZJZA 3ICVA 4WKGA 4DCTA 3RANA 1L7PA 2WNSA 5DN6D 5KCZA 2G7MC 1Q0QA 3BCUA 1MW9X 1HYHA 3D2AA 3DLCA 1CZHA 3O31A 4K3UA 3AUAA 4PC2A 5EWLA 4EO9A 4MPJA 1Z2OX 3VZPA 1GPUA 1KZ1A 1OXUA 2IZ6A 3W3AA 2IU0A 3GHHA 3G0DA 3JYQA 3NG1A 2O7VA 4Q82A 4X94A 4HEQA 4H59A 1JPUA 2ENWA 3W5HA 1M5RA 1XQ6A 4RK5A 2QU8A 1E2PA 3D3EA 1XPOA 1KERA 1OR8A 4GE3A 4ZGBA 4TL9A 5C8YF 2R8RA 1ZBDA 4R84A 4XYGA 5AXDA 3UJCA 1J0BA 1R0XA 2BFCB 2OV4A 3HN2A 5E3JA 4GKVA 2TMKA 3LC0A 3P9CA 3TNLA 2FNAA 5CITA 1Q7BA 2OM6A 2NO0A 3A6JA 2VIIA 5EUBA 5IUKC 3UXMA 4XJVA 1TAHA 4EPXA 1SBHA 4IV5A 3VR3D 4FN4A 1NMXA 2O2HA 3JYPA 4M55A 2ORED 3AG5A 4ONEA 3TBHA 3UG6A 1F6WA 2BIFA 5CB8A 1NOIA 4KODA 1VXRA 1QG2A 1QC5B 3WOVA 3BEOA 2IOQA 3L5OA 4XJSA 3V4RA 4A91A 4EG1A 1WULS 1AO0A 2OA0A 3GLTA 3OPNA 5AI4A 2IXTA 2FMIA 3HP1A 1RWMA 4KRXA 4ASUD 2OFWA 5E4JA 2JCBA 3KZCA 2EG9A 3I3SR 4MR9B 1CIPA 5DLDA 4TKVA 4P0QB 1PLLA 3EXAA 3PLAE 2EX4A 1SB8A 3VYVA 2CXTA 3EXHB 1BQ3A 1F2UA 4YECA 4PCLA 2QRLA 2ISSD 1T1JA 3L1HA 4KPFC 1RVV1 3G5LA 3IUBA 1ZGZA 4JIGA 2FJ0A 1W9HA 4K3VA 2JIZA 5C52B 5JRZA 5D2CA 5HKBA 4I4TB 4IOLA 4PYIA 3RS2A 3AHEA 5JROA 3R9KA 1EX9A 5CCDA 4YXFA 3TUIC 3FWYA 4JJIA 5KTMA 3TWOA 4AP5A 2QTTA 4AY3A 1PJ2A 3CUWA 1QK5A 3H05A 1TZBA 3KXKA 4MHOA 1WY5A 2PN1A 3NB0A 4HR7A 4EFNA 3IP9A 3N6VA 4BQSA 3IBFA 3ZHRA 3H5LA 3NIBA 4DCJA 5BR7A 1W5SA 4HPWA 2ZYUX 2HDWA 4AO8A 2DRIA 1CRWG 2FMHA 2J9XB 2R8XA 3LOQA 3S2YA 3TXXA 4DYDA 4MGYR 2ORIA 1SRQA 2XNDA 5GINE 3X2FA 1BDIA 2OXEA 4GMFA 4AROA 4IG4A 4ZDKA 1TCUA 2YJTD 4KBGA 3SJZA 2FUNB 4CTKA 8ABPA 1G8MA 1M9NA 1UMCB 3T3IA 4NDZA 1UQTA 4LAFA 3AVTA 1M6YA 2HUNA 3OJWA 3OLWA 2FMKA 1BU8A 2RH5A 3E23A 2JGDB 2CEAA 1KE2A 1OWNA 1U0HC 1ORIA 5JE8A 4EPRA 2O8BA 3KBBA 2DPGA 2DWPA 5JNSA 1RPJA 2CFOA 3I0NA 5ILQA 4PQYA 5JYCA 3JWHA 3MBOA 4KSYA 2XCTB 2IYNA 2Q49A 3FGNA 4OF4A 2B1JA 1MO6A 5LQUA 4L02A 3UUWA 2IWRA 5ULLA 2VRNA 1RXSA 4AF8A 4RHTA 3ZHCA 1WV1A 1Z2EA 5EHXA 5JS1A 8MHTA 2F1HA 3C7AA 1PGNA 1EVKA 2FVXA 3K16A 1JAXA 5D3MA 1XDUA 4FDTA 4M54A 4YP1A 4ZDJA 1FMTA 1NGSA 4NAVA 3HE3A 2WYUA 4YB8A 3ILSA 5SZKB 3PFHA 4LQ4A 3OLQA 3U7FB 2F8LA 1TAGA 2GTHA 2ECFA 2AG8A 4PZYA 1IUOA 4QWMA 4MPPA 4XEHA 2IP1A 4HNVA 3P94A 4JYMA 3A1TA 3GBSA 3NT5A 3LC2O 3AP3A 3R7BA 1IBMB 2IXGA 1PNVA 1ZRNA 2F2TA 4QXOA 3A2NA 2ERCA 4W1PA 1GG2A 2HGZA 3C24A 3BXFA 3KHUA 3IJPA 2V7QD 4FU0A 4IKEA 4E51A 2PE5A 1CG6A 3X2EA 2IF0A 1OH5A 4P7JA 4QPPA 3IPXA 4ISBA 5FI1B 4D5GA 1UM8A 1E1YA 2AC7A 3PUHA 4J0CA 4NENB 5F23A 1LU9A 1JQJC 1NQTA 5IC5A 4YRDA 1TUBA 4M0CA 1X7YA 2XZTA 3DWIA 3KQPA 4L4SA 3QOWA 2AYYA 4EYKA 3O8OA 4KWHA 2XZPA 1H05A 2CLDX 1DDGA 1XD2A 2Q3FA 2Y0EA 4IJ5A 4ZO4A 4RTRA 1O6CA 1GIAA 1R0SA 5FL7A 1V8BA 1DAKA 1GNSA 2PTHA 2WWIA 3DF9A 4YVFA 1JUDA 2GKGA 3S5UA 1GCGA 3J7TA 5L3QA 1XZFA 4OHYA 2DBYA 1T4CA 2A9KA 3CJTA 4RDIA 4E07A 4C21A 3M2TA 4MV5A 5EWMA 4ZVKA 2C0QA 2A5GA 1W8DA 2IT1A 4JGIA 1T9AA 4BLRA 1JHPA 2O14A 3NOOA 4HRVA 5LL6P 1VB5A 5EZYB 3INNA 3CRZA 3AKDA 3DAYA 5TS2A 1G8PA 1SXHA 2WHPA 1M2HA 4HDOB 5GP1A 4YCCA 3JQGB 1MB3A 4OB8A 3RVLA 2QB5A 4RADA 4KQMA 3BT7A 1JU4A 1XAIA 4WZAE 3JAWA 3TOXA 1EM6A 3DDNA 1XEWX 3V8RA 1E1NA 1TVCA 5MF6A 4R51A 3CTPA 3N07A 1WVGA 3CRW1 5CTAA 3PT9A 4G5XA 4BJ3A 2XE4A 3M2PA 4G2TA 4H7JA 4H6XA 4URVR 5L95A 4F9GA 3P0HA 1A5TA 4BXOA 3U61B 1J90A 2N42A 4KJXA 5IWCA 5KSYA 3KOYA 1YIDA 1SCDA 3OU6A 4NFHA 5BVGB 3OX4A 2IPXA 4A6EA 1ZUNA 1DAIA 3NNNA 5T3UA 2C99A 2QPTA 2QDXA 1EQ2A 2ZUVA 4N6GA 3D7KA 4J90A 3NWEA 3C3MA 3DOFA 3ZCPA 3KKKA 2XUZA 1TYDE 1RKQA 2VBGA 3UJ8A 3W05A 1VE1A 2E1RA 2GJ9A 3DBOB 2X0FA 2AXPA 3GLIA 2H1SA 5BOSB 4B35A 2IGTA 1UQRA 4CV3A 3F4BA 2XXAA 1S2MA 1SXJC 2YJZA 2H2WA 3H2IA 3IPLA 3WB1A 4BASA 5JYDA 3K1ZA 1IMJA 1JAHA 3OD1A 4H0FA 4R6WA 5E6RA 3V8VA 1SU6A 1E2HA 3CLRC 2B3TA 2COKA 2G09A 2OQRA 4TVOA 3FYUA 4C29A 3UJNA 4KBFA 1JF8A 3LUBA 4QPDA 2ZK7A 5L6LB 2K7FA 3W8EA 1S7CA 1N5DA 2XUQA 2NXEA 3CUEF 2ZVQX 1WW8A 3V00A 5EE5B 2FW8A 1LK5A 1T1EA 4CWAA 5BWOA 1DJOA 5KDLA 2FK8A 3VPXA 3WGTA 2IYPA 2YV2A 4LISA 4IHAA 4R41A 3FCAA 3WP0A 2MSWA 1X7ZA 4KLAA 1ZINA 4A82A 2DFPA 2EQ5A 1L5FA 3NHSA 1NI4A 3AEYA 3KLPX 3D8BA 2H59A 3FDIA 4COOA 3GLUA 1AKUA 1WB4A 3QK7A 4HJRA 5CVUA 3V6LA 4AG3A 2IXDA 5FBVB 1QGZA 2F6RA 5JTUA 1MPTA 2FUG6 2WPDD 1Z37A 4MQLA 2VJKA 3H84A 4QUGA 2OD2A 4ZTZB 3DGFC 2Y9MB 1OD6A 2JF0A 3C3EA 2BSAA 3DYBA 3M81A 3PGKA 1QE0A 3L8CA 4LWOA 5I5GA 4B43A 2IPMA 1T26A 2DKOA 2L42A 3H5TA 3LBNA 4MITA 2QQ5A 1QCYA 3WSVA 2HBZA 2IVZA 3GJ5A 1KI9A 3FNQA 4XX0B 1B6RA 3R7DA 1QIJA 3F78A 4BQRA 4MQUA 5GIPE 4IIXA 3R9WA 3BXXA 3L8DA 4NU0A 4BN4A 3BXGA 1LC0A 3LHDA 3Q3IA 3IOMA 5AQ1A 5EAIA 2G9UA 3A6GA 5EJ8A 3W1EA 5BRNA 3ZIAA 4DSAA 2F59A 3QVLA 1O2DA 5AW8A 1J0DA 2EVWX 2WMNB 3UMSA 1TQ4A 2IOYA 4GXQA 3NRJA 4TTJA 4XEUA 2FSVC 4A1FA 1M6WA 4DBLC 3BWMA 3BHJA 3LSYA 3MYRA 3UK0A 1Y98A 1W36B 2R751 3EASA 4I9GA 3NHLA 4TN1A 3VFDA 4GMKA 5EZ6B 4EABA 1P39A 1QQ5A 2J30A 5DLPA 3TTUA 2WNHA 1A71A 4AG5A 5A5VA 2IPLA 1H5QA 4G1CA 1T5BA 4PG6A 1O03A 2MOKA 2H57A 2J5QA 2QTVA 4OVKA 4YRTA 1ADFA 2UXDB 3MCAA 3O91A 1KS2A 2RI6A 4RPGA 2EIXA 4Y0VA 3AI2A 1E7RA 2A1UB 2CHVA 3ZIAD 3M6LA 3IELA 5F4ZA 3VZRA 3ILYA 1XXHA 4HXGA 4GYYA 3D1LA 5JD5A 3O94A 3OA2A 2ZAMA 1JIVA 2V4MA 4WLUA 6LDHA 5HILA 5K0BA 4XVCA 3TOVA 5CR9A 4E3WA 4X3PA 1IFXA 3I32A 1CS0B 2C2OA 4G89A 2AYXA 3CR8A 4OFXA 3T4XA 1EINA 1W2WB 2IOFK 2O1SA 5JJLA 5C7IO 5EKTA 3GEEA 1JKJB 1BYIA 3JWJA 2NZYA 2CBZA 1SC9A 4UZFA 1Q0HA 3TM5A 4M7OA 1FFGA 1HDZA 1RWVA 3FWHA 2Q6VA 4G1EB 4JAVC 5EKUA 3IT1A 4BX0A 2I2FA 4MINA 5JJBA 3HYRA 1UKBA 2CNWA 2IXAA 1TA9A 2HA3A 2JGJA 3LPMA 1Z17A 2FPRA 3O8QB 5IDVA 3UT5B 4CL3A 5H80A 1MABA 1KAGA 1Z6PA 2ZSJA 2IP4A 3HMKA 3KKLA 3R5KA 3RJTA 4Q4HB 1Y5RA 2E37A 3ID6C 4QASA 3CUYA 3JQ9C 5AM4A 3TW6A 2Y1WA 4CLHA 4XLTA 1SIOA 1P1CA 2B1RA 1HLFA 1TC1A 3NWBA 4HBZA 2ZUUA 4LI3X 4FDVA 4B3SB 5TF4A 1RD4A 4J2OA 1NXVA 3B7WA 4MOWA 4ZHQB 4WFIA 4CR7A 2DQYA 1E5VA 1RYHA 1WU7A 3CINA 4RCZA 3DD5A 1SHUX 1YKFA 4JROA 3H97A 1I0ZA 3MZ0A 2YRFA 4PAMA 1OYYA 1U6JA 1BRTA 1XVAA 4F6LA 1B14A 4U7WA 3P5BA 4IF4A 1JECA 2ZSHA 4AY2A 1FFDA 1KEEB 3O2JA 4OSOA 2BZ1A 4GD3Q 4CMAA 1D2MA 5F4BA 5K1ZA 1ZSYA 3GUCA 3VX4A 4BGVA 4HNUA 3BE4A 3RK1A 4AYXA 3O1HB 4I1RA 2QJTA 1I3CA 2QPOA 1ISGA 4H1HA 3V97A 3MIZA 4QHYA 3CSUA 3WLSA 4UC0A 1EGAA 3L7KA 3LSTA 3QYPA 3IJ5A 2F3TA 1EJ6A 4ZCRA 5DTJA 1GLNA 4OJNA 1KAOA 3VO1A 4RTKA 5LP6A 2B4AA 1US8A 1FLAA 5AOCA 3GT0A 3FI0A 1QYCA 1A7AA 3V1NA 3KJHA 5IX8A 3HWRA 3QLVC 1ZR4A 2Y71A 4Z99A 3AFMA 1J23A 3AESB 1G9TA 2V9PA 5A4MS 4K0KB 2ZM5A 1A9TA 1OA1A 1CHDA 3ITNA 1PNTA 1LB1B 1PT8A 4GT1A 4EP1A 4HX2A 1E3IA 1OWOA 4UBOA 5KMGB 4D7AA 1DBPA 2HCFA 5CW1A 3NZEA 1I2ZA 2XWJI 1DCKA 1TEHA 1CUGA 3OVMA 1I24A 5K3DA 2XTJA 4KRGA 3G68A 3WL5A 1PZMA 3SX0A 3UICA 4G0VA 4FM9A 1F3LA 1ST2A 1KI6A 1C9KA 3Q11A 2IV3A 2B7CA 1EUQA 4I50A 1MIOA 2H1RA 2AX3A 4REMA 3OY2A 1CERA 3AV0B 1Y9JA 4KB5A 4ZI2A 221PA 2PR7A 2RH9B 2R6FA 1R5NA 2OHFA 4G8DA 4DIUA 1AMNA 2Y92A 1VL6A 3NBFA 1CIJA 1V96A 4M7WA 1IN7A 1AGPA 1KK1A 2A7QA 2PMBA 2XB8A 1HORA 1VYHA 2XDQB 3LY9A 4KG7A 1G7TA 4B32A 3H2GA 2I55A 1WCIA 3N2ZB 1JLKA 1R0BA 3JU3A 3LK6A 4QNNA 2WDPA 3WIVA 1UBOS 1JS1X 4WLNA 2W0SA 3CF0A 3GROA 2HT6A 4IBOA 3F7MA 1GAQA 1GL3A 1Q1AA 1QVAA 4Y2YA 4EUNA 3P9YA 4XM1A 4DCSA 3A9CA 4UM9B 1I7NA 1QKKA 1NUHA 2H5IA 4XLLA 1TJ3A 1CNMA 1V7ZA 2DFVA 2JLYA 3EIUA 4N0DA 3RYIB 1GTJ1 2BD0A 2IODA 1FXUA 4XIGS 4B87A 4F8JA 5JDIA 1JLRA 1K2VN 4LRWA 1EFRA 5ESWA 1ZXLA 2Y6VA 1FDIA 5GZ1A 2V1UA 3OC0A 2IU3A 3RK0A 2WU3A 4DLAA 1GM5A 1U5BB 2HF7A 3Q10A 3TK1A 2WU0A 4M53A 3SOZA 3SC2A 1NNI1 2DKNA 2C9DA 2HZBA 3DH0A 4EKEA 2Y0PA 1ZP6A 4AZWA 4D57A 1P9WA 1VFPA 5IYZF 2HY7A 3AO0B 3EMDA 3R7SA 4PWYA 5JC8A 3AFHA 2JIQA 2DXIA 1HEIA 3FW1A 4W63A 4WBNF 1A4XA 4CKCB 1KK3A 4CL8A 2CMGA 4ZQFA 3W2EA 2G9ZA 4HWOA 2C92A 3UYKA 3FNFA 2P9FA 2D5CA 3BOSA 5SV2A 5JCOA 2PNFA 4B2PA 4NC9A 4HDNB 5CHEA 1UF9A 1XKQA 5BWBA 2REBA 5HZGA 1ID8A 4XX1A 4EHHA 2XJ4A 2WKQA 2Z2ZA 3E8MA 3TZQA 4CIBA 3KTAA 4AJLA 2MSKA 4S35A 4N47A 3A26A 2XMQA 5JXIA 1W73A 4KUGA 4MB0A 5BSUA 1IOZA 2FZKA 2QAGB 4MB2A 1K8XB 1Y7IA 2W5UA 5B3AA 3GJZA 3FI9A 4FGKA 3SHTA 1WMDA 2QUBA 2BKEA 3W2IA 3E82A 3GQBA 3T99A 1I7LA 2H4ZA 4AO7A 3Q5DA 4N41A 5KC9A 5ALLA 4P4UA 2QM3A 3OT1B 4QDOA 4B4DA 4PC6A 2XLBA 3B9PA 2XSZD 4OQZA 3VYRB 4QOEA 3EX7C 4XD7D 1WDWB 3GCXA 4OO3A 2OQ2A 4K9RA 4BFXA 4F2PA 4HLCA 5LFAA 2F67A 2G0TA 4QJBA 3RS9A 1X15A 3L6CA 4MGIR 5EIXA 1NDUA 2PIAA 1FVOA 4PCUA 4IZIA 2H0RA 3F3KA 4KRYA 4JNKA 1JR2A 2ZPUA 4E94A 1FSZA 3MWLA 5C32A 4KVAA 2VBIA 4MVXA 3U3RA 1I5EA 4FQ5A 2J5XA 1T8SA 4CNQA 4CV2A 5CA1A 1SMKA 2Q1XA 2DMRA 5K45A 1GTL1 4OXQA 1H2RS 4KGZA 1Y8RB 1PNQA 5EUMA 3EF0A 4Z7OB 1G8FA 2CYAA 1SBCA 5K99A 2W2NA 1QGUA 3AETA 4RPIA 3DV9A 2ZUEA 3QOYA 3D64A 4L9WA 4YBRA 2DX7A 2ZQ5A 4K2AA 5KOJA 1E60A 1PEDA 4JITA 4XKJA 3ZU2A 5GJBA 3DPUA 3QU5A 4OA8A 4QPZA 3OOYA 2QVLA 2RJOA 2AN9A 3NYWA 2OKCA 1L3CA 1VMAA 2B20A 1WXDA 1EAMA 3ZHSA 5A4JA 1P0FA 1TXGA 1XYGA 2CW5A 1TW2A 2QF7A 5FL7D 4HDAA 2E48A 4BNDB 2XLCA 1IZ9A 2BZSA 4NH0A 3V42A 1QRUA 3ZN2A 3Q0EA 1FFXB 1G3MA 1TM4E 2Q41A 4ZOQI 1ZN9A 2HO4A 4XUEA 3DSRA 3K32A 2QGZA 1C9DB 2NXJA 3Q2IA 1GGHA 3GCGA 3JQQA 5FLYA 5CDSA 3EQZA 2FCAA 4LTNA 4TTIA 1ULBA 5LNK1 1QK4A 4L9AA 2DKFA 1ML3A 1NI5A 2Y0CA 1ECBA 3KK0A 1VG0B 2P9GA 1XNHA 1J0AA 2PZFA 4GPEA 4WVLA 4DRZA 1YS7A 4ZKDA 3PL1A 1X3LA 3PWKA 4G5FA 4JC4A 4QSHA 4GQBA 4D6YA 4LF7B 1RAIA 7REQB 4C7OA 3PHBE 2HA7A 4LQCA 1H8HD 1USKA 2ZYDA 3EUWA 4FNMA 4C7VA 3TEFA 5A6SA 2Q5FA 4ARUA 4MUAA 1S02A 2EJVA 5DBGA 2XUJA 2C59A 1E89A 2Q3BA 4D8WA 1MCZA 5GAJA 1E6WA 3R3HA 1SZJG 3IEKA 2FSFA 3H7AA 2JBAA 5ERGB 3TAHA 4BTEA 3NCHA 3EEOA 1M2NA 3FLBA 3IBSA 2MTBA 3TFWA 4C1BA 1VL8A 2VPXA 4OYLA 3QEMB 4WMLA 4DR1B 2ZTMA 2GJSA 1YKGA 1Z68A 2PSJA 4I5IA 3L7JA 4EECA 4BO4A 2IX9A 2VTVA 5FH9A 3RIXA 2Q4OA 5ETJA 1IUKA 5FBWB 1Y1RA 1HWYA 1M1NA 2I3ZA 6ABPA 1KO1A 1A9PA 2PUJA 5B5SA 1Z5UA 1PTJC 2CJWB 4UHCA 1V8ZA 2VPYA 3MJ4A 2HYIC 5DJ5A 4RZXA 4QXQA 3MLEA 4MW9A 4KIJA 2OOKA 3BRWA 1AD2A 3L7CA 5DTMA 1EBFA 2PRIA 2WF6A 3DXFA 2CD7A 4JOQA 3RJZA 4KPEC 2DWQA 5TMBA 1AQIA 4OKIA 1CTQA 4HL6A 3UAYA 4CCWA 5E9WA 3MRXA 1V5IA 2V0CA 3Q1LA 4UFOA 5CFOA 1J8MF 1TZJA 1Z75A 1E0AA 1SR8A 1AUQA 3DVAB 2DFDA 2RCYA 4ZAGA 5JCJA 3SBXA 4PSVA 1MUUA 1Y33E 4P83A 1WZUA 4MYHA 2GCGA 3QBJA 1T0BA 2D2FA 3OECA 4D0SA 1M0TA 5KQMA 3A27A 1EP9A 1M2EA 1GA1A 2P68A 3E7WA 3F6EX 4B47A 2BFAA 2CFIA 5D6OA 1OZAA 4RKEA 3O38A 2G83A 3RWMB 1E8DA 1JXOA 3EGDA 1JE0A 3KBOA 4GKBA 4TKUB 3UXYA 1LBQA 5EHIA 5KVAA 4UBNA 2J6BA 3JQAA 3MINA 1K9SA 2YVQA 1JQ3A 2JIMA 4GZLA 3PNQA 4JBWA 4L7VA 2AN4A 3I9NA 3LVQE 1IHPA 3H2BA 1MB2A 4C20A 3I2IA 5BRJA 4F71A 1Y9DA 4RD1A 3L79A 1T25A 2H0QA 1X1SA 3ST7A 4R2MA 1C0EA 1Y1SA 1OB5A 1VMIA 1SG0A 1FK8A 1ORTA 3WYGA 3W5VA 4GPD1 4UTXA 5CDYA 3I6IA 2XCSB 4BRSA 1ZONA 5JJIA 4EF4A 5AXCA 4RFSA 3B1KA 3IAM6 4LECA 3HUDA 1B8PA 3KQOA 5F76A 4S04A 3FWPA 4A2PA 3TE6A 1USGA 3KQMA 3GY0A 1P9NA 5LDDC 1RAGA 3D43A 5AKGA 3PSAA 2BGNA 4B8ZA 1KYYA 4BUZA 3C5WP 1DBQA 2GF9A 1XHFA 4L7QA 5NLLA 3JARB 4S0ZA 3IGFA 2ZSIA 1CS4C 4AZTA 3P9IA 5AOVA 3RYFB 3VVLA 3O93A 3EMBA 5IULC 2DJ5A 1TL7C 1C3VA 3KSBC 1EB9A 2NN3C 2Y05A 4I55F 2SKEA 3AHHA 3W8NA 3AEXA 3EBPA 5BW5A 4ERNA 4YUWA 3C3KA 1M2JA 3KYDA 3ZLBA 3IILA 1KO7A 2ORWA 1QGOA 3PYMA 3ZKWA 4YJFA 3LO5A 3TLGA 2BCJQ 1ZSNA 4NCKA 4Q03A 1ZGBA 2Q4TA 4E15A 4YI5A 4MWOA 2I3DA 4M9QA 2ANBA 3VDRA 3AM5A 4M88A 3KM0A 1T5SA 4NKRA 1KMCA 3ZVNA 1ZMTA 3HKCA 1DXOA 2ZCVA 3PDHA 4BUJA 1WW2A 2QTZA 1VSTA 3DL7A 3L82B 4IQ0A 3DG9A 4PIVA 4RZ3A 4MQBA 2ICAA 2HSEA 3M3PA 4QQNA 1EX1A 4NULA 2XAAA 2DUNA 1OLUA 3ZZUA 1X8KA 4OXKA 5KNDH 4YAFA 2NSLA 3CKKA 4K9KA 3T5CA 2QY6A 2QVXX 1GZ7A 2PL5A 2QA5A 4FFBA 2GBGA 3L1VA 1X1BA 1WZIA 1MC1A 2HMYB 4EPVA 1YL7A 1MNAA 1S6YA 2XOKA 4PPYA 2E4YA 4RD4A 4TLAA 1KJ8A 2EAUA 3U3OA 3RVSA 1L7NA 4UNSA 3C8UA 1WBJB 3X1ZA 5JZSA 1H1DA 3ZE1B 5EJ5A 1YRWA 4OGWA 1ULSA 4O6VA 1EJ0A 2OG1A 2QV7A 3DNFA 5FI3A 3U62A 3P45A 3ZR4B 4NE7A 4JS0A 1Q3KA 4NOLA 4TXJA 3BMXA 2QTFA 2FWPA 1DI0A 1Q50A 5EJIA 1AGRA 1SG6A 1SXJE 4N7BA 1W93A 4BN5A 2FW7A 2JHGA 2C4MA 3AF2A 2J59A 4IUBS 4XWTA 5DV9A 5D7BA 3PX3A 2WWVD 3VPBA 4LJLA 3VYTB 1WCWA 1VTKA 3DVQX 4ARBA 5B7QA 3EVGA 1YBHA 4YP7A 4JSTA 2YXDA 3LY5A 2A5LA 1GFIA 5DGXA 4HY3A 5A02A 3M6IA 1YK1A 5EESA 4IWYA 3AR3A 3OTHA 1IM5A 5FOVA 1IZ0A 1PN3A 2JJ1D 3I3OA 3COZA 3HCCA 1T13A 3DXYA 3K9NA 2YVLA 2J1LA 3T9BA 4BB5A 3AR9A 3GEMA 2YRXA 1MVNA 4UPVA 3O9VA 2ARKA 4YGYA 3AHIA 1ITZA 5F1KA 4UVHA 3RT7A 5C5DA 2PUGA 2PCLA 1X7GA 1LSJA 1XCJA 2FPXA 3AF5A 3MXOA 4WXHA 1TU4A 4ABYA 5I7WA 3KOMA 1FJGB 1E7SA 1HG0A 2JHAA 2OT3B 5E1OA 5P21A 4MP6A 5SYAA 1LBTA 2R8ZA 3SSMA 3FUVA 4G1UC 4L95C 4PQGA 5A4IS 4PSUA 1I1QB 1E3EA 4IDCA 4H1WA 1RBYA 4MR8A 5DIZA 4A3SA 3PHCA 3EGDB 3SX2A 1U80A 4MLDA 4IVPA 4CG0A 3LWNA 4I46A 5BORA 3OQVA 3EJ6A 4XQEA 1JBQA 4MH0R 2XWQA 4M89A 1E96A 4B44A 3EA0A 3CLTC 4DL9A 3W4IA 4DXAA 1VHQA 4YY3B 4YT2A 3RARA 3NC0C 2ZB4A 4ZCTA 2EZ4A 1NVBA 2BPOA 3H65A 4L75A 2CHFA 4F06A 4NQRA 4KQHA 5IDYA 1G63A 4D6PA 2GXQA 3B5EA 1CK4A 1UDBA 1H0RA 2Z0MA 3WE7A 3OQBA 4ZU6X 3WA7A 4Y2SA 3WXBA 1P9RA 1JW9B 5AVVA 3D59A 1JYFA 3IE2A 4JB3A 5LB2A 1L5HA 1RRGA 2PSFA 4AXXA 5A5GA 1VLLA 2R4TA 5AK5A 1TFUA 4W5QA 3P7MA 1S0UA 4G1BA 1CKEA 1QTIA 5J5CA 3RG2A 1DQZA 1SVMA 1GJRA 2DF8A 5K09A 3M5DA 4PO3X 4C0BA 3F4LA 4AXBA 4BPRA 4RK1A 1WCV1 3K5HA 1X6VA 4N3BA 5F2OA 1D07A 1LQTA 2ZCUA 5H82A 3AVQA 2QKYA 1DEKA 3SLGA 4PFKA 3ER9A 2Z3VA 5AKLA 4ZQGA 1E8MA 3OIUA 4J03A 3CVWA 2QRVB 4H17A 3GJ6A 3I2JA 2HWWA 1NR1A 2ZVJA 4MKHA 1Q3HA 1EFUA 4F93B 1A8HA 1U1CA 2HFKA 4FYHA 4HDMA 1XVTA 2NU9B 5IHXA 4HNAA 4P7FA 5ANRB 4XSGA 3HO1A 4LNUB 2XTAA 3EDRA 4WDQA 2B6HA 5AM2A 5JHHB 1XK6A 1GXSA 3VZCA 2HOQA 3P0EA 5H81A 2IEGA 5BN4A 1KFBB 5DCUA 4NCBA 2Y68A 3H8VA 4KE8A 3SR4A 5C18A 1GKIA 3IQXA 5B4VA 3L1IA 2YWJA 1XEWY 4I1YA 4L74A 2VPWA 2NXNA 2XHZA 3KG2A 1PFGA 3LK7A 5DGTA 4PZUA 4OGGA 4LV5B 3SQOA 4DUPA 1M6VA 4KWCA 4LHEA 4QJ4A 1B0UA 1GZDA 2L0XA 1JDPA 5EZQA 2HLPA 3E5HA 2M1ZA 1QF6A 3ZDBA 2V6JA 1Y6FA 3MAAC 2X8JB 3IDQA 4EL5A 2DQSA 4ZVPA 1W0JD 4JYAB 3ORHA 4R6XA 1AKTA 4KPGA 4AZ3B 3OP1A 1YU6A 2E87A 3O3NB 4KLCA 4YJ2A 2E4XA 3LBHA 3PHIA 5EOVA 3WWYA 2I4LA 4IEFB 3R8FA 2CV1A 3PGMA 4N7MA 5BSMA 3UCFA 4C7XA 2AWOA 1WLYA 3JQFC 3A1SA 4QLAA 2CSXA 4YWHA 1YZFA 1THZA 2VATA 2FFAA 4MV8A 4LF5B 1ZWLA 5A9TA 3R20A 4Y2HA 1HE3A 2WMYA 3DTVB 1O6FA 3GJ7A 4E30A 2ANCA 1P7VA 2FWNA 2OBYA 5C8YB 1S96A 3AJDA 1E0JA 2CC2A 4WD3A 5KKAA 4CVNA 1SKAA 1N3LA 3ZNOA 2BVNA 1Z82A 3OTIA 3KXLA 1LK0A 2VTEA 4P0TA 2JEYA 3V8NA 4L08A 2Y2VA 2GSWA 3G1WA 2POCA 4UEQA 3B6EA 1D2EA 1VJCA 3LRXA 3DMGA 3TEMA 4GMDA 1M0SA 1MXHA 1MNQA 1U11A 1E5LA 2X8LA 3MD9A 3F2VA 2D8MA 3EIFA 4HAXA 1X8XA 5BP7A 4QG3A 5AVXA 3EFOB 3NASA 2J9YB 4GVXA 5BUZA 3TEJA 3K8QA 1X80B 7REQA 5F7ZA 3WO0A 3FM9A 3FOZA 3EXHC 2IS4A 4XZ3A 5A2GA 4UDOA 1FX0A 1P8JA 3UO8B 5JD4A 1DC5A 3BH0A 3NFYA 1UT6A 1YRHA 5FUWA 4B3XA 3MTEA 3NGMA 4F5WA 2VDRB 2Z5LA 3T5AA 5TC4A 1M5UA 3DWGA 3PYXA 3GR6A 5DISB 2CVFA 3FGOA 4F3YA 1SAYA 5YASA 5KTKA 821PA 4V0ME 3QEMA 2XIJA 3T5BA 1QFYA 3ND7A 4GC5A 3O90A 3MWFA 1QGAA 1X1TA 1U1DA 2OAGA 2TMYA 3JD4A 4DIFA 4KI0A 1AKWA 5KYYB 3PX7A 1G5FA 1IHUA 1CQIA 3JZAA 4L5YA 4EKNB 1Q22A 5FKJA 4IH1A 2QUAA 3PZBA 2SHKA 1O0CA 1HOTA 2CJPA 2YASA 3IESA 4WKCA 1SBTA 2C2ZA 2DWCA 2ZSBA 3BILA 3TOCA 3WBFA 5BNTA 3Q3CA 1B8VA 3DOEA 3FPJA 3OKPA 1Y5LA 1E5DA 5BT8A 3F3YA 2QX9A 3MCUA 4NJEA 1BXKA 3E53A 1OFTA 3FKSD 2C0CA 3IMCA 4JGBA 4A6DA 3HPRA 1BCSB 5CX1B 5ER6A 1KJJA 1ZUNB 2ZS7A 4AN0A 4TMKA 1UINA 3DKKA 1CFJA 1ISHA 3CLTD 4GO1A 3GLFE 3HEBA 2IRWA 2JFHA 4BGUA 2ERYA 2YOHA 2NO9A 5GM1A 1D2RA 3EW9A 1FX0B 4KMSA 4LXYA 2A14A 1VIMA 1HO3A 4S3MA 1TQ8A 5DBFA 1G55A 3RYTC 2P27A 5JDIC 5JMOA 3A05A 2Q5HA 3QFFA 3WMXA 4EOGA 4A23A 1QX4A 4R98A 4XFKA 1SCKA 3D31A 2ZAIA 3TQRA 2ZIEA 4Z1MD 4QLBA 4LRYA 3G2KA 1UEJA 1UMBA 5JATA 4PE5B 5JOQA 2PGJA 4JL5A 1KJ9A 2H6EA 5B4UA 3OE5A 1IQRA 3QU7A 1NJ2A 1ZD9A 2EBUA 4PHHA 5KSWB 3RBZA 3IUNA 2PX6A 3QIVA 2CVZA 3K0CC 3MT7A 3OQIB 1PR9A 3KTAB 1WS6A 3GRRA 1PKEA 2VAWA 2D74A 1U3TA 3PXDA 5TQ0B 1JSCA 3THWB 1BHJA 3KB6A 1Z2AA 3LCVB 2FV8A 4RENA 1D0VA 1Z0FA 2QMZA 4IQFA 5HTKA 4TYNA 4I14A 4NTZA 3G0GA 3UIEA 2WLSA 5CYOA 4DEYA 4TVBA 1Z5WA 1N5MA 4ETMA 1RE1A 1YJQA 1ZCJA 5F2EA 3FDZB 1FRFS 4L0CA 3IAHA 4NYMR 2ZULA 4LG1A 4QD3A 2X8JA 3ZJTA 2HLHA 1OPRA 1ZUIA 4QDXA 2IHUA 1J0CA 2FHPA 3N70A 1OU4A 5AHKA 3OT1A 4GRIA 4BQIA 1IWOA 4PTYA 5ALOA 5EFZA 1LQUA 2C57A 2KW5A 4GX5A 1RPTA 3CT6A 2ZW9A 4JMLA 4WCFA 1Z25A 4A5OA 2H2DA 3AEKA 2P79A 5L51A 1AZLA 2PAAA 1DTWA 3LQFA 3R3UA 4JQSA 4KXLA 4Q01A 2Q28A 2YCBA 3SEAA 4XRGA 5KMGA 4TLBA 2OZLA 4RBNA 1FS4A 4FLMA 2NVWA 3CH5A 1TMGE 2KBEA 4JI5B 3ZXYA 1UMDB 3GAFA 4HDNA 3KWLA 4JMPA 1SEPA 2H18A 1AK1A 2IPAB 2V65A 4OBWA 4UUNA 3E35A 2G4VA 3HDQA 1NQXA 2P7HA 4Q9IA 5I7RA 5MFPA 1C8BA 1JV2B 3CM0A 2IUTA 2MHCA 4UTVA 4C0LA 1B3BA 2Q45A 1DRJA 1GAXA 1FMFA 2PL1A 3CNOA 3HCOA 3I8SA 3DZFA 1RR6A 4HP8A 3V4PB 3VM6A 1C4WA 4P4LA 2GF2A 1O3YA 3LXXA 3BK2A 5IC4A 4P8RA 3UTCA 1M10A 1O8CA 3QU9A 4FE7A 4MQ5A 3HH8A 1IMOA 1HYBA 2YC2C 3LS2A 5DGCA 3X1MA 1DKUA 2VAVA 4MRMA 4DA8A 4E31A 1VC2A 4H27A 4I1PA 1NPDA 3ONNA 4G9BA 4MR7A 3KTDA 3MMNA 4NV3A 4WINA 4R9NA 2JK0A 1NXXA 4IFBA 4U4AA 4WKPA 2FK7A 3P2IA 4DV5B 4HPXB 2XBLA 4IWXA 5EMHA 4FLFA 3IMGA 3UW3A 3B6KA 4BRZA 1KXJA 4DA0A 3ZCQA 5CA1F 5FHQA 4RVFA 4DXHA 4B6JA 1T5OA 3OPXA 4EKDA 1MQ8B 3ZU4A 4R2HA 1SQFA 2D2IA 1S2GA 4C6TA 3D7SA 4EJMA 3HA5A 3PUXA 3HB7A 1SC3A 1I01A 1E9SA 1C41A 1ODIA 2P9JA 3CCFA 1QAQA 1XLTC 5CA0B 4RMGA 4YMSA 1VZ2A 1F0NA 4FYMA 1G42A 4G84A 4OTZA 4O4LB 4F9FA 3RIHA 3RVOA 4ZMRA 2ZRMA 3OPYA 4W82A 3FTEA 1NA5A 3MWKA 3N0WA 4FMPA 4HQKA 5AVQA 2HWYA 2Q9UA 5F3WB 1KI8A 1JKJA 2PH5A 2TRSB 4HBGA 4FT4A 4PX2A 3CZCA 1K8ZB 3S8EA 2YYAA 2NO5A 4YMUA 1E94E 1VLMA 2OAEA 3GGDA 3OMXA 4NMMA 1NJ8A 1QS0A 2CZGA 2W2QA 3P9ZA 3U4IA 4MR9A 4JI1B 1GZUA 1MOPA 2YYYA 1M2WA 3STTA 3STXA 2O2SA 4YRFA 5DEIA 2A2ZA 1A04A 4C6HA 4AFNA 3RFTA 4UUOA 4CN8A 3EEIA 4UUQA 2VOEA 4IILA 4QREA 2VF7A 1H6DA 3UB2A 4D81A 3QJGA 1X2BA 2JLCA 3I1FA 4JEUA 3BD8A 4R2JA 1B16A 3NUGA 5HS4A 4CDGA 5CBPB 5CD9A 5JJKA 2VPQA 1QRRA 2BGTA 2BFWA 2GA8A 2Z9DA 4BU1A 2VOJA 1ZM9A 1Z13A 4HUTA 3A1EA 1E9AA 2XQIA 3BQMB 3KZNA 3PLRA 2WKPA 2FZWA 4ZO9A 1UPAA 2X15A 5I7FA 3NAQA 1KVSA 3KTOA 5BSHA 4P3OA 1EEHA 4BLOA 1CCWA 3TTWA 4MLPA 4XM0A 1BWPA 2AEJA 2QD4A 2VQ6A 3DB2A 4QPCA 1EFPA 1XDBA 3U4AA 4DCMA 3GFRA 2W2OA 2NOAA 3IO3A 1YE5A 4KDEA 5BSRA 1FTNA 5H83A 1I94B 1PQYA 4UU1A 3O2QB 4CT5A 2AE2A 4LXHA 1E2FA 1JLSA 4GXNA 4TWRA 3LIPA 2NU7B 3W0LB 2C1XA 3MFYA 4WNIA 5ITZB 5IN4A 1EVJA 1QFMA 1R6VA 3ZWBA 4B4OA 1YTUA 1UK7A 5K3OA 4F1WA 3G23A 1H93A 1TAUA 2HXGA 4KN6A 1UKYA 1L4UA 4JKIA 1GWNA 5D5PA 4YMLA 4EJSA 2C20A 3CUUA 4MQFA 4OQMA 3DUFB 3LFUA 4R3UC 4UOZA 3BIJA 4LBWA 5EY5B 1U1EA 4GDMA 4ZOEA 1L7BA 2AEMA 3I64A 3QX7A 1YZNA 3PFFA 4PFSA 1I33A 2YJ6A 3BMCA 4TS1A 4UHBA 4QODA 3I76A 1BU5A 1F38A 4GW3A 4Q0MA 3BUSA 3CWQA 2ZZKA 2QN1A 4BOYA 2HIHA 2NYRA 4FX5A 3WXMA 5BRAA 3G7UA 2Y1EA 2B4KA 2BEWA 1V16B 3CZ5A 4R16A 3D8SA 4TV8A 2QTVB 1ZA1A 3TD6A 3OZXA 4X66B 4DR5B 4A8HA 2JFXA 2OV3A 5I8WA 4ZYXA 3C3XA 3VZSA 3EVFA 3ROTA 1PTJA 1L8QA 1UC9A 3AUXA 3DEKA 1ICEA 3ETEA 4PCVA 1ABFA 1OV4A 1XMPA 1YQUA 3TVDA 2DHQA 2FMFA 5GADl 1P3Y1 3A6FA 3ENNA 3ZD6A 4MR7B 4P2GA 3FWKA 5EHQA 4C4TA 4UTNA 5KTRA 5BQXA 2P6RA 3AY7A 5IFLA 2Y1FA 1P4JA 4O2LA 3GN1A 4PHFA 5IK2A 1XRPA 5U1PA 3KL2A 4OIMA 1KE1A 5AVUA 4K2HA 3MERA 4CTJA 3FUUA 3KDSE 5CNJA 4D3SA 2AJLI 1NJ6A 5JBIA 3FCYA 4YEDA 4CM8B 3GWZA 2VRCA 2I2BA 2JJQA 1GRCA 2RK6A 1M8KA 4HQ6A 5AK6A 3Q0TA 5G4KA 1E2DA 1VHJA 1Z45A 4FKMA 1O4WA 4FI3F 4EW2A 2QTNA 3HN7A 2V7UA 3MTDA 3IQFA 3JTEA 2JIPA 4IRUB 1CW2B 4NK4A 1DJMA 1R8SA 3HCPA 1T91A 2PS1A 1LTHR 2ZGVA 1K0UA 3R5JA 4B71A 3JQAB 4ZANA 1PDVA 2JCGA 4BZWA 1E1RA 1OI2A 1RJEA 2PSEA 3NYIA 2R66A 5INTA 3YASA 4S1VA 1FUIA 4AUMA 1EVIA 1H5NA 1IEQA 2W2KA 1NVXQ 1V41E 2H54A 2NADA 5HQ3A 1Q1BA 3EJWA 4H2DA 4DMGA 3KE9A 1II0A 3Q6NA 4TPKA 4OUKX 4I9NA 4HN9A 1IY9A 2AFHE 3KSUA 3BCHA 4FWIB 1P29A 1DO2A 1G59A 1FP4A 4YRRA 3CT4A 3ILVA 2X7JA 3DKRA 3FPAA 3HZRA 1X94A 1AE1A 4G01B 5ENVA 4XRRA 4IFIA 1RIIA 5D86A 1KOLA 2WV9A 3V9AA 2P3LA 4AC9A 4DIMA 3JTMA 4UUAA 1KRHA 1V9LA 4D8TA 5KOHB 1PLJA 4JLVA 1GSOA 1F9EA 1VI6A 2F9LA 4TV9B 5FBRB 3ZD7A 5A3VA 2AOWA 1HEYA 4DAOA 4B79A 3KQNA 4IIYA 3Q8LA 3KPJA 3OZVA 4MA4A 3QITA 3ZDRA 5AKIA 2C7PA 1BMQA 1NYLA 2AW3A 5SY9A 5C51B 2NUTA 3H5AA 2ZYAA 3MWEB 5GM2A 2ZYTX 4YAOA 4JL6A 1P4HA 4P2BA 1TGVA 2ST1A 4MA0A 1V43A 3JPWA 4P34A 3C3CA 1OBOA 4RM3A 1AKEA 4IUCS 1QR6A 5CURA 3JSAA 1GGFA 3AIOA 1HNNA 1UDRA 3B1XA 4R0NA 4RA6A 4F45A 1M73E 1T36B 2C4VA 3DEAA 1YACA 1ZJ6A 4K6HA 5E6RB 5IEBA 2FY8A 5LR6A 1V35A 3W5CA 3FLAA 3I58A 4O0LA 1AB5A 2NNLD 4QOFA 4W5NA 3DTVD 4HDSA 4GZ5A 4FGJA 3DP7A 4OU4A 2CE7A 1PF7E 2VYND 3N74A 4B74A 2QN6A 1GNQA 2GD2A 2CYCA 2O0HA 2DGDA 2ZE7A 2I71A 3H18A 3HHPA 1QZ3A 1IOVA 2JBAB 3M3HA 4HAVA 1TM2A 4NAHA 4BNKA 1E1QA 5LU9A 5EPUA 4DJJA 5IT9A 3R5TA 4RWZA 2IIBA 5TVKA 4NOKA 3KHTA 1CB0A 1QUFA 2FPIA 2OOSA 5FPKA 1KR2A 1VYVA 2XTMA 3P9NA 4JGGA 3TB6A 2N1MA 2YV5A 1SVNA 1B7GO 7YASA 2FZLA 2HADA 3FPKA 4H3VA 2O6LA 3H9GA 2B0CA 2VHUA 2BZGA 1R8QA 1XV5A 2Z98A 3JAKB 1XU4A 3Q5EA 4FHGA 3G0HA 2PR2A 1OE0A 4LFBB 1TA0A 4EG4A 1Z8FA 2CKMA 4YRCA 1XLWA 3AI1A 4O1HA 3A4LA 1Y3DE 2PU7A 2ZJ7A 3FUWA 3KYCB 4NCHA 5EN4A 4BMCA 2WKRA 1R0KA 4J0HA 4U7JA 4DBZA 4Z5XA 3OM0A 5GGYA 1U99A 2EEPA 3IP6A 3K20A 4RA9A 2YXBA 5DX8A 4JDPA 1YVRA 3W8DA 1AQYA 3LW8A 4YUYA 4O1IA 1KOFA 5AI5A 5JVDF 2QSJA 3R4CA 1NBME 1XO1A 1L7VC 1ECPA 2D7JA 4KUEA 2ID9A 3T38A 1Y7HA 1QHNA 4FD3A 1I0IA 1UIMA 4M8KA 1WDMA 3ANTA 1OAOC 4ISCA 4ZFNA 1Z0IA 3IV6A 5JAMA 3KP1A 2P5SA 4W7HA 3UH1A 3HV0A 3II6X 5L3QB 2V1XA 1M6EX 1RM3A 1DBIA 1PFUA 2JGDA 3NBAA 4K46A 4DY4A 3AETB 2IDMA 3IALA 4HWSA 3FMIA 1XIVA 3QEBZ 3K4HA 1NX6A 5DRYA 4DQ0A 1UFKA 1ZITA 5AVTA 2AMVA 1Z9BA 1O4VA 2Q21A 2GBLC 3G17A 2E4AA 1C30A 3PICA 5HFJA 4YYEA 3NALA 2WIGA 3OKAA 1SVSA 5CFNA 2OV2A 2AT1A 2QP3A 5B1HA 3LA6A 2XDWA 3BWCA 2YOFA 2GH1A 4LV6A 1OX4A 4FS8A 2UZAA 3RR2A 1TAQA 3KKQA 2XD9A 2OZEA 2D4AA 3C6YA 2WJ3A 3QF4A 4G0WA 3H2SA 2C2HA 3QOFA 2QUIA 3UGQA 3Q9LA 2R87A 1GPMA 1NAHA 1GKKA 2LKDA 3Q72A 1K75A 2XZLA 3JQDA 3RREA 1HDIA 2JC3A 3C7CB 3QH4A 4R0VA 3RAGA 2X4IA 4RVSA 2GA9A 3GLGB 1Y3IA 3SJAA 4GP6A 5KX5F 1KYWA 1B0PA 1SKBA 2JGNA 3NYRA 4ID3A 4B0PA 3DE2X 1L4FA 3TZKA 1OFGA 5SYNA 3UBMA 5AK3A 1R16A 2JI8A 2VUTA 2G04A 1P3JA 1Q77A 2YV3A 2PJUA 3GXBA 4M21A 2GETA 3JWPA 4NS1A 3PFIA 5F12A 2GHTA 3OWOA 2NU6A 1NKVA 3WGHA 4IXWA 4JUDX 1LVHA 1NVKA 4IMPA 1KO5A 2H92A 4N39A 5BV0A 5C4IA 1WZCA 1SKYE 1O1YA 3BRWD 1NRJB 1PUXA 3BGIA 3VSEA 5CVVA 2XMDA 3KKZA 2QIOA 1OTHA 4CEHA 3A28A 1FJ2A 1ZK3A 1EFCA 2VYFA 1WSBA 2JFNA 3DZKA 4FILA 2R62A 1PW7A 3RS0A 3CZ4A 5ADWA 1I0LA 4PZPA 3PD0A 1KKMA 3N8DA 4PV7A 5E6UA 2P35A 4KAFA 2NP6A 1UXOA 2Q4RA 4WW0A 2B36A 4BVGA 2UUAB 4RLHA 3VTKA 2RONA 3GEIA 1OLSA 1RADA 5HCIA 4M46A 2PM8A 4HLUA 4TQGA 2QRGA 5LMCA 1QE3A 5DBEX 4YALA 2HCTA 2Z8XA 1IB6A 3X1DA 3FF1A 4N5NA 1WTCA 1QYXA 1JHDA 4YP9A 4QELA 4DMHA 2VSFA 2BKLA 3HSKA 1VRVA 2AOTB 1Z7WA 3LV8A 4RV4A 3B89A 3OMLA 4YUZA 2AC4A 4R0MA 4MI6A 3DFIA 5J4VA 2FX2A 3WZLA 4LC9A 3VO8A 3L0IB 3UKOA 2ZPAA 1OILA 3CN7A 5JDCC 1QV7A 1MQSA 1ZL0A 4V39A 5CK4A 4XVUA 1K88A 2ORYA 1Y6JA 3KUUA 3UV3A 4WZBE 2ZG6A 3UF0A 1OMOA 2DPXA 4WLVA 4RACA 2NSHA 4FK8A 4ACBA 3ZHTA 5I9LA 2HHHB 5COAA 4J0QA 1ZMRA 1XHLA 1JVNA 2VZ8A 1XBTA 4HLQB 4U6SA 4DSNA 4X00A 4HH4A 4XIYA 5EMKA 3ADCA 2PZJA 1J2YA 2RAVA 4XGIA 5ALQA 2OSVA 5GZ6A 8ADHA 3KFLA 3TINA 3HBMA 3TSAA 2BMDA 4PHTA 1QO0D 3C70A 5LLSA 2AQHA 4MDYA 2VZ0A 3FHLA 3HCDA 4MYUA 4ARIA 3E70C 4RJIA 1N6OA 2FGJA 1WABA 1V7CA 3WO1A 3T5TA 3B7PA 1ZBQA 1U3VA 3QVWA 4YMHA 4V2UA 2WD9A 1XVUA 4EHDA 4P3XA 1MTZA 4AJEA 4BV8A 4DLLA 2RGDA 5AKZA 3A9WA 4LEIA 2B30A 3PQ2A 1ZHOA 3BD6A 2L2QA 1TMKA 3L01A 5THQA 1E5QA 3KIPA 5AUQA 3WNVA 2Y1DA 1KZ6A 3HYLA 1IPFA 2QUKA 4R8RA 1EZZA 1GPWB 2ILVA 1Q5PA 5E7IA 4B6EA 1ZG3A 2P0AA 2IJGX 4F4HA 2BM9A 2HBRA 4AP6A 3WZMA 1BHO1 2CJXA 3UT0A 3KZMA 2QRQA 1B6SA 3OEHD 2DUUA 2IBTA 1KEUA 1QLJA 1Y8QA 3CA8A 2XKJE 2AS0A 4C5BA 1CY4A 4ZYVA 3A4TA 1ZNWA 2VTBB 1JE1A 1J06A 4NFLA 4NU8X 3QTTA 2EV9A 1XPRA 1L4YA 4KLNA 3P5SA 1F51E 1V11B 3FFWA 5G0SA 1R5BA 3AEUB 3I4LA 1TE2A 3QQ5A 1G2PA 4H7DA 1HZJA 4KTTE 3UTDA 3CLRD 3PPIA 1N3YA 3NIWA 5CLIA 2QQ0A 4PLGA 3TRIA 4N5IX 4US0R 2FLVA 1FFBA 2NT4A 3BK7A 1NVGA 2D54A 4Q37A 4BMZA 1EB8A 3GI1A 1RAEA 2HAEA 5I7SA 1C8LA 2QTLA 4TT3A 3V33A 1VHDA 2AN1A 4FYWA 5CX4A 5CEJA 4K86A 4P6VF 3ZDYB 1ZD8A 1K8YB 9LDTA 5CB0A 1XROA 2BI7A 3JR3A 2XGMA 1YC2A 4K88A 5AKKA 3ERCA 1LNZA 1GR0A 1M1YA 4QWWA 1PSDA 1Z6ZA 4PPFA 3VR6A 3IVRA 4FJ0A 2DSTA 4U7HA 1G0OA 1R74A 2ZSDA 3UJ7A 1SG9A 3PE4A 3G8AA 1GQOA 5BN3A 3RC8A 1HQDA 1PHPA 2WM8A 1DINA 3Q7EA 1L5RA 2QD5A 3I6ZA 5AUNB 3PGA1 3CB4A 4YWJA 1U2DC 2QTGA 3UJBA 2P3OA 2W11A 4DUGD 4LC0A 5LSAA 1M1ZA 2FSUA 3EPRA 3VYWA 2O48X 1OUMA 4V0QA 1FP7A 1N2JA 2H7CA 4CMCA 1ZI6A 1TO6A 3RSFA 1PR5A 4TKUA 4IHJB 3EGIA 1A9YA 3U17A 2YZMA 1J5PA 1DBSA 1EFVA 2JNWA 2OCYC 2XDYA 3BTUA 4HC4A 4WACA 4KRFA 2G5TA 3E9ZA 3RCBA 3JWGA 1BNCA 2IU4A 3AIIA 4GYJA 2FWJA 3AFOA 4J4HA 4JBNA 2A5JA 4ZAYA 5EP4A 4B5LA 3ER8A 1GUFA 1TJNA 4HAIA 5FF9A 3NTUA 4F96A 1FFHA 2WUWE 2JA1A 2NO7A 5JD3A 5A4AA 1ADGA 5F2NA 1QQTA 3AVOA 2GBPA 3N8NA 1WKCA 4JJFA 5AKJA 4B46A 1UXGA 2Z09A 2AXQA 3IAS6 3L7IA 1B6TA 1C7JA 3OQJA 3BRSA 3KB8A 3FYCA 4GFDA 3UN1A 3WYAA 4W5TA 3GJQA 2C7QA 3O95A 1E0SA 3NVAA 3CKMA 4OQXA 3Q3HA 2X19A 4XSHA 4YPFA 1V3TA 4Z3DA 1EP2B 4ETIA 4WBNA 2AI2A 2R7KA 3MLBA 3RJ5A 4C7BA 1UXIA 2IYWA 1EUCA 2V5UA 3F6BX 2OORC 4AYWA 2C82A 2ZTSA 2EKPA 4V3BA 2RHMA 1GTG1 4RTSA 3K9LA 4A4DA 3EGVA 1GVHA 3M4NA 4CR8A 2C9OA 4EVRA 5K20A 2MSDB 2RGAA 2Q3JA 4IW3B 1CRLA 4JLNA 4NAUA 4R1PA 3RUEA 4B75A 5CDFE 1ZESA 2YV4A 3JWEA 2R6DA 3QUBA 5CFPA 1PWXA 1OJLA 1QWSA 2DUMA 3N0XA 5F35A 3UGTA 3G7NA 1JKXA 4TMTA 5DRTA 4LVOA 2VNJA 4A15A 5ISMA 3TQFA 3L93A 4LJ4A 3PTZA 5EJGA 3K92A 3L18A 3OJLA 3URMA 1KDZA 3V4LA 1QPZA 1BDJA 3KCNA 1NU6A 2XIQA 1IU9A 2V6IA 4GICA 2MYNA 4I3HA 1Q84A 4XGRA 2CLHB 2R48A 3DDWA 4TRJA 3UENA 5IYZA 3FFBA 2BFOA 1NG1A 3REQA 1I2DA 2Z4SA 4H15A 5CEFA 5BW8A 2WY2D 1WMBA 4S1OA 3WLMA 5A71A 1XRNA 2LKCA 3JD3A 2BOVA 2I7XA 3KLOA 4HB3A 5HKKD 5JH7B 1YJ5A 5KQSA 4LHZA 4YCBA 4PSCA 1MFPA 5A7GA 1FXWF 5HQTA 2CXOA 4JX9A 4TWZA 5JY6A 1YS4A 1QDEA 5CT6A 1E4EB 4HWTA 4J3FA 4PC7A 4R9RA 5F21A 3RYHA 3ZEIA 2ZANA 4ZODA 5C7OO 5I01A 3MUFA 4XDHA 1HE1C 3TGWA 4BFZA 2IZ1A 4K8OA 1N2CB 1Y5NA 3ZTWA 3ETHA 4YC7A 2FLWA 4M9SA 3ETLA 2C97A 3EARA 3VKVA 3WX0A 5HDBB 1XK7A 1DTEA 1T9HA 2GJ4A 4HFJA 1E7YA 5FYDA 4Z7NB 1YK0A 4C3VA 3N39C 3T3PB 2PS0A 1D9XA 2XB4A 4EQ6A 3TZ6A 4IZHA 2IYSA 1GGMA 2F3RA 1SHLA 4BN0A 3RBAA 4BO8A 4ZU3A 4EZBA 1KVQA 5KAMA 2AFIE 3IX7A 1S2NA 2BE9A 4MQ6A 4C0QC 1DC3A 1BGWA 1SIUA 2DTDA 2HV8A 2PU5A 1ZC4A 2WMOB 4WLEA 4ETWA 3D8TA 4OLHA 1EUDA 1L6RA 2CDNA 2IYTA 1W0JA 4BNLA 4FZVA 1D8TA 4BYMA 4KVFA 1XLTA 4WFQA 2A35A 1ONSA 1SUAA 2WEKA 2EGGA 3BJIC 4TYMA 3UHJA 4EGJA 5A6VA 2FJUA 2Y1XA 5ICMA 5J47A 3NDBB 1X70A 3LP6A 1X8JA 4TXHA 2EC5A 3ISJA 3VMFA 3UVEA 3BVPA 2QW1A 4I4TF 1B2LA 3ENZA 3NH6A 4DQDA 4EJSC 1N34B 4RKQA 4YRJA 3W3AH 3AR2A 3WI7A 1I1NA 1T9CA 3FDXA 2Z1MA 1U2EA 1GEGA 4OHOA 1ZHHA 1KWKA 1AG9A 1X1QA 4JI4B 1OY1A 1DRUA 2JAWA 2BGKA 1F4LA 1FSSA 1N7JA 1YQTA 3I9MA 5HMMA 1Q14A 5CFLA 1FFYA 1HK7A 1FY2A 3IPRA 4ZCQA 5ARDA 4CI9A 3AERB 1U1FA 5IAAA 5CUQA 4HZGA 4YPVA 3TW8B 1SBYA 4HLDA 4EENA 4OI0A 4YQFA 3I4CA 5TJ9A 1YU9A 2UDPA 1ZISA 5FOTA 1EGHA 2DT5A 3OTGA 1MLDA 4CLXA 1ZOOA 2HB6A 2V7GA 1MC8A 3V9PA 1V4NA 4NZYA 1Q17A 2P9ZA 3HYNA 3I8XA 4ZVTA 1PFYA 3SMQA 2YHIB 1R0RE 1TKBA 1GILA 1JLLA 3KVNA 1VI5A 3MN1A 2G6TA 4LWPA 4MYRA 3Q3EA 1MMFB 1Z16A 2RARA 2Y1LA 3BD7A 1Y5MA 3KELA 2HSGA 1RTTA 3WIUA 3KJQA 3LH5A 1PVVA 1HSOA 1ZK2A 1N5OX 2ZUBA 4U2KA 5L4SA 4PY2A 4O8CA 4TTAA 1QF7A 1MQ9A 1HYEA 3ELDA 2IL1A 4M37A 3E5MA 1A5ZA 2JANA 3FYDA 4QNMA 4ZZIA 1BO6A 1EFTA 2CXUA 4KVGA 3GUZA 4Z49A 2OLEA 1MJHA 3NVDA 4G5HA 1K08A 1NRXA 3HABA 1T3TA 1DRVA 4BNIA 1T8RA 2HXYA 1VRCA 2VDOB