2VBQA

Structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
b'SHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
publication title Kinetic and Structural Analysis of Bisubstrate Inhibition of the Salmonella Enterica Aminoglycoside 6'-N-Acetyltransferase.
pubmed doi rcsb
source organism Salmonella choleraesuis
molecule tags Transferase
total genus 39
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vbqA00
2VQYA 2B4BA 2ZW6A 2G3TA 4IF5A 2Y0MA 4E2AA 4L89A 3FBUA 3FXTA 5F48A 5H86A 2Q44A 3D8PA 4OAEA 4KVXA 2REEA 4JJXA 3FB3A 2PC1A 3IGRA 4KUAA 4CRZB 1YLEA 3CXPA 1S3ZA 1IB1E 2FS5A 4AVBA 3QAHA 2B5GA 4FD6A 3MGDA 3JUWA 4KOYA 4R87A 1MK4A 5EC4A 2PSWA 4OLLA 2OZHA 1M4DA 1KZFA 2ARHA 2Q7BA 3E0KA 1KUVA 1VKCA 3FNCA 4KOXA 5C88A 4OADA 4II9A 2J8RA 1QSOA 2CNSA 1NE9A 4R9MA 1P4NA 1S7LA 2GIVA 2P6GA 1S5KA 2P0WA 1I12A 1S60A 2PRBA 4AB7A 3BLNA 2DXQA 3CXSA 1Z9UA 3VWDA 4QB9A 5KTCA 3NE7A 4H89A 1XIXA 3W91A 2PQ8A 2ZW5A 2Q4VA 1Y9KA 3PP9A 4Y49B 2BEIA 1YK3A 4B5OA 2A4NA 4UWIA 3R95A 3EC4A 3GYAA 2Q0YA 2P6FA 3DR6A 1S7NA 1J4JA 4XNHC 4YRHA 2PR1A 5I0CA 1QSRA 1YVOA 2BL1A 2OZUA 3W6SA 2JDDA 1Q2CA 4ZBGA 4U9YA 5HH1A 2R98A 3BJ8A 3R9FA 4KVME 1NMTA 4HNXB 5IX3A 3FIXA 1FY7A 2VI7A 4L8AA 2J8MA 3SXNA 4U9ZA 5GCNA 2FE7A 1B87A 4AG9A 2O28A 3UY5A 2GE3A 2RC4A 4JWPA 2QMLA 2Z10A 3LODA 1B6BA 5F49A 1R57A 5KTDA 2X7BA 2OH1A 3R1KA 4KVOE 3N7ZA 4MBUA 4R57A 4IUSA 4XPKA 1S7KA 3TFYA 3D2PA 4LUAA 4E0AA 1IYLA 4AVAA 1KUYA 4ORFA 4XPDC 4J3GA 5JPHA 4KZTA 4I49A 1BOBA 1M4IA 1U6MA 3RYOA 1Y7RA 1IIDA 4MJ8A 4PV6A 4B5PA 1SQHA 4MHDA 3H4QA 5IB0A 2Z11A 4R3KA 4QVTA 5DWNA 3K9UA 4PSWA 3PGPA 4X5KA 3KKWA 2FL4A 1WK4A 4MY3A 3I9SA 5H84A 1PUAA 3D2MA 1RO5A 3S6HA 4F6AA 2AE6A 1L0CA 4NEXA 4KORA 4JLYA 2FCKA 3ZZIA 2I00A 1XE4A 2GANA 3P2FA 3S6KA 1S7FA 5E96A 1IYKA 2WPWA 4KOVA 4CRYB 2R7HA 1RXTA 1UFHA 4KUBA 4PK3A 4XNHB 1TIQA 1VHSA 3W6XA 4PSXA 2OZGA 3F0AA 5ISVA 4XPLA 2HQYA 1YREA 3T90A 2JEVA 2R1IA 1Z4EA 2FXFA 2VZZA 4RI1A 3G8WA 1N71A 2F5IA 4QC6A 1M1DA 5J8CA 4HNWB 4KLVA 1YGHA 4CS0B 1P0HA 4H6UA 3GY9A 5CNPA 3VWEA 1YR0A 2B58A 4HNYB 4BMHA 2H5MA 3ZJ0A 1XMTA 4QBJA 2B3UA 4ONUA 3P2HA 2PDOA 3LD2A 3TOAA 2D4OA 2K5TA 3TE4A 3CXQA 3I3GA 2OU2A 3TOBA 1M44A 5J8FA 2PR8A 2EUIA 3PZJA 3SXOA 2ZW4A 4F0YA 1I21A 3SHPA 4CAXA 3G3SA 2Q04A 4KOTA 1BO4A 2KCWA 4XPDB 2HV2A 3QB8A 2B4DB 3F5BA 2JLMA 3D3SA 3FYNA 3WR7A 3BJ7A 4KLWA 1Q2DA 3TO9A 1NSLA 5DWMA 4EVYA 1V0CA 1KUXA 1CJWA 3EY5A 1ON0A 2IL4A 3EFAA 5F47A 2VZYA 3F8KA 4NF1A 2FT0A 2REFA 3S6GA 1M4GA 2B3VA 4KOWA 2P6EA 3OWCA 3TT2A 3DDDA 4KOSA 4NCZA 2I79A 2WPXA 2FIWA 1QSMA 2FIAA 2Z0ZA 2R8VA 3JVNA 4KOUA 1QSTA 4H6ZA 4QUSA 4PK2A 4HKFA 4CAWA 1K4JA 5JQ4A 1XEBA 4GS4A 1WWZA 1YVKA 4AG7A 4CAVA 2HUZA 2B4DA 5IV0A 1XF8A 1LRZA 4JXRA 4UA3A 4M3SA 3TO6A 3GKRA 3DNSA 2C27A 2G0BA 4K30A 4FD5A 4MY0A 1I1DA 2VXKA 3R9GA 5KTAA 4FD4A 4AVCA 2NMTA 2ZW7A 4DNCA 4UWJA 2BUEA 4NSQA 1YX0A 5C82A 4RS2A 1Q2YA 5FVJA 4UBRA 3R9EA 4Y49C 2EVNA 3V8IA 1QSNA 4JXQA 2ZPAA 2OB0A 1GHEA 3TTHA 1MJAA 3S6FA 2D4PA 3C26A 1Z4RA 2AJ6A 4E8OA 2ATRA 2CNMA 3IWGA 5EBVA 2FSRA 2JDCA 2Q4YA 3R96A 2VBQA 4YGOA 1PU9A 4M85A 1IICA 3FRMA 4B5PB 2ZXVA 4LX9A 2BSWA 2QIRA 4FD7A 4U5YA 2B5GB 4R3LA 3DSBA 5F46A 2QECA 3T9YA 4YFJA 3DR8A 5HMNA 2G3AA 1Y9WA 2CNTA 3B8GA 1CM0A 1MJ9A 4NXYA 1OZPA 1MJBA 4JD6A 3TO7A 3TCVA 2VEZA 3EO4A 2J8NA 4MI4A 2CY2A 3EXNA
chains in the Genus database with same CATH superfamily
2VQYA 4GM5A 2B4BA 2ZW6A 2G3TA 4IF5A 2ABZA 2Y0MA 3LWUA 4P4DA 3FF3A 5HVHA 4E2AA 3KQZA 4L89A 4G1PA 1KWMA 5G22A 3FBUA 3FXTA 5F48A 5H86A 4NGQA 4UEEA 2Q44A 3D8PA 4OAEA 4KVXA 4FBEA 5A27A 4B12A 1IOIA 2WYRA 2REEA 4JJXA 2YNDA 3FB3A 2BOAA 4MHZA 2PC1A 3IGRA 5JGFA 4KUAA 4CRZB 1X10A 1TKJA 3PB9X 1YLEA 2PE3A 2PJ6A 3I1UA 5LRKA 3CXPA 1TKFA 4H2KA 4P45A 4DJLA 1S3ZA 1IB1E 2FS5A 4P6YA 1ZLHA 4AVBA 3QAHA 2PIZA 4RN7A 4MFLA 4PQAA 4PXBA 1NSAA 2B5GA 1Z8WA 4FD6A 2QVPA 3DGVA 3H8FA 3JUWA 3MGDA 4KOYA 4R87A 1AMPA 1MK4A 5EC4A 2PSWA 4OLLA 2OZHA 1M4DA 1KZFA 2ARHA 2ZOGA 2Q7BA 5HVGA 1GYTA 2DPSA 3E0KA 4MFQA 2YGWA 3B3WA 4P4IA 1KUVA 1VKCA 3FNCA 4KOXA 3K9TA 5C88A 4OADA 2Q4ZA 4II9A 2J8RA 1QSOA 2CNSA 1NE9A 3IU1A 4P10A 1P4NA 4R9MA 1S7LA 1F2PA 2EBJA 4UIAA 2GIVA 2ZEFA 2P6GA 1IU8A 4DUKA 2GLJA 4PXDA 1JQGA 2PJ2A 4OIDA 5K8OA 1VHEA 1S5KA 2C6PA 1I12A 2P0WA 1S60A 3KHXA 2PRBA 3FECA 3ISXA 5AGEA 3PBBA 4AB7A 1ELLP 3BLNA 4BD9A 4C2XA 4W9YA 2DXQA 4Q38A 4M6IA 3CXSA 1Z9UA 3VWDA 4QB9A 6CPAA 1VIXA 5KTCA 3GUXA 3NE7A 4H89A 2V8DA 1XIXA 4UCPA 3W91A 2PQ8A 2ZW5A 1UWYA 3NA6A 1LAMA 2Q4VA 1R43A 1Y9KA 3PP9A 4Y49B 2BEIA 1YK3A 1TF9A 3D7DA 5DS0A 2A4NA 4B5OA 5AG4A 1HEEA 1BPNA 4UWIA 3R95A 5AG7A 3EC4A 3GYAA 4UF4A 5G21A 4NJRA 4A30A 2Q0YA 3TX8A 2P6FA 3DR6A 1S7NA 1J4JA 4OC5A 4TWEA 2ZEHA 4XNHC 3WABA 1XBUA 2IMOA 4YRHA 4OP4A 4OC2A 3NE8A 1BPMA 2PR1A 5I0CA 1QSRA 4A37A 4P4FA 2AFWA 2AFUA 4MMOA 1YVOA 1TF8A 2BL1A 4CPAA 2OZUA 4FUUA 3W6SA 2PVWA 1FNOA 1LCPA 3NH8A 2JDDA 2CXAA 1Q2CA 2QJ8A 4ZBGA 4U9YA 4OIWA 2AFMA 5HH1A 3RO0A 3SJXA 2PIYA 2R98A 3BJ8A 2PJCA 4ZYQA 3R9FA 4KVME 1YLOA 1NMTA 2IQ6A 4ZGYB 4HNXB 5JM6A 5IX3A 3FIXA 1FY7A 2VI7A 4ZX9A 4L8AA 2WUUA 4NGSA 2J8MA 3SXNA 4U9ZA 3KL9A 5GCNA 1XRYA 2XEIA 2GREA 2FE7A 4C7IA 1CBXA 1B87A 2V77A 4B10A 5LYLA 4UEFA 4NFRA 3B2YA 1RTQA 4AG9A 2O28A 4NGTA 3UY5A 4CGOA 4NGRA 3QNVA 2GE3A 2PJ8A 4LQ6A 5ELYA 2RC4A 4JWPA 2QMLA 3VATA 2Z10A 4X2TA 3KQXA 1B6BA 3LODA 4HPSA 3CPAA 3S9LA 3B35A 1R57A 5F49A 3L2NA 3ISZA 5KTDA 2C6GA 3H8GA 5K8PA 1Z2LA 2ZENA 4F9VA 2PCUA 2X7BA 5HVFA 3V38A 2OH1A 4ONWA 3R1KA 2WSAA 5IB9A 4KVOE 3VH9A 3N7ZA 2O4HA 2NYQA 4MBUA 4C68A 1Z8LA 2ZELA 3BXMA 3KGQA 4R57A 2F8HA 2YNCA 1S7KA 4IUSA 4XPKA 3TFYA 3D2PA 4LUAA 4O23A 4YWYA 4E0AA 4MFPA 1IYLA 1DE4C 1M4LA 4X3RA 4AVAA 4NGMA 4P4JA 4YU9A 1KUYA 4ORFA 4XPDC 4B11A 1FT7A 2EWBA 4J3GA 5JPHA 4KZTA 2Q7SA 4I49A 2Z3PA 3FEDA 4A39A 3FVLA 1BOBA 1M4IA 1VHOA 1U6MA 1Y7EA 3H8EA 1Y7RA 3IFEA 1IIDA 3KR5A 1CP7A 4MJ8A 4PV6A 1HDUA 4F0XA 2PJ9A 4B5PA 1SQHA 3GB0A 4MHDA 2JEWA 3H4QA 4MCPA 5IB0A 2Z11A 3PB8X 4R3KA 4QVTA 1CPXA 5LRJA 3RNZA 1PYTB 3MN8A 5DWNA 1EE3P 3K9UA 2POKA 2AFSA 1CG2A 3CT9A 3PB7X 3TC8A 4PSWA 3PGPA 4X5KA 1BAVA 4OC0A 1ZO0A 4CAFA 4CGLA 3KKWA 3S9NA 2FL4A 3CDXA 1CP6A 1WK4A 4MY3A 3MRUA 2PVVA 3H5ZA 4OMEA 3I9SA 4OKOA 1QMUA 5H84A 1PUAA 1F2OA 3LACA 4ZY2A 5LYIA 3D2MA 1RO5A 4UCNA 3S6HA 4UFWA 4F6AA 2PJ1A 1ZG7A 2AE6A 4A32A 4CGMA 1L0CA 4NEXA 4KORA 3CZXA 4JLYA 2DEAA 2FCKA 4Q36A 4MFZA 3ZZIA 4A2ZA 3SI0A 1LFWA 4NGNA 4EMEA 2Z3OA 2I00A 1XE4A 3FEEA 1XMBA 2GANA 3P2FA 2AFOA 5THWA 3S6KA 1S7FA 5E96A 1IYKA 2WPWA 3B3VA 3SJFA 4MCSA 4KOVA 4CRYB 1LANA 3SJEA 1YW4A 2R7HA 2GFQA 1RXTA 1UFHA 1XJOA 1F57A 4KSIA 1ARMA 4MFKA 4KUBA 1ARLA 4PK3A 2OR4A 1IOFA 2C6CA 2ZEDA 4B6ZA 4XNHB 3NFZA 1LOKA 5K8NA 1TIQA 1YMEA 8CPAA 1AYEA 1JWQA 1VHSA 3V7ZA 2ZEOA 4A94A 3W6XA 4MFJA 2BCOA 4MHPA 4PSXA 3QAYA 2OZGA 4IK2A 3F0AA 3SI2A 4M6GA 4MCRA 2CIJA 2DPTA 4MCQA 5ISVA 4XPLA 7CPAA 2HQYA 2PJ5A 1HDQA 3JRUA 1YREA 3T90A 5CBMA 2JEVA 3BHXA 5AG5A 2R1IA 1Z4EA 2FXFA 2VZZA 4IHMA 2NSMA 4Q7AA 4RI1A 3D67A 3G8WA 5D29A 2PJ3A 1N71A 2V8VA 2F5IA 4QC6A 4P4EA 3IJ3A 1M1DA 2ZOFA 3D7FA 5J8CA 3PFEA 3VARA 4UEZA 3IO1A 4HNWB 3KASA 4KLVA 5EMIA 1YGHA 1XOVA 3RYOA 4CS0B 1P0HA 2IJZA 4H6UA 3GY9A 5CNPA 1YSJA 3VWEA 1YR0A 2YNCC 4KS9A 1XFOA 2GU2A 2B58A 2ZEEA 2PJ7A 3NH5A 4ZY0A 4HNYB 4CYOA 1ELMP 2H5MA 3ZJ0A 1XMTA 4BMHA 4ZY1A 4QBJA 2B3UA 3PB6X 3P2HA 2PDOA 4FWUA 3LD2A 3KHZA 4ONUA 2WZNA 3TOAA 4F8ZA 2D4OA 2K5TA 1R3NA 3IWEA 4KSFA 5F09A 1AUGA 2Z3NA 3TE4A 3CXQA 2PJ4A 4BBHA 3I3GA 4OC4A 2OU2A 1QQ9A 2F7VA 3TOBA 1M44A 4WJBA 2G9DA 2RB7A 3A9LA 4R8FA 5J8FA 2PR8A 2EUIA 3PZJA 4PPZA 3SXOA 2ZEMA 2ZW4A 3PRTA 3DLJA 4F0YA 1I21A 4P44A 3SHPA 4CAXA 3G3SA 2PJBA 4WWVA 2Q04A 3B3CA 4KOTA 1BO4A 1YQEA 3HLPA 2XEJA 2KCWA 1Z5RA 4XPDB 2PJ0A 3RZAA 3CPXA 3WT4A 5G20A 2HV2A 5I4MA 3QB8A 3B3SA 2B4DB 3F5BA 5CPAA 2JLMA 2V8GA 4KSAA 3D3SA 3FYNA 3GIUA 3WR7A 3BJ7A 5G1ZA 4KLWA 4MHNA 2Q51A 2BO9A 1Q2DA 3TO9A 1OBRA 3IWWA 1NSLA 5DWMA 4EVYA 1V0CA 1KUXA 1PCAA 1CJWA 2Q43A 2PJAA 1TXRA 3B7IA 4GXHA 3EY5A 1ON0A 3PEIA 2IL4A 3EFAA 4M6HA 5F47A 3WC6A 4C7HA 2VZYA 2AFXA 3RBUA 3F8KA 4JZ0A 4A38A 4NF1A 5AG6A 2FT0A 2JBKA 2REFA 4R7MA 3S6GA 2O53A 4Z65A 3K2KA 1M4GA 2B3VA 4KOWA 2P6EA 3OWCA 1VGYA 3TT2A 3DDDA 4KOSA 2PRQA 4X8IA 2ZEPA 3T8WA 4NCZA 2I79A 2WPXA 3FJUA 2FIWA 5A28A 1QSMA 3FX6A 2FIAA 2I3CA 2R8VA 2Z0ZA 4OC1A 4CYPA 3LMSA 4A33A 3JVNA 4C2ZA 1Y0YA 4KOUA 2V8HA 4PXEA 4PXCA 1QSTA 3KR4A 4H6ZA 4QUSA 4PK2A 1Q7LA 4HKFA 2ANPA 4UFVA 3BI1A 3HUVA 4CAWA 1K4JA 5JQ4A 1XEBA 4GS4A 4NJQA 1WWZA 1YVKA 4AG7A 2J9AA 4CAVA 2EO8A 1A2ZA 5LYFA 2HUZA 2CF4A 3NH4A 2B4DA 2XEFA 4OC3A 4JYWA 4R6TA 1TKHA 1XF8A 5LRGA 4CGNA 5IV0A 2ZEGA 2HB6A 1LRZA 4JXRA 4R76A 4UA3A 4M3SA 3KZWA 3TO6A 4K3NA 3D68A 3GKRA 1BLLE 3DNSA 1LAPA 2C27A 2Z3LA 2HC9A 2G0BA 3WC7A 2Z3MA 3BI0A 4K30A 3D7GA 2VL1A 3WC5A 1YW6A 2C1CA 4UIBA 1IY7A 2CTBA 4FD5A 4LQGA 4MY0A 2JBJA 1I1DA 2YNEA 2VXKA 3R9GA 5KTAA 4FD4A 4AVCA 2NMTA 2ZW7A 4ZI6A 4DNCA 4UWJA 1CX8A 1ZLIA 4A31A 3RAMA 4CGPA 4MHYA 3S9MA 5LYDA 2DF5A 3D4UA 2QYVA 2BUEA 3FMCA 4NSQA 4AXVA 1YX0A 2FVGA 3IC1A 4NGPA 5C82A 4RUHA 4RS2A 1Q2YA 5FVJA 4UBRA 1Y0RA 3R9EA 4Y49C 5D8NA 4UFXA 2EVNA 3V8IA 1QSNA 4JXQA 4CAEA 2ZPAA 1ZG9A 2EK9A 1GHEA 2OB0A 3IEHA 3FH4A 4ZX8A 3TTHA 1MJAA 3S6FA 4MRIA 2D4PA 3C26A 1Z4RA 2AJ6A 4E8OA 2ATRA 2CNMA 2GLFA 3GLJA 3IWGA 3JTKA 5EBVA 2FSRA 2JDCA 3KI9A 1DTDA 1CPSA 1X12A 4MXUA 2Q4YA 3R96A 4C2YA 2VBQA 4YGOA 1PU9A 3SI1A 1ZG8A 2RFHA 3B3TA 4M85A 4FAIA 2Z3KA 1IICA 3FRMA 4B5PB 1Z8TA 2CTCA 4CYQA 3IU2A 4UCMA 2ZXVA 4LX9A 2BSWA 2QIRA 3PB4X 4FD7A 4U5YA 2B5GB 4R3LA 3D66A 3DSBA 4F9UA 2ODFA 4DYOA 5F46A 2AFZA 3D7HA 2QECA 3T9YA 1H8LA 3DR8A 3N5FA 4TNUA 3SJGA 4YFJA 5HMNA 2G3AA 1Y9WA 2CNTA 3B8GA 1CM0A 1Z8XA 2XEGA 1MJ9A 4NXYA 1OZPA 4P4BA 1MJBA 4JD6A 3PBEA 3TO7A 4BINA 2EK8A 2OOTA 1IGBA 4CYNA 5BWAB 4EFDA 3TCVA 4B13A 2VEZA 4IAVA 4EWTA 4A95A 3EO4A 5HXDA 2J8NA 5JH9A 3IIBA 5K8MA 3PFOA 4MI4A 5J1QA 2CY2A 3EXNA 4B14A
chains in the Genus database with same CATH topology
2VQYA 2B4BA 2ZW6A 2G3TA 4IF5A 2Y0MA 4E2AA 4L89A 5G22A 3FBUA 3FXTA 5F48A 5H86A 2Q44A 3D8PA 4OAEA 4KVXA 5A27A 4B12A 2REEA 4JJXA 2YNDA 3FB3A 2PC1A 3IGRA 4KUAA 4CRZB 1YLEA 3CXPA 1S3ZA 1IB1E 2FS5A 4AVBA 3QAHA 4MFLA 2B5GA 4FD6A 3MGDA 3JUWA 4KOYA 4R87A 1MK4A 5EC4A 2PSWA 4OLLA 2OZHA 1M4DA 1KZFA 2ARHA 2Q7BA 2DPSA 3E0KA 4MFQA 2YGWA 1KUVA 1VKCA 3FNCA 4KOXA 5C88A 4OADA 4II9A 2J8RA 1QSOA 2CNSA 1NE9A 3IU1A 4R9MA 1P4NA 1S7LA 2GIVA 2P6GA 1S5KA 2P0WA 1I12A 1S60A 2PRBA 5AGEA 4AB7A 3BLNA 2DXQA 4Q38A 3CXSA 1Z9UA 3VWDA 4QB9A 5KTCA 3NE7A 4H89A 1XIXA 4UCPA 3W91A 2PQ8A 2ZW5A 2Q4VA 1Y9KA 3PP9A 4Y49B 2BEIA 1YK3A 4B5OA 5AG4A 2A4NA 4UWIA 3R95A 5AG7A 3EC4A 3GYAA 5G21A 4A30A 2Q0YA 2P6FA 3DR6A 1S7NA 1J4JA 4XNHC 4YRHA 2PR1A 5I0CA 1QSRA 1YVOA 2BL1A 2OZUA 3W6SA 2JDDA 2CXAA 1Q2CA 4ZBGA 4U9YA 5HH1A 2R98A 3BJ8A 3R9FA 4KVME 1NMTA 4ZGYB 4HNXB 5IX3A 3FIXA 1FY7A 2VI7A 4L8AA 2WUUA 2J8MA 3SXNA 4U9ZA 5GCNA 4C7IA 2FE7A 1B87A 4B10A 4AG9A 2O28A 3UY5A 4CGOA 2GE3A 2RC4A 4JWPA 2QMLA 2Z10A 3LODA 1B6BA 5F49A 1R57A 5KTDA 2X7BA 2OH1A 3R1KA 2WSAA 4KVOE 3N7ZA 4C68A 4MBUA 4R57A 2YNCA 4IUSA 1S7KA 4XPKA 3TFYA 3D2PA 4LUAA 4E0AA 4MFPA 1IYLA 4AVAA 1KUYA 4ORFA 4XPDC 4B11A 4J3GA 5JPHA 4KZTA 4I49A 2Z3PA 1BOBA 1M4IA 4C2XA 1U6MA 3RYOA 4F0XA 1Y7RA 1IIDA 4MJ8A 4PV6A 4B5PA 1SQHA 4MHDA 3H4QA 5IB0A 2Z11A 4R3KA 4QVTA 5DWNA 3K9UA 4PSWA 3PGPA 4X5KA 1ZO0A 4CAFA 4CGLA 3KKWA 2FL4A 1WK4A 4MY3A 3H5ZA 3I9SA 5H84A 1PUAA 3D2MA 1RO5A 4UCNA 3S6HA 4UFWA 4F6AA 2AE6A 4A32A 4CGMA 1L0CA 4NEXA 4KORA 4JLYA 4Q36A 2FCKA 4MFZA 3ZZIA 4A2ZA 2Z3OA 2I00A 1XE4A 2GANA 3P2FA 3S6KA 1S7FA 5E96A 1IYKA 2WPWA 4KOVA 4CRYB 2R7HA 1RXTA 1UFHA 4MFKA 4KUBA 4PK3A 4XNHB 1TIQA 1VHSA 3W6XA 4MFJA 4PSXA 2OZGA 3F0AA 2DPTA 5ISVA 4XPLA 2HQYA 1YREA 3T90A 2JEVA 5AG5A 2R1IA 1Z4EA 2FXFA 2VZZA 4RI1A 3G8WA 1N71A 2F5IA 4QC6A 1M1DA 5J8CA 4HNWB 4KLVA 1YGHA 4CS0B 1P0HA 4H6UA 3GY9A 5CNPA 3VWEA 1YR0A 2YNCC 4KS9A 2B58A 4HNYB 4CYOA 4BMHA 2H5MA 3ZJ0A 1XMTA 4QBJA 2B3UA 4ONUA 3P2HA 2PDOA 3LD2A 3TOAA 2D4OA 2K5TA 3IWEA 4KSFA 2Z3NA 3TE4A 3CXQA 4BBHA 3I3GA 2OU2A 3TOBA 1M44A 3A9LA 5J8FA 2PR8A 2EUIA 3PZJA 3SXOA 2ZW4A 4F0YA 1I21A 3SHPA 4CAXA 3G3SA 2Q04A 4KOTA 1BO4A 2KCWA 4XPDB 5G20A 2HV2A 3QB8A 2B4DB 3F5BA 2JLMA 4KSAA 3D3SA 3FYNA 3WR7A 3BJ7A 5G1ZA 4KLWA 1Q2DA 3TO9A 1NSLA 5DWMA 4EVYA 1V0CA 1KUXA 1CJWA 3EY5A 1ON0A 4C7HA 2IL4A 3EFAA 5F47A 2VZYA 3F8KA 4NF1A 5AG6A 2FT0A 2REFA 3S6GA 1M4GA 2B3VA 4KOWA 2P6EA 3OWCA 3TT2A 3DDDA 4KOSA 4NCZA 2I79A 2WPXA 2FIWA 5A28A 1QSMA 2FIAA 2Z0ZA 2R8VA 4CYPA 4A33A 3JVNA 4C2ZA 4KOUA 1QSTA 4H6ZA 4QUSA 4PK2A 4HKFA 4UFVA 4CAWA 1K4JA 5JQ4A 1XEBA 4GS4A 1WWZA 1YVKA 4AG7A 4CAVA 2HUZA 2B4DA 5IV0A 1XF8A 4CGNA 1LRZA 4JXRA 4UA3A 4M3SA 3TO6A 3GKRA 3DNSA 2C27A 2Z3LA 2G0BA 2Z3MA 4K30A 4FD5A 4MY0A 1I1DA 2YNEA 2VXKA 3R9GA 5KTAA 4FD4A 4AVCA 2NMTA 2ZW7A 4DNCA 4UWJA 4A31A 4CGPA 2BUEA 4NSQA 1YX0A 5C82A 4RS2A 1Q2YA 5FVJA 4UBRA 3R9EA 4Y49C 4UFXA 2EVNA 3V8IA 1QSNA 4JXQA 4CAEA 2ZPAA 2OB0A 1GHEA 3TTHA 1MJAA 3S6FA 2D4PA 3C26A 1Z4RA 2AJ6A 4E8OA 2ATRA 2CNMA 3IWGA 5EBVA 3JTKA 2FSRA 2JDCA 2Q4YA 3R96A 4C2YA 2VBQA 4YGOA 1PU9A 4M85A 2Z3KA 1IICA 3FRMA 4B5PB 4CYQA 3IU2A 4UCMA 2ZXVA 4LX9A 2BSWA 2QIRA 4FD7A 4U5YA 2B5GB 4R3LA 3DSBA 5F46A 2QECA 3T9YA 4YFJA 3DR8A 5HMNA 2G3AA 1Y9WA 2CNTA 3B8GA 1CM0A 1MJ9A 4NXYA 1OZPA 1MJBA 4JD6A 3TO7A 4CYNA 5BWAB 3TCVA 4B13A 2VEZA 4A95A 3EO4A 2J8NA 4MI4A 2CY2A 3EXNA 4B14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQY A;  2B4B A;  2ZW6 A;  2G3T A;  4IF5 A;  2Y0M A;  4E2A A;  4L89 A;  3FBU A;  3FXT A;  5F48 A;  5H86 A;  2Q44 A;  3D8P A;  4OAE A;  4KVX A;  2REE A;  4JJX A;  3FB3 A;  2PC1 A;  3IGR A;  4KUA A;  4CRZ B;  1YLE A;  3CXP A;  1S3Z A;  1IB1 E;  2FS5 A;  4AVB A;  3QAH A;  2B5G A;  4FD6 A;  3MGD A;  3JUW A;  4KOY A;  4R87 A;  1MK4 A;  5EC4 A;  2PSW A;  4OLL A;  2OZH A;  1M4D A;  1KZF A;  2ARH A;  2Q7B A;  3E0K A;  1KUV A;  1VKC A;  3FNC A;  4KOX A;  5C88 A;  4OAD A;  4II9 A;  2J8R A;  1QSO A;  2CNS A;  1NE9 A;  4R9M A;  1P4N A;  1S7L A;  2GIV A;  2P6G A;  1S5K A;  2P0W A;  1I12 A;  1S60 A;  2PRB A;  4AB7 A;  3BLN A;  2DXQ A;  3CXS A;  1Z9U A;  3VWD A;  4QB9 A;  5KTC A;  3NE7 A;  4H89 A;  1XIX A;  3W91 A;  2PQ8 A;  2ZW5 A;  2Q4V A;  1Y9K A;  3PP9 A;  4Y49 B;  2BEI A;  1YK3 A;  4B5O A;  2A4N A;  4UWI A;  3R95 A;  3EC4 A;  3GYA A;  2Q0Y A;  2P6F A;  3DR6 A;  1S7N A;  1J4J A;  4XNH C;  4YRH A;  2PR1 A;  5I0C A;  1QSR A;  1YVO A;  2BL1 A;  2OZU A;  3W6S A;  2JDD A;  1Q2C A;  4ZBG A;  4U9Y A;  5HH1 A;  2R98 A;  3BJ8 A;  3R9F A;  4KVM E;  1NMT A;  4HNX B;  5IX3 A;  3FIX A;  1FY7 A;  2VI7 A;  4L8A A;  2J8M A;  3SXN A;  4U9Z A;  5GCN A;  2FE7 A;  1B87 A;  4AG9 A;  2O28 A;  3UY5 A;  2GE3 A;  2RC4 A;  4JWP A;  2QML A;  2Z10 A;  3LOD A;  1B6B A;  5F49 A;  1R57 A;  5KTD A;  2X7B A;  2OH1 A;  3R1K A;  4KVO E;  3N7Z A;  4MBU A;  4R57 A;  4IUS A;  4XPK A;  1S7K A;  3TFY A;  3D2P A;  4LUA A;  4E0A A;  1IYL A;  4AVA A;  1KUY A;  4ORF A;  4XPD C;  4J3G A;  5JPH A;  4KZT A;  4I49 A;  1BOB A;  1M4I A;  1U6M A;  3RYO A;  1Y7R A;  1IID A;  4MJ8 A;  4PV6 A;  4B5P A;  1SQH A;  4MHD A;  3H4Q A;  5IB0 A;  2Z11 A;  4R3K A;  4QVT A;  5DWN A;  3K9U A;  4PSW A;  3PGP A;  4X5K A;  3KKW A;  2FL4 A;  1WK4 A;  4MY3 A;  3I9S A;  5H84 A;  1PUA A;  3D2M A;  1RO5 A;  3S6H A;  4F6A A;  2AE6 A;  1L0C A;  4NEX A;  4KOR A;  4JLY A;  2FCK A;  3ZZI A;  2I00 A;  1XE4 A;  2GAN A;  3P2F A;  3S6K A;  1S7F A;  5E96 A;  1IYK A;  2WPW A;  4KOV A;  4CRY B;  2R7H A;  1RXT A;  1UFH A;  4KUB A;  4PK3 A;  4XNH B;  1TIQ A;  1VHS A;  3W6X A;  4PSX A;  2OZG A;  3F0A A;  5ISV A;  4XPL A;  2HQY A;  1YRE A;  3T90 A;  2JEV A;  2R1I A;  1Z4E A;  2FXF A;  2VZZ A;  4RI1 A;  3G8W A;  1N71 A;  2F5I A;  4QC6 A;  1M1D A;  5J8C A;  4HNW B;  4KLV A;  1YGH A;  4CS0 B;  1P0H A;  4H6U A;  3GY9 A;  5CNP A;  3VWE A;  1YR0 A;  2B58 A;  4HNY B;  4BMH A;  2H5M A;  3ZJ0 A;  1XMT A;  4QBJ A;  2B3U A;  4ONU A;  3P2H A;  2PDO A;  3LD2 A;  3TOA A;  2D4O A;  2K5T A;  3TE4 A;  3CXQ A;  3I3G A;  2OU2 A;  3TOB A;  1M44 A;  5J8F A;  2PR8 A;  2EUI A;  3PZJ A;  3SXO A;  2ZW4 A;  4F0Y A;  1I21 A;  3SHP A;  4CAX A;  3G3S A;  2Q04 A;  4KOT A;  1BO4 A;  2KCW A;  4XPD B;  2HV2 A;  3QB8 A;  2B4D B;  3F5B A;  2JLM A;  3D3S A;  3FYN A;  3WR7 A;  3BJ7 A;  4KLW A;  1Q2D A;  3TO9 A;  1NSL A;  5DWM A;  4EVY A;  1V0C A;  1KUX A;  1CJW A;  3EY5 A;  1ON0 A;  2IL4 A;  3EFA A;  5F47 A;  2VZY A;  3F8K A;  4NF1 A;  2FT0 A;  2REF A;  3S6G A;  1M4G A;  2B3V A;  4KOW A;  2P6E A;  3OWC A;  3TT2 A;  3DDD A;  4KOS A;  4NCZ A;  2I79 A;  2WPX A;  2FIW A;  1QSM A;  2FIA A;  2Z0Z A;  2R8V A;  3JVN A;  4KOU A;  1QST A;  4H6Z A;  4QUS A;  4PK2 A;  4HKF A;  4CAW A;  1K4J A;  5JQ4 A;  1XEB A;  4GS4 A;  1WWZ A;  1YVK A;  4AG7 A;  4CAV A;  2HUZ A;  2B4D A;  5IV0 A;  1XF8 A;  1LRZ A;  4JXR A;  4UA3 A;  4M3S A;  3TO6 A;  3GKR A;  3DNS A;  2C27 A;  2G0B A;  4K30 A;  4FD5 A;  4MY0 A;  1I1D A;  2VXK A;  3R9G A;  5KTA A;  4FD4 A;  4AVC A;  2NMT A;  2ZW7 A;  4DNC A;  4UWJ A;  2BUE A;  4NSQ A;  1YX0 A;  5C82 A;  4RS2 A;  1Q2Y A;  5FVJ A;  4UBR A;  3R9E A;  4Y49 C;  2EVN A;  3V8I A;  1QSN A;  4JXQ A;  2ZPA A;  2OB0 A;  1GHE A;  3TTH A;  1MJA A;  3S6F A;  2D4P A;  3C26 A;  1Z4R A;  2AJ6 A;  4E8O A;  2ATR A;  2CNM A;  3IWG A;  5EBV A;  2FSR A;  2JDC A;  2Q4Y A;  3R96 A;  2VBQ A;  4YGO A;  1PU9 A;  4M85 A;  1IIC A;  3FRM A;  4B5P B;  2ZXV A;  4LX9 A;  2BSW A;  2QIR A;  4FD7 A;  4U5Y A;  2B5G B;  4R3L A;  3DSB A;  5F46 A;  2QEC A;  3T9Y A;  4YFJ A;  3DR8 A;  5HMN A;  2G3A A;  1Y9W A;  2CNT A;  3B8G A;  1CM0 A;  1MJ9 A;  4NXY A;  1OZP A;  1MJB A;  4JD6 A;  3TO7 A;  3TCV A;  2VEZ A;  3EO4 A;  2J8N A;  4MI4 A;  2CY2 A;  3EXN A; 
#chains in the Genus database with same CATH topology
 2VQY A;  4GM5 A;  2B4B A;  2ZW6 A;  2G3T A;  4IF5 A;  2ABZ A;  2Y0M A;  3LWU A;  4P4D A;  3FF3 A;  5HVH A;  4E2A A;  3KQZ A;  4L89 A;  4G1P A;  1KWM A;  5G22 A;  3FBU A;  3FXT A;  5F48 A;  5H86 A;  4NGQ A;  4UEE A;  2Q44 A;  3D8P A;  4OAE A;  4KVX A;  4FBE A;  5A27 A;  4B12 A;  1IOI A;  2WYR A;  2REE A;  4JJX A;  2YND A;  3FB3 A;  2BOA A;  4MHZ A;  2PC1 A;  3IGR A;  5JGF A;  4KUA A;  4CRZ B;  1X10 A;  1TKJ A;  3PB9 X;  1YLE A;  2PE3 A;  2PJ6 A;  3I1U A;  5LRK A;  3CXP A;  1TKF A;  4H2K A;  4P45 A;  4DJL A;  1S3Z A;  1IB1 E;  2FS5 A;  4P6Y A;  1ZLH A;  4AVB A;  3QAH A;  2PIZ A;  4RN7 A;  4MFL A;  4PQA A;  4PXB A;  1NSA A;  2B5G A;  1Z8W A;  4FD6 A;  2QVP A;  3DGV A;  3H8F A;  3JUW A;  3MGD A;  4KOY A;  4R87 A;  1AMP A;  1MK4 A;  5EC4 A;  2PSW A;  4OLL A;  2OZH A;  1M4D A;  1KZF A;  2ARH A;  2ZOG A;  2Q7B A;  5HVG A;  1GYT A;  2DPS A;  3E0K A;  4MFQ A;  2YGW A;  3B3W A;  4P4I A;  1KUV A;  1VKC A;  3FNC A;  4KOX A;  3K9T A;  5C88 A;  4OAD A;  2Q4Z A;  4II9 A;  2J8R A;  1QSO A;  2CNS A;  1NE9 A;  3IU1 A;  4P10 A;  1P4N A;  4R9M A;  1S7L A;  1F2P A;  2EBJ A;  4UIA A;  2GIV A;  2ZEF A;  2P6G A;  1IU8 A;  4DUK A;  2GLJ A;  4PXD A;  1JQG A;  2PJ2 A;  4OID A;  5K8O A;  1VHE A;  1S5K A;  2C6P A;  1I12 A;  2P0W A;  1S60 A;  3KHX A;  2PRB A;  3FEC A;  3ISX A;  5AGE A;  3PBB A;  4AB7 A;  1ELL P;  3BLN A;  4BD9 A;  4C2X A;  4W9Y A;  2DXQ A;  4Q38 A;  4M6I A;  3CXS A;  1Z9U A;  3VWD A;  4QB9 A;  6CPA A;  1VIX A;  5KTC A;  3GUX A;  3NE7 A;  4H89 A;  2V8D A;  1XIX A;  4UCP A;  3W91 A;  2PQ8 A;  2ZW5 A;  1UWY A;  3NA6 A;  1LAM A;  2Q4V A;  1R43 A;  1Y9K A;  3PP9 A;  4Y49 B;  2BEI A;  1YK3 A;  1TF9 A;  3D7D A;  5DS0 A;  2A4N A;  4B5O A;  5AG4 A;  1HEE A;  1BPN A;  4UWI A;  3R95 A;  5AG7 A;  3EC4 A;  3GYA A;  4UF4 A;  5G21 A;  4NJR A;  4A30 A;  2Q0Y A;  3TX8 A;  2P6F A;  3DR6 A;  1S7N A;  1J4J A;  4OC5 A;  4TWE A;  2ZEH A;  4XNH C;  3WAB A;  1XBU A;  2IMO A;  4YRH A;  4OP4 A;  4OC2 A;  3NE8 A;  1BPM A;  2PR1 A;  5I0C A;  1QSR A;  4A37 A;  4P4F A;  2AFW A;  2AFU A;  4MMO A;  1YVO A;  1TF8 A;  2BL1 A;  4CPA A;  2OZU A;  4FUU A;  3W6S A;  2PVW A;  1FNO A;  1LCP A;  3NH8 A;  2JDD A;  2CXA A;  1Q2C A;  2QJ8 A;  4ZBG A;  4U9Y A;  4OIW A;  2AFM A;  5HH1 A;  3RO0 A;  3SJX A;  2PIY A;  2R98 A;  3BJ8 A;  2PJC A;  4ZYQ A;  3R9F A;  4KVM E;  1YLO A;  1NMT A;  2IQ6 A;  4ZGY B;  4HNX B;  5JM6 A;  5IX3 A;  3FIX A;  1FY7 A;  2VI7 A;  4ZX9 A;  4L8A A;  2WUU A;  4NGS A;  2J8M A;  3SXN A;  4U9Z A;  3KL9 A;  5GCN A;  1XRY A;  2XEI A;  2GRE A;  2FE7 A;  4C7I A;  1CBX A;  1B87 A;  2V77 A;  4B10 A;  5LYL A;  4UEF A;  4NFR A;  3B2Y A;  1RTQ A;  4AG9 A;  2O28 A;  4NGT A;  3UY5 A;  4CGO A;  4NGR A;  3QNV A;  2GE3 A;  2PJ8 A;  4LQ6 A;  5ELY A;  2RC4 A;  4JWP A;  2QML A;  3VAT A;  2Z10 A;  4X2T A;  3KQX A;  1B6B A;  3LOD A;  4HPS A;  3CPA A;  3S9L A;  3B35 A;  1R57 A;  5F49 A;  3L2N A;  3ISZ A;  5KTD A;  2C6G A;  3H8G A;  5K8P A;  1Z2L A;  2ZEN A;  4F9V A;  2PCU A;  2X7B A;  5HVF A;  3V38 A;  2OH1 A;  4ONW A;  3R1K A;  2WSA A;  5IB9 A;  4KVO E;  3VH9 A;  3N7Z A;  2O4H A;  2NYQ A;  4MBU A;  4C68 A;  1Z8L A;  2ZEL A;  3BXM A;  3KGQ A;  4R57 A;  2F8H A;  2YNC A;  1S7K A;  4IUS A;  4XPK A;  3TFY A;  3D2P A;  4LUA A;  4O23 A;  4YWY A;  4E0A A;  4MFP A;  1IYL A;  1DE4 C;  1M4L A;  4X3R A;  4AVA A;  4NGM A;  4P4J A;  4YU9 A;  1KUY A;  4ORF A;  4XPD C;  4B11 A;  1FT7 A;  2EWB A;  4J3G A;  5JPH A;  4KZT A;  2Q7S A;  4I49 A;  2Z3P A;  3FED A;  4A39 A;  3FVL A;  1BOB A;  1M4I A;  1VHO A;  1U6M A;  1Y7E A;  3H8E A;  1Y7R A;  3IFE A;  1IID A;  3KR5 A;  1CP7 A;  4MJ8 A;  4PV6 A;  1HDU A;  4F0X A;  2PJ9 A;  4B5P A;  1SQH A;  3GB0 A;  4MHD A;  2JEW A;  3H4Q A;  4MCP A;  5IB0 A;  2Z11 A;  3PB8 X;  4R3K A;  4QVT A;  1CPX A;  5LRJ A;  3RNZ A;  1PYT B;  3MN8 A;  5DWN A;  1EE3 P;  3K9U A;  2POK A;  2AFS A;  1CG2 A;  3CT9 A;  3PB7 X;  3TC8 A;  4PSW A;  3PGP A;  4X5K A;  1BAV A;  4OC0 A;  1ZO0 A;  4CAF A;  4CGL A;  3KKW A;  3S9N A;  2FL4 A;  3CDX A;  1CP6 A;  1WK4 A;  4MY3 A;  3MRU A;  2PVV A;  3H5Z A;  4OME A;  3I9S A;  4OKO A;  1QMU A;  5H84 A;  1PUA A;  1F2O A;  3LAC A;  4ZY2 A;  5LYI A;  3D2M A;  1RO5 A;  4UCN A;  3S6H A;  4UFW A;  4F6A A;  2PJ1 A;  1ZG7 A;  2AE6 A;  4A32 A;  4CGM A;  1L0C A;  4NEX A;  4KOR A;  3CZX A;  4JLY A;  2DEA A;  2FCK A;  4Q36 A;  4MFZ A;  3ZZI A;  4A2Z A;  3SI0 A;  1LFW A;  4NGN A;  4EME A;  2Z3O A;  2I00 A;  1XE4 A;  3FEE A;  1XMB A;  2GAN A;  3P2F A;  2AFO A;  5THW A;  3S6K A;  1S7F A;  5E96 A;  1IYK A;  2WPW A;  3B3V A;  3SJF A;  4MCS A;  4KOV A;  4CRY B;  1LAN A;  3SJE A;  1YW4 A;  2R7H A;  2GFQ A;  1RXT A;  1UFH A;  1XJO A;  1F57 A;  4KSI A;  1ARM A;  4MFK A;  4KUB A;  1ARL A;  4PK3 A;  2OR4 A;  1IOF A;  2C6C A;  2ZED A;  4B6Z A;  4XNH B;  3NFZ A;  1LOK A;  5K8N A;  1TIQ A;  1YME A;  8CPA A;  1AYE A;  1JWQ A;  1VHS A;  3V7Z A;  2ZEO A;  4A94 A;  3W6X A;  4MFJ A;  2BCO A;  4MHP A;  4PSX A;  3QAY A;  2OZG A;  4IK2 A;  3F0A A;  3SI2 A;  4M6G A;  4MCR A;  2CIJ A;  2DPT A;  4MCQ A;  5ISV A;  4XPL A;  7CPA A;  2HQY A;  2PJ5 A;  1HDQ A;  3JRU A;  1YRE A;  3T90 A;  5CBM A;  2JEV A;  3BHX A;  5AG5 A;  2R1I A;  1Z4E A;  2FXF A;  2VZZ A;  4IHM A;  2NSM A;  4Q7A A;  4RI1 A;  3D67 A;  3G8W A;  5D29 A;  2PJ3 A;  1N71 A;  2V8V A;  2F5I A;  4QC6 A;  4P4E A;  3IJ3 A;  1M1D A;  2ZOF A;  3D7F A;  5J8C A;  3PFE A;  3VAR A;  4UEZ A;  3IO1 A;  4HNW B;  3KAS A;  4KLV A;  5EMI A;  1YGH A;  1XOV A;  3RYO A;  4CS0 B;  1P0H A;  2IJZ A;  4H6U A;  3GY9 A;  5CNP A;  1YSJ A;  3VWE A;  1YR0 A;  2YNC C;  4KS9 A;  1XFO A;  2GU2 A;  2B58 A;  2ZEE A;  2PJ7 A;  3NH5 A;  4ZY0 A;  4HNY B;  4CYO A;  1ELM P;  2H5M A;  3ZJ0 A;  1XMT A;  4BMH A;  4ZY1 A;  4QBJ A;  2B3U A;  3PB6 X;  3P2H A;  2PDO A;  4FWU A;  3LD2 A;  3KHZ A;  4ONU A;  2WZN A;  3TOA A;  4F8Z A;  2D4O A;  2K5T A;  1R3N A;  3IWE A;  4KSF A;  5F09 A;  1AUG A;  2Z3N A;  3TE4 A;  3CXQ A;  2PJ4 A;  4BBH A;  3I3G A;  4OC4 A;  2OU2 A;  1QQ9 A;  2F7V A;  3TOB A;  1M44 A;  4WJB A;  2G9D A;  2RB7 A;  3A9L A;  4R8F A;  5J8F A;  2PR8 A;  2EUI A;  3PZJ A;  4PPZ A;  3SXO A;  2ZEM A;  2ZW4 A;  3PRT A;  3DLJ A;  4F0Y A;  1I21 A;  4P44 A;  3SHP A;  4CAX A;  3G3S A;  2PJB A;  4WWV A;  2Q04 A;  3B3C A;  4KOT A;  1BO4 A;  1YQE A;  3HLP A;  2XEJ A;  2KCW A;  1Z5R A;  4XPD B;  2PJ0 A;  3RZA A;  3CPX A;  3WT4 A;  5G20 A;  2HV2 A;  5I4M A;  3QB8 A;  3B3S A;  2B4D B;  3F5B A;  5CPA A;  2JLM A;  2V8G A;  4KSA A;  3D3S A;  3FYN A;  3GIU A;  3WR7 A;  3BJ7 A;  5G1Z A;  4KLW A;  4MHN A;  2Q51 A;  2BO9 A;  1Q2D A;  3TO9 A;  1OBR A;  3IWW A;  1NSL A;  5DWM A;  4EVY A;  1V0C A;  1KUX A;  1PCA A;  1CJW A;  2Q43 A;  2PJA A;  1TXR A;  3B7I A;  4GXH A;  3EY5 A;  1ON0 A;  3PEI A;  2IL4 A;  3EFA A;  4M6H A;  5F47 A;  3WC6 A;  4C7H A;  2VZY A;  2AFX A;  3RBU A;  3F8K A;  4JZ0 A;  4A38 A;  4NF1 A;  5AG6 A;  2FT0 A;  2JBK A;  2REF A;  4R7M A;  3S6G A;  2O53 A;  4Z65 A;  3K2K A;  1M4G A;  2B3V A;  4KOW A;  2P6E A;  3OWC A;  1VGY A;  3TT2 A;  3DDD A;  4KOS A;  2PRQ A;  4X8I A;  2ZEP A;  3T8W A;  4NCZ A;  2I79 A;  2WPX A;  3FJU A;  2FIW A;  5A28 A;  1QSM A;  3FX6 A;  2FIA A;  2I3C A;  2R8V A;  2Z0Z A;  4OC1 A;  4CYP A;  3LMS A;  4A33 A;  3JVN A;  4C2Z A;  1Y0Y A;  4KOU A;  2V8H A;  4PXE A;  4PXC A;  1QST A;  3KR4 A;  4H6Z A;  4QUS A;  4PK2 A;  1Q7L A;  4HKF A;  2ANP A;  4UFV A;  3BI1 A;  3HUV A;  4CAW A;  1K4J A;  5JQ4 A;  1XEB A;  4GS4 A;  4NJQ A;  1WWZ A;  1YVK A;  4AG7 A;  2J9A A;  4CAV A;  2EO8 A;  1A2Z A;  5LYF A;  2HUZ A;  2CF4 A;  3NH4 A;  2B4D A;  2XEF A;  4OC3 A;  4JYW A;  4R6T A;  1TKH A;  1XF8 A;  5LRG A;  4CGN A;  5IV0 A;  2ZEG A;  2HB6 A;  1LRZ A;  4JXR A;  4R76 A;  4UA3 A;  4M3S A;  3KZW A;  3TO6 A;  4K3N A;  3D68 A;  3GKR A;  1BLL E;  3DNS A;  1LAP A;  2C27 A;  2Z3L A;  2HC9 A;  2G0B A;  3WC7 A;  2Z3M A;  3BI0 A;  4K30 A;  3D7G A;  2VL1 A;  3WC5 A;  1YW6 A;  2C1C A;  4UIB A;  1IY7 A;  2CTB A;  4FD5 A;  4LQG A;  4MY0 A;  2JBJ A;  1I1D A;  2YNE A;  2VXK A;  3R9G A;  5KTA A;  4FD4 A;  4AVC A;  2NMT A;  2ZW7 A;  4ZI6 A;  4DNC A;  4UWJ A;  1CX8 A;  1ZLI A;  4A31 A;  3RAM A;  4CGP A;  4MHY A;  3S9M A;  5LYD A;  2DF5 A;  3D4U A;  2QYV A;  2BUE A;  3FMC A;  4NSQ A;  4AXV A;  1YX0 A;  2FVG A;  3IC1 A;  4NGP A;  5C82 A;  4RUH A;  4RS2 A;  1Q2Y A;  5FVJ A;  4UBR A;  1Y0R A;  3R9E A;  4Y49 C;  5D8N A;  4UFX A;  2EVN A;  3V8I A;  1QSN A;  4JXQ A;  4CAE A;  2ZPA A;  1ZG9 A;  2EK9 A;  1GHE A;  2OB0 A;  3IEH A;  3FH4 A;  4ZX8 A;  3TTH A;  1MJA A;  3S6F A;  4MRI A;  2D4P A;  3C26 A;  1Z4R A;  2AJ6 A;  4E8O A;  2ATR A;  2CNM A;  2GLF A;  3GLJ A;  3IWG A;  3JTK A;  5EBV A;  2FSR A;  2JDC A;  3KI9 A;  1DTD A;  1CPS A;  1X12 A;  4MXU A;  2Q4Y A;  3R96 A;  4C2Y A;  2VBQ A;  4YGO A;  1PU9 A;  3SI1 A;  1ZG8 A;  2RFH A;  3B3T A;  4M85 A;  4FAI A;  2Z3K A;  1IIC A;  3FRM A;  4B5P B;  1Z8T A;  2CTC A;  4CYQ A;  3IU2 A;  4UCM A;  2ZXV A;  4LX9 A;  2BSW A;  2QIR A;  3PB4 X;  4FD7 A;  4U5Y A;  2B5G B;  4R3L A;  3D66 A;  3DSB A;  4F9U A;  2ODF A;  4DYO A;  5F46 A;  2AFZ A;  3D7H A;  2QEC A;  3T9Y A;  1H8L A;  3DR8 A;  3N5F A;  4TNU A;  3SJG A;  4YFJ A;  5HMN A;  2G3A A;  1Y9W A;  2CNT A;  3B8G A;  1CM0 A;  1Z8X A;  2XEG A;  1MJ9 A;  4NXY A;  1OZP A;  4P4B A;  1MJB A;  4JD6 A;  3PBE A;  3TO7 A;  4BIN A;  2EK8 A;  2OOT A;  1IGB A;  4CYN A;  5BWA B;  4EFD A;  3TCV A;  4B13 A;  2VEZ A;  4IAV A;  4EWT A;  4A95 A;  3EO4 A;  5HXD A;  2J8N A;  5JH9 A;  3IIB A;  5K8M A;  3PFO A;  4MI4 A;  5J1Q A;  2CY2 A;  3EXN A;  4B14 A; 
#chains in the Genus database with same CATH homology
 2VQY A;  2B4B A;  2ZW6 A;  2G3T A;  4IF5 A;  2Y0M A;  4E2A A;  4L89 A;  5G22 A;  3FBU A;  3FXT A;  5F48 A;  5H86 A;  2Q44 A;  3D8P A;  4OAE A;  4KVX A;  5A27 A;  4B12 A;  2REE A;  4JJX A;  2YND A;  3FB3 A;  2PC1 A;  3IGR A;  4KUA A;  4CRZ B;  1YLE A;  3CXP A;  1S3Z A;  1IB1 E;  2FS5 A;  4AVB A;  3QAH A;  4MFL A;  2B5G A;  4FD6 A;  3MGD A;  3JUW A;  4KOY A;  4R87 A;  1MK4 A;  5EC4 A;  2PSW A;  4OLL A;  2OZH A;  1M4D A;  1KZF A;  2ARH A;  2Q7B A;  2DPS A;  3E0K A;  4MFQ A;  2YGW A;  1KUV A;  1VKC A;  3FNC A;  4KOX A;  5C88 A;  4OAD A;  4II9 A;  2J8R A;  1QSO A;  2CNS A;  1NE9 A;  3IU1 A;  4R9M A;  1P4N A;  1S7L A;  2GIV A;  2P6G A;  1S5K A;  2P0W A;  1I12 A;  1S60 A;  2PRB A;  5AGE A;  4AB7 A;  3BLN A;  2DXQ A;  4Q38 A;  3CXS A;  1Z9U A;  3VWD A;  4QB9 A;  5KTC A;  3NE7 A;  4H89 A;  1XIX A;  4UCP A;  3W91 A;  2PQ8 A;  2ZW5 A;  2Q4V A;  1Y9K A;  3PP9 A;  4Y49 B;  2BEI A;  1YK3 A;  4B5O A;  5AG4 A;  2A4N A;  4UWI A;  3R95 A;  5AG7 A;  3EC4 A;  3GYA A;  5G21 A;  4A30 A;  2Q0Y A;  2P6F A;  3DR6 A;  1S7N A;  1J4J A;  4XNH C;  4YRH A;  2PR1 A;  5I0C A;  1QSR A;  1YVO A;  2BL1 A;  2OZU A;  3W6S A;  2JDD A;  2CXA A;  1Q2C A;  4ZBG A;  4U9Y A;  5HH1 A;  2R98 A;  3BJ8 A;  3R9F A;  4KVM E;  1NMT A;  4ZGY B;  4HNX B;  5IX3 A;  3FIX A;  1FY7 A;  2VI7 A;  4L8A A;  2WUU A;  2J8M A;  3SXN A;  4U9Z A;  5GCN A;  4C7I A;  2FE7 A;  1B87 A;  4B10 A;  4AG9 A;  2O28 A;  3UY5 A;  4CGO A;  2GE3 A;  2RC4 A;  4JWP A;  2QML A;  2Z10 A;  3LOD A;  1B6B A;  5F49 A;  1R57 A;  5KTD A;  2X7B A;  2OH1 A;  3R1K A;  2WSA A;  4KVO E;  3N7Z A;  4C68 A;  4MBU A;  4R57 A;  2YNC A;  4IUS A;  1S7K A;  4XPK A;  3TFY A;  3D2P A;  4LUA A;  4E0A A;  4MFP A;  1IYL A;  4AVA A;  1KUY A;  4ORF A;  4XPD C;  4B11 A;  4J3G A;  5JPH A;  4KZT A;  4I49 A;  2Z3P A;  1BOB A;  1M4I A;  4C2X A;  1U6M A;  3RYO A;  4F0X A;  1Y7R A;  1IID A;  4MJ8 A;  4PV6 A;  4B5P A;  1SQH A;  4MHD A;  3H4Q A;  5IB0 A;  2Z11 A;  4R3K A;  4QVT A;  5DWN A;  3K9U A;  4PSW A;  3PGP A;  4X5K A;  1ZO0 A;  4CAF A;  4CGL A;  3KKW A;  2FL4 A;  1WK4 A;  4MY3 A;  3H5Z A;  3I9S A;  5H84 A;  1PUA A;  3D2M A;  1RO5 A;  4UCN A;  3S6H A;  4UFW A;  4F6A A;  2AE6 A;  4A32 A;  4CGM A;  1L0C A;  4NEX A;  4KOR A;  4JLY A;  4Q36 A;  2FCK A;  4MFZ A;  3ZZI A;  4A2Z A;  2Z3O A;  2I00 A;  1XE4 A;  2GAN A;  3P2F A;  3S6K A;  1S7F A;  5E96 A;  1IYK A;  2WPW A;  4KOV A;  4CRY B;  2R7H A;  1RXT A;  1UFH A;  4MFK A;  4KUB A;  4PK3 A;  4XNH B;  1TIQ A;  1VHS A;  3W6X A;  4MFJ A;  4PSX A;  2OZG A;  3F0A A;  2DPT A;  5ISV A;  4XPL A;  2HQY A;  1YRE A;  3T90 A;  2JEV A;  5AG5 A;  2R1I A;  1Z4E A;  2FXF A;  2VZZ A;  4RI1 A;  3G8W A;  1N71 A;  2F5I A;  4QC6 A;  1M1D A;  5J8C A;  4HNW B;  4KLV A;  1YGH A;  4CS0 B;  1P0H A;  4H6U A;  3GY9 A;  5CNP A;  3VWE A;  1YR0 A;  2YNC C;  4KS9 A;  2B58 A;  4HNY B;  4CYO A;  4BMH A;  2H5M A;  3ZJ0 A;  1XMT A;  4QBJ A;  2B3U A;  4ONU A;  3P2H A;  2PDO A;  3LD2 A;  3TOA A;  2D4O A;  2K5T A;  3IWE A;  4KSF A;  2Z3N A;  3TE4 A;  3CXQ A;  4BBH A;  3I3G A;  2OU2 A;  3TOB A;  1M44 A;  3A9L A;  5J8F A;  2PR8 A;  2EUI A;  3PZJ A;  3SXO A;  2ZW4 A;  4F0Y A;  1I21 A;  3SHP A;  4CAX A;  3G3S A;  2Q04 A;  4KOT A;  1BO4 A;  2KCW A;  4XPD B;  5G20 A;  2HV2 A;  3QB8 A;  2B4D B;  3F5B A;  2JLM A;  4KSA A;  3D3S A;  3FYN A;  3WR7 A;  3BJ7 A;  5G1Z A;  4KLW A;  1Q2D A;  3TO9 A;  1NSL A;  5DWM A;  4EVY A;  1V0C A;  1KUX A;  1CJW A;  3EY5 A;  1ON0 A;  4C7H A;  2IL4 A;  3EFA A;  5F47 A;  2VZY A;  3F8K A;  4NF1 A;  5AG6 A;  2FT0 A;  2REF A;  3S6G A;  1M4G A;  2B3V A;  4KOW A;  2P6E A;  3OWC A;  3TT2 A;  3DDD A;  4KOS A;  4NCZ A;  2I79 A;  2WPX A;  2FIW A;  5A28 A;  1QSM A;  2FIA A;  2Z0Z A;  2R8V A;  4CYP A;  4A33 A;  3JVN A;  4C2Z A;  4KOU A;  1QST A;  4H6Z A;  4QUS A;  4PK2 A;  4HKF A;  4UFV A;  4CAW A;  1K4J A;  5JQ4 A;  1XEB A;  4GS4 A;  1WWZ A;  1YVK A;  4AG7 A;  4CAV A;  2HUZ A;  2B4D A;  5IV0 A;  1XF8 A;  4CGN A;  1LRZ A;  4JXR A;  4UA3 A;  4M3S A;  3TO6 A;  3GKR A;  3DNS A;  2C27 A;  2Z3L A;  2G0B A;  2Z3M A;  4K30 A;  4FD5 A;  4MY0 A;  1I1D A;  2YNE A;  2VXK A;  3R9G A;  5KTA A;  4FD4 A;  4AVC A;  2NMT A;  2ZW7 A;  4DNC A;  4UWJ A;  4A31 A;  4CGP A;  2BUE A;  4NSQ A;  1YX0 A;  5C82 A;  4RS2 A;  1Q2Y A;  5FVJ A;  4UBR A;  3R9E A;  4Y49 C;  4UFX A;  2EVN A;  3V8I A;  1QSN A;  4JXQ A;  4CAE A;  2ZPA A;  2OB0 A;  1GHE A;  3TTH A;  1MJA A;  3S6F A;  2D4P A;  3C26 A;  1Z4R A;  2AJ6 A;  4E8O A;  2ATR A;  2CNM A;  3IWG A;  5EBV A;  3JTK A;  2FSR A;  2JDC A;  2Q4Y A;  3R96 A;  4C2Y A;  2VBQ A;  4YGO A;  1PU9 A;  4M85 A;  2Z3K A;  1IIC A;  3FRM A;  4B5P B;  4CYQ A;  3IU2 A;  4UCM A;  2ZXV A;  4LX9 A;  2BSW A;  2QIR A;  4FD7 A;  4U5Y A;  2B5G B;  4R3L A;  3DSB A;  5F46 A;  2QEC A;  3T9Y A;  4YFJ A;  3DR8 A;  5HMN A;  2G3A A;  1Y9W A;  2CNT A;  3B8G A;  1CM0 A;  1MJ9 A;  4NXY A;  1OZP A;  1MJB A;  4JD6 A;  3TO7 A;  4CYN A;  5BWA B;  3TCV A;  4B13 A;  2VEZ A;  4A95 A;  3EO4 A;  2J8N A;  4MI4 A;  2CY2 A;  3EXN A;  4B14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...