2VBQA

Structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
SHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
publication title Kinetic and Structural Analysis of Bisubstrate Inhibition of the Salmonella Enterica Aminoglycoside 6'-N-Acetyltransferase.
pubmed doi rcsb
source organism Salmonella choleraesuis
molecule tags Transferase
total genus 39
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vbqA00
4HNXB 4XNHB 2HQYA 1OZPA 3S6FA 4GS4A 4KUAA 4MHDA 2CNTA 3TO9A 2OZUA 2B4BA 4ORFA 4B5PB 4R3KA 1MJAA 2WPWA 1J4JA 3UY5A 2G3AA 1WWZA 3T90A 4XPDC 5DWMA 3BJ8A 2REFA 1Q2DA 2OZHA 2P6GA 2FSRA 4E8OA 2Q44A 2QMLA 4KVME 4KOYA 3OWCA 4NXYA 5KTDA 2P0WA 3IWGA 1IIDA 2VQYA 3TCVA 1RXTA 1S60A 1S5KA 3IGRA 5DWNA 5IX3A 3E0KA 4ONUA 4UWJA 4JWPA 2FIAA 2R7HA 1XE4A 5J8FA 1Y9KA 2R1IA 2J8RA 4NF1A 4RS2A 2JEVA 3D2PA 4X5KA 1BOBA 1YR0A 2GIVA 1LRZA 4JD6A 3DDDA 2P6EA 5F49A 3PP9A 2VEZA 1S7NA 4KVOE 4LUAA 3SXOA 5ISVA 5F46A 2JDDA 3GY9A 2CNMA 1I1DA 3TE4A 5IB0A 3ZJ0A 5IV0A 4AVAA 1N71A 4KOTA 1UFHA 2J8NA 1Z4RA 2VZZA 2B58A 4U9YA 2FCKA 4DNCA 2H5MA 3I9SA 4Y49B 1QSOA 2KCWA 4OLLA 2Q4VA 2J8MA 3T9YA 3SHPA 2ZXVA 4H6UA 5I0CA 2HV2A 3N7ZA 2EVNA 2PSWA 2FT0A 3FXTA 2ZPAA 2R8VA 5EC4A 1GHEA 2DXQA 4CRZB 5J8CA 4AVBA 4L8AA 1Z4EA 5EBVA 4HNWB 4CS0B 3G3SA 2QIRA 4PV6A 4KVXA 1R57A 2OB0A 2VXKA 3R1KA 1Z9UA 1YGHA 4YRHA 1YREA 1WK4A 4NSQA 3W91A 3FB3A 2GANA 4LX9A 3TT2A 3VWDA 1B6BA 3GYAA 4NCZA 1XEBA 4EVYA 4QC6A 3C26A 4XPLA 3F8KA 2FXFA 1PUAA 1B87A 4KOWA 4CAVA 2B4DA 3K9UA 2EUIA 2AE6A 2F5IA 1SQHA 2PQ8A 3EO4A 4YFJA 3RYOA 3PZJA 4NEXA 2ARHA 3R9EA 1VHSA 1I21A 2B5GA 5E96A 2BEIA 2VI7A 3CXPA 1IB1E 4PK2A 1YK3A 3W6XA 2PDOA 1VKCA 1IYLA 2WPXA 2RC4A 4QVTA 4JXRA 3TTHA 1YVOA 4OADA 1QSMA 4B5OA 2X7BA 3TOAA 3DR8A 5H84A 3DNSA 3TFYA 2GE3A 3V8IA 2BL1A 4KOUA 2C27A 4JXQA 1P0HA 3R9FA 1BO4A 2OZGA 4KUBA 3D3SA 5C82A 3DR6A 4OAEA 4F0YA 3SXNA 2B4DB 1Y9WA 3H4QA 3CXQA 1YX0A 4FD4A 3S6KA 2CY2A 2ZW4A 4BMHA 2Q04A 3JUWA 2B3VA 2ZW5A 4JLYA 3WR7A 5C88A 3TO6A 4UBRA 2G0BA 2B5GB 3FIXA 1S7FA 1S7KA 1PU9A 2BUEA 2REEA 3LODA 1YLEA 2PR1A 3EY5A 5HH1A 4PSWA 1M4DA 2AJ6A 1K4JA 4K30A 4MJ8A 2ZW7A 4QUSA 1KUVA 1P4NA 4KLVA 1Q2CA 2FE7A 4J3GA 2I00A 1U6MA 3F5BA 3NE7A 3MGDA 4KOXA 2P6FA 4KZTA 5H86A 2Q7BA 4ZBGA 2B3UA 1V0CA 4FD6A 4CRYB 4CAWA 4XNHC 3LD2A 4I49A 4R57A 4H89A 2OU2A 4E0AA 4AG9A 3P2HA 4XPKA 3S6GA 1MK4A 5GCNA 3VWEA 4QBJA 3R96A 4E2AA 1M44A 2NMTA 1M4GA 2K5TA 2Q0YA 4F6AA 2OH1A 4IF5A 4UWIA 5CNPA 5KTCA 4H6ZA 1NSLA 4KOVA 1I12A 2Z10A 3QAHA 2D4PA 2CNSA 5FVJA 4XPDB 5HMNA 3FBUA 1M4IA 4PK3A 1QSTA 4FD7A 1YVKA 4FD5A 1Y7RA 2HUZA 3PGPA 1Q2YA 2Y0MA 2O28A 2Z0ZA 4MBUA 5JPHA 3F0AA 3QB8A 1XMTA 3FRMA 4MY3A 1RO5A 4QB9A 2FL4A 2PC1A 3DSBA 4HNYB 1KZFA 2FIWA 1IYKA 3G8WA 4CAXA 4KLWA 5JQ4A 2PRBA 3BJ7A 2D4OA 4AG7A 1CM0A 3EC4A 3FYNA 3D8PA 4R3LA 1L0CA 3B8GA 3P2FA 4KORA 1MJBA 1ON0A 3D2MA 4YGOA 3S6HA 1FY7A 4JJXA 1IICA 4Y49C 5F48A 2G3TA 2ZW6A 3TO7A 2BSWA 4M3SA 4AVCA 3EFAA 1S3ZA 4B5PA 4R87A 3W6SA 4AB7A 1KUYA 1QSRA 3BLNA 1TIQA 4MI4A 4UA3A 4PSXA 3FNCA 1MJ9A 1KUXA 3I3GA 4RI1A 2R98A 4KOSA 4U5YA 2VBQA 4II9A 2VZYA 1S7LA 5F47A 4IUSA 1XIXA 2Z11A 2A4NA 2FS5A 3CXSA 1CJWA 1QSNA 1NE9A 1M1DA 4L89A 4R9MA 4U9ZA 2JDCA 2Q4YA 5KTAA 4M85A 3R9GA 2IL4A 4MY0A 3JVNA 2I79A 3KKWA 3TOBA 1XF8A 1NMTA 3EXNA 4HKFA 3R95A 2QECA 2ATRA 2JLMA 2PR8A 3GKRA 3ZZIA
chains in the Genus database with same CATH superfamily
5DS0A 4HNXB 4XNHB 3RO0A 2HQYA 1OZPA 3S6FA 4GS4A 5LRGA 4P6YA 4W9YA 4KUAA 4MHDA 4WJBA 2CNTA 5G20A 4HPSA 3TO9A 2OZUA 2B4BA 4ORFA 3NFZA 4B5PB 3NA6A 4R3KA 4ZY0A 1MJAA 4KSFA 2IMOA 2WPWA 1J4JA 1OBRA 3UY5A 2Z3MA 6CPAA 4UIAA 2G3AA 1WWZA 3T90A 4XPDC 5DWMA 3B3WA 3BJ8A 1VGYA 2AFWA 4A95A 1PYTB 2Q7SA 2REFA 4A37A 1Q2DA 1XRYA 2WZNA 4C7HA 2OZHA 3BXMA 2P6GA 4B14A 2FSRA 1CPSA 2I3CA 3KR5A 4MFQA 3PBBA 4E8OA 2Q44A 2QMLA 4KVME 4KOYA 4MFPA 3OWCA 4M6IA 4NXYA 5KTDA 3QAYA 4F9VA 2P0WA 3IWGA 1IIDA 2VQYA 3TCVA 1RXTA 4P10A 1ELLP 1S60A 1S5KA 3LMSA 1HDQA 3IGRA 4MFJA 5DWNA 5IX3A 3E0KA 4CGMA 4ONUA 4UWJA 4JWPA 4OC2A 4KS9A 2FIAA 2R7HA 2HC9A 3HUVA 1XE4A 4MXUA 3H5ZA 3D67A 4NGTA 4OC1A 5J8FA 1BAVA 3PB8X 1F2OA 1Y9KA 2R1IA 3IU1A 3KHXA 2J8RA 4NF1A 4RS2A 2CF4A 2JEVA 3PEIA 4OMEA 2PJ7A 4JYWA 3S9MA 2ZEMA 1FNOA 5BWAB 4IHMA 4P4JA 4ZYQA 2PVWA 3D2PA 4X5KA 2AFMA 1BOBA 2IJZA 4EMEA 1YR0A 2VL1A 2F7VA 1YMEA 1TKFA 4CGPA 2GIVA 1LRZA 4JD6A 1XFOA 3DDDA 1ELMP 4RUHA 2P6EA 5F49A 3PP9A 2VEZA 1YSJA 1S7NA 4KVOE 2EK9A 4LUAA 2EO8A 4F0XA 3SXOA 3JRUA 5ISVA 5F46A 1Y7EA 4P44A 4R7MA 2JDDA 5JH9A 3NH4A 4NGNA 3GY9A 3S9LA 3SJGA 2CNMA 4A33A 1I1DA 4EFDA 5IB0A 3TE4A 2GFQA 4Q7AA 1ZG9A 2DF5A 4NGMA 3ZJ0A 1F2PA 5IV0A 4AVAA 1N71A 1IY7A 4KOTA 1UFHA 2J8NA 4MCPA 1Z4RA 2VZZA 2B58A 2JBKA 2Z3NA 4U9YA 1CPXA 2FCKA 4DNCA 2ANPA 1CX8A 2H5MA 3I9SA 4Y49B 4OKOA 8CPAA 1QSOA 4A30A 2KCWA 4OLLA 2Q4VA 4EWTA 3GB0A 4C7IA 4NFRA 4TNUA 2J8MA 2GLJA 3WABA 2ZEFA 4UEZA 3PB6X 3RNZA 3T9YA 3SHPA 2YNCA 2ZXVA 3JTKA 2PVVA 2CTCA 4H6UA 4MHPA 5I0CA 3SJFA 2HV2A 3N7ZA 4Q36A 2AFSA 2EVNA 3WC5A 2GU2A 2PSWA 2FT0A 1R43A 3D7GA 5HVFA 3V38A 3A9LA 2ZPAA 1DE4C 3FXTA 3PRTA 4YWYA 1JQGA 2R8VA 5EC4A 1GHEA 2DXQA 3IEHA 4DUKA 4CRZB 5J8CA 4A32A 4FWUA 3RBUA 4AVBA 4L8AA 1Z4EA 5EBVA 4HNWB 2PJAA 4GM5A 3G3SA 4CS0B 4P4EA 1TXRA 1Z8TA 2QIRA 4PV6A 3H8FA 2ZOGA 1KWMA 4KVXA 1R57A 2GLFA 2ABZA 2AFOA 2WSAA 4TWEA 2OB0A 1ZLHA 2VXKA 3H8GA 1X10A 3R1KA 5THWA 1Z9UA 1YGHA 2PIZA 4RN7A 4YRHA 2HB6A 1YREA 1WK4A 4NSQA 4OC4A 2PJ9A 4M6GA 2EBJA 3W91A 3FB3A 1M4LA 2GANA 4LX9A 3TT2A 3VWDA 4BD9A 1B6BA 3BI1A 4CGNA 1R3NA 2Q43A 3FMCA 1XMBA 3GYAA 2Q51A 3VARA 4NCZA 1XEBA 4EVYA 1XBUA 2YNCC 4X3RA 5LYLA 4NGRA 2EK8A 3QNVA 4QC6A 4AXVA 3C26A 5F09A 1ZG8A 4XPLA 3F8KA 3WC7A 2FXFA 3B35A 1PUAA 1B87A 4A2ZA 5JGFA 4KOWA 4CAVA 1PCAA 2B4DA 1CBXA 2NSMA 3IIBA 3K9UA 2EUIA 4O23A 2AE6A 2F5IA 3KASA 1SQHA 4PXCA 4UF4A 2CXAA 3ISZA 4CYNA 2PQ8A 2Z3LA 5JM6A 3EO4A 4B6ZA 3D4UA 5G21A 4YFJA 3ISXA 3RYOA 3PZJA 2Q4ZA 3PFOA 4NEXA 2ARHA 1YW4A 5CPAA 3R9EA 1VHSA 2RFHA 1I21A 2B5GA 5E96A 1TF8A 2BEIA 4X8IA 3PFEA 4PXEA 2VI7A 1Z2LA 3CXPA 1IB1E 3GUXA 2GREA 3SJXA 3NH8A 4PK2A 2JBJA 3FH4A 1YK3A 2PJ0A 4Q38A 3W6XA 3FF3A 1LFWA 3GIUA 4Z65A 2PDOA 1VKCA 5HVHA 1IYLA 4MFZA 4UEFA 4CYOA 4UCNA 2WPXA 2RC4A 4QVTA 4JXRA 4NGSA 2YGWA 3TTHA 1YVOA 4BINA 3CPAA 3D7DA 1QSMA 3L2NA 2PJCA 4OADA 4B5OA 2X7BA 3TOAA 4MRIA 4R8FA 3DR8A 4UIBA 5H84A 3T8WA 3DNSA 3TFYA 2GE3A 4UCPA 3V8IA 2BL1A 5J1QA 4KOUA 4WWVA 3GLJA 2C6CA 4M6HA 3KI9A 3LACA 2C27A 3V7ZA 4JXQA 1P0HA 3R9FA 1BO4A 5G1ZA 2EWBA 2OZGA 3FJUA 4KUBA 3D3SA 5D29A 5C82A 1TKJA 4YU9A 4LQ6A 4MHNA 3DR6A 4A94A 4UFXA 4OAEA 2Z3PA 3RZAA 4F0YA 3SXNA 1ARMA 4MCQA 1CP7A 4KSIA 2B4DB 4PXDA 1Y9WA 3H4QA 3CXQA 1YX0A 4FD4A 3S6KA 2F8HA 2CY2A 2ZW4A 4BMHA 4PXBA 2BO9A 3SJEA 4LQGA 4MCRA 1BLLE 2Q04A 3MRUA 3JUWA 3PB7X 4OC5A 2B3VA 2ZW5A 3D7HA 1HEEA 3CZXA 2ZEEA 4JLYA 3CPXA 3WR7A 2V8DA 5C88A 3TO6A 4CGLA 4B12A 4F8ZA 4UBRA 2G0BA 5ELYA 2B5GB 3FIXA 3IJ3A 1S7FA 1S7KA 4IAVA 1PU9A 2BUEA 5LRKA 2DPTA 2REEA 4FUUA 3FX6A 3LODA 1YLEA 2PR1A 2ZELA 1A2ZA 3DGVA 1GYTA 2XEFA 3EY5A 5HH1A 1XOVA 5LYDA 2JEWA 4P4IA 4PSWA 4CYPA 1M4DA 2PCUA 4G1PA 4MFLA 3SI2A 3NH5A 1RTQA 1K4JA 2AJ6A 4K30A 4MJ8A 1VHOA 3TC8A 2ZW7A 4QUSA 1KUVA 1P4NA 2C6GA 4KLVA 1Q2CA 5HXDA 1IOFA 1ZLIA 2FE7A 4NJQA 4ZX8A 2ZEPA 2I00A 4J3GA 1U6MA 3F5BA 2CTBA 3B7IA 1Z8XA 2OR4A 3NE7A 4X2TA 1Z8LA 1Z8WA 2XEIA 4FAIA 3MGDA 4P45A 2ZEDA 4KOXA 4CAEA 3PB4X 2P6FA 4KZTA 4GXHA 5H86A 2Q7BA 1X12A 4ZBGA 1LCPA 2QYVA 2ZEGA 2B3UA 1FT7A 1V0CA 4FD6A 1AYEA 4MFKA 4CRYB 5K8PA 4CAWA 3IWEA 2PJ3A 4XNHC 2WUUA 4FBEA 4NGPA 3B3CA 2V8HA 3LD2A 4I49A 4R57A 4H89A 4R76A 3IFEA 2OU2A 3N5FA 2PJBA 3D68A 3BHXA 4E0AA 4AG9A 5K8MA 3P2HA 1NSAA 5K8OA 4XPKA 3S6GA 1MK4A 2PJ2A 5GCNA 1HDUA 3VWEA 4CGOA 4QBJA 3R96A 2PJ4A 4PPZA 5LYFA 4E2AA 4MHYA 1M44A 2NMTA 1M4GA 2K5TA 2Q0YA 3KR4A 2POKA 4F6AA 2PRQA 2OH1A 2V8VA 5AG4A 4A38A 1UWYA 2ODFA 1YLOA 4B10A 2BOAA 2ZEOA 3NE8A 4IF5A 4UWIA 5D8NA 5CNPA 5KTCA 3CT9A 4H6ZA 3DLJA 2J9AA 1NSLA 2XEGA 4KOVA 4NJRA 1I12A 2QVPA 2Z10A 2AFXA 3FVLA 3QAHA 2D4PA 3SI0A 4ZY2A 2CNSA 3K9TA 5FVJA 4XPDB 5HMNA 2AFZA 3FBUA 1VHEA 3VATA 1M4IA 4PK3A 4DJLA 4ZGYB 3FECA 1QSTA 4FD7A 1YVKA 4FD5A 4F9UA 1IOIA 2RB7A 1Y7RA 7CPAA 1ZO0A 4BBHA 2HUZA 3PGPA 1Q2YA 2Y0MA 2O28A 3FEDA 1CG2A 1Y0YA 2Z0ZA 4K3NA 2C1CA 5A28A 4MBUA 1ARLA 5JPHA 3F0AA 3QB8A 5G22A 1XMTA 1ZG7A 3FRMA 4MY3A 1RO5A 4MHZA 1QQ9A 4QB9A 2Z3KA 2FL4A 2PC1A 3DSBA 4OIDA 3CDXA 5AGEA 1QMUA 4HNYB 1KZFA 2FIWA 2O4HA 1IYKA 2Z3OA 4OP4A 3G8WA 4UFWA 4UFVA 3D7FA 4CAXA 4KLWA 3IWWA 4OC0A 4IK2A 1F57A 4C68A 3TX8A 2V8GA 4C2YA 5JQ4A 2PRBA 3BJ7A 2D4OA 4AG7A 2G9DA 4B11A 1CM0A 3EC4A 3FYNA 2PJ5A 2NYQA 3RAMA 3D8PA 4JZ0A 1L0CA 2AFUA 3B8GA 4KSAA 4R3LA 1IGBA 3P2FA 1EE3P 1MJBA 1Y0RA 1ON0A 3D2MA 3KQZA 3MN8A 1YW6A 3IU2A 4YGOA 4A39A 3S6HA 3WC6A 1LANA 4MMOA 5EMIA 2ZENA 1FY7A 3D66A 3S9NA 4ZI6A 4JJXA 2V77A 1IICA 2DPSA 4Y49C 2G3TA 5F48A 2ZW6A 4C2ZA 3K2KA 3KHZA 3IO1A 2WYRA 2BSWA 4UEEA 2XEJA 1VIXA 4M3SA 4OC3A 3TO7A 2PJ6A 4AVCA 3EFAA 2BCOA 1DTDA 2PE3A 2PJ1A 5A27A 1S3ZA 1TF9A 2CIJA 2ZEHA 3KZWA 4B5PA 4R87A 3W6SA 4AB7A 1KUYA 1QSRA 2PIYA 1TIQA 2IQ6A 2YNDA 3BLNA 4MI4A 4PSXA 4UA3A 5CBMA 3HLPA 3FNCA 4MCSA 1TKHA 3VH9A 4P4BA 1BPMA 4NGQA 4DYOA 4B13A 1MJ9A 3KQXA 3LWUA 4CYQA 4CPAA 1KUXA 1Z5RA 3I3GA 4RI1A 1CP6A 2R98A 4KOSA 4PQAA 4ZY1A 1LOKA 5HVGA 4U5YA 2VBQA 4II9A 1LAPA 2VZYA 5AG6A 1S7LA 5AG7A 5F47A 4IUSA 3B3SA 1XIXA 1AMPA 2Z11A 2A4NA 2FS5A 3CXSA 4C2XA 1IU8A 5LYIA 3SI1A 4R6TA 1CJWA 4P4DA 1QSNA 2C6PA 2PJ8A 1M1DA 1NE9A 1XJOA 2ZOFA 3B3VA 1AUGA 5I4MA 4L89A 1H8LA 4R9MA 2OOTA 4U9ZA 3PBEA 2JDCA 3KGQA 2QJ8A 3I1UA 5K8NA 4OIWA 2Q4YA 5KTAA 1JWQA 5LRJA 3BI0A 3KL9A 2YNEA 4A31A 4M85A 3R9GA 3B3TA 4H2KA 4KORA 4P4FA 3IC1A 2IL4A 3B2YA 2DEAA 3H8EA 4MY0A 1Q7LA 4UCMA 5IB9A 3JVNA 2I79A 3KKWA 3TOBA 1NMTA 1XF8A 3EXNA 4HKFA 3R95A 4CAFA 4ZX9A 5AG5A 3FEEA 2FVGA 2O53A 2QECA 1YQEA 1BPNA 4ONWA 2ATRA 2JLMA 1LAMA 2PR8A 3PB9X 3GKRA 3ZZIA 3WT4A
chains in the Genus database with same CATH topology
4HNXB 4XNHB 2HQYA 1OZPA 3S6FA 4GS4A 4KUAA 4MHDA 2CNTA 5G20A 3TO9A 2OZUA 2B4BA 4ORFA 4B5PB 4R3KA 1MJAA 4KSFA 2WPWA 1J4JA 3UY5A 2Z3MA 2G3AA 1WWZA 3T90A 4XPDC 5DWMA 3BJ8A 4A95A 2REFA 1Q2DA 4C7HA 2OZHA 2P6GA 4B14A 2FSRA 4MFQA 4E8OA 2Q44A 2QMLA 4KVME 4KOYA 4MFPA 3OWCA 4NXYA 5KTDA 2P0WA 3IWGA 1IIDA 2VQYA 3TCVA 1RXTA 1S60A 1S5KA 3IGRA 4MFJA 5DWNA 5IX3A 3E0KA 4CGMA 4ONUA 4UWJA 4JWPA 4KS9A 2FIAA 2R7HA 1XE4A 3H5ZA 5J8FA 1Y9KA 2R1IA 3IU1A 2J8RA 4NF1A 4RS2A 2JEVA 5BWAB 3D2PA 4X5KA 1BOBA 1YR0A 4CGPA 2GIVA 1LRZA 4JD6A 3DDDA 2P6EA 5F49A 3PP9A 2VEZA 1S7NA 4KVOE 4LUAA 4F0XA 3SXOA 5ISVA 5F46A 2JDDA 3GY9A 2CNMA 4A33A 1I1DA 3TE4A 5IB0A 3ZJ0A 5IV0A 4AVAA 1N71A 4KOTA 1UFHA 2J8NA 1Z4RA 2VZZA 2B58A 2Z3NA 4U9YA 2FCKA 4DNCA 2H5MA 3I9SA 4Y49B 1QSOA 4A30A 2KCWA 4OLLA 2Q4VA 4C7IA 2J8MA 3T9YA 3SHPA 2YNCA 2ZXVA 3JTKA 4H6UA 5I0CA 2HV2A 3N7ZA 4Q36A 2EVNA 2PSWA 2FT0A 3A9LA 2ZPAA 3FXTA 2R8VA 5EC4A 1GHEA 2DXQA 4CRZB 5J8CA 4A32A 4AVBA 4L8AA 1Z4EA 5EBVA 4HNWB 4CS0B 3G3SA 2QIRA 4PV6A 4KVXA 1R57A 2WSAA 2OB0A 2VXKA 3R1KA 1Z9UA 1YGHA 4YRHA 1YREA 1WK4A 4NSQA 3W91A 3FB3A 2GANA 4LX9A 3TT2A 3VWDA 1B6BA 4CGNA 3GYAA 4NCZA 1XEBA 4EVYA 2YNCC 4QC6A 3C26A 4XPLA 3F8KA 2FXFA 1PUAA 1B87A 4A2ZA 4KOWA 4CAVA 2B4DA 3K9UA 2EUIA 2AE6A 2F5IA 1SQHA 4CYNA 2CXAA 2PQ8A 2Z3LA 3EO4A 5G21A 4YFJA 3RYOA 3PZJA 4NEXA 2ARHA 3R9EA 1VHSA 1I21A 2B5GA 5E96A 2BEIA 2VI7A 3CXPA 1IB1E 4PK2A 1YK3A 4Q38A 3W6XA 2PDOA 1VKCA 1IYLA 4MFZA 4CYOA 4UCNA 2WPXA 2RC4A 4QVTA 4JXRA 2YGWA 3TTHA 1YVOA 4OADA 1QSMA 4B5OA 2X7BA 3TOAA 3DR8A 5H84A 3DNSA 3TFYA 2GE3A 4UCPA 3V8IA 2BL1A 4KOUA 2C27A 4JXQA 1P0HA 3R9FA 1BO4A 5G1ZA 2OZGA 4KUBA 3D3SA 5C82A 3DR6A 4UFXA 4OAEA 2Z3PA 4F0YA 3SXNA 2B4DB 1Y9WA 3H4QA 3CXQA 1YX0A 4FD4A 3S6KA 2CY2A 2ZW4A 4BMHA 2Q04A 3JUWA 2B3VA 2ZW5A 4JLYA 3WR7A 5C88A 3TO6A 4CGLA 4B12A 4UBRA 2G0BA 2B5GB 3FIXA 1S7FA 1S7KA 1PU9A 2BUEA 2DPTA 2REEA 3LODA 1YLEA 2PR1A 3EY5A 5HH1A 4PSWA 4CYPA 1M4DA 4MFLA 2AJ6A 1K4JA 4K30A 4MJ8A 2ZW7A 4QUSA 1KUVA 1P4NA 4KLVA 1Q2CA 2FE7A 4J3GA 2I00A 1U6MA 3F5BA 3NE7A 3MGDA 4KOXA 4CAEA 2P6FA 4KZTA 5H86A 2Q7BA 4ZBGA 2B3UA 1V0CA 4FD6A 4MFKA 4CRYB 4CAWA 3IWEA 4XNHC 2WUUA 3LD2A 4I49A 4R57A 4H89A 2OU2A 4E0AA 4AG9A 3P2HA 4XPKA 3S6GA 1MK4A 5GCNA 3VWEA 4CGOA 4QBJA 3R96A 4E2AA 1M44A 2NMTA 1M4GA 2K5TA 2Q0YA 4F6AA 2OH1A 5AG4A 4B10A 4IF5A 4UWIA 5CNPA 5KTCA 4H6ZA 1NSLA 4KOVA 1I12A 2Z10A 3QAHA 2D4PA 2CNSA 5FVJA 4XPDB 5HMNA 3FBUA 1M4IA 4PK3A 4ZGYB 1QSTA 4FD7A 1YVKA 4FD5A 1Y7RA 1ZO0A 4BBHA 2HUZA 3PGPA 1Q2YA 2Y0MA 2O28A 2Z0ZA 5A28A 4MBUA 5JPHA 3F0AA 3QB8A 5G22A 1XMTA 3FRMA 4MY3A 1RO5A 4QB9A 2Z3KA 2FL4A 2PC1A 3DSBA 5AGEA 4HNYB 1KZFA 2FIWA 1IYKA 2Z3OA 3G8WA 4UFWA 4UFVA 4CAXA 4KLWA 4C68A 4C2YA 5JQ4A 2PRBA 3BJ7A 2D4OA 4AG7A 4B11A 1CM0A 3EC4A 3FYNA 3D8PA 4R3LA 1L0CA 3B8GA 4KSAA 3P2FA 4KORA 1MJBA 1ON0A 3D2MA 4YGOA 3IU2A 3S6HA 1FY7A 4JJXA 1IICA 2DPSA 4Y49C 2G3TA 5F48A 2ZW6A 4C2ZA 3TO7A 2BSWA 4M3SA 4AVCA 3EFAA 5A27A 1S3ZA 4B5PA 4R87A 3W6SA 4AB7A 1KUYA 1QSRA 2YNDA 1TIQA 3BLNA 4MI4A 4UA3A 4PSXA 3FNCA 4B13A 1MJ9A 4CYQA 1KUXA 3I3GA 4RI1A 2R98A 4KOSA 4U5YA 2VBQA 4II9A 2VZYA 5AG6A 1S7LA 5AG7A 5F47A 4IUSA 1XIXA 2Z11A 2A4NA 2FS5A 3CXSA 4C2XA 1CJWA 1QSNA 1NE9A 1M1DA 4L89A 4R9MA 4U9ZA 2JDCA 2Q4YA 5KTAA 2YNEA 4A31A 4M85A 3R9GA 2IL4A 4MY0A 4UCMA 3JVNA 2I79A 3KKWA 3TOBA 4HKFA 1XF8A 1NMTA 3EXNA 3R95A 4CAFA 5AG5A 2QECA 2ATRA 2JLMA 2PR8A 3GKRA 3ZZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNX B;  4XNH B;  2HQY A;  1OZP A;  3S6F A;  4GS4 A;  4KUA A;  4MHD A;  2CNT A;  3TO9 A;  2OZU A;  2B4B A;  4ORF A;  4B5P B;  4R3K A;  1MJA A;  2WPW A;  1J4J A;  3UY5 A;  2G3A A;  1WWZ A;  3T90 A;  4XPD C;  5DWM A;  3BJ8 A;  2REF A;  1Q2D A;  2OZH A;  2P6G A;  2FSR A;  4E8O A;  2Q44 A;  2QML A;  4KVM E;  4KOY A;  3OWC A;  4NXY A;  5KTD A;  2P0W A;  3IWG A;  1IID A;  2VQY A;  3TCV A;  1RXT A;  1S60 A;  1S5K A;  3IGR A;  5DWN A;  5IX3 A;  3E0K A;  4ONU A;  4UWJ A;  4JWP A;  2FIA A;  2R7H A;  1XE4 A;  5J8F A;  1Y9K A;  2R1I A;  2J8R A;  4NF1 A;  4RS2 A;  2JEV A;  3D2P A;  4X5K A;  1BOB A;  1YR0 A;  2GIV A;  1LRZ A;  4JD6 A;  3DDD A;  2P6E A;  5F49 A;  3PP9 A;  2VEZ A;  1S7N A;  4KVO E;  4LUA A;  3SXO A;  5ISV A;  5F46 A;  2JDD A;  3GY9 A;  2CNM A;  1I1D A;  3TE4 A;  5IB0 A;  3ZJ0 A;  5IV0 A;  4AVA A;  1N71 A;  4KOT A;  1UFH A;  2J8N A;  1Z4R A;  2VZZ A;  2B58 A;  4U9Y A;  2FCK A;  4DNC A;  2H5M A;  3I9S A;  4Y49 B;  1QSO A;  2KCW A;  4OLL A;  2Q4V A;  2J8M A;  3T9Y A;  3SHP A;  2ZXV A;  4H6U A;  5I0C A;  2HV2 A;  3N7Z A;  2EVN A;  2PSW A;  2FT0 A;  3FXT A;  2ZPA A;  2R8V A;  5EC4 A;  1GHE A;  2DXQ A;  4CRZ B;  5J8C A;  4AVB A;  4L8A A;  1Z4E A;  5EBV A;  4HNW B;  4CS0 B;  3G3S A;  2QIR A;  4PV6 A;  4KVX A;  1R57 A;  2OB0 A;  2VXK A;  3R1K A;  1Z9U A;  1YGH A;  4YRH A;  1YRE A;  1WK4 A;  4NSQ A;  3W91 A;  3FB3 A;  2GAN A;  4LX9 A;  3TT2 A;  3VWD A;  1B6B A;  3GYA A;  4NCZ A;  1XEB A;  4EVY A;  4QC6 A;  3C26 A;  4XPL A;  3F8K A;  2FXF A;  1PUA A;  1B87 A;  4KOW A;  4CAV A;  2B4D A;  3K9U A;  2EUI A;  2AE6 A;  2F5I A;  1SQH A;  2PQ8 A;  3EO4 A;  4YFJ A;  3RYO A;  3PZJ A;  4NEX A;  2ARH A;  3R9E A;  1VHS A;  1I21 A;  2B5G A;  5E96 A;  2BEI A;  2VI7 A;  3CXP A;  1IB1 E;  4PK2 A;  1YK3 A;  3W6X A;  2PDO A;  1VKC A;  1IYL A;  2WPX A;  2RC4 A;  4QVT A;  4JXR A;  3TTH A;  1YVO A;  4OAD A;  1QSM A;  4B5O A;  2X7B A;  3TOA A;  3DR8 A;  5H84 A;  3DNS A;  3TFY A;  2GE3 A;  3V8I A;  2BL1 A;  4KOU A;  2C27 A;  4JXQ A;  1P0H A;  3R9F A;  1BO4 A;  2OZG A;  4KUB A;  3D3S A;  5C82 A;  3DR6 A;  4OAE A;  4F0Y A;  3SXN A;  2B4D B;  1Y9W A;  3H4Q A;  3CXQ A;  1YX0 A;  4FD4 A;  3S6K A;  2CY2 A;  2ZW4 A;  4BMH A;  2Q04 A;  3JUW A;  2B3V A;  2ZW5 A;  4JLY A;  3WR7 A;  5C88 A;  3TO6 A;  4UBR A;  2G0B A;  2B5G B;  3FIX A;  1S7F A;  1S7K A;  1PU9 A;  2BUE A;  2REE A;  3LOD A;  1YLE A;  2PR1 A;  3EY5 A;  5HH1 A;  4PSW A;  1M4D A;  2AJ6 A;  1K4J A;  4K30 A;  4MJ8 A;  2ZW7 A;  4QUS A;  1KUV A;  1P4N A;  4KLV A;  1Q2C A;  2FE7 A;  4J3G A;  2I00 A;  1U6M A;  3F5B A;  3NE7 A;  3MGD A;  4KOX A;  2P6F A;  4KZT A;  5H86 A;  2Q7B A;  4ZBG A;  2B3U A;  1V0C A;  4FD6 A;  4CRY B;  4CAW A;  4XNH C;  3LD2 A;  4I49 A;  4R57 A;  4H89 A;  2OU2 A;  4E0A A;  4AG9 A;  3P2H A;  4XPK A;  3S6G A;  1MK4 A;  5GCN A;  3VWE A;  4QBJ A;  3R96 A;  4E2A A;  1M44 A;  2NMT A;  1M4G A;  2K5T A;  2Q0Y A;  4F6A A;  2OH1 A;  4IF5 A;  4UWI A;  5CNP A;  5KTC A;  4H6Z A;  1NSL A;  4KOV A;  1I12 A;  2Z10 A;  3QAH A;  2D4P A;  2CNS A;  5FVJ A;  4XPD B;  5HMN A;  3FBU A;  1M4I A;  4PK3 A;  1QST A;  4FD7 A;  1YVK A;  4FD5 A;  1Y7R A;  2HUZ A;  3PGP A;  1Q2Y A;  2Y0M A;  2O28 A;  2Z0Z A;  4MBU A;  5JPH A;  3F0A A;  3QB8 A;  1XMT A;  3FRM A;  4MY3 A;  1RO5 A;  4QB9 A;  2FL4 A;  2PC1 A;  3DSB A;  4HNY B;  1KZF A;  2FIW A;  1IYK A;  3G8W A;  4CAX A;  4KLW A;  5JQ4 A;  2PRB A;  3BJ7 A;  2D4O A;  4AG7 A;  1CM0 A;  3EC4 A;  3FYN A;  3D8P A;  4R3L A;  1L0C A;  3B8G A;  3P2F A;  4KOR A;  1MJB A;  1ON0 A;  3D2M A;  4YGO A;  3S6H A;  1FY7 A;  4JJX A;  1IIC A;  4Y49 C;  5F48 A;  2G3T A;  2ZW6 A;  3TO7 A;  2BSW A;  4M3S A;  4AVC A;  3EFA A;  1S3Z A;  4B5P A;  4R87 A;  3W6S A;  4AB7 A;  1KUY A;  1QSR A;  3BLN A;  1TIQ A;  4MI4 A;  4UA3 A;  4PSX A;  3FNC A;  1MJ9 A;  1KUX A;  3I3G A;  4RI1 A;  2R98 A;  4KOS A;  4U5Y A;  2VBQ A;  4II9 A;  2VZY A;  1S7L A;  5F47 A;  4IUS A;  1XIX A;  2Z11 A;  2A4N A;  2FS5 A;  3CXS A;  1CJW A;  1QSN A;  1NE9 A;  1M1D A;  4L89 A;  4R9M A;  4U9Z A;  2JDC A;  2Q4Y A;  5KTA A;  4M85 A;  3R9G A;  2IL4 A;  4MY0 A;  3JVN A;  2I79 A;  3KKW A;  3TOB A;  1XF8 A;  1NMT A;  3EXN A;  4HKF A;  3R95 A;  2QEC A;  2ATR A;  2JLM A;  2PR8 A;  3GKR A;  3ZZI A; 
#chains in the Genus database with same CATH topology
 5DS0 A;  4HNX B;  4XNH B;  3RO0 A;  2HQY A;  1OZP A;  3S6F A;  4GS4 A;  5LRG A;  4P6Y A;  4W9Y A;  4KUA A;  4MHD A;  4WJB A;  2CNT A;  5G20 A;  4HPS A;  3TO9 A;  2OZU A;  2B4B A;  4ORF A;  3NFZ A;  4B5P B;  3NA6 A;  4R3K A;  4ZY0 A;  1MJA A;  4KSF A;  2IMO A;  2WPW A;  1J4J A;  1OBR A;  3UY5 A;  2Z3M A;  6CPA A;  4UIA A;  2G3A A;  1WWZ A;  3T90 A;  4XPD C;  5DWM A;  3B3W A;  3BJ8 A;  1VGY A;  2AFW A;  4A95 A;  1PYT B;  2Q7S A;  2REF A;  4A37 A;  1Q2D A;  1XRY A;  2WZN A;  4C7H A;  2OZH A;  3BXM A;  2P6G A;  4B14 A;  2FSR A;  1CPS A;  2I3C A;  3KR5 A;  4MFQ A;  3PBB A;  4E8O A;  2Q44 A;  2QML A;  4KVM E;  4KOY A;  4MFP A;  3OWC A;  4M6I A;  4NXY A;  5KTD A;  3QAY A;  4F9V A;  2P0W A;  3IWG A;  1IID A;  2VQY A;  3TCV A;  1RXT A;  4P10 A;  1ELL P;  1S60 A;  1S5K A;  3LMS A;  1HDQ A;  3IGR A;  4MFJ A;  5DWN A;  5IX3 A;  3E0K A;  4CGM A;  4ONU A;  4UWJ A;  4JWP A;  4OC2 A;  4KS9 A;  2FIA A;  2R7H A;  2HC9 A;  3HUV A;  1XE4 A;  4MXU A;  3H5Z A;  3D67 A;  4NGT A;  4OC1 A;  5J8F A;  1BAV A;  3PB8 X;  1F2O A;  1Y9K A;  2R1I A;  3IU1 A;  3KHX A;  2J8R A;  4NF1 A;  4RS2 A;  2CF4 A;  2JEV A;  3PEI A;  4OME A;  2PJ7 A;  4JYW A;  3S9M A;  2ZEM A;  1FNO A;  5BWA B;  4IHM A;  4P4J A;  4ZYQ A;  2PVW A;  3D2P A;  4X5K A;  2AFM A;  1BOB A;  2IJZ A;  4EME A;  1YR0 A;  2VL1 A;  2F7V A;  1YME A;  1TKF A;  4CGP A;  2GIV A;  1LRZ A;  4JD6 A;  1XFO A;  3DDD A;  1ELM P;  4RUH A;  2P6E A;  5F49 A;  3PP9 A;  2VEZ A;  1YSJ A;  1S7N A;  4KVO E;  2EK9 A;  4LUA A;  2EO8 A;  4F0X A;  3SXO A;  3JRU A;  5ISV A;  5F46 A;  1Y7E A;  4P44 A;  4R7M A;  2JDD A;  5JH9 A;  3NH4 A;  4NGN A;  3GY9 A;  3S9L A;  3SJG A;  2CNM A;  4A33 A;  1I1D A;  4EFD A;  5IB0 A;  3TE4 A;  2GFQ A;  4Q7A A;  1ZG9 A;  2DF5 A;  4NGM A;  3ZJ0 A;  1F2P A;  5IV0 A;  4AVA A;  1N71 A;  1IY7 A;  4KOT A;  1UFH A;  2J8N A;  4MCP A;  1Z4R A;  2VZZ A;  2B58 A;  2JBK A;  2Z3N A;  4U9Y A;  1CPX A;  2FCK A;  4DNC A;  2ANP A;  1CX8 A;  2H5M A;  3I9S A;  4Y49 B;  4OKO A;  8CPA A;  1QSO A;  4A30 A;  2KCW A;  4OLL A;  2Q4V A;  4EWT A;  3GB0 A;  4C7I A;  4NFR A;  4TNU A;  2J8M A;  2GLJ A;  3WAB A;  2ZEF A;  4UEZ A;  3PB6 X;  3RNZ A;  3T9Y A;  3SHP A;  2YNC A;  2ZXV A;  3JTK A;  2PVV A;  2CTC A;  4H6U A;  4MHP A;  5I0C A;  3SJF A;  2HV2 A;  3N7Z A;  4Q36 A;  2AFS A;  2EVN A;  3WC5 A;  2GU2 A;  2PSW A;  2FT0 A;  1R43 A;  3D7G A;  5HVF A;  3V38 A;  3A9L A;  2ZPA A;  1DE4 C;  3FXT A;  3PRT A;  4YWY A;  1JQG A;  2R8V A;  5EC4 A;  1GHE A;  2DXQ A;  3IEH A;  4DUK A;  4CRZ B;  5J8C A;  4A32 A;  4FWU A;  3RBU A;  4AVB A;  4L8A A;  1Z4E A;  5EBV A;  4HNW B;  2PJA A;  4GM5 A;  3G3S A;  4CS0 B;  4P4E A;  1TXR A;  1Z8T A;  2QIR A;  4PV6 A;  3H8F A;  2ZOG A;  1KWM A;  4KVX A;  1R57 A;  2GLF A;  2ABZ A;  2AFO A;  2WSA A;  4TWE A;  2OB0 A;  1ZLH A;  2VXK A;  3H8G A;  1X10 A;  3R1K A;  5THW A;  1Z9U A;  1YGH A;  2PIZ A;  4RN7 A;  4YRH A;  2HB6 A;  1YRE A;  1WK4 A;  4NSQ A;  4OC4 A;  2PJ9 A;  4M6G A;  2EBJ A;  3W91 A;  3FB3 A;  1M4L A;  2GAN A;  4LX9 A;  3TT2 A;  3VWD A;  4BD9 A;  1B6B A;  3BI1 A;  4CGN A;  1R3N A;  2Q43 A;  3FMC A;  1XMB A;  3GYA A;  2Q51 A;  3VAR A;  4NCZ A;  1XEB A;  4EVY A;  1XBU A;  2YNC C;  4X3R A;  5LYL A;  4NGR A;  2EK8 A;  3QNV A;  4QC6 A;  4AXV A;  3C26 A;  5F09 A;  1ZG8 A;  4XPL A;  3F8K A;  3WC7 A;  2FXF A;  3B35 A;  1PUA A;  1B87 A;  4A2Z A;  5JGF A;  4KOW A;  4CAV A;  1PCA A;  2B4D A;  1CBX A;  2NSM A;  3IIB A;  3K9U A;  2EUI A;  4O23 A;  2AE6 A;  2F5I A;  3KAS A;  1SQH A;  4PXC A;  4UF4 A;  2CXA A;  3ISZ A;  4CYN A;  2PQ8 A;  2Z3L A;  5JM6 A;  3EO4 A;  4B6Z A;  3D4U A;  5G21 A;  4YFJ A;  3ISX A;  3RYO A;  3PZJ A;  2Q4Z A;  3PFO A;  4NEX A;  2ARH A;  1YW4 A;  5CPA A;  3R9E A;  1VHS A;  2RFH A;  1I21 A;  2B5G A;  5E96 A;  1TF8 A;  2BEI A;  4X8I A;  3PFE A;  4PXE A;  2VI7 A;  1Z2L A;  3CXP A;  1IB1 E;  3GUX A;  2GRE A;  3SJX A;  3NH8 A;  4PK2 A;  2JBJ A;  3FH4 A;  1YK3 A;  2PJ0 A;  4Q38 A;  3W6X A;  3FF3 A;  1LFW A;  3GIU A;  4Z65 A;  2PDO A;  1VKC A;  5HVH A;  1IYL A;  4MFZ A;  4UEF A;  4CYO A;  4UCN A;  2WPX A;  2RC4 A;  4QVT A;  4JXR A;  4NGS A;  2YGW A;  3TTH A;  1YVO A;  4BIN A;  3CPA A;  3D7D A;  1QSM A;  3L2N A;  2PJC A;  4OAD A;  4B5O A;  2X7B A;  3TOA A;  4MRI A;  4R8F A;  3DR8 A;  4UIB A;  5H84 A;  3T8W A;  3DNS A;  3TFY A;  2GE3 A;  4UCP A;  3V8I A;  2BL1 A;  5J1Q A;  4KOU A;  4WWV A;  3GLJ A;  2C6C A;  4M6H A;  3KI9 A;  3LAC A;  2C27 A;  3V7Z A;  4JXQ A;  1P0H A;  3R9F A;  1BO4 A;  5G1Z A;  2EWB A;  2OZG A;  3FJU A;  4KUB A;  3D3S A;  5D29 A;  5C82 A;  1TKJ A;  4YU9 A;  4LQ6 A;  4MHN A;  3DR6 A;  4A94 A;  4UFX A;  4OAE A;  2Z3P A;  3RZA A;  4F0Y A;  3SXN A;  1ARM A;  4MCQ A;  1CP7 A;  4KSI A;  2B4D B;  4PXD A;  1Y9W A;  3H4Q A;  3CXQ A;  1YX0 A;  4FD4 A;  3S6K A;  2F8H A;  2CY2 A;  2ZW4 A;  4BMH A;  4PXB A;  2BO9 A;  3SJE A;  4LQG A;  4MCR A;  1BLL E;  2Q04 A;  3MRU A;  3JUW A;  3PB7 X;  4OC5 A;  2B3V A;  2ZW5 A;  3D7H A;  1HEE A;  3CZX A;  2ZEE A;  4JLY A;  3CPX A;  3WR7 A;  2V8D A;  5C88 A;  3TO6 A;  4CGL A;  4B12 A;  4F8Z A;  4UBR A;  2G0B A;  5ELY A;  2B5G B;  3FIX A;  3IJ3 A;  1S7F A;  1S7K A;  4IAV A;  1PU9 A;  2BUE A;  5LRK A;  2DPT A;  2REE A;  4FUU A;  3FX6 A;  3LOD A;  1YLE A;  2PR1 A;  2ZEL A;  1A2Z A;  3DGV A;  1GYT A;  2XEF A;  3EY5 A;  5HH1 A;  1XOV A;  5LYD A;  2JEW A;  4P4I A;  4PSW A;  4CYP A;  1M4D A;  2PCU A;  4G1P A;  4MFL A;  3SI2 A;  3NH5 A;  1RTQ A;  1K4J A;  2AJ6 A;  4K30 A;  4MJ8 A;  1VHO A;  3TC8 A;  2ZW7 A;  4QUS A;  1KUV A;  1P4N A;  2C6G A;  4KLV A;  1Q2C A;  5HXD A;  1IOF A;  1ZLI A;  2FE7 A;  4NJQ A;  4ZX8 A;  2ZEP A;  2I00 A;  4J3G A;  1U6M A;  3F5B A;  2CTB A;  3B7I A;  1Z8X A;  2OR4 A;  3NE7 A;  4X2T A;  1Z8L A;  1Z8W A;  2XEI A;  4FAI A;  3MGD A;  4P45 A;  2ZED A;  4KOX A;  4CAE A;  3PB4 X;  2P6F A;  4KZT A;  4GXH A;  5H86 A;  2Q7B A;  1X12 A;  4ZBG A;  1LCP A;  2QYV A;  2ZEG A;  2B3U A;  1FT7 A;  1V0C A;  4FD6 A;  1AYE A;  4MFK A;  4CRY B;  5K8P A;  4CAW A;  3IWE A;  2PJ3 A;  4XNH C;  2WUU A;  4FBE A;  4NGP A;  3B3C A;  2V8H A;  3LD2 A;  4I49 A;  4R57 A;  4H89 A;  4R76 A;  3IFE A;  2OU2 A;  3N5F A;  2PJB A;  3D68 A;  3BHX A;  4E0A A;  4AG9 A;  5K8M A;  3P2H A;  1NSA A;  5K8O A;  4XPK A;  3S6G A;  1MK4 A;  2PJ2 A;  5GCN A;  1HDU A;  3VWE A;  4CGO A;  4QBJ A;  3R96 A;  2PJ4 A;  4PPZ A;  5LYF A;  4E2A A;  4MHY A;  1M44 A;  2NMT A;  1M4G A;  2K5T A;  2Q0Y A;  3KR4 A;  2POK A;  4F6A A;  2PRQ A;  2OH1 A;  2V8V A;  5AG4 A;  4A38 A;  1UWY A;  2ODF A;  1YLO A;  4B10 A;  2BOA A;  2ZEO A;  3NE8 A;  4IF5 A;  4UWI A;  5D8N A;  5CNP A;  5KTC A;  3CT9 A;  4H6Z A;  3DLJ A;  2J9A A;  1NSL A;  2XEG A;  4KOV A;  4NJR A;  1I12 A;  2QVP A;  2Z10 A;  2AFX A;  3FVL A;  3QAH A;  2D4P A;  3SI0 A;  4ZY2 A;  2CNS A;  3K9T A;  5FVJ A;  4XPD B;  5HMN A;  2AFZ A;  3FBU A;  1VHE A;  3VAT A;  1M4I A;  4PK3 A;  4DJL A;  4ZGY B;  3FEC A;  1QST A;  4FD7 A;  1YVK A;  4FD5 A;  4F9U A;  1IOI A;  2RB7 A;  1Y7R A;  7CPA A;  1ZO0 A;  4BBH A;  2HUZ A;  3PGP A;  1Q2Y A;  2Y0M A;  2O28 A;  3FED A;  1CG2 A;  1Y0Y A;  2Z0Z A;  4K3N A;  2C1C A;  5A28 A;  4MBU A;  1ARL A;  5JPH A;  3F0A A;  3QB8 A;  5G22 A;  1XMT A;  1ZG7 A;  3FRM A;  4MY3 A;  1RO5 A;  4MHZ A;  1QQ9 A;  4QB9 A;  2Z3K A;  2FL4 A;  2PC1 A;  3DSB A;  4OID A;  3CDX A;  5AGE A;  1QMU A;  4HNY B;  1KZF A;  2FIW A;  2O4H A;  1IYK A;  2Z3O A;  4OP4 A;  3G8W A;  4UFW A;  4UFV A;  3D7F A;  4CAX A;  4KLW A;  3IWW A;  4OC0 A;  4IK2 A;  1F57 A;  4C68 A;  3TX8 A;  2V8G A;  4C2Y A;  5JQ4 A;  2PRB A;  3BJ7 A;  2D4O A;  4AG7 A;  2G9D A;  4B11 A;  1CM0 A;  3EC4 A;  3FYN A;  2PJ5 A;  2NYQ A;  3RAM A;  3D8P A;  4JZ0 A;  1L0C A;  2AFU A;  3B8G A;  4KSA A;  4R3L A;  1IGB A;  3P2F A;  1EE3 P;  1MJB A;  1Y0R A;  1ON0 A;  3D2M A;  3KQZ A;  3MN8 A;  1YW6 A;  3IU2 A;  4YGO A;  4A39 A;  3S6H A;  3WC6 A;  1LAN A;  4MMO A;  5EMI A;  2ZEN A;  1FY7 A;  3D66 A;  3S9N A;  4ZI6 A;  4JJX A;  2V77 A;  1IIC A;  2DPS A;  4Y49 C;  2G3T A;  5F48 A;  2ZW6 A;  4C2Z A;  3K2K A;  3KHZ A;  3IO1 A;  2WYR A;  2BSW A;  4UEE A;  2XEJ A;  1VIX A;  4M3S A;  4OC3 A;  3TO7 A;  2PJ6 A;  4AVC A;  3EFA A;  2BCO A;  1DTD A;  2PE3 A;  2PJ1 A;  5A27 A;  1S3Z A;  1TF9 A;  2CIJ A;  2ZEH A;  3KZW A;  4B5P A;  4R87 A;  3W6S A;  4AB7 A;  1KUY A;  1QSR A;  2PIY A;  1TIQ A;  2IQ6 A;  2YND A;  3BLN A;  4MI4 A;  4PSX A;  4UA3 A;  5CBM A;  3HLP A;  3FNC A;  4MCS A;  1TKH A;  3VH9 A;  4P4B A;  1BPM A;  4NGQ A;  4DYO A;  4B13 A;  1MJ9 A;  3KQX A;  3LWU A;  4CYQ A;  4CPA A;  1KUX A;  1Z5R A;  3I3G A;  4RI1 A;  1CP6 A;  2R98 A;  4KOS A;  4PQA A;  4ZY1 A;  1LOK A;  5HVG A;  4U5Y A;  2VBQ A;  4II9 A;  1LAP A;  2VZY A;  5AG6 A;  1S7L A;  5AG7 A;  5F47 A;  4IUS A;  3B3S A;  1XIX A;  1AMP A;  2Z11 A;  2A4N A;  2FS5 A;  3CXS A;  4C2X A;  1IU8 A;  5LYI A;  3SI1 A;  4R6T A;  1CJW A;  4P4D A;  1QSN A;  2C6P A;  2PJ8 A;  1M1D A;  1NE9 A;  1XJO A;  2ZOF A;  3B3V A;  1AUG A;  5I4M A;  4L89 A;  1H8L A;  4R9M A;  2OOT A;  4U9Z A;  3PBE A;  2JDC A;  3KGQ A;  2QJ8 A;  3I1U A;  5K8N A;  4OIW A;  2Q4Y A;  5KTA A;  1JWQ A;  5LRJ A;  3BI0 A;  3KL9 A;  2YNE A;  4A31 A;  4M85 A;  3R9G A;  3B3T A;  4H2K A;  4KOR A;  4P4F A;  3IC1 A;  2IL4 A;  3B2Y A;  2DEA A;  3H8E A;  4MY0 A;  1Q7L A;  4UCM A;  5IB9 A;  3JVN A;  2I79 A;  3KKW A;  3TOB A;  1NMT A;  1XF8 A;  3EXN A;  4HKF A;  3R95 A;  4CAF A;  4ZX9 A;  5AG5 A;  3FEE A;  2FVG A;  2O53 A;  2QEC A;  1YQE A;  1BPN A;  4ONW A;  2ATR A;  2JLM A;  1LAM A;  2PR8 A;  3PB9 X;  3GKR A;  3ZZI A;  3WT4 A; 
#chains in the Genus database with same CATH homology
 4HNX B;  4XNH B;  2HQY A;  1OZP A;  3S6F A;  4GS4 A;  4KUA A;  4MHD A;  2CNT A;  5G20 A;  3TO9 A;  2OZU A;  2B4B A;  4ORF A;  4B5P B;  4R3K A;  1MJA A;  4KSF A;  2WPW A;  1J4J A;  3UY5 A;  2Z3M A;  2G3A A;  1WWZ A;  3T90 A;  4XPD C;  5DWM A;  3BJ8 A;  4A95 A;  2REF A;  1Q2D A;  4C7H A;  2OZH A;  2P6G A;  4B14 A;  2FSR A;  4MFQ A;  4E8O A;  2Q44 A;  2QML A;  4KVM E;  4KOY A;  4MFP A;  3OWC A;  4NXY A;  5KTD A;  2P0W A;  3IWG A;  1IID A;  2VQY A;  3TCV A;  1RXT A;  1S60 A;  1S5K A;  3IGR A;  4MFJ A;  5DWN A;  5IX3 A;  3E0K A;  4CGM A;  4ONU A;  4UWJ A;  4JWP A;  4KS9 A;  2FIA A;  2R7H A;  1XE4 A;  3H5Z A;  5J8F A;  1Y9K A;  2R1I A;  3IU1 A;  2J8R A;  4NF1 A;  4RS2 A;  2JEV A;  5BWA B;  3D2P A;  4X5K A;  1BOB A;  1YR0 A;  4CGP A;  2GIV A;  1LRZ A;  4JD6 A;  3DDD A;  2P6E A;  5F49 A;  3PP9 A;  2VEZ A;  1S7N A;  4KVO E;  4LUA A;  4F0X A;  3SXO A;  5ISV A;  5F46 A;  2JDD A;  3GY9 A;  2CNM A;  4A33 A;  1I1D A;  3TE4 A;  5IB0 A;  3ZJ0 A;  5IV0 A;  4AVA A;  1N71 A;  4KOT A;  1UFH A;  2J8N A;  1Z4R A;  2VZZ A;  2B58 A;  2Z3N A;  4U9Y A;  2FCK A;  4DNC A;  2H5M A;  3I9S A;  4Y49 B;  1QSO A;  4A30 A;  2KCW A;  4OLL A;  2Q4V A;  4C7I A;  2J8M A;  3T9Y A;  3SHP A;  2YNC A;  2ZXV A;  3JTK A;  4H6U A;  5I0C A;  2HV2 A;  3N7Z A;  4Q36 A;  2EVN A;  2PSW A;  2FT0 A;  3A9L A;  2ZPA A;  3FXT A;  2R8V A;  5EC4 A;  1GHE A;  2DXQ A;  4CRZ B;  5J8C A;  4A32 A;  4AVB A;  4L8A A;  1Z4E A;  5EBV A;  4HNW B;  4CS0 B;  3G3S A;  2QIR A;  4PV6 A;  4KVX A;  1R57 A;  2WSA A;  2OB0 A;  2VXK A;  3R1K A;  1Z9U A;  1YGH A;  4YRH A;  1YRE A;  1WK4 A;  4NSQ A;  3W91 A;  3FB3 A;  2GAN A;  4LX9 A;  3TT2 A;  3VWD A;  1B6B A;  4CGN A;  3GYA A;  4NCZ A;  1XEB A;  4EVY A;  2YNC C;  4QC6 A;  3C26 A;  4XPL A;  3F8K A;  2FXF A;  1PUA A;  1B87 A;  4A2Z A;  4KOW A;  4CAV A;  2B4D A;  3K9U A;  2EUI A;  2AE6 A;  2F5I A;  1SQH A;  4CYN A;  2CXA A;  2PQ8 A;  2Z3L A;  3EO4 A;  5G21 A;  4YFJ A;  3RYO A;  3PZJ A;  4NEX A;  2ARH A;  3R9E A;  1VHS A;  1I21 A;  2B5G A;  5E96 A;  2BEI A;  2VI7 A;  3CXP A;  1IB1 E;  4PK2 A;  1YK3 A;  4Q38 A;  3W6X A;  2PDO A;  1VKC A;  1IYL A;  4MFZ A;  4CYO A;  4UCN A;  2WPX A;  2RC4 A;  4QVT A;  4JXR A;  2YGW A;  3TTH A;  1YVO A;  4OAD A;  1QSM A;  4B5O A;  2X7B A;  3TOA A;  3DR8 A;  5H84 A;  3DNS A;  3TFY A;  2GE3 A;  4UCP A;  3V8I A;  2BL1 A;  4KOU A;  2C27 A;  4JXQ A;  1P0H A;  3R9F A;  1BO4 A;  5G1Z A;  2OZG A;  4KUB A;  3D3S A;  5C82 A;  3DR6 A;  4UFX A;  4OAE A;  2Z3P A;  4F0Y A;  3SXN A;  2B4D B;  1Y9W A;  3H4Q A;  3CXQ A;  1YX0 A;  4FD4 A;  3S6K A;  2CY2 A;  2ZW4 A;  4BMH A;  2Q04 A;  3JUW A;  2B3V A;  2ZW5 A;  4JLY A;  3WR7 A;  5C88 A;  3TO6 A;  4CGL A;  4B12 A;  4UBR A;  2G0B A;  2B5G B;  3FIX A;  1S7F A;  1S7K A;  1PU9 A;  2BUE A;  2DPT A;  2REE A;  3LOD A;  1YLE A;  2PR1 A;  3EY5 A;  5HH1 A;  4PSW A;  4CYP A;  1M4D A;  4MFL A;  2AJ6 A;  1K4J A;  4K30 A;  4MJ8 A;  2ZW7 A;  4QUS A;  1KUV A;  1P4N A;  4KLV A;  1Q2C A;  2FE7 A;  4J3G A;  2I00 A;  1U6M A;  3F5B A;  3NE7 A;  3MGD A;  4KOX A;  4CAE A;  2P6F A;  4KZT A;  5H86 A;  2Q7B A;  4ZBG A;  2B3U A;  1V0C A;  4FD6 A;  4MFK A;  4CRY B;  4CAW A;  3IWE A;  4XNH C;  2WUU A;  3LD2 A;  4I49 A;  4R57 A;  4H89 A;  2OU2 A;  4E0A A;  4AG9 A;  3P2H A;  4XPK A;  3S6G A;  1MK4 A;  5GCN A;  3VWE A;  4CGO A;  4QBJ A;  3R96 A;  4E2A A;  1M44 A;  2NMT A;  1M4G A;  2K5T A;  2Q0Y A;  4F6A A;  2OH1 A;  5AG4 A;  4B10 A;  4IF5 A;  4UWI A;  5CNP A;  5KTC A;  4H6Z A;  1NSL A;  4KOV A;  1I12 A;  2Z10 A;  3QAH A;  2D4P A;  2CNS A;  5FVJ A;  4XPD B;  5HMN A;  3FBU A;  1M4I A;  4PK3 A;  4ZGY B;  1QST A;  4FD7 A;  1YVK A;  4FD5 A;  1Y7R A;  1ZO0 A;  4BBH A;  2HUZ A;  3PGP A;  1Q2Y A;  2Y0M A;  2O28 A;  2Z0Z A;  5A28 A;  4MBU A;  5JPH A;  3F0A A;  3QB8 A;  5G22 A;  1XMT A;  3FRM A;  4MY3 A;  1RO5 A;  4QB9 A;  2Z3K A;  2FL4 A;  2PC1 A;  3DSB A;  5AGE A;  4HNY B;  1KZF A;  2FIW A;  1IYK A;  2Z3O A;  3G8W A;  4UFW A;  4UFV A;  4CAX A;  4KLW A;  4C68 A;  4C2Y A;  5JQ4 A;  2PRB A;  3BJ7 A;  2D4O A;  4AG7 A;  4B11 A;  1CM0 A;  3EC4 A;  3FYN A;  3D8P A;  4R3L A;  1L0C A;  3B8G A;  4KSA A;  3P2F A;  4KOR A;  1MJB A;  1ON0 A;  3D2M A;  4YGO A;  3IU2 A;  3S6H A;  1FY7 A;  4JJX A;  1IIC A;  2DPS A;  4Y49 C;  2G3T A;  5F48 A;  2ZW6 A;  4C2Z A;  3TO7 A;  2BSW A;  4M3S A;  4AVC A;  3EFA A;  5A27 A;  1S3Z A;  4B5P A;  4R87 A;  3W6S A;  4AB7 A;  1KUY A;  1QSR A;  2YND A;  1TIQ A;  3BLN A;  4MI4 A;  4UA3 A;  4PSX A;  3FNC A;  4B13 A;  1MJ9 A;  4CYQ A;  1KUX A;  3I3G A;  4RI1 A;  2R98 A;  4KOS A;  4U5Y A;  2VBQ A;  4II9 A;  2VZY A;  5AG6 A;  1S7L A;  5AG7 A;  5F47 A;  4IUS A;  1XIX A;  2Z11 A;  2A4N A;  2FS5 A;  3CXS A;  4C2X A;  1CJW A;  1QSN A;  1NE9 A;  1M1D A;  4L89 A;  4R9M A;  4U9Z A;  2JDC A;  2Q4Y A;  5KTA A;  2YNE A;  4A31 A;  4M85 A;  3R9G A;  2IL4 A;  4MY0 A;  4UCM A;  3JVN A;  2I79 A;  3KKW A;  3TOB A;  4HKF A;  1XF8 A;  1NMT A;  3EXN A;  3R95 A;  4CAF A;  5AG5 A;  2QEC A;  2ATR A;  2JLM A;  2PR8 A;  3GKR A;  3ZZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...