2VBQA

Structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
SHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
publication title Kinetic and Structural Analysis of Bisubstrate Inhibition of the Salmonella Enterica Aminoglycoside 6'-N-Acetyltransferase.
pubmed doi rcsb
source organism Salmonella choleraesuis
molecule tags Transferase
total genus 39
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vbqA00
4II9A 4H6UA 1IYKA 3TO7A 5C88A 3S6KA 4ORFA 4CRZB 5E96A 2FSRA 4E8OA 3S6HA 4HNYB 2OZUA 5F46A 2QIRA 2B3UA 1Z4RA 4R57A 4CAVA 4CS0B 2VEZA 3R9EA 3V8IA 2ZPAA 4NXYA 2B5GA 1M4DA 1WWZA 3LODA 4QB9A 1B6BA 3CXQA 3QAHA 1VHSA 4M85A 4PSXA 2IL4A 2VZZA 3BJ8A 3CXSA 3JVNA 3GKRA 3TCVA 4EVYA 2CNSA 3BLNA 5KTAA 4RS2A 2B3VA 3TO6A 4NF1A 1Z9UA 2OZHA 4L8AA 5F47A 2Q04A 2Q4VA 1XIXA 2PR8A 3VWEA 2QMLA 2Z0ZA 3I9SA 1YLEA 1Z4EA 3TFYA 2J8MA 3R1KA 5IB0A 2HQYA 1QSOA 3EFAA 1S7LA 3FBUA 4BMHA 3DSBA 3G3SA 4UWJA 4HNWB 3EY5A 2Q7BA 3ZJ0A 3SXOA 4LUAA 1S7FA 3SHPA 4J3GA 4UBRA 1PU9A 1SQHA 2VBQA 1B87A 2Q4YA 4MJ8A 2FIWA 1U6MA 2P6EA 5IV0A 1S60A 1CM0A 3EC4A 3QB8A 1Y9WA 2H5MA 2J8RA 1Q2YA 3E0KA 2P6GA 3ZZIA 3PP9A 4QBJA 1IB1E 1ON0A 4XPKA 2DXQA 2ZW5A 2O28A 4KUBA 3FRMA 4JXQA 4R3LA 2ZXVA 5JPHA 4JWPA 2BSWA 4PK3A 2FXFA 3TO9A 2FE7A 4GS4A 5F48A 3T90A 5DWMA 4AVAA 5ISVA 2B5GB 1I21A 1KUVA 1XMTA 1Y7RA 2C27A 4PSWA 3FNCA 1S7NA 3GYAA 2BEIA 2OH1A 3P2HA 2REFA 1QSNA 4FD6A 1NE9A 3IGRA 1OZPA 3DR6A 1P0HA 2G3AA 4E2AA 2Z11A 4UA3A 3F8KA 3T9YA 1M4GA 3LD2A 3N7ZA 2QECA 4YRHA 3FB3A 2HUZA 3RYOA 1N71A 1NSLA 2J8NA 3R9GA 1I1DA 4KOUA 3WR7A 3TTHA 2GIVA 4KVOE 4B5OA 5C82A 3D8PA 4KOWA 2R8VA 4MY0A 1BOBA 4KZTA 4RI1A 4IF5A 4MBUA 3IWGA 1L0CA 1M44A 2NMTA 5KTDA 2K5TA 1QSRA 4KOYA 1RXTA 1KUXA 2GE3A 2FT0A 3G8WA 5JQ4A 2Q44A 2FS5A 4PV6A 5F49A 4KLWA 2Q0YA 2I79A 2KCWA 5EC4A 4CAXA 1M4IA 3D2PA 1CJWA 2G0BA 2ZW7A 4U5YA 4JLYA 2CY2A 3K9UA 3JUWA 2REEA 5GCNA 3UY5A 1XEBA 3TT2A 2BUEA 2I00A 2WPXA 1QSTA 4E0AA 4NCZA 2Z10A 1MK4A 3VWDA 4M3SA 4QC6A 2G3TA 3D3SA 3R9FA 1QSMA 2B58A 1M1DA 2ARHA 4I49A 1S5KA 3MGDA 1XF8A 3FYNA 1R57A 4YGOA 4MI4A 2PRBA 4UWIA 4KOTA 4KLVA 5H86A 1FY7A 4NEXA 1MJ9A 2JDCA 2FCKA 5EBVA 2P6FA 4R9MA 4JJXA 4DNCA 1MJBA 3NE7A 1RO5A 2JLMA 1NMTA 3OWCA 1XE4A 1KUYA 4B5PB 2F5IA 5J8CA 1YX0A 2PC1A 3C26A 4H89A 3F0AA 1UFHA 4XPLA 4Y49C 4HNXB 4LX9A 2BL1A 2VI7A 4KOSA 2JDDA 1VKCA 2B4BA 4Y49B 2PQ8A 2Y0MA 4HKFA 4XPDC 3W91A 4FD4A 5I0CA 4OLLA 1YK3A 2WPWA 3CXPA 3DNSA 4NSQA 4B5PA 2PSWA 4R87A 5HH1A 4AG9A 2VQYA 4XPDB 3SXNA 4CRYB 4QUSA 3EXNA 2FIAA 4JD6A 2CNMA 4H6ZA 4OAEA 5HMNA 1PUAA 4U9YA 4K30A 2PDOA 2OU2A 4ONUA 1IIDA 5IX3A 4X5KA 2D4OA 2RC4A 3FIXA 1YR0A 2AJ6A 3I3GA 2B4DB 2VXKA 4KOXA 1P4NA 1WK4A 2EVNA 3PZJA 3S6GA 1YVKA 3S6FA 4AVCA 2VZYA 5FVJA 1S3ZA 5CNPA 4AB7A 2FL4A 1BO4A 2CNTA 3R96A 1I12A 4OADA 3F5BA 3BJ7A 4CAWA 4QVTA 4FD5A 1IYLA 2B4DA 3FXTA 4YFJA 2D4PA 2R1IA 4IUSA 1IICA 1LRZA 3R95A 5H84A 3P2FA 4KUAA 3GY9A 2ATRA 2R98A 3TOBA 4MHDA 4FD7A 1K4JA 3TE4A 2R7HA 3W6SA 4AG7A 1Y9KA 4KOVA 4R3KA 1YREA 4ZBGA 4XNHC 2X7BA 2AE6A 3B8GA 2P0WA 2EUIA 1GHEA 3KKWA 3H4QA 1TIQA 1YGHA 2OB0A 3PGPA 3DDDA 2HV2A 4JXRA 4PK2A 4XNHB 3W6XA 1YVOA 2JEVA 1KZFA 4L89A 4AVBA 4KVME 4KORA 5KTCA 3EO4A 1Q2DA 1J4JA 2ZW6A 3D2MA 4MY3A 4F6AA 1MJAA 2ZW4A 4KVXA 1Q2CA 2A4NA 2OZGA 4F0YA 2PR1A 2GANA 4U9ZA 1V0CA 3DR8A 5DWNA 3TOAA 1S7KA 5J8FA
chains in the Genus database with same CATH superfamily
4II9A 4Z65A 4H6UA 1IYKA 3TO7A 5C88A 3S6KA 3B2YA 3IWWA 4ORFA 4FUUA 3TX8A 4UFXA 1VHOA 4CRZB 5E96A 2FSRA 2WYRA 3JTKA 3V7ZA 2PJ2A 4E8OA 1VGYA 3S6HA 3GIUA 4HNYB 2OZUA 5F46A 4R7MA 2QIRA 4TWEA 2B3UA 1Z4RA 2POKA 4NJQA 4R57A 3PB4X 1ELLP 2ODFA 4CAVA 4ZY1A 4CS0B 2VEZA 3FEEA 3MN8A 3DGVA 4C2ZA 4Q38A 3FH4A 2AFXA 3R9EA 3IEHA 2ZPAA 3KZWA 3B35A 3V8IA 4HPSA 4NXYA 2B5GA 1M4DA 1WWZA 3LODA 1R3NA 1XMBA 4QB9A 3IWEA 1B6BA 3CXQA 3QAHA 3FX6A 1VHSA 1QQ9A 4OC2A 4M85A 1Y7EA 1HDQA 2IL4A 2VZZA 4PSXA 3BJ8A 4P4IA 2Z3OA 3NFZA 4NGSA 1XBUA 2AFOA 1HEEA 3CXSA 4A95A 3JVNA 4PXEA 3GKRA 3TCVA 1VHEA 4EVYA 2CNSA 2Q7SA 3BLNA 3FF3A 2PRQA 2WUUA 5KTAA 2ZEGA 4MRIA 4RS2A 1TKFA 2B3VA 3WABA 2YGWA 4MHZA 2XEJA 5EMIA 1ZLHA 2XEGA 4NF1A 3TO6A 1Z9UA 2OZHA 1M4LA 4L8AA 5F47A 2Q04A 2Q4VA 1XIXA 2EBJA 2AFWA 2Z3LA 3RO0A 5IB9A 2PR8A 3GB0A 1Z8XA 2QMLA 3VWEA 5LYLA 2Z0ZA 3I9SA 1ZLIA 1YLEA 1XRYA 1Z4EA 2AFUA 2J8MA 3R1KA 3TFYA 5IB0A 2HQYA 1UWYA 4K3NA 1QSOA 2DPTA 2ABZA 1S7LA 3EFAA 2O53A 3FBUA 4BMHA 3NH4A 3DSBA 2V8VA 4RUHA 4DJLA 3G3SA 4F9VA 4A94A 4UWJA 4HNWB 3IU2A 3IJ3A 1EE3P 3EY5A 3K2KA 2Q7BA 3ZJ0A 4AXVA 2DF5A 3SXOA 3CDXA 4LUAA 2PJAA 2ZEEA 1S7FA 3SHPA 1IOFA 4A37A 4J3GA 5LYFA 4TNUA 4UBRA 4GM5A 1PU9A 6CPAA 5A28A 4ZGYB 2DPSA 2YNCC 1SQHA 2VBQA 1B87A 4KSAA 2Q4YA 4MJ8A 4NFRA 2FIWA 4G1PA 1U6MA 2ZEOA 2P6EA 5IV0A 4Q36A 1S60A 1CM0A 4KS9A 5AG4A 3EC4A 2CTCA 4UFWA 5AG5A 3QB8A 1Y9WA 2RB7A 4A30A 2H5MA 2J8RA 1Q2YA 2P6GA 3E0KA 4NGRA 4UCMA 3ZZIA 3T8WA 2CTBA 3PP9A 4B12A 4QBJA 3H8FA 5G1ZA 2CF4A 1IB1E 1LAMA 1ON0A 3H8GA 4XPKA 2PVVA 2Q4ZA 3LACA 3PB8X 2DXQA 2WSAA 3B3TA 5HVFA 2ZW5A 2O28A 2BOAA 1X10A 5F09A 5LYIA 4CGOA 4WWVA 4B11A 3PB7X 3FRMA 4JXQA 4KUBA 4CGPA 4MFJA 4R3LA 2ZXVA 5JPHA 4JWPA 5G21A 2BSWA 4PK3A 2FXFA 3TO9A 2Z3MA 2IQ6A 2FE7A 1Z8WA 4ZI6A 4ZX9A 5HVHA 4GS4A 5F48A 3T90A 4PXDA 5DWMA 4FAIA 4A38A 4AVAA 5ISVA 1YW4A 2CIJA 2PJ5A 2B5GB 1I21A 3KHZA 1LOKA 1KUVA 1XMTA 2C6GA 4OC5A 5AG6A 1Y7RA 3SI1A 2C27A 4C2YA 4PSWA 3FNCA 1S7NA 2V8DA 3GYAA 3IC1A 2F8HA 2BEIA 4MCSA 2OH1A 3P2HA 2Q51A 2C1CA 4JYWA 4A39A 2V77A 2REFA 1ZG7A 1QSNA 2ZEFA 4FD6A 1NE9A 4KSFA 3WC5A 1Y0RA 1PYTB 3IGRA 1OZPA 4R76A 3DR6A 1P0HA 2BO9A 2G3AA 4E2AA 2Z11A 3D7FA 4UA3A 2EK8A 2FVGA 3F8KA 1M4GA 3LD2A 3N7ZA 2QECA 3T9YA 3LWUA 2PJ1A 4CGMA 5J1QA 1CBXA 1NSAA 4MCPA 2QJ8A 4YRHA 7CPAA 1XOVA 5G22A 3FB3A 4P45A 4CGNA 1BAVA 2HUZA 5LRKA 3RYOA 1N71A 4BD9A 1NSLA 1LCPA 4ONWA 1H8LA 2J8NA 3R9GA 1I1DA 4KOUA 3WR7A 4UFVA 2PJ0A 3N5FA 2GIVA 3TTHA 1R43A 4KVOE 1CX8A 4B5OA 2ZELA 4DYOA 5C82A 1Z2LA 3D8PA 4JZ0A 3D7DA 2CXAA 5BWAB 1FT7A 4KOWA 5LYDA 2R8VA 4MY0A 2G9DA 1AUGA 1QMUA 1TKJA 1BOBA 4KZTA 4RI1A 4IF5A 4MBUA 3IWGA 1L0CA 1M44A 1TKHA 2NMTA 4A32A 5KTDA 2K5TA 1QSRA 2YNEA 2VL1A 4M6IA 1BPNA 4M6HA 4B14A 5AG7A 4KOYA 4MCQA 1RXTA 3QAYA 1KUXA 2GE3A 2FT0A 3G8WA 1KWMA 2GLFA 5JQ4A 2RFHA 2Q44A 2FS5A 5HVGA 4PV6A 5F49A 4A31A 4Q7AA 4KLWA 2Q0YA 4MHPA 4EFDA 1DTDA 2J9AA 2I79A 2KCWA 5EC4A 3WT4A 4CAXA 1M4IA 4GXHA 3D2PA 1CJWA 2G0BA 2ZW7A 4P10A 2GREA 4U5YA 1ARLA 3KR5A 4JLYA 4UCPA 2CY2A 3K9UA 4KSIA 3JUWA 4F9UA 4M6GA 5JM6A 2REEA 1F57A 5GCNA 3UY5A 1XEBA 3TT2A 2BUEA 2EO8A 2I00A 2WPXA 3PFOA 1QSTA 3BXMA 4E0AA 4PQAA 4OIWA 4NCZA 4OC0A 2Z10A 1IGBA 2PCUA 1MK4A 1Z8TA 2OOTA 4P4JA 1LANA 3PB9X 3VWDA 4UEZA 3KGQA 2DEAA 2V8HA 4MHYA 3S9LA 2ZEHA 3PEIA 4M3SA 4QC6A 2G3TA 3KASA 2PJBA 3D3SA 1QSMA 3R9FA 2B58A 3SJGA 5CPAA 1YQEA 1M1DA 2ARHA 3D7HA 3D67A 4I49A 1S5KA 4ZY2A 2IMOA 3L2NA 1IOIA 3MGDA 1XF8A 3FYNA 1R57A 4YGOA 4MI4A 2PRBA 4UWIA 3ISXA 4KOTA 4MFQA 3S9MA 2ZOGA 4KLVA 1GYTA 5H86A 1FY7A 2JBKA 4NEXA 4OC3A 4C7HA 1MJ9A 2JDCA 1OBRA 2FCKA 5EBVA 1VIXA 2P6FA 4R9MA 3V38A 1LFWA 4JJXA 4WJBA 4DNCA 2Q43A 5K8MA 1MJBA 4X8IA 3VATA 1RTQA 3TC8A 4A2ZA 3NE7A 1RO5A 2JLMA 3H5ZA 3K9TA 1NMTA 2PJ4A 4P6YA 4UF4A 1A2ZA 3H8EA 5DS0A 3OWCA 1XE4A 3I1UA 2HC9A 1KUYA 3WC6A 3SJXA 4B5PB 2F5IA 5J8CA 3SJFA 1YX0A 2PC1A 3C26A 3CPXA 3NH5A 4H89A 4C7IA 1TXRA 5LRGA 3SI0A 3F0AA 1UFHA 4ZY0A 4XPLA 3PFEA 4Y49C 4MCRA 4HNXB 4LX9A 2BL1A 2VI7A 4PXCA 2PIYA 3PBBA 4KOSA 2GFQA 2JDDA 1VKCA 4NGNA 1AMPA 1F2OA 1X12A 2B4BA 4BINA 3B3CA 4CAFA 4NGPA 1HDUA 3KR4A 4IK2A 3WC7A 4Y49B 2PQ8A 1CP7A 4YU9A 2Y0MA 4HKFA 4XPDC 3W91A 4FD4A 3IFEA 4NGMA 5I0CA 2JBJA 1YLOA 4B6ZA 4OLLA 1YK3A 2WPWA 3CXPA 4O23A 3CT9A 3DNSA 4NSQA 3RZAA 4CGLA 1LAPA 4UEFA 3FMCA 4B5PA 1ELMP 2PSWA 4R87A 2ANPA 4X2TA 4X3RA 5HH1A 4AG9A 4IAVA 2VQYA 4NJRA 4XPDB 2NYQA 4NGTA 3SXNA 4CRYB 4B13A 2HB6A 4QUSA 3EXNA 3VH9A 4OMEA 2AFMA 2FIAA 2XEIA 1JQGA 4JD6A 5ELYA 2AFZA 2CNMA 3S9NA 4H6ZA 4OAEA 5G20A 5HMNA 4EWTA 1PUAA 4F0XA 8CPAA 3FECA 4RN7A 1Z8LA 4F8ZA 1CP6A 3NH8A 4U9YA 4UIBA 3CZXA 4K30A 2PDOA 2PJCA 1YSJA 1DE4C 2OU2A 4ONUA 4CYPA 4DUKA 1IIDA 3QNVA 5IX3A 4X5KA 5K8OA 4H2KA 2D4OA 4P44A 2RC4A 4MHNA 2PJ7A 3JRUA 4CAEA 2WZNA 4EMEA 2PVWA 3BI0A 4MXUA 3FIXA 1Q7LA 1YR0A 2AJ6A 1XFOA 4OKOA 3I3GA 5JH9A 2ZOFA 2B4DB 2PIZA 1CPSA 5K8NA 4C68A 2ZEDA 2V8GA 2VXKA 1ZO0A 4C2XA 4KOXA 3B3SA 1P4NA 1WK4A 2EVNA 3PZJA 4P4BA 3B3VA 3S6GA 4P4EA 4OC4A 1YVKA 3D66A 1Y0YA 3S6FA 4UEEA 4AVCA 5A27A 2PE3A 2XEFA 4CYQA 4CYNA 2VZYA 1CPXA 3SI2A 5FVJA 2F7VA 1S3ZA 5CNPA 3DLJA 2Z3KA 1PCAA 4AB7A 4BBHA 3FEDA 3PBEA 4A33A 1ARMA 4LQ6A 2FL4A 1BO4A 2CNTA 3CPAA 4IHMA 1CG2A 2ZEMA 1I12A 3BHXA 4OADA 3F5BA 3R96A 1AYEA 2ZEPA 3BJ7A 4P4DA 1Z5RA 4PPZA 1BLLE 4W9YA 1FNOA 4CAWA 4QVTA 4CYOA 1YMEA 4FD5A 1BPMA 1IYLA 2B4DA 2C6PA 2EK9A 1IU8A 3FXTA 4YFJA 3BI1A 2D4PA 2R1IA 2GU2A 2NSMA 2PJ6A 4IUSA 1ZG9A 1IICA 3KHXA 2IJZA 4YWYA 1LRZA 3R95A 5H84A 3P2FA 1TF8A 4KUAA 3GY9A 2ATRA 2R98A 4MFZA 5LRJA 3TOBA 4MHDA 4CPAA 4FD7A 4OP4A 1K4JA 3PRTA 4UIAA 2OR4A 4P4FA 5J8FA 4B10A 3TE4A 3D68A 2R7HA 1JWQA 3W6SA 5HXDA 4AG7A 1F2PA 2BCOA 2PJ8A 1Y9KA 3GLJA 4MMOA 4ZYQA 4KOVA 4R3KA 3NA6A 1YREA 4ZBGA 1YW6A 3KL9A 3MRUA 4XNHC 2Z3PA 2JEWA 2X7BA 2AE6A 3B8GA 2P0WA 2EUIA 1TF9A 1GHEA 3B3WA 3FVLA 3GUXA 3KKWA 4UCNA 4FWUA 5I4MA 3HLPA 3H4QA 1TIQA 1YGHA 2C6CA 2OB0A 4MFPA 2QYVA 3PGPA 4FBEA 3DDDA 2HV2A 3A9LA 3IIBA 4OIDA 2EWBA 4MFLA 2AFSA 4JXRA 4PK2A 3IO1A 5D29A 4XNHB 2GLJA 3RNZA 3W6XA 2ZENA 1YVOA 3KI9A 2JEVA 1KZFA 2I3CA 1ZG8A 4L89A 4AVBA 4KVME 4KORA 3D7GA 3HUVA 5KTCA 3RAMA 3EO4A 4PXBA 3RBUA 4R8FA 4NGQA 5D8NA 1Q2DA 5JGFA 3SJEA 3FJUA 4R6TA 2O4HA 1J4JA 2ZW6A 3LMSA 3D2MA 3ISZA 1IY7A 4MY3A 3IU1A 5THWA 5K8PA 1XJOA 2QVPA 4F6AA 1MJAA 2PJ3A 3NE8A 4MFKA 3VARA 2ZW4A 4KVXA 2PJ9A 3B7IA 1Q2CA 2A4NA 2OZGA 2YNDA 2PR1A 4F0YA 3KQZA 2YNCA 3KQXA 2GANA 3PB6X 4U9ZA 1V0CA 3DR8A 2Z3NA 5DWNA 4OC1A 5AGEA 1S7KA 3D4UA 3TOAA 5CBMA 4LQGA 4ZX8A
chains in the Genus database with same CATH topology
4II9A 4H6UA 1IYKA 3TO7A 5C88A 3S6KA 4ORFA 4UFXA 4CRZB 5E96A 2FSRA 3JTKA 4E8OA 3S6HA 4HNYB 2OZUA 5F46A 2QIRA 2B3UA 1Z4RA 4R57A 4CAVA 4CS0B 2VEZA 4C2ZA 4Q38A 3R9EA 3V8IA 2ZPAA 4NXYA 2B5GA 1M4DA 1WWZA 3LODA 4QB9A 3IWEA 1B6BA 3CXQA 3QAHA 1VHSA 4M85A 4PSXA 2IL4A 2VZZA 3BJ8A 2Z3OA 3CXSA 4A95A 3JVNA 3GKRA 3TCVA 4EVYA 2CNSA 3BLNA 5KTAA 2WUUA 4RS2A 2B3VA 2YGWA 3TO6A 4NF1A 1Z9UA 2OZHA 4L8AA 5F47A 2Q04A 2Q4VA 1XIXA 2Z3LA 2PR8A 3VWEA 2QMLA 2Z0ZA 3I9SA 1YLEA 1Z4EA 3TFYA 2J8MA 3R1KA 5IB0A 2HQYA 1QSOA 2DPTA 3EFAA 1S7LA 3FBUA 4BMHA 3DSBA 3G3SA 4UWJA 4HNWB 3IU2A 3EY5A 2Q7BA 3ZJ0A 3SXOA 4LUAA 1S7FA 3SHPA 4J3GA 4UBRA 1PU9A 5A28A 4ZGYB 2DPSA 2YNCC 1SQHA 2VBQA 1B87A 4KSAA 2Q4YA 4MJ8A 2FIWA 1U6MA 2P6EA 5IV0A 4Q36A 1S60A 1CM0A 4KS9A 5AG4A 3EC4A 4UFWA 5AG5A 3QB8A 1Y9WA 4A30A 2H5MA 2J8RA 1Q2YA 3E0KA 2P6GA 4UCMA 3ZZIA 3PP9A 4B12A 4QBJA 5G1ZA 1IB1E 1ON0A 4XPKA 2DXQA 2WSAA 2ZW5A 2O28A 4CGOA 4B11A 4KUBA 3FRMA 4JXQA 4CGPA 4MFJA 4R3LA 2ZXVA 5JPHA 4JWPA 5G21A 2BSWA 4PK3A 2FXFA 3TO9A 2Z3MA 2FE7A 4GS4A 5F48A 3T90A 5DWMA 4AVAA 5ISVA 2B5GB 1I21A 1KUVA 1XMTA 5AG6A 1Y7RA 2C27A 4C2YA 4PSWA 3FNCA 1S7NA 3GYAA 2BEIA 2OH1A 3P2HA 2REFA 1QSNA 4FD6A 1NE9A 4KSFA 3IGRA 1OZPA 3DR6A 1P0HA 2G3AA 4E2AA 2Z11A 4UA3A 3F8KA 3T9YA 1M4GA 3LD2A 3N7ZA 2QECA 4CGMA 4YRHA 5G22A 3FB3A 4CGNA 2HUZA 3RYOA 1N71A 1NSLA 2J8NA 3R9GA 1I1DA 4KOUA 3WR7A 4UFVA 3TTHA 2GIVA 4KVOE 4B5OA 5C82A 3D8PA 2CXAA 5BWAB 4KOWA 2R8VA 4MY0A 1BOBA 4KZTA 4RI1A 4IF5A 4MBUA 3IWGA 1L0CA 1M44A 2NMTA 4A32A 5KTDA 2K5TA 1QSRA 2YNEA 4B14A 5AG7A 4KOYA 1RXTA 1KUXA 2GE3A 2FT0A 3G8WA 5JQ4A 2Q44A 2FS5A 4PV6A 5F49A 4A31A 4KLWA 2Q0YA 2I79A 2KCWA 5EC4A 4CAXA 1M4IA 3D2PA 1CJWA 2G0BA 2ZW7A 4U5YA 4JLYA 4UCPA 2CY2A 3K9UA 3JUWA 2REEA 5GCNA 3UY5A 1XEBA 3TT2A 2BUEA 2I00A 2WPXA 1QSTA 4E0AA 4NCZA 2Z10A 1MK4A 3VWDA 4M3SA 4QC6A 2G3TA 3D3SA 3R9FA 1QSMA 2B58A 1M1DA 2ARHA 4I49A 1S5KA 3MGDA 1XF8A 3FYNA 1R57A 4YGOA 4MI4A 2PRBA 4UWIA 4KOTA 4MFQA 4KLVA 5H86A 4C7HA 1FY7A 4NEXA 1MJ9A 2JDCA 2FCKA 5EBVA 2P6FA 4R9MA 4JJXA 4DNCA 1MJBA 4A2ZA 3NE7A 1RO5A 2JLMA 3H5ZA 1NMTA 3OWCA 1XE4A 1KUYA 4B5PB 2F5IA 5J8CA 4C7IA 1YX0A 2PC1A 3C26A 4H89A 3F0AA 1UFHA 4XPLA 4Y49C 4HNXB 4LX9A 2BL1A 2VI7A 4KOSA 2JDDA 1VKCA 2B4BA 4CAFA 4Y49B 2PQ8A 2Y0MA 4HKFA 4XPDC 3W91A 4FD4A 5I0CA 4OLLA 1YK3A 2WPWA 3CXPA 3DNSA 4NSQA 4CGLA 4B5PA 2PSWA 4R87A 5HH1A 4AG9A 2VQYA 4XPDB 3SXNA 4CRYB 4B13A 4QUSA 3EXNA 2FIAA 4JD6A 2CNMA 4H6ZA 4OAEA 5G20A 5HMNA 1PUAA 4F0XA 4U9YA 4K30A 2PDOA 2OU2A 4CYPA 4ONUA 1IIDA 5IX3A 4X5KA 2D4OA 2RC4A 4CAEA 3FIXA 1YR0A 2AJ6A 3I3GA 2B4DB 4C68A 2VXKA 1ZO0A 4C2XA 4KOXA 1P4NA 1WK4A 2EVNA 3PZJA 3S6GA 1YVKA 3S6FA 4AVCA 5A27A 4CYQA 4CYNA 2VZYA 5FVJA 1S3ZA 5CNPA 2Z3KA 4AB7A 4BBHA 4A33A 2FL4A 1BO4A 2CNTA 3R96A 1I12A 4OADA 3F5BA 3BJ7A 4CAWA 4QVTA 4CYOA 4FD5A 1IYLA 2B4DA 3FXTA 4YFJA 2D4PA 2R1IA 4IUSA 1IICA 1LRZA 3R95A 5H84A 3P2FA 4KUAA 3GY9A 2ATRA 2R98A 4MFZA 3TOBA 4MHDA 4FD7A 1K4JA 4B10A 3TE4A 2R7HA 3W6SA 4AG7A 1Y9KA 4KOVA 4R3KA 1YREA 4ZBGA 4XNHC 2Z3PA 2X7BA 2AE6A 3B8GA 2P0WA 2EUIA 1GHEA 3KKWA 4UCNA 3H4QA 1TIQA 1YGHA 2OB0A 4MFPA 3PGPA 3DDDA 2HV2A 3A9LA 4MFLA 4JXRA 4PK2A 4XNHB 3W6XA 1YVOA 2JEVA 1KZFA 4L89A 4AVBA 4KVME 4KORA 5KTCA 3EO4A 1Q2DA 1J4JA 2ZW6A 3D2MA 4MY3A 3IU1A 4F6AA 1MJAA 4MFKA 2ZW4A 4KVXA 1Q2CA 2A4NA 2OZGA 2YNDA 2PR1A 4F0YA 2YNCA 2GANA 4U9ZA 1V0CA 3DR8A 2Z3NA 5DWNA 5AGEA 3TOAA 1S7KA 5J8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II9 A;  4H6U A;  1IYK A;  3TO7 A;  5C88 A;  3S6K A;  4ORF A;  4CRZ B;  5E96 A;  2FSR A;  4E8O A;  3S6H A;  4HNY B;  2OZU A;  5F46 A;  2QIR A;  2B3U A;  1Z4R A;  4R57 A;  4CAV A;  4CS0 B;  2VEZ A;  3R9E A;  3V8I A;  2ZPA A;  4NXY A;  2B5G A;  1M4D A;  1WWZ A;  3LOD A;  4QB9 A;  1B6B A;  3CXQ A;  3QAH A;  1VHS A;  4M85 A;  4PSX A;  2IL4 A;  2VZZ A;  3BJ8 A;  3CXS A;  3JVN A;  3GKR A;  3TCV A;  4EVY A;  2CNS A;  3BLN A;  5KTA A;  4RS2 A;  2B3V A;  3TO6 A;  4NF1 A;  1Z9U A;  2OZH A;  4L8A A;  5F47 A;  2Q04 A;  2Q4V A;  1XIX A;  2PR8 A;  3VWE A;  2QML A;  2Z0Z A;  3I9S A;  1YLE A;  1Z4E A;  3TFY A;  2J8M A;  3R1K A;  5IB0 A;  2HQY A;  1QSO A;  3EFA A;  1S7L A;  3FBU A;  4BMH A;  3DSB A;  3G3S A;  4UWJ A;  4HNW B;  3EY5 A;  2Q7B A;  3ZJ0 A;  3SXO A;  4LUA A;  1S7F A;  3SHP A;  4J3G A;  4UBR A;  1PU9 A;  1SQH A;  2VBQ A;  1B87 A;  2Q4Y A;  4MJ8 A;  2FIW A;  1U6M A;  2P6E A;  5IV0 A;  1S60 A;  1CM0 A;  3EC4 A;  3QB8 A;  1Y9W A;  2H5M A;  2J8R A;  1Q2Y A;  3E0K A;  2P6G A;  3ZZI A;  3PP9 A;  4QBJ A;  1IB1 E;  1ON0 A;  4XPK A;  2DXQ A;  2ZW5 A;  2O28 A;  4KUB A;  3FRM A;  4JXQ A;  4R3L A;  2ZXV A;  5JPH A;  4JWP A;  2BSW A;  4PK3 A;  2FXF A;  3TO9 A;  2FE7 A;  4GS4 A;  5F48 A;  3T90 A;  5DWM A;  4AVA A;  5ISV A;  2B5G B;  1I21 A;  1KUV A;  1XMT A;  1Y7R A;  2C27 A;  4PSW A;  3FNC A;  1S7N A;  3GYA A;  2BEI A;  2OH1 A;  3P2H A;  2REF A;  1QSN A;  4FD6 A;  1NE9 A;  3IGR A;  1OZP A;  3DR6 A;  1P0H A;  2G3A A;  4E2A A;  2Z11 A;  4UA3 A;  3F8K A;  3T9Y A;  1M4G A;  3LD2 A;  3N7Z A;  2QEC A;  4YRH A;  3FB3 A;  2HUZ A;  3RYO A;  1N71 A;  1NSL A;  2J8N A;  3R9G A;  1I1D A;  4KOU A;  3WR7 A;  3TTH A;  2GIV A;  4KVO E;  4B5O A;  5C82 A;  3D8P A;  4KOW A;  2R8V A;  4MY0 A;  1BOB A;  4KZT A;  4RI1 A;  4IF5 A;  4MBU A;  3IWG A;  1L0C A;  1M44 A;  2NMT A;  5KTD A;  2K5T A;  1QSR A;  4KOY A;  1RXT A;  1KUX A;  2GE3 A;  2FT0 A;  3G8W A;  5JQ4 A;  2Q44 A;  2FS5 A;  4PV6 A;  5F49 A;  4KLW A;  2Q0Y A;  2I79 A;  2KCW A;  5EC4 A;  4CAX A;  1M4I A;  3D2P A;  1CJW A;  2G0B A;  2ZW7 A;  4U5Y A;  4JLY A;  2CY2 A;  3K9U A;  3JUW A;  2REE A;  5GCN A;  3UY5 A;  1XEB A;  3TT2 A;  2BUE A;  2I00 A;  2WPX A;  1QST A;  4E0A A;  4NCZ A;  2Z10 A;  1MK4 A;  3VWD A;  4M3S A;  4QC6 A;  2G3T A;  3D3S A;  3R9F A;  1QSM A;  2B58 A;  1M1D A;  2ARH A;  4I49 A;  1S5K A;  3MGD A;  1XF8 A;  3FYN A;  1R57 A;  4YGO A;  4MI4 A;  2PRB A;  4UWI A;  4KOT A;  4KLV A;  5H86 A;  1FY7 A;  4NEX A;  1MJ9 A;  2JDC A;  2FCK A;  5EBV A;  2P6F A;  4R9M A;  4JJX A;  4DNC A;  1MJB A;  3NE7 A;  1RO5 A;  2JLM A;  1NMT A;  3OWC A;  1XE4 A;  1KUY A;  4B5P B;  2F5I A;  5J8C A;  1YX0 A;  2PC1 A;  3C26 A;  4H89 A;  3F0A A;  1UFH A;  4XPL A;  4Y49 C;  4HNX B;  4LX9 A;  2BL1 A;  2VI7 A;  4KOS A;  2JDD A;  1VKC A;  2B4B A;  4Y49 B;  2PQ8 A;  2Y0M A;  4HKF A;  4XPD C;  3W91 A;  4FD4 A;  5I0C A;  4OLL A;  1YK3 A;  2WPW A;  3CXP A;  3DNS A;  4NSQ A;  4B5P A;  2PSW A;  4R87 A;  5HH1 A;  4AG9 A;  2VQY A;  4XPD B;  3SXN A;  4CRY B;  4QUS A;  3EXN A;  2FIA A;  4JD6 A;  2CNM A;  4H6Z A;  4OAE A;  5HMN A;  1PUA A;  4U9Y A;  4K30 A;  2PDO A;  2OU2 A;  4ONU A;  1IID A;  5IX3 A;  4X5K A;  2D4O A;  2RC4 A;  3FIX A;  1YR0 A;  2AJ6 A;  3I3G A;  2B4D B;  2VXK A;  4KOX A;  1P4N A;  1WK4 A;  2EVN A;  3PZJ A;  3S6G A;  1YVK A;  3S6F A;  4AVC A;  2VZY A;  5FVJ A;  1S3Z A;  5CNP A;  4AB7 A;  2FL4 A;  1BO4 A;  2CNT A;  3R96 A;  1I12 A;  4OAD A;  3F5B A;  3BJ7 A;  4CAW A;  4QVT A;  4FD5 A;  1IYL A;  2B4D A;  3FXT A;  4YFJ A;  2D4P A;  2R1I A;  4IUS A;  1IIC A;  1LRZ A;  3R95 A;  5H84 A;  3P2F A;  4KUA A;  3GY9 A;  2ATR A;  2R98 A;  3TOB A;  4MHD A;  4FD7 A;  1K4J A;  3TE4 A;  2R7H A;  3W6S A;  4AG7 A;  1Y9K A;  4KOV A;  4R3K A;  1YRE A;  4ZBG A;  4XNH C;  2X7B A;  2AE6 A;  3B8G A;  2P0W A;  2EUI A;  1GHE A;  3KKW A;  3H4Q A;  1TIQ A;  1YGH A;  2OB0 A;  3PGP A;  3DDD A;  2HV2 A;  4JXR A;  4PK2 A;  4XNH B;  3W6X A;  1YVO A;  2JEV A;  1KZF A;  4L89 A;  4AVB A;  4KVM E;  4KOR A;  5KTC A;  3EO4 A;  1Q2D A;  1J4J A;  2ZW6 A;  3D2M A;  4MY3 A;  4F6A A;  1MJA A;  2ZW4 A;  4KVX A;  1Q2C A;  2A4N A;  2OZG A;  4F0Y A;  2PR1 A;  2GAN A;  4U9Z A;  1V0C A;  3DR8 A;  5DWN A;  3TOA A;  1S7K A;  5J8F A; 
#chains in the Genus database with same CATH topology
 4II9 A;  4Z65 A;  4H6U A;  1IYK A;  3TO7 A;  5C88 A;  3S6K A;  3B2Y A;  3IWW A;  4ORF A;  4FUU A;  3TX8 A;  4UFX A;  1VHO A;  4CRZ B;  5E96 A;  2FSR A;  2WYR A;  3JTK A;  3V7Z A;  2PJ2 A;  4E8O A;  1VGY A;  3S6H A;  3GIU A;  4HNY B;  2OZU A;  5F46 A;  4R7M A;  2QIR A;  4TWE A;  2B3U A;  1Z4R A;  2POK A;  4NJQ A;  4R57 A;  3PB4 X;  1ELL P;  2ODF A;  4CAV A;  4ZY1 A;  4CS0 B;  2VEZ A;  3FEE A;  3MN8 A;  3DGV A;  4C2Z A;  4Q38 A;  3FH4 A;  2AFX A;  3R9E A;  3IEH A;  2ZPA A;  3KZW A;  3B35 A;  3V8I A;  4HPS A;  4NXY A;  2B5G A;  1M4D A;  1WWZ A;  3LOD A;  1R3N A;  1XMB A;  4QB9 A;  3IWE A;  1B6B A;  3CXQ A;  3QAH A;  3FX6 A;  1VHS A;  1QQ9 A;  4OC2 A;  4M85 A;  1Y7E A;  1HDQ A;  2IL4 A;  2VZZ A;  4PSX A;  3BJ8 A;  4P4I A;  2Z3O A;  3NFZ A;  4NGS A;  1XBU A;  2AFO A;  1HEE A;  3CXS A;  4A95 A;  3JVN A;  4PXE A;  3GKR A;  3TCV A;  1VHE A;  4EVY A;  2CNS A;  2Q7S A;  3BLN A;  3FF3 A;  2PRQ A;  2WUU A;  5KTA A;  2ZEG A;  4MRI A;  4RS2 A;  1TKF A;  2B3V A;  3WAB A;  2YGW A;  4MHZ A;  2XEJ A;  5EMI A;  1ZLH A;  2XEG A;  4NF1 A;  3TO6 A;  1Z9U A;  2OZH A;  1M4L A;  4L8A A;  5F47 A;  2Q04 A;  2Q4V A;  1XIX A;  2EBJ A;  2AFW A;  2Z3L A;  3RO0 A;  5IB9 A;  2PR8 A;  3GB0 A;  1Z8X A;  2QML A;  3VWE A;  5LYL A;  2Z0Z A;  3I9S A;  1ZLI A;  1YLE A;  1XRY A;  1Z4E A;  2AFU A;  2J8M A;  3R1K A;  3TFY A;  5IB0 A;  2HQY A;  1UWY A;  4K3N A;  1QSO A;  2DPT A;  2ABZ A;  1S7L A;  3EFA A;  2O53 A;  3FBU A;  4BMH A;  3NH4 A;  3DSB A;  2V8V A;  4RUH A;  4DJL A;  3G3S A;  4F9V A;  4A94 A;  4UWJ A;  4HNW B;  3IU2 A;  3IJ3 A;  1EE3 P;  3EY5 A;  3K2K A;  2Q7B A;  3ZJ0 A;  4AXV A;  2DF5 A;  3SXO A;  3CDX A;  4LUA A;  2PJA A;  2ZEE A;  1S7F A;  3SHP A;  1IOF A;  4A37 A;  4J3G A;  5LYF A;  4TNU A;  4UBR A;  4GM5 A;  1PU9 A;  6CPA A;  5A28 A;  4ZGY B;  2DPS A;  2YNC C;  1SQH A;  2VBQ A;  1B87 A;  4KSA A;  2Q4Y A;  4MJ8 A;  4NFR A;  2FIW A;  4G1P A;  1U6M A;  2ZEO A;  2P6E A;  5IV0 A;  4Q36 A;  1S60 A;  1CM0 A;  4KS9 A;  5AG4 A;  3EC4 A;  2CTC A;  4UFW A;  5AG5 A;  3QB8 A;  1Y9W A;  2RB7 A;  4A30 A;  2H5M A;  2J8R A;  1Q2Y A;  2P6G A;  3E0K A;  4NGR A;  4UCM A;  3ZZI A;  3T8W A;  2CTB A;  3PP9 A;  4B12 A;  4QBJ A;  3H8F A;  5G1Z A;  2CF4 A;  1IB1 E;  1LAM A;  1ON0 A;  3H8G A;  4XPK A;  2PVV A;  2Q4Z A;  3LAC A;  3PB8 X;  2DXQ A;  2WSA A;  3B3T A;  5HVF A;  2ZW5 A;  2O28 A;  2BOA A;  1X10 A;  5F09 A;  5LYI A;  4CGO A;  4WWV A;  4B11 A;  3PB7 X;  3FRM A;  4JXQ A;  4KUB A;  4CGP A;  4MFJ A;  4R3L A;  2ZXV A;  5JPH A;  4JWP A;  5G21 A;  2BSW A;  4PK3 A;  2FXF A;  3TO9 A;  2Z3M A;  2IQ6 A;  2FE7 A;  1Z8W A;  4ZI6 A;  4ZX9 A;  5HVH A;  4GS4 A;  5F48 A;  3T90 A;  4PXD A;  5DWM A;  4FAI A;  4A38 A;  4AVA A;  5ISV A;  1YW4 A;  2CIJ A;  2PJ5 A;  2B5G B;  1I21 A;  3KHZ A;  1LOK A;  1KUV A;  1XMT A;  2C6G A;  4OC5 A;  5AG6 A;  1Y7R A;  3SI1 A;  2C27 A;  4C2Y A;  4PSW A;  3FNC A;  1S7N A;  2V8D A;  3GYA A;  3IC1 A;  2F8H A;  2BEI A;  4MCS A;  2OH1 A;  3P2H A;  2Q51 A;  2C1C A;  4JYW A;  4A39 A;  2V77 A;  2REF A;  1ZG7 A;  1QSN A;  2ZEF A;  4FD6 A;  1NE9 A;  4KSF A;  3WC5 A;  1Y0R A;  1PYT B;  3IGR A;  1OZP A;  4R76 A;  3DR6 A;  1P0H A;  2BO9 A;  2G3A A;  4E2A A;  2Z11 A;  3D7F A;  4UA3 A;  2EK8 A;  2FVG A;  3F8K A;  1M4G A;  3LD2 A;  3N7Z A;  2QEC A;  3T9Y A;  3LWU A;  2PJ1 A;  4CGM A;  5J1Q A;  1CBX A;  1NSA A;  4MCP A;  2QJ8 A;  4YRH A;  7CPA A;  1XOV A;  5G22 A;  3FB3 A;  4P45 A;  4CGN A;  1BAV A;  2HUZ A;  5LRK A;  3RYO A;  1N71 A;  4BD9 A;  1NSL A;  1LCP A;  4ONW A;  1H8L A;  2J8N A;  3R9G A;  1I1D A;  4KOU A;  3WR7 A;  4UFV A;  2PJ0 A;  3N5F A;  2GIV A;  3TTH A;  1R43 A;  4KVO E;  1CX8 A;  4B5O A;  2ZEL A;  4DYO A;  5C82 A;  1Z2L A;  3D8P A;  4JZ0 A;  3D7D A;  2CXA A;  5BWA B;  1FT7 A;  4KOW A;  5LYD A;  2R8V A;  4MY0 A;  2G9D A;  1AUG A;  1QMU A;  1TKJ A;  1BOB A;  4KZT A;  4RI1 A;  4IF5 A;  4MBU A;  3IWG A;  1L0C A;  1M44 A;  1TKH A;  2NMT A;  4A32 A;  5KTD A;  2K5T A;  1QSR A;  2YNE A;  2VL1 A;  4M6I A;  1BPN A;  4M6H A;  4B14 A;  5AG7 A;  4KOY A;  4MCQ A;  1RXT A;  3QAY A;  1KUX A;  2GE3 A;  2FT0 A;  3G8W A;  1KWM A;  2GLF A;  5JQ4 A;  2RFH A;  2Q44 A;  2FS5 A;  5HVG A;  4PV6 A;  5F49 A;  4A31 A;  4Q7A A;  4KLW A;  2Q0Y A;  4MHP A;  4EFD A;  1DTD A;  2J9A A;  2I79 A;  2KCW A;  5EC4 A;  3WT4 A;  4CAX A;  1M4I A;  4GXH A;  3D2P A;  1CJW A;  2G0B A;  2ZW7 A;  4P10 A;  2GRE A;  4U5Y A;  1ARL A;  3KR5 A;  4JLY A;  4UCP A;  2CY2 A;  3K9U A;  4KSI A;  3JUW A;  4F9U A;  4M6G A;  5JM6 A;  2REE A;  1F57 A;  5GCN A;  3UY5 A;  1XEB A;  3TT2 A;  2BUE A;  2EO8 A;  2I00 A;  2WPX A;  3PFO A;  1QST A;  3BXM A;  4E0A A;  4PQA A;  4OIW A;  4NCZ A;  4OC0 A;  2Z10 A;  1IGB A;  2PCU A;  1MK4 A;  1Z8T A;  2OOT A;  4P4J A;  1LAN A;  3PB9 X;  3VWD A;  4UEZ A;  3KGQ A;  2DEA A;  2V8H A;  4MHY A;  3S9L A;  2ZEH A;  3PEI A;  4M3S A;  4QC6 A;  2G3T A;  3KAS A;  2PJB A;  3D3S A;  1QSM A;  3R9F A;  2B58 A;  3SJG A;  5CPA A;  1YQE A;  1M1D A;  2ARH A;  3D7H A;  3D67 A;  4I49 A;  1S5K A;  4ZY2 A;  2IMO A;  3L2N A;  1IOI A;  3MGD A;  1XF8 A;  3FYN A;  1R57 A;  4YGO A;  4MI4 A;  2PRB A;  4UWI A;  3ISX A;  4KOT A;  4MFQ A;  3S9M A;  2ZOG A;  4KLV A;  1GYT A;  5H86 A;  1FY7 A;  2JBK A;  4NEX A;  4OC3 A;  4C7H A;  1MJ9 A;  2JDC A;  1OBR A;  2FCK A;  5EBV A;  1VIX A;  2P6F A;  4R9M A;  3V38 A;  1LFW A;  4JJX A;  4WJB A;  4DNC A;  2Q43 A;  5K8M A;  1MJB A;  4X8I A;  3VAT A;  1RTQ A;  3TC8 A;  4A2Z A;  3NE7 A;  1RO5 A;  2JLM A;  3H5Z A;  3K9T A;  1NMT A;  2PJ4 A;  4P6Y A;  4UF4 A;  1A2Z A;  3H8E A;  5DS0 A;  3OWC A;  1XE4 A;  3I1U A;  2HC9 A;  1KUY A;  3WC6 A;  3SJX A;  4B5P B;  2F5I A;  5J8C A;  3SJF A;  1YX0 A;  2PC1 A;  3C26 A;  3CPX A;  3NH5 A;  4H89 A;  4C7I A;  1TXR A;  5LRG A;  3SI0 A;  3F0A A;  1UFH A;  4ZY0 A;  4XPL A;  3PFE A;  4Y49 C;  4MCR A;  4HNX B;  4LX9 A;  2BL1 A;  2VI7 A;  4PXC A;  2PIY A;  3PBB A;  4KOS A;  2GFQ A;  2JDD A;  1VKC A;  4NGN A;  1AMP A;  1F2O A;  1X12 A;  2B4B A;  4BIN A;  3B3C A;  4CAF A;  4NGP A;  1HDU A;  3KR4 A;  4IK2 A;  3WC7 A;  4Y49 B;  2PQ8 A;  1CP7 A;  4YU9 A;  2Y0M A;  4HKF A;  4XPD C;  3W91 A;  4FD4 A;  3IFE A;  4NGM A;  5I0C A;  2JBJ A;  1YLO A;  4B6Z A;  4OLL A;  1YK3 A;  2WPW A;  3CXP A;  4O23 A;  3CT9 A;  3DNS A;  4NSQ A;  3RZA A;  4CGL A;  1LAP A;  4UEF A;  3FMC A;  4B5P A;  1ELM P;  2PSW A;  4R87 A;  2ANP A;  4X2T A;  4X3R A;  5HH1 A;  4AG9 A;  4IAV A;  2VQY A;  4NJR A;  4XPD B;  2NYQ A;  4NGT A;  3SXN A;  4CRY B;  4B13 A;  2HB6 A;  4QUS A;  3EXN A;  3VH9 A;  4OME A;  2AFM A;  2FIA A;  2XEI A;  1JQG A;  4JD6 A;  5ELY A;  2AFZ A;  2CNM A;  3S9N A;  4H6Z A;  4OAE A;  5G20 A;  5HMN A;  4EWT A;  1PUA A;  4F0X A;  8CPA A;  3FEC A;  4RN7 A;  1Z8L A;  4F8Z A;  1CP6 A;  3NH8 A;  4U9Y A;  4UIB A;  3CZX A;  4K30 A;  2PDO A;  2PJC A;  1YSJ A;  1DE4 C;  2OU2 A;  4ONU A;  4CYP A;  4DUK A;  1IID A;  3QNV A;  5IX3 A;  4X5K A;  5K8O A;  4H2K A;  2D4O A;  4P44 A;  2RC4 A;  4MHN A;  2PJ7 A;  3JRU A;  4CAE A;  2WZN A;  4EME A;  2PVW A;  3BI0 A;  4MXU A;  3FIX A;  1Q7L A;  1YR0 A;  2AJ6 A;  1XFO A;  4OKO A;  3I3G A;  5JH9 A;  2ZOF A;  2B4D B;  2PIZ A;  1CPS A;  5K8N A;  4C68 A;  2ZED A;  2V8G A;  2VXK A;  1ZO0 A;  4C2X A;  4KOX A;  3B3S A;  1P4N A;  1WK4 A;  2EVN A;  3PZJ A;  4P4B A;  3B3V A;  3S6G A;  4P4E A;  4OC4 A;  1YVK A;  3D66 A;  1Y0Y A;  3S6F A;  4UEE A;  4AVC A;  5A27 A;  2PE3 A;  2XEF A;  4CYQ A;  4CYN A;  2VZY A;  1CPX A;  3SI2 A;  5FVJ A;  2F7V A;  1S3Z A;  5CNP A;  3DLJ A;  2Z3K A;  1PCA A;  4AB7 A;  4BBH A;  3FED A;  3PBE A;  4A33 A;  1ARM A;  4LQ6 A;  2FL4 A;  1BO4 A;  2CNT A;  3CPA A;  4IHM A;  1CG2 A;  2ZEM A;  1I12 A;  3BHX A;  4OAD A;  3F5B A;  3R96 A;  1AYE A;  2ZEP A;  3BJ7 A;  4P4D A;  1Z5R A;  4PPZ A;  1BLL E;  4W9Y A;  1FNO A;  4CAW A;  4QVT A;  4CYO A;  1YME A;  4FD5 A;  1BPM A;  1IYL A;  2B4D A;  2C6P A;  2EK9 A;  1IU8 A;  3FXT A;  4YFJ A;  3BI1 A;  2D4P A;  2R1I A;  2GU2 A;  2NSM A;  2PJ6 A;  4IUS A;  1ZG9 A;  1IIC A;  3KHX A;  2IJZ A;  4YWY A;  1LRZ A;  3R95 A;  5H84 A;  3P2F A;  1TF8 A;  4KUA A;  3GY9 A;  2ATR A;  2R98 A;  4MFZ A;  5LRJ A;  3TOB A;  4MHD A;  4CPA A;  4FD7 A;  4OP4 A;  1K4J A;  3PRT A;  4UIA A;  2OR4 A;  4P4F A;  5J8F A;  4B10 A;  3TE4 A;  3D68 A;  2R7H A;  1JWQ A;  3W6S A;  5HXD A;  4AG7 A;  1F2P A;  2BCO A;  2PJ8 A;  1Y9K A;  3GLJ A;  4MMO A;  4ZYQ A;  4KOV A;  4R3K A;  3NA6 A;  1YRE A;  4ZBG A;  1YW6 A;  3KL9 A;  3MRU A;  4XNH C;  2Z3P A;  2JEW A;  2X7B A;  2AE6 A;  3B8G A;  2P0W A;  2EUI A;  1TF9 A;  1GHE A;  3B3W A;  3FVL A;  3GUX A;  3KKW A;  4UCN A;  4FWU A;  5I4M A;  3HLP A;  3H4Q A;  1TIQ A;  1YGH A;  2C6C A;  2OB0 A;  4MFP A;  2QYV A;  3PGP A;  4FBE A;  3DDD A;  2HV2 A;  3A9L A;  3IIB A;  4OID A;  2EWB A;  4MFL A;  2AFS A;  4JXR A;  4PK2 A;  3IO1 A;  5D29 A;  4XNH B;  2GLJ A;  3RNZ A;  3W6X A;  2ZEN A;  1YVO A;  3KI9 A;  2JEV A;  1KZF A;  2I3C A;  1ZG8 A;  4L89 A;  4AVB A;  4KVM E;  4KOR A;  3D7G A;  3HUV A;  5KTC A;  3RAM A;  3EO4 A;  4PXB A;  3RBU A;  4R8F A;  4NGQ A;  5D8N A;  1Q2D A;  5JGF A;  3SJE A;  3FJU A;  4R6T A;  2O4H A;  1J4J A;  2ZW6 A;  3LMS A;  3D2M A;  3ISZ A;  1IY7 A;  4MY3 A;  3IU1 A;  5THW A;  5K8P A;  1XJO A;  2QVP A;  4F6A A;  1MJA A;  2PJ3 A;  3NE8 A;  4MFK A;  3VAR A;  2ZW4 A;  4KVX A;  2PJ9 A;  3B7I A;  1Q2C A;  2A4N A;  2OZG A;  2YND A;  2PR1 A;  4F0Y A;  3KQZ A;  2YNC A;  3KQX A;  2GAN A;  3PB6 X;  4U9Z A;  1V0C A;  3DR8 A;  2Z3N A;  5DWN A;  4OC1 A;  5AGE A;  1S7K A;  3D4U A;  3TOA A;  5CBM A;  4LQG A;  4ZX8 A; 
#chains in the Genus database with same CATH homology
 4II9 A;  4H6U A;  1IYK A;  3TO7 A;  5C88 A;  3S6K A;  4ORF A;  4UFX A;  4CRZ B;  5E96 A;  2FSR A;  3JTK A;  4E8O A;  3S6H A;  4HNY B;  2OZU A;  5F46 A;  2QIR A;  2B3U A;  1Z4R A;  4R57 A;  4CAV A;  4CS0 B;  2VEZ A;  4C2Z A;  4Q38 A;  3R9E A;  3V8I A;  2ZPA A;  4NXY A;  2B5G A;  1M4D A;  1WWZ A;  3LOD A;  4QB9 A;  3IWE A;  1B6B A;  3CXQ A;  3QAH A;  1VHS A;  4M85 A;  4PSX A;  2IL4 A;  2VZZ A;  3BJ8 A;  2Z3O A;  3CXS A;  4A95 A;  3JVN A;  3GKR A;  3TCV A;  4EVY A;  2CNS A;  3BLN A;  5KTA A;  2WUU A;  4RS2 A;  2B3V A;  2YGW A;  3TO6 A;  4NF1 A;  1Z9U A;  2OZH A;  4L8A A;  5F47 A;  2Q04 A;  2Q4V A;  1XIX A;  2Z3L A;  2PR8 A;  3VWE A;  2QML A;  2Z0Z A;  3I9S A;  1YLE A;  1Z4E A;  3TFY A;  2J8M A;  3R1K A;  5IB0 A;  2HQY A;  1QSO A;  2DPT A;  3EFA A;  1S7L A;  3FBU A;  4BMH A;  3DSB A;  3G3S A;  4UWJ A;  4HNW B;  3IU2 A;  3EY5 A;  2Q7B A;  3ZJ0 A;  3SXO A;  4LUA A;  1S7F A;  3SHP A;  4J3G A;  4UBR A;  1PU9 A;  5A28 A;  4ZGY B;  2DPS A;  2YNC C;  1SQH A;  2VBQ A;  1B87 A;  4KSA A;  2Q4Y A;  4MJ8 A;  2FIW A;  1U6M A;  2P6E A;  5IV0 A;  4Q36 A;  1S60 A;  1CM0 A;  4KS9 A;  5AG4 A;  3EC4 A;  4UFW A;  5AG5 A;  3QB8 A;  1Y9W A;  4A30 A;  2H5M A;  2J8R A;  1Q2Y A;  3E0K A;  2P6G A;  4UCM A;  3ZZI A;  3PP9 A;  4B12 A;  4QBJ A;  5G1Z A;  1IB1 E;  1ON0 A;  4XPK A;  2DXQ A;  2WSA A;  2ZW5 A;  2O28 A;  4CGO A;  4B11 A;  4KUB A;  3FRM A;  4JXQ A;  4CGP A;  4MFJ A;  4R3L A;  2ZXV A;  5JPH A;  4JWP A;  5G21 A;  2BSW A;  4PK3 A;  2FXF A;  3TO9 A;  2Z3M A;  2FE7 A;  4GS4 A;  5F48 A;  3T90 A;  5DWM A;  4AVA A;  5ISV A;  2B5G B;  1I21 A;  1KUV A;  1XMT A;  5AG6 A;  1Y7R A;  2C27 A;  4C2Y A;  4PSW A;  3FNC A;  1S7N A;  3GYA A;  2BEI A;  2OH1 A;  3P2H A;  2REF A;  1QSN A;  4FD6 A;  1NE9 A;  4KSF A;  3IGR A;  1OZP A;  3DR6 A;  1P0H A;  2G3A A;  4E2A A;  2Z11 A;  4UA3 A;  3F8K A;  3T9Y A;  1M4G A;  3LD2 A;  3N7Z A;  2QEC A;  4CGM A;  4YRH A;  5G22 A;  3FB3 A;  4CGN A;  2HUZ A;  3RYO A;  1N71 A;  1NSL A;  2J8N A;  3R9G A;  1I1D A;  4KOU A;  3WR7 A;  4UFV A;  3TTH A;  2GIV A;  4KVO E;  4B5O A;  5C82 A;  3D8P A;  2CXA A;  5BWA B;  4KOW A;  2R8V A;  4MY0 A;  1BOB A;  4KZT A;  4RI1 A;  4IF5 A;  4MBU A;  3IWG A;  1L0C A;  1M44 A;  2NMT A;  4A32 A;  5KTD A;  2K5T A;  1QSR A;  2YNE A;  4B14 A;  5AG7 A;  4KOY A;  1RXT A;  1KUX A;  2GE3 A;  2FT0 A;  3G8W A;  5JQ4 A;  2Q44 A;  2FS5 A;  4PV6 A;  5F49 A;  4A31 A;  4KLW A;  2Q0Y A;  2I79 A;  2KCW A;  5EC4 A;  4CAX A;  1M4I A;  3D2P A;  1CJW A;  2G0B A;  2ZW7 A;  4U5Y A;  4JLY A;  4UCP A;  2CY2 A;  3K9U A;  3JUW A;  2REE A;  5GCN A;  3UY5 A;  1XEB A;  3TT2 A;  2BUE A;  2I00 A;  2WPX A;  1QST A;  4E0A A;  4NCZ A;  2Z10 A;  1MK4 A;  3VWD A;  4M3S A;  4QC6 A;  2G3T A;  3D3S A;  3R9F A;  1QSM A;  2B58 A;  1M1D A;  2ARH A;  4I49 A;  1S5K A;  3MGD A;  1XF8 A;  3FYN A;  1R57 A;  4YGO A;  4MI4 A;  2PRB A;  4UWI A;  4KOT A;  4MFQ A;  4KLV A;  5H86 A;  4C7H A;  1FY7 A;  4NEX A;  1MJ9 A;  2JDC A;  2FCK A;  5EBV A;  2P6F A;  4R9M A;  4JJX A;  4DNC A;  1MJB A;  4A2Z A;  3NE7 A;  1RO5 A;  2JLM A;  3H5Z A;  1NMT A;  3OWC A;  1XE4 A;  1KUY A;  4B5P B;  2F5I A;  5J8C A;  4C7I A;  1YX0 A;  2PC1 A;  3C26 A;  4H89 A;  3F0A A;  1UFH A;  4XPL A;  4Y49 C;  4HNX B;  4LX9 A;  2BL1 A;  2VI7 A;  4KOS A;  2JDD A;  1VKC A;  2B4B A;  4CAF A;  4Y49 B;  2PQ8 A;  2Y0M A;  4HKF A;  4XPD C;  3W91 A;  4FD4 A;  5I0C A;  4OLL A;  1YK3 A;  2WPW A;  3CXP A;  3DNS A;  4NSQ A;  4CGL A;  4B5P A;  2PSW A;  4R87 A;  5HH1 A;  4AG9 A;  2VQY A;  4XPD B;  3SXN A;  4CRY B;  4B13 A;  4QUS A;  3EXN A;  2FIA A;  4JD6 A;  2CNM A;  4H6Z A;  4OAE A;  5G20 A;  5HMN A;  1PUA A;  4F0X A;  4U9Y A;  4K30 A;  2PDO A;  2OU2 A;  4CYP A;  4ONU A;  1IID A;  5IX3 A;  4X5K A;  2D4O A;  2RC4 A;  4CAE A;  3FIX A;  1YR0 A;  2AJ6 A;  3I3G A;  2B4D B;  4C68 A;  2VXK A;  1ZO0 A;  4C2X A;  4KOX A;  1P4N A;  1WK4 A;  2EVN A;  3PZJ A;  3S6G A;  1YVK A;  3S6F A;  4AVC A;  5A27 A;  4CYQ A;  4CYN A;  2VZY A;  5FVJ A;  1S3Z A;  5CNP A;  2Z3K A;  4AB7 A;  4BBH A;  4A33 A;  2FL4 A;  1BO4 A;  2CNT A;  3R96 A;  1I12 A;  4OAD A;  3F5B A;  3BJ7 A;  4CAW A;  4QVT A;  4CYO A;  4FD5 A;  1IYL A;  2B4D A;  3FXT A;  4YFJ A;  2D4P A;  2R1I A;  4IUS A;  1IIC A;  1LRZ A;  3R95 A;  5H84 A;  3P2F A;  4KUA A;  3GY9 A;  2ATR A;  2R98 A;  4MFZ A;  3TOB A;  4MHD A;  4FD7 A;  1K4J A;  4B10 A;  3TE4 A;  2R7H A;  3W6S A;  4AG7 A;  1Y9K A;  4KOV A;  4R3K A;  1YRE A;  4ZBG A;  4XNH C;  2Z3P A;  2X7B A;  2AE6 A;  3B8G A;  2P0W A;  2EUI A;  1GHE A;  3KKW A;  4UCN A;  3H4Q A;  1TIQ A;  1YGH A;  2OB0 A;  4MFP A;  3PGP A;  3DDD A;  2HV2 A;  3A9L A;  4MFL A;  4JXR A;  4PK2 A;  4XNH B;  3W6X A;  1YVO A;  2JEV A;  1KZF A;  4L89 A;  4AVB A;  4KVM E;  4KOR A;  5KTC A;  3EO4 A;  1Q2D A;  1J4J A;  2ZW6 A;  3D2M A;  4MY3 A;  3IU1 A;  4F6A A;  1MJA A;  4MFK A;  2ZW4 A;  4KVX A;  1Q2C A;  2A4N A;  2OZG A;  2YND A;  2PR1 A;  4F0Y A;  2YNC A;  2GAN A;  4U9Z A;  1V0C A;  3DR8 A;  2Z3N A;  5DWN A;  5AGE A;  3TOA A;  1S7K A;  5J8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...