2VCHA

Characterization and engineering of the bifunctional n- and o- glucosyltransferase involved in xenobiotic metabolism in plants
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
471
structure length
462
Chain Sequence
TPHVAIIPSPGMGHLIPLVEFAKRLVHLHGLTVTFVIAGEGPPSAQRTVLDLPSSISSVFLPPVDLTDLSSSTRIESRISLTVTRSNPELRKVFDSFVEGGRLPTALVVDLFGTDAFDVAVEFHVPPYIFYPTTANVLSFFLHLPKLDETVSCEFRELTEPLMLPGCVPVAGKDFLDPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFELEPNAIKALQEPGLDKPPVYPVGPLVNIGKQEASECLKWLDNQPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRSPSGIANSSYFDSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKKELEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROQUINONE GLUCOSYLTRANSFERASE
publication title Characterization and Engineering of the Bifunctional N- and O-Glucosyltransferase Involved in Xenobiotic Metabolism in Plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 163
structure length 462
sequence length 471
ec nomenclature ec 2.4.1.218: Hydroquinone glucosyltransferase.
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vchA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vchA02
2XMPA 2GJ4A 2WTXA 1NOIA 2IV7A 1L5RA 2GT1A 3BD7A 3SYMA 2BISA 3TAXA 1P4HA 3VDNB 3ZCRA 1L5WA 3T5TA 4N9WA 2VCHA 4NEQA 1XV5A 4BQEA 1XL0A 3QHPA 4XI9A 3NP9A 5TMBA 1JEJA 4N3BA 4EKYA 2ACWA 3MT8A 4CTOA 1RZUA 1WUTA 4FKZA 4PQGA 2AZDA 2X6QA 1Z62A 1BX3A 2PQ6A 1JIUA 2QN7A 2IEIA 3DD1A 4HLNA 1XKXA 3OKAA 3CEMA 4G2TA 1Z8DA 2G9RA 2GEKA 2QRGA 3GUHA 1Y6GA 1P4JA 4GZ6A 3L7CA 3DZCA 2R68A 1P29A 1Z6PA 2IYFA 2QLLA 2QN1A 3FROA 3UYKA 2JJMA 3NAZA 2Q6VA 3MRTA 2FF5A 1AXRA 3ZCVA 3Q3IA 2QNBA 6GPBA 2JLBA 3ZCPA 4REMA 1V4VA 1EM6A 3G2JA 2ATIA 2G9VA 3BEOA 3T3EA 3PE3A 5JTTA 1NOJA 1XC7A 3G2HA 2JZCA 3VUEA 1ABBA 4EKEA 5D00A 3CUTA 3G2LA 3T3DA 3NPAA 1WV0A 3L7AA 3MRVA 1P4GA 5I45A 3D0RA 3MTBA 2BGTA 4GYYA 1C50A 3NB0A 3C4QA 3T3HA 2ASVA 1LWNA 3ZCSA 1PSWA 2PRIA 1H5UA 1VGVA 2KS6A 3UYLA 2F3PA 4M60A 2ECPA 2X6RA 1FTQA 4BQIA 4AMBA 4QLBA 2PRJA 2AW3A 3OTIA 5TVGA 2O6LA 4AMGA 3ZCTA 2FFRA 3NP7A 8GPBA 3CUWA 3MBOA 2QRQA 4BFCA 3BD6A 1FU8A 5IKOA 2XGMA 3QKWA 4F9FA 2AV6A 4M7PA 1SXQA 2F9FA 3CEHA 4RIGA 1IXYA 2QN8A 4Z5XA 3C48A 4WHMA 2QN3A 2GEJA 3WADA 2QN9A 3ZCUA 4MHSA 1FTWA 3S27A 2ZB2A 3MS4A 1L5QA 2XA9A 2BGUA 1NLMA 2C1ZA 4NESA 1NZFA 2FETA 1RZVA 5BNWA 3S28A 1F0KA 4WADA 2QZSA 3SYRA 1SXPA 4EJ2A 4RELA 1E4OA 4KQ1A 1NOKA 2R4TA 2HY7A 3MS7A 4F96A 1FS4A 4MI6A 1JIXA 2AMVA 2QN2A 4GPBA 2SKDA 3EBPA 4CTMA 1KTIA 1K06A 4CTNA 1Y8ZA 1NZDA 1Y6FA 3G2IA 4XIFA 4CDRA 4RIEA 5D01A 1WW3A 3CUYA 5DXFA 1L7XA 3O3CA 1UZUA 7GPBA 2IEGA 4L22A 3OTHA 2QLNA 2R4UA 3Q3EA 3WC4A 2GPBA 3RSCA 5C1DA 1RRVA 2YJNA 3MQFA 1J39A 1B4DA 2XGSA 1UQUA 3MRXA 3MSCA 1QKJA 2ACVA 2QRMA 3S2UA 4GZ3A 3T3GA 4GZ5A 3Q3HA 4YI5A 2F3QA 2X0FA 4EL5A 3G2KA 3EBOA 3S0JA 1GPYA 4AN4A 4LDPA 5DLDA 4RENA 2H1FA 4X7MA 3D1JA 3CUUA 1C8KA 2IUYA 4MICA 1PYGA 1FU4A 3OKCA 1EXVA 1NVKA 4X7RA 2P6PA 3HBFA 2GPNA 3TOVA 3IAAA 3RSZA 1FA9A 3OTGA 2X0EA 4W6QA 2G9UA 1P2BA 2VCEA 4YI3A 1QM5A 2QLMA 4AY5A 2XGOA 3OKPA 1JG7A 3DDSA 4RIIA 1Z6QA 3NC4A 1C8LA 3H4IA 3OT5A 5GPBA 2SKEA 4GYWA 3MT9A 1WW2A 3MTAA 1GGNA 1E1YA 3TSAA 2BFWA 4X7PA 4RIFA 5JTUA 1P2GA 3IA7A 3AMVA 1YA6A 5LQDA 2VSNA 3E3OA 4EL0A 3HBMA 3T3IA 4N3AA 4RBNA 2IYAA 5TMEA 1M5RA 3NCHA 1L6IA 3E3LA 2IV3A 3G2NA 3BCUA 4KQ2A 3VDMA 4N3CA 4NC9A 3PE4A 1UQTA 2F3SA 3COPA 2SKCA 4WACA 2QRHA 4BQFA 2XCIA 2R60A 1WUYA 1WV1A 4F97A 3CV3A 1GZ5A 2OFFA 2VSYA 3HBJA 3L7DA 2R66A 1GFZA 4MI9A 3MTDA 4RIHA 2G9QA 1L5VA 3BCSA 3D0QA 3C4VA 1AHPA 2VG8A 1K08A 4KQMA 3L01A 1F6DA 2QRPA 3BD8A 1L5SA 2IW1A 1JIVA 3T7DA 3RT1A 2C4MA 1A8IA 1XOIA 3E3NA 3L79A 4LEIA 4YUAA 1YGPA 1PNVA 5DU2A 1C3JA 4N39A 3S29A 4HWGA 5HXAA 3RHZA 4X6LA 4FZRA 3WAGA 3DDWA 3CUVA 3H4TA 3BDAA 3VUFA 2XA1A 1XL1A 3MS2A 4MI3A 3OY7A 1O6CA 1FTYA 2GPAA 9GPBA 1GG8A 4MHOA 4MRAA 1P2DA 1FU7A 5IKPA 2C9ZA 2F3UA 1PN3A 2GM9A 5ENZA 3HBNA 2H1HA 1GPBA 3MT7A 3L7BA 5TMDA 1FC0A 2X0DA 1IIRA 4AY6A 3GPBA 3OY2A 4M83A 3ZCQA 3CX4A 2PYIA 2XA2A 2XCUA 1GPAA 3CEJA 2PYDA 1JG6A 3BCRA 1LWOA 2C1XA 1HLFA
chains in the Genus database with same CATH superfamily
5CURA 3BXZA 2D1SA 3R7LA 4GM1A 4DLZA 3HJTA 4M6WA 4WOBA 4PFJA 3BEDA 1Y1TA 1ENYA 3EPRA 2C42A 3K1ZA 5ED0A 4KMOA 4RKEA 1A8UA 1LBSA 4KE9A 4NZMA 1MRZA 4DJTA 1E2PA 3PXGA 2RHGB 1D7OA 1MA0A 4ENWA 2PRYA 2F7SA 4YBRA 1BWRA 2VDOB 4Y9DA 4A4DA 4YDHB 5DM4A 3KU4A 5JJ5A 1TEXA 4G84A 4NEQA 4MW4A 4MQ5A 4GYKA 3HXMA 4MUIA 3C1AA 1P4SA 1FFXA 4MDHA 3THYA 1AF4A 2IH4A 1P9WA 2QS9A 5HG0A 1EQUA 2I34A 3GELA 3HJFA 3S1AB 1AQNA 3LF2A 4CTOA 2BMVA 2R6FA 4MS3A 1G8YA 3I6MA 4NU8X 4AG5A 2BM8A 4G09A 4TKZA 5JCOA 2GD1O 1S2OA 4LJ7A 4JL5A 3VMFA 3UJNA 2AZTA 2GJKA 1V1RA 2BM0A 2O48X 3C3YA 3EVCA 3AP2A 1EHYA 2OY0A 3B12A 1I1HA 1EA5A 3KR2A 2Y1LA 4CCSA 1GGJA 2BTQA 4NYMQ 2DBQA 4UVIA 2GAJA 3C98A 3ANMA 3FPAA 3RIGA 3JQFA 3PC2A 4JQZA 4D1YA 2V55B 3UGTA 3GCDA 2YICA 1A5ZA 4N5MA 1NMZA 5FUVA 4Y67A 3S5UA 1OH6A 1K5GA 2I4TA 4JP8A 4MUFA 1M7HA 1VHLA 4OI4A 1Z07A 1E0JA 4PZ0A 4QBHA 1DQRA 3FPGA 4UJ5A 1IG0A 4EKNB 5LIPA 1OX5A 3FF1A 1CEXA 1RLJA 1T15A 3U19A 1E2KA 3VFDA 4BWGA 1QO9A 2NXCA 4K03A 3AYXB 2XVAA 3IJ5A 2RAFA 1TA4A 4OATA 4P5DA 4WXYB 4G9GA 2I7VA 3HUFA 4FYVA 3GLGE 1PQUA 3EGDB 4IDCA 5A03A 3B3GA 1CEQA 4JCOA 5BSWA 1C9KA 4O4IF 1JDPA 1JN0A 1GSIA 2KQUA 3BKXA 1YRBA 1JVSA 2AOWA 3FGOA 1O54A 2X76A 4NICA 1S3IA 4A8TA 5HRUA 1YONA 2F55A 1IWOA 3AJ8A 1I9GA 5K0TA 2CXXA 3O1IC 1I7DA 3R20A 3KQMA 5KHOC 1P0FA 1NG1A 2XITA 1ISSA 4D92A 1C3OB 1J5PA 1CCWA 3KXLA 3FYHA 1OXXK 4UFPA 5D5PA 2NO5A 4FSHA 1Y8RA 3WNQA 2ZSIA 4P83A 3S99A 3UPTA 3SZOA 2RJNA 4XDZA 1N9KA 4KAAA 1BRMA 4HOYA 5F1PA 4KMMA 4EHNA 4EFDA 2BHSA 4KMSA 2SCUB 4PFSA 3L77A 1ZESA 4K6GA 2JLWA 1KZ1A 4GDMA 4BNIA 1WV0A 3QU4A 2YL2A 4JLMA 3VPAA 2FX3A 1O5OA 4LXYA 3D0RA 2P3OA 3QEJA 2H1OA 3RU3A 3HJNA 1QRRA 2R8EA 1BH6A 1G7TA 2VVTA 1FYFA 4WBNB 1FUEA 4C7OB 4C20A 1D9ZA 2ETXA 3ZCSA 2P9TA 5C1PA 3IPLA 1Y1QA 1XTPA 2FFBA 4P3OA 1TQ8A 1GNTA 3W2GA 4JXXA 1A3CA 1TTQB 1YHYA 1AO3A 2G6BA 4JLKA 4P4SA 4BKOA 2OPBA 2PKYX 4F4DA 2D6FA 4XWWA 2REBA 2P9FA 4M1OA 2YS7A 5IC6A 3D2LA 3INRA 1MABA 1PWXA 3OCJA 4JC4A 2GH1A 3ICEA 4IDHA 1P73A 2XNCA 3MWJA 3ECSA 1Q0HA 2ZRNA 3LY5A 1DCMA 3SZRA 1PWZA 3RLIA 4RY2A 3ZVNA 4F6LA 3GFRA 1IG3A 4AMGA 2OZLA 2ODBA 3EH2A 1O0SA 2YXEA 3H5AA 4ZGGA 4D56A 3HQ4O 5A6SB 3A14A 1G8GA 4BQSA 4ZAZA 3GBPA 1U2GA 2JCGA 4P80A 2JD0A 5TJHA 4COOA 4ARBA 1E7QA 1J8MF 1CUIA 4JUBA 1A9ZA 3DAOA 5E6RA 5JD5A 3LDUA 1H69A 1YB4A 3BD6A 1TQ2A 2CL0X 4MUHA 4RK0A 4DJ5X 5C1OA 5CCDA 3S68A 2CV2A 1MJNA 3T4UA 3W5CA 3H0EA 2FP4A 2UVPB 5D3KA 2QX9A 5LIRA 2WF7A 3V7UA 1DXQA 2QZZA 4CI9A 1UMKA 5LD2C 2CHEA 4EY3A 3WDSA 4F1JA 5E9AA 2C59A 4HQ6A 3GOQA 4EYSA 3LVQE 1FY2A 3JRWA 3G0CA 3EEBA 2NZVG 1HL3A 1H66A 1XRLA 3KR1A 2GAIA 3M34A 4MW9A 1OH7A 5JROA 4DV5B 1M66A 2HEGA 4JLBA 1XTKA 4Q82A 5IM5A 2HHHB 1ODTC 2OXEA 1E6MA 2HXSA 5DYIA 5BRNA 3ZHQA 5TQ0A 4JBLA 4PINA 2QMEA 4NRDA 1XYGA 3QHAA 3DEAA 4JZKA 2PSFA 3MAJA 4X64B 1TEZA 3WL6A 1O6BA 3FAKA 4C7JA 4TMKA 1G8FA 1G8AA 1GZVA 2G83A 4JVMA 2B1RA 1Z56C 3RJZA 1AMNA 1OHHA 1P81A 5JD4A 1L1RA 4MI1A 4CIBA 3TLEA 1A27A 1SIUA 3GJ6A 2RGUA 4DRXB 9ATCA 1J9ZA 1MPTA 5FCDA 3UTDA 2X42A 3S28A 1KY5A 1G8KA 3WLAA 3RAEC 4QPDA 3TMYA 3O26A 1Y3HA 3QFTA 3SYRA 2PMFA 1P7VA 3PDIB 4J7AA 3FOAA 4KFSA 4LWZA 4B87A 1CJSA 2C4VA 3AO0B 4PYMA 2GZMA 2R4TA 3AQIA 4TRMA 4XYMA 1ML3A 3KD3A 5FQNA 4I1IA 4B3DA 3O0TA 1YHZA 4U2BA 1CTQA 1G8JA 2FTKE 4CN9A 4M1MA 1LY1A 1YBHA 2C07A 5L7WA 3L1JA 1HM5A 1R0WA 2O0JA 2X4LA 2FZWA 1LZKA 2WUFA 3VDRA 4RDXA 2BC9A 1Z9BA 4IV0A 4YAEA 2BFFB 1MJ5A 1VMEA 4TMZA 5IVHA 3QEKA 4DZZA 3DT8A 1CWUA 3G5TA 2QG9A 3I45A 1GV1A 1OT3A 1XZ8A 1WLSA 4UU1A 1LK0A 4BQNA 5C32A 4X1YA 2JCVA 3LW7A 1XTVA 3GLIA 2O2DA 2PWZA 4TT3D 1H6AA 4LOAA 3UMGA 5H7XA 3THOA 1NFFA 1UKBA 2AE1A 1H3EA 1A82A 1RMYA 3EAQA 3TR5A 3ENQA 1STOA 4QUIA 1M0EA 4DR7B 3QTTA 3UJPA 4XUGB 2CUZA 2OQIA 2RJOA 1P6UA 1JH8A 3LYAA 4DV1B 5ESWA 3ZVMA 4QX6A 2W22A 2IYNA 2JDID 1XEXB 3AV3A 1SXGA 3ITEA 4E5SA 3HU2A 3PE6A 3KX2A 4PLYA 2H18A 4BQPA 4BN5A 2C7RA 5JZVA 1EVIA 3G82C 1CY4A 2FOLA 5IM4F 4JUDX 5KQSA 2QX6A 4WASA 5K7SA 5JMWA 4XQ0A 3SMVA 2CW5A 2PUJA 1N2EA 4IZOA 1PNRA 4Z86A 1C3VA 2ZJBA 4HH3C 3V7WA 2BW0A 1ZVVA 3EHEA 1XZQA 1ZVQA 5BSTA 2ZZKA 3MSCA 4TTRA 3BE6A 3U4DA 3GN2A 2QV7A 4IQ8A 2XMCA 3GYBA 4YREA 1E2DA 1FDIA 2ZI7A 2OGTA 4KIGA 5DWVA 4YIHA 1DX6A 3EAGA 3TZLA 4BO8A 1L7QA 1E2HA 3FDFA 5ERGB 4N0MA 1MB3A 3INTA 1GWNA 1FSSA 4GXNA 4MW2A 3PEYA 2A0WA 1NM5A 2C8JA 1HE3A 4Y6LA 2KM1A 1KMQA 3ZHZA 2BEUB 4B6RA 1MAHA 3WHLA 1JJAA 4U7WA 1IJEA 1JYFA 3VPXA 2WWXA 3PZRA 3GQVA 2P11A 4F4UA 3LUKA 1M6EX 1H6DA 4ALMA 4D9KA 2ZM6B 3S1AA 2D7CA 3ZVKA 5A5EA 3AR6A 2BM9A 3T41A 2A9PA 2CVFA 1YA4A 2IF2A 3E5RA 1QR6A 4C4XA 4ADSG 5JXHA 1Q44A 1N2CE 1Y6ZA 2ZT5A 3BC1A 2QTWB 3K2BA 4W1PA 1SVKA 1IBKB 2DQSA 1E7MA 1IZZA 2DT5A 4Q02A 3V8RA 3KVVA 3VI3B 5K0SA 3PT5A 2J6BA 3AF1A 4P33A 4X7RA 1CNFA 3AX6A 3M4NA 4C9BA 4J4BA 2YRFA 1UF9A 3N8KA 5K3OA 1ACJA 2W8BA 5C4IA 1D09A 2IZ1A 2A94A 3IAAA 4DCUA 5L3SB 5KKNB 2I78A 3P0RA 1YJ8A 3DR3A 3ESQA 3WKEA 3PGVA 2HCRA 1VBKA 2D0OB 3NBAA 2I55A 4V2IA 3UNXA 4LYAA 2UYYA 1T4CA 2XGOA 5DCYA 1RBYA 1CR0A 3KLMX 4R7ZA 4XPZA 1JHRA 4D8UA 1UBKS 1ENZA 1Y82A 1LBIA 1SXJE 1X14A 1RWVA 1UKCA 1JFFA 1LTQA 2ZRPA 1VYHA 3KEOA 4E5YA 1AQ6A 2R48A 5F7OA 5IAAA 5KNCH 2EYUA 2A0FA 2RHTA 3H87A 4P86A 3ZWCA 4I5FA 2ZDHA 4UDXX 5FB3A 4ZDKA 4QGBA 1JV2B 3BKWA 5EZSA 5KYGA 5DBOA 2D1YA 4UREA 3IAXA 1G4HA 1U2RA 2B30A 1B3BA 1E98A 3WK7A 1SQ5A 3I05A 3LK7A 1X2EA 4RIFA 5AW8A 2JHCA 1G21E 3N5CA 2QRKA 1K4MA 1UK7A 4CM4A 1ECCA 3C3BA 1ARZA 3E3OA 3BTOA 1IVNA 3EY4A 3R5TA 4A23A 2K5UA 3ZHCA 1AS2A 2O59A 3RSGA 1RWWA 1HYGA 4L72A 4ZODA 2W5UA 5BSMA 1ULAA 3ZQUA 1SD2A 1FX0B 2SCUA 3KK0A 3Q3VA 2P2CA 5I9MA 3AEXA 1G55A 3M5WA 4CKCB 1U1GA 3I6BA 3F1KA 4JP3A 4KLAA 2Q46A 3CCFA 4B6QA 1CJCA 1BO6A 2JK0A 3ZW7A 4HXYA 3K73O 1VIVA 3IOEA 5FHRA 5FPTA 2RKBA 1OVGA 3O7WA 5I8ZA 1F12A 2QT0A 1Q6ZA 4PVDA 1WW8A 3I5MA 2ECQA 2G80A 1YR7A 1PZFA 5D84A 3DFFA 1BYUA 1OFTA 4FXPA 4LA4A 4WN9A 1PLLA 4XD2A 1JP7A 2XWJI 2DYKA 3GG9A 5AOAA 5C5CA 5LWQA 4ALIA 1ADGA 4RULA 2QRHA 1NQOA 3KUUA 3OZFA 3V8EA 3R5HA 2GDZA 1Q20A 2CLEB 5MN5A 1L7RA 1Q14A 1S4MA 2M6LA 2PZMA 3SCZA 3R9XB 3CUSA 2ZE5A 1R7RA 1SA0B 2HJVA 1IBSA 1W52X 2F59A 3O93A 1DOHA 4MARA 4AP6A 5LUAA 4NCHA 2VOEA 1OROA 2NVBA 4MP3A 2QD4A 4WGGA 1ESNA 2FX5A 4V02A 4CKZA 2O1EA 2DCMA 1TZMA 4KRFA 2W0MA 3TTYA 1GNPA 1UBGA 3HVUA 3PQ7A 2EC5A 4RJKA 1AHPA 1BWPA 3D3WA 1OWPA 3OEYA 3C0KA 4QUKA 2G1AA 3C6QA 3E7DA 5TIIA 1J70A 2VQFB 3IDAA 1F6WA 1QOQB 1J2YA 2J30A 3DB2A 3M8KA 2RGBA 4JITA 4NZOA 3A2KA 2YIDA 2VK8A 2KBEA 3JQCA 4YACA 4CLOB 2X3UA 2WAYA 5FBVB 4IIXA 1OYYA 4BJ3A 3KKNA 4X6XA 3ZWWA 3WA6A 4YV7A 3ORQA 4D82A 1RXVA 4JEUA 2HWKA 2LKDA 3IEIA 4YUAA 5B1SA 1PNVA 5PNTA 2H6EA 3NDIA 5DU2A 5IVDA 5IDXA 4DR3B 1H0RA 2B1IA 2R1VA 3U7QB 1ZVMA 2ZIUB 3MMNA 4RK7A 3OD1A 1XNGA 1I7QB 2QY6A 2ZTVA 1U94A 4N39A 3ZIAA 3G9XA 2YDXA 4DBVO 5CCEA 2PV0A 1FQWA 4KN9S 1T4GA 1UOQA 4CV1A 2JEOA 5HKAA 5BV8A 4YCDA 1OHHD 3U2QA 3LXUX 3SZUA 3IEMA 2PS3A 1QONA 4JT9A 1U8EA 1CDZA 3VU1A 1T8SA 4CFSA 3I1YA 1SQSA 3GROA 2C2XA 1HTBA 4A8HA 3AIKA 4BASA 5IC5A 2B94A 1CJKC 4HAYA 4TOIA 4Q4JB 3UY4A 4WFKA 4CM9D 4OQMA 1Q2XA 4AL4A 4ON9A 1PHPA 4R68A 4BKRA 4YRZA 5KDOA 4E31A 2GM9A 4IWYA 3NBYC 1E92A 4G0XA 4K28A 1WZCA 1SXJC 3U5ZB 3GMTA 4MITA 1XALA 4UZFA 4XASA 5TXGA 3SF8A 3MQ4A 4EG3A 1VIYA 3PGLA 1LKZA 1W5TA 4RMIA 1UPAA 5BUCA 2PGJA 4FCCA 4N5LA 1OX4B 2CL5A 2FPXA 2FQWA 2R8PA 3FSEA 4HUJA 1PYOA 3FETA 4EUKA 1JIJA 4BGIA 4BVHA 4IP0A 5AM5A 3RUPA 5FLXA 1N4DA 2YQ5A 4CTJA 1Z6TA 1KK1A 3RK1A 3R9WA 1AUQA 3T5GA 4Q12A 3RUIA 3GEBA 3BG5A 4I5DA 4QVKA 5EOVA 2QTFA 4BNXA 1T0HB 3GO4A 3LY9A 5BMVF 3NHBA 3R77A 1RE1A 5H70A 3FIUA 4MVJD 5EE1A 3PI6A 2JANA 1T24A 2WQ6A 5E4JA 2NX2A 4YALA 4GG1A 2PUTA 3HNRA 5LZ2A 5COAA 2RBEA 3LUHA 5TR9A 4D80A 5CB4B 3ZZ0A 3O8QB 2J41A 2O50A 3DOJA 3EXEB 1GKIA 1P0CA 4LYYA 5BSRA 5KWEA 4BP8A 4PG6A 2XNDA 3G2PA 3CNQS 4IH4A 2VRNA 4FR5A 4J16C 4O4LA 4BO9A 3A37A 2YYYA 2H2WA 1XKTA 2OFOA 4JU9A 3KBOA 4N54A 1YS1X 2N1MA 2ZAYA 4MA0A 4XA8A 3BHJA 4TL8A 3E1SA 2I6SA 4Y18A 4AXXA 4C0WA 4TRRA 1CU1A 3ESBA 1WR8A 2PIAA 4JUAA 5AKHA 2N46A 4R4JA 2CXNA 2Y67A 4JQYA 1RXYA 1YBAA 1NF9A 2PU7A 9MHTA 4JHXA 1ZCZA 5HZMA 3O92A 3VKFA 4ZXPA 2A1TS 1P4JA 3ROMA 1GPH1 1Q7EA 5DM1A 2OXRA 4ATNA 3BERA 2J3JA 5EP4A 4LNAA 1J90A 3QNUA 3E58A 4BJ5A 3PFHA 4HNSA 2ZM5A 2CDCA 3NR2A 3X0DA 1WXQA 3OG9A 3GFQA 1CRWG 1T2EA 3QLJA 1OKKA 3VH3A 4F06A 3WMFA 8ABPA 3L04A 3EF3A 2PUHA 4ZGBA 3R41A 1MT0A 3DZFA 4MS1A 3RBXA 2GZRA 2D0IA 2PZJA 5FA8A 3QPUA 3FYUB 2GARA 2WQZA 4QHYA 3EIQA 4WZBE 2FFJA 3RKSA 4GOMD 4QREA 3EQ8A 3LLUA 1KI6B 3M3DA 1MTZA 4Q1BA 5EI5A 1ZK3A 4NE9A 1RZ3A 3A6ZA 4KAFA 4DW8A 1YJCA 2ZB3A 1F7UA 1RHUA 4NCIA 4DBZA 2Q4BA 4PBRA 1LK7A 5BNFA 3KS9A 1LPOA 3KU1A 3ORFA 4RGYA 3PE3A 2JARA 1XQ9A 3GLUA 4BEJA 4YMVA 5EE0A 1MEJA 1Z33A 1IL0A 2ZJ4A 4TWJA 1OLUA 4CRWB 3KETA 3RS3A 2WHPB 2BH2A 3GAMA 5JZOA 3I5YA 5T4BA 1WAMA 2E4UA 1B76A 1P18A 3TKYA 4G23A 4KL8S 4BLVA 1PV2A 1UWVA 3HU3A 3KTAA 4OUDB 3TVDA 5KJCA 1GUBA 4R2WA 4TV9F 5DYYA 1VJGA 1KY4A 1Z8NA 2AJDA 3NOVA 4RVCA 1DDOA 5CLIA 5ILGA 3SSNA 5DT2A 3ZX5A 2W9XA 3N2LA 2WG0A 3VO2A 4AIRA 4WOKA 1QBKC 3RIXA 2ASVA 2JCXA 5ALMA 2RI0A 3D2CA 3H5NA 4G24A 3QH4A 1TKRA 3TLGB 1Y9AA 1T3TA 7MDHA 4K88A 4WD3A 4WUVA 1W5BA 2OLKA 1QYRA 1ULZA 3U3RA 1Z74A 2DRIA 3A9TA 1AE1A 5LBUA 1VG1A 4GPZA 5AD1A 4IWNA 4US0R 2DPMA 1ZGJA 3CRW1 4J49A 2J4DA 4KGZA 3R3SA 3KD2A 2HU7A 3I5UA 3PR1A 4WY2A 2AF4C 2I4IA 3F7OA 3KWLA 4YGYA 3SZLA 5JAMA 4LK2A 1TCBA 4TLDA 5TSDA 3FPKA 2D54A 4X54A 1E3LA 1U0TA 2ADFA 4HP8A 3HKDB 5EIWA 4EEZA 4JI0B 1KXZA 4CQLB 1Q0PA 4AMYA 1QOPB 1VXRA 3FWNA 3IJRA 2YH2A 3IPCA 3CNBA 3PFNA 4M1TA 4ND6A 1XO1A 5DNWA 4H7DA 5LDGA 1UJ4A 2LR0A 4YPVA 4A3SA 3M6UA 5IKOA 3HCWA 1WB4A 4INOA 3RYHB 4LJ4A 1Z4MA 3W5SA 2PL5A 1IOZA 3MCTA 1WVIA 5K3BA 3ZWKA 5EJ5A 4I1PA 2H4ZA 1ZRMA 2JKYA 2NN3C 3FMOB 3MAAC 1PR0A 1T0BA 3EEOA 1TIPA 3U7EB 5DASA 4RIGA 4BYGA 1G6HA 2ZIEA 2JH9A 3WWZA 3GUVA 1Q7BA 3GVHA 1Z7BA 1Q3TA 3LCJA 4QPZA 1KH1A 1QIFA 1WCWA 4EQ6A 4WHMA 1A5SB 1DKRA 1HR0B 1CW2B 1KMHB 1TYEB 1JDBB 3FHLA 4Y6SA 3UH0A 3AEYA 2QKYA 3SQDA 4HQOA 1IATA 3H7IA 4X8LA 5EHQA 1RFLA 4G26A 3W1WA 1AUPA 1KJ9A 3PL1A 2XA9A 4QUHA 1L1EA 5CT6A 5C2JB 1BFKA 3AQ4A 1TL7C 2AG6A 3KZCA 1B6RA 4TPKA 1NPDA 1E4YA 4JAVC 1A4RA 2XUHA 3NFRA 3SG0A 2B25A 4LY0A 4R3NA 2CLSA 2C1ZA 1JS1X 1W1IA 2X9NA 3B3JA 3EG5A 3GZTB 3LYLA 4XJSA 2VJLA 5L7YA 3ZEAA 3ZIAD 1Z2CA 1U2QA 1Y8AA 3ECAA 2VZ8A 1SURA 4FZJA 5IJAA 2Z0MA 2VJPA 3T61A 2AA3A 5ECGC 2K4MA 4ZYLA 2QQ0A 1AJEA 1JW9B 1CVRA 1TJ5A 3F5DA 3IDOA 4MTLA 3LT1A 3CIFA 3SI7A 2IXTA 4MV3A 1J24A 1V39A 3N2YA 4KQ1A 1FLVA 3SXJA 5DM2A 4Y2HA 5SY6A 4Q37A 5KKCA 4WZAE 5BO5A 2J0VA 2EXXA 1VM6A 5EEHA 4H1WA 1KJIA 3PB3A 4BNLA 1ZAYA 3R8CA 1DRUA 3UV3A 1SK9A 2GK3A 1DLJA 2FVYA 1JA1A 2DLNA 2NO1A 2WUEA 4UUPA 3LQQA 3RRMA 3SJCA 5K6RA 5K8CA 1MHTA 1E1RA 3AV0B 2AJBA 2QW1A 1F0PA 3VPDA 3EC2A 3HV0A 3HYTA 4XIFA 3W90A 4RSHA 3ZBQA 4N41A 1G7CA 1RMQA 1ZM9A 4DIEA 4EB8A 1ZAKA 3ADBA 3ZU5A 3IV6A 1JE1A 2QU8A 2XAAA 4FBGA 1SZCA 2YMQA 1YOBA 4BQRA 1VRWA 4LJ6A 4DCOA 2POQX 1FQOA 4BVFA 3O2JA 2FDCA 4L4SA 4HZUA 2RD2A 1YR9A 1IY9A 4JLPA 5C7OO 2A78A 1B6SA 1GPNA 5BUSA 4Y9SA 4OHMA 2ZRCA 7MHTA 3GBSA 2EWMA 4WECA 1L4FA 2E82A 4MXDA 1GU0A 3GZNB 2IPOA 3G7SA 3R0IA 3GLFA 2CT8A 1DQSA 1PGOA 2E6KA 1G18A 2Y4OA 3G0BA 3KT3A 1Z5OA 3M83A 4IPTA 4J1TA 1FBNA 3T5DA 3WGJA 2PIDA 4RESA 4ZI2A 2QDKA 1W4BA 2JLUA 1OTYA 4DCCA 3DLHA 1BVYF 3DYVA 2X1MA 4IZIA 3X1WA 2ES4A 1DELA 3K05A 1Y8CA 2OLEA 3UICA 3U49A 2I7XA 5E1BA 5AKYA 2GZHA 1TM4E 1XLVA 1YRWA 5EJ9A 2OTCA 3R7DA 3VDXA 1FYDA 1XB2A 1BHQ1 1F51E 3LRPA 4M8KA 4OXYA 4QSHA 1KKUA 1R10A 1NLUA 1UC8A 2QR3A 3AHFA 4GX5A 5L95A 1IVSA 3OQHA 4ZALA 2FR0A 4J0KA 3E0XA 4YK7A 5GOTA 3UHJA 2EJUA 2PX0A 4KTVE 2HA3A 1CE8B 1BKSB 3GYGA 4YI5A 1L8QA 1NDHA 4E2XA 2WM8A 2VK1A 3OHSX 5CB4A 2JJQA 3ZJVA 1IHYA 2FW8A 1TDJA 1V3QE 3U7HB 2QL5A 4GKVA 4ZDWA 4ZEMA 1DBWA 1NBOA 2GK6A 2GWRA 3E6AA 4QBKA 4WV3A 1LBQA 3RRXA 2X2FA 3WK9A 2PUFA 2CDRA 3PU6A 3NHUA 4B3HA 1QJCA 4PU0A 1ZQ1A 2XVXA 2VJDA 4H77A 5J4YA 1CDDA 3CUUA 1DMSA 4D96A 2XMGA 4DYDA 1DWUA 4U2KA 1L5KA 1SUWA 5THKA 1RYDA 2PL1A 5AI0A 3T3OA 2F8MA 4PAWA 5C8YB 2PUWA 4R8RA 4ZVLA 3PR2B 3TRIA 3KL4A 4BEBA 1JB9A 2BHLA 3E22A 1U6IA 2YOHA 4YLYA 3ADPA 5K3EA 2PGXA 3ND5A 2GBCA 1VKNA 4PLFA 3AU9A 3I2GA 3NH9A 1R6DA 4KIFA 5EUBA 1PDOA 4TTIA 1OKKD 1R5BA 2V7XA 1QHYA 4MW6A 2V7PA 3PBKA 5EEGA 1HZJA 3QKSA 4BVKA 4CL0A 4DHWA 5CFRA 3NC0C 2XVMA 4B3IA 2HCJB 5K05A 3OKPA 1Z2DA 2P5TB 3AEUA 3IUJA 1WJGA 5G53C 3G0HA 1S2GA 3AEQA 2HRRA 4RIIA 3NJRA 3L4BA 3TIIA 4B3TB 3AVQA 2MIIA 4R8KA 1ULTA 3OPYI 1ILWA 5FAXA 1DRVA 4K6KA 5KC9A 4KQCA 4ZQIA 3VKGA 5IBCA 2BUCA 4D8YA 1K9VF 3FGNA 3FYUA 2EZ8A 3MT9A 5DHTA 1XLTC 4D45A 1DRJA 2W6NA 4RXUA 3QVJA 1O0CA 3LC7O 4U1RA 1OPRA 1SN7A 1J9EA 2G9NA 5A3RA 3G6KA 3OP4A 4O2BF 4BEVA 3COYA 1E20A 1EP9A 1QWOA 1KERA 1V9SA 3IE2A 1UL1X 4PAQA 2HDNB 5IDQA 5LQDA 3GRKA 4NPAA 4PBSA 2NO0A 3GDOA 3DBRB 1QVRA 1TKAA 3ST7A 1TT5B 3AFIA 3X1ZA 2XX3A 3W5AA 5TY0A 5C7IO 1YFZA 3BF7A 1AA9A 1XJ0A 1P17A 3TNJA 3DE2X 3AR3A 5IWCA 3V1TC 4C04A 3DAHA 4YY3B 1DX9A 4G3XA 3B1VA 1NZJA 1H22A 1QYDA 4JY7A 1T9CA 4I19A 3OX1A 2IEAA 4ZVNA 5CBKA 5ESRA 1X3SA 3K9LA 3KAJA 1O89A 4B74A 4JA0A 3IIMA 3D31A 3HKCA 3T9AA 5MN4A 5BP7A 1S5PA 2R8RA 2XB8A 3OCCA 4FR2A 1Z3CA 2O05A 3LBIA 3LSTA 1TZBA 3OPNA 4WK2B 3R7SA 1VL0A 3Q1KA 1DP4A 3M9LA 5CLLA 3GCGA 2FV8A 3ET5A 3JQ7B 4HH1A 4IIEA 1DKUA 3FLEA 2O5RA 2O7RA 5B3JA 2ZPAA 2BRUC 1KJZA 5SZJA 3ZWPA 4Z0HO 3AESB 3NYWA 4NAVA 5AW3A 4WKBA 3JAWB 5CCBA 3L7DA 3HVJA 2TS1A 4QDKA 1XXHB 3A6PC 3SIWA 1FSZA 2W11A 1RHKA 1NN5A 2JI8A 3I04M 2IBSA 1UCFA 3WIUA 4S1TA 4YDSA 3SJAA 3VTZA 3ZC3A 3EK2A 3EVNA 1ZD5A 2OC4A 2ZTMA 1TK9A 3IMEA 3LUJA 2ZFUA 4TXNA 4UHDA 3RSOA 2VS1A 4KVZA 1K08A 2IQIA 1KPIA 1ZVKA 4IRUB 3WR5A 3VR5H 2PD3A 4JV5B 4D8VA 1WSAA 3HKDA 3BD8A 4IF6A 4RLFA 4BOYA 3H8SA 1N0IA 3PNQA 2A2ZA 3WKDA 1QO0D 3CKMA 3DV0B 2G04A 3H97A 4GI1A 2HA4A 5AIAA 4EECA 4YXWA 2QTTA 3B1FA 4BVLA 4EFLA 4YYZA 2Q5FA 2C4MA 4KXQA 4UTVA 3OE4A 3VYRB 2QTVB 2WM2A 1YZLA 1C9NA 4O4IA 2NO9A 3PDCA 3E3NA 5COBA 1MORA 4MRMB 1JEDA 2BZ1A 3B7PA 4OMDA 2BGWA 3GLHE 2A5JA 3V1YA 3BGDA 1KEVA 3JYNA 1LU9A 3ETHA 4BNTA 4O6VA 4RV5A 1XQWA 3BK7A 5IBQA 2B1JA 4N6NA 3R3XA 2AFVA 4FUTA 4LYFA 2B5OA 4FNMA 4UM7A 3WOHA 2C31A 2AFIB 1WNFA 2C2OA 4JLAA 1RAEA 2WEKA 5AMXA 4ZPXA 3S29A 5CCXA 3BWMA 2ZROA 1HQYE 1ATZA 2JFVA 1LPMA 5I48A 5JLJA 1ORIA 4BNDA 2GN1A 1I10A 1USWA 3IAS1 3SC4A 4GRIA 5KJ6A 4HVAA 1DQYA 3KXPA 1TMGE 2IELA 2QVZX 4QGGA 4BNVA 1HFEL 3HGQA 3HLYA 5FR2A 2YWJA 2Q8PA 3HFJA 2YV2A 3BCHA 1EDBA 2HA5A 1LPBB 1G17A 4JZYA 1ND6A 1YJAA 4QOGA 4UE6A 1ZJ5A 3RARA 4PPYA 2Q99A 4PYJA 4MR7B 5IC4A 1XZJA 4M9QA 4YJ3B 4CN8A 5JNLA 5KYTA 3BUSA 1MQSA 1JHQA 1A7KA 1ZXBA 1F4LA 1GPBA 2NQ2C 2OENG 3QPCA 1XUOA 2DC1A 1KKLA 1VIAA 2V6GA 3BWXA 1YXMA 2Q4OA 3PUJA 1TLFA 4WIAA 3KQOA 4GXQA 1KRWA 4CBVA 2VNIA 1QF6A 1F3OA 1A88A 1HE1C 4R2HA 3AR5A 1SUPA 4A2WA 3IQFA 4EPRA 2G88A 1PBTA 3DBHA 2XA2A 2MINB 1V4BA 2JC3A 2Q5IA 3FMIA 3ZD7A 4Q1EA 4FFDA 1DEOA 1SEVA 5FWXB 1FNBA 1L5ZA 1M1UA 1WP9A 1YASA 1HLFA 2XMPA 4HTFA 5ALZA 3ROGA 3EPKA 4JB8A 1N3BA 3EZLA 1L5RA 1JPJA 3SLGA 4AU1A 4BFLA 4BMDA 5KWJA 2BH9A 3BBLA 3CRQA 3U26A 4PVCA 1L4UA 1X1DA 3M9XA 2DFPA 2GZ2A 3M6FA 5CR9A 5FWAA 2J0QA 1KAQA 1QH1A 3OCVA 1X74A 2B3DA 2AEJA 3P1JA 4AURA 3S55A 1V1JA 3ORSA 2ZBEA 3KHSA 1P7PA 4KNWA 2MSNA 1QUFA 3KPVA 4QGSA 1L5WA 1PT7A 1X7ZA 2IHTA 1ESMA 3OETA 1ZMOA 3UM9A 4BX2A 4F5EA 2ONYA 2ZYIA 3LHFA 2N75A 3ND7A 1E77A 2P6NA 3BTUA 5K3FB 4MKGA 4DEXA 4GBJA 1ZM3A 4YAUA 1GTL1 1E3IA 1TFRA 1Z88A 1RBMA 1WCV1 3E9NA 1E58A 5HF5A 4C0AC 5C7YA 1WXIA 2CXTA 3KAPA 3H11B 4HX5A 3SNKA 5IZCC 3MCWA 1PQWA 1Q3KA 2N3ZA 4HB0A 4FKZA 2OKGA 3R0ZA 1KRHA 4NNJA 1E89A 4JS0A 4TL7A 1AXGA 2VA8A 5CLHA 3KWFA 4PPFA 1MW8X 1GOTA 4WINA 1TYZA 2VRWA 2ZTHA 3IQZA 4LDNA 2BHNA 1WPXA 1EX1A 3DD1A 3H9JA 5DTQA 4JI6B 2BMWA 5IABA 3CFYA 2A57A 3EYAA 1JAXA 2CB9A 2R3SA 5JBIA 5KOHB 5GP1A 2UVQA 3EGEA 3VO9A 3VVLA 3FN4A 1Z8DA 4DNXA 4TVKA 3GH1A 4IH1A 4ETWA 2FMXA 5EE9A 4ZV7A 4PCLA 2DF8A 2PRSA 3Q98A 4YDQA 4AYTA 2P0YA 3RG8A 2J3LA 5CBPA 4I50F 1W73A 2NQ8A 4FNOA 1L4EA 5LP6C 3RFTA 3OA0A 5IPFA 1H8EA 4IV5A 2AQKA 5FV7A 3NEYA 4E6EA 3QY0A 5HYVA 4RS3A 4EJMA 2QJRA 4XX1A 5KYYA 3M1LA 4PN3A 4IFTA 2ZJOA 4EY8A 4A0HA 4ABYA 3LPLA 4EVSA 1Y80A 3TQRA 5AK5A 4L3WA 2R62A 4Y1RB 2ZCVA 2ZRHA 2JJ2A 2HGZA 4MPDA 3W9SA 4DY4A 4E4TA 1T0JB 3MK31 2GPYA 1C7ZA 4ARAA 1H6CA 1U9ZA 3E03A 1JMVA 1ADYA 1UJ2A 2FA9A 4KC0A 4NONA 1IHUA 2CHFA 2VT2A 1TK3A 2YBDA 3IQEA 3PCRB 4K9MA 5KNLA 4OLBA 2ZRKA 1E5XA 1FUYB 1F38A 2ZG6A 3O73A 4K81B 4L5IA 1IQUA 4E2YA 1PRYA 5JNSA 1GFWA 4ZEXA 1GPKA 1CJTC 1V3VA 2P6MA 4E88A 1GRNA 3IBYA 4I2VA 1WMAA 1BYIA 2JGMA 2XHEA 3IUNA 3G0GA 4LRTB 4B71A 1POWA 2QU7A 4EG8A 4TKUA 3CUTA 1AKEA 3NPAA 2GDJA 5CB6A 4CR7A 2WOJA 3AINA 2EW2A 2R4QA 1YNOA 4GYYA 2NYRA 5FUMA 2A1UA 4KQ6A 1V5GA 5F73A 2AUNA 3UFXA 4OYRA 2HWYA 2XDYA 1QIMA 2D8AA 3F3YA 3QQ5A 4LHXA 1PFWA 4WMLA 4XYBA 1QR2A 5IM4A 5JS1A 5I3CA 4ND2A 2PRIA 1EFLA 2HAEA 4ZI5A 3RC2A 3I12A 4MAMA 1GTG1 4GUAA 5FLYA 3L1VA 1YKFA 4HHEA 2PHZA 4KAXA 1L7MA 4HBGA 3JZAA 4OUKX 4BP3A 1HMYA 1V8OA 3D43A 3EZXA 4ZA2A 5FNVF 4UTXA 2ERXA 1TAUA 3BH7A 4X6UA 3QXHA 4MCHA 2C95A 1CZKA 2CYBA 2IPNA 3I39X 4OG2A 4S0ZA 3ZI0A 3AERA 2VDUE 1CLEA 1JLRA 3FCCA 3QVLA 5DLQC 2B4RO 2ZUCA 1YV9A 2O5VA 4TT8A 3M6AA 3GB9A 3DXXA 3TWOA 1XJCA 2P1ZA 2OT3B 2O6LA 3NIDB 3TXAA 4HB4A 4M0FA 1CUCA 2B78A 2IU3A 1GHTA 3DHYA 3NNDA 2F1IA 5CM9C 3REQA 1NASA 1NVGA 1Y4ZA 4XCVA 1KQ3A 4D98A 1XDUA 4B3GA 1M2EA 4DDTA 1IM5A 2R5FA 3BDIA 3NO4A 3OMWA 3Q3JB 3SJBA 5JANA 1BJKA 1U81A 2RHDA 4PHFA 3MHPA 3T34A 5GINE 1UPUA 3IDZA 3JTEA 2Q7OE 3RF6A 4EY5A 3RVJA 5TPWA 1A76A 2YWRA 2ZUFA 1CS0B 4YJ2B 4P8RA 4QOSA 1HDZA 3GCWA 3GGGA 3LAWA 4M7PA 4YHHB 2IA5A 3OEHA 4QSMA 2F9FA 1LS6A 4L1KA 4P0TA 3LOQA 3USES 5D85A 2CGEA 1QP7A 3T1OA 3QLVA 4NAHA 1ZUHA 2WE8A 2Q5CA 4LZAA 3DFZA 1Z47A 1RQRA 1R0XA 3ZJYA 4XEHA 1YJ5A 1EK2A 1CY8A 1R16A 2AKAB 2HF2A 3CW8X 3B85A 4LTDA 3QLTA 5TNXA 5A2GA 3T5PA 3GRCA 3L8HA 2O8BB 3CONA 3AJRA 1OFVA 1AQLA 1P2TA 1A50B 1Z83A 3NTOA 4LMRA 4PYRA 4BWVA 4YXWD 2Q6IA 5AUNB 2PJUA 1XR3A 3LGAA 2ZB2A 3D0KA 2NOAA 3GFPA 1M2VA 2C98A 2I1QA 4URWR 1W47A 4BHTA 1NQ5A 3FNRA 1NLMA 2A5GA 3BL6A 2J5XA 3PXEA 2CZQA 3K6SA 5T4FA 5DI3B 3WL5A 3P9CA 1TUBB 1HL7A 2YY5A 4IRXA 5CXSA 2MYUA 4HCJA 3W4IA 4JKIA 2HMAA 4X94A 4F9GA 3MERA 3E23A 2AKYA 3HVKA 4I4TF 1ZX1A 2M1XA 2ZP1A 4XDGA 3DVAB 1SCUA 3OBIA 3U0VA 3KHKA 1XPJA 5JSFA 3NM5A 5LQJA 1T5OA 3Q9LA 5J4LA 4JIMA 3I2HA 2FK8A 4R1MA 2AFIA 4W9RA 1A8PA 3TOSA 2GCPA 4IMJB 1WQ1R 3UB4A 4EFMA 2YXDA 3TRDA 3H8WA 4O1MA 2QL7A 4YJDA 3DNMA 1TVKB 1DAFA 2HSWA 3H1FA 1ODIA 2Q2NA 2DQZA 2FE4A 1SGWA 4JJAA 2Z9DA 5EL0A 2FN8A 1JG4A 2G1KA 3QU7A 2Q5HA 2QIOA 4MMZB 1H2HA 2AXNA 2IHZA 3RUDA 3TIGA 3IT1A 3K0SA 3OQIB 1DKNA 3TIFA 5SZKB 4UAVA 4KR7A 3AUXA 2WTEA 4E12A 3KYJB 5CIWA 2XQFA 5DW3A 4RIEA 3MVEA 2ZUWA 3NHFA 5GM2A 4A7PA 4FC6A 1XKQA 3OJWA 3QZUA 4MR7A 3OMLA 4Y6RA 5IT9A 5TVKA 2AFRA 4NG5A 3RR2A 4EW1A 5KYNA 3LZDA 4IHJB 1N6IA 4ZO4A 2JF0A 4D4GA 5EJ7A 2WQ7A 2G17A 3NDBB 4LQDA 4KVAA 2B36A 2Z2KA 3QKRA 4YP1A 3QE4A 2DMRA 4E32A 4YMLA 2QJTA 2NO4A 3WB1A 1XVAA 3W3AA 1FB5A 2ZT7A 1KO5A 2EZ9A 1D2GA 1Z39A 2VDJA 4X44A 3WGKA 4AIIA 4F7WA 1UDBA 1K92A 4KPFC 4O2AA 4K9SA 1PF7E 4UHCA 2OXIA 2GPBA 5DKFA 5FDFA 2WD8A 1Y4SA 1F8YA 3PGA1 8AT1A 3KJQA 3SS9X 4JKYA 4FMCB 3TI7A 1F5NA 1Z82A 1PX2A 1UMBB 1I30A 2ZJYA 2WT4A 4YRLA 1IY1A 3AJ9A 4DDWA 1HDCA 3SC2A 3R5KA 1Z4QA 1SVNA 3AIMA 1ZKMA 4Y2PA 4YC7A 1XMVA 1IN6A 1ZJJA 2Q5JA 5ELXA 4FYHA 2MYPA 1Z13A 2OBXA 4TLAA 2BEVB 3U40A 4DNPA 5D7NA 4EX7A 3HA3A 3ESYA 1JR2A 1N3YA 1XAHA 3MMXA 5AFSA 4G1BA 4GZ3A 4V0SA 4S1VA 2IY8A 2NZJA 3NM6B 4UVDA 1J0CA 2DFLA 2YX1A 1NNLA 1Y3BE 2VDLB 3F4BA 3ZDAA 4FTWA 3J7TA 3NNSA 2FLKA 5A4DA 3JYLA 1B8VA 3E9MA 5HKKA 4D26A 4DLBA 3CO5A 3T38A 4AJEA 4PHGA 2XJ4A 1O0BA 5E3HA 3VR2D 1T1RA 1TGYA 4G65A 4X95A 4CTKA 1Z22A 3R5JA 4FFSA 4QBTA 4QOFA 3ZDYB 3C8DA 2ZI3A 1ZMRA 2H4WA 2ZE8A 2ORED 3I9V6 1B8NA 5KYWB 2JGNA 1RDFA 3SR4A 1VP9A 3TSYA 1VHQA 2FP3A 2OAQ1 3KOXA 4KUGA 5CEJA 3R23A 3RTDA 5JQGF 1W4AA 2CLLB 4N65A 5FQOA 2C57A 1FU4A 4OK3A 1SU8A 2IPLA 3Q9NA 1B0ZA 3MGBA 1X19A 3KR9A 5EP1A 2P6PA 5HUQA 4B3JA 4BNHA 4DIFA 4KIJA 2Z1MA 4CU2A 1H8ED 3A04A 5BW8A 4D6PA 4GOOD 4BY9E 3G1TA 4HLDA 4BMVA 2DWOA 3WO0A 3JWEA 5CA1A 1JLMA 3H9UA 1N78A 1U63A 3L3BA 4LZPA 1ZBQA 2VCEA 2BKUA 4TS4A 5LQKA 5EXTA 2PSSA 4WK4B 1T8UA 5HMMA 3TNYA 4CWAA 2JJ2D 3SAJA 1I4LD 1S8AA 2FCAA 2FZCA 2PZFA 4PRZA 1TX4B 2OORA 3AEKA 5JWOA 1QCYA 2CUTA 2GXSA 4OQEA 5BSVA 5J5AA 1J99A 1TA0A 4MROA 3VKWA 5AVUA 1E66A 3NHJA 5CT4A 4ER0A 1GADO 5B7GA 3IDQA 4INJA 3NBXX 5CYGA 1RYZA 4FGLA 2FXIA 3GFOA 1PR2A 1YSCA 3TSAA 4L4YA 5BWCA 4AECA 3CVWA 1BMDA 2AW5A 2QUIA 1EG7A 3IA7A 3IODA 1YGYA 1AKVA 2E9SA 1MNQA 1PG2A 1E7WA 1QYXA 2WYWA 3BWVA 2IODA 4NE7A 5ALTA 4EL0A 1F2TA 3MJ4A 3Q8KA 2HD4A 2OEPA 4JB2A 2ZGVA 4PLZA 2H1LA 5T41A 3T1YB 2TMDA 4TYYA 1B23P 1GKUB 2DR0A 5FOTA 1B74A 1DTWA 3W2EA 4JI7B 2XUAA 1FLAA 3PWTA 4E09A 4UZEA 2XYGA 1DG1G 1N57A 3EZYA 5ITZA 2Q9CA 3QK7A 1KJQA 2QVYX 3OFSA 3M5DA 3ASUA 4GR9A 5T8KA 3SMQA 4F3KA 1ZU4A 3ZHXA 5LKAA 1UQTA 2GHQA 3LO8A 3M2TA 4D4IA 5I7WA 2JFOA 3G89A 1LQ2A 1T1GA 3GD7A 4L50A 2WLSA 4ZYVA 4DMMA 3H5LA 4L8YA 3WIOA 1M33A 2EWVA 1K6MA 4IGAA 4QNRA 4W7SA 4S04A 1DJMA 1WUYA 4OBXA 1U8AA 2IIPA 2BFPA 4IHKA 3WLLA 3L6DA 1GZ5A 3LPDA 1O9GA 4E13A 3M7IA 1QHHB 4YXFA 3JQAA 3RU7A 1H9AA 2PVPA 1W6RA 2QI9F 2CLMB 2TSYB 2VQ3A 3MOIA 3C6XA 4GP6A 3HMQA 4P3YA 2NPIA 4JIGA 4CHTA 4PR3A 4C0BA 3G2MA 5F78A 5H4GA 1I4DD 2VQSA 4K8RB 3KQVA 5JCOC 4LF5B 2OHFA 1E5DA 3NC1C 1OF1A 3H3XA 3T7SA 3HV2A 2V03A 3OEHD 3P4XA 3QTBA 4QXPA 4UTOA 5FA5A 1VHJA 5EWMA 1RRMA 1E96A 1F17A 2HGSA 2YFQA 3DKRA 3AYZB 3LVBA 1S1CA 3IR6A 4B3BA 4PANA 2Q49A 1VE7A 3K5IA 2NUPB 3O4GA 4IXTA 3ZUGA 4DV0B 1F7VA 4GMFA 4U0JA 1Z68A 4C43A 1NY5A 4IAOA 1T8WA 3UXYA 2JGJA 1PZHA 2RAUA 1SXIA 4IL5A 4DEYA 2H8GA 2K6GA 1YCFA 5E2AA 2CMHA 4F4CA 2H8KA 4K0RA 4UNSA 4L08A 4C76A 2ONJA 1RPTA 4MVJH 3LLMA 4J07A 1PK7A 1FDTA 4PO9A 4UPVA 2A6PA 3PXDA 4Z0PA 1X1EA 4AF8A 1Z0UA 4YRMA 3TNLA 4MMYB 3C4JA 3P8ZA 3RRBA 3UK7A 1MW9X 3A1TA 1XZLA 4M0KA 4NNPA 1RPZA 3IEXA 1R0ZA 3JQBC 4ZAYA 3SPXA 3WWPA 1X87A 2YMLA 3MW8A 2O8DB 1YQDA 3MIIA 3BMOB 3OF5A 4EGSA 5TT0A 4K86A 1MO4A 4TWAA 4YJHA 2OOKA 2PU5A 4GPEA 4JYCA 4TUYF 1V5FA 4JT4A 4F9EA 5DI3A 4YCJA 5LB2A 2VQ6A 2YASA 3ZNQA 1HRKA 1ZXLA 5IKPA 4IIJF 1H0HA 2ZSAA 3EISA 1WHSB 3ZBPA 1N0VC 2IPMA 1AK9A 3DPIA 4EDHA 3MT7A 5DRYA 2XHZA 3U9SA 1L8LA 2GPTA 4JJ4A 5JE8A 2GVNA 3DUFB 3G7UA 2ZT8A 3PA8A 3DEFA 4DCPA 3BMCB 5E1MA 621PA 3AUYA 2QXYA 3PEWA 1XI2A 4EJ0A 2BGIA 3QPAA 3B5EA 2KLHA 1LPAB 121PA 5FUQA 3CT4A 4ODIA 2EATA 4MVJE 4OJMX 1DAPA 2V74B 2CHGA 3H04A 3HM2A 2QM3A 3I83A 3KO8A 1CB0A 3H2GA 3GAFA 3PRHA 3FTQA 1UBUS 2WTXA 1EE9A 4MLDA 4MULA 4MVJI 2IV7A 3NGMA 3QE2A 5EVCA 1Y5IA 2FWAA 2JATA 4G97A 4IINA 4MS4B 5K5EA 1NJ8A 4QQRA 3N8HA 5LBTA 3DONA 3LDAA 3W3AD 4CG3A 1XZBA 4ZV4A 4H7PA 2JGLA 4Y2QA 5JDCC 1RI3A 3KUKA 3PKIA 2PS0A 2QRZA 2XZLA 4QUGA 5BQ5A 5IUNC 3T6KA 3ZBTA 4B17A 5BN3A 7AT1A 4LI3X 1XEWX 4BV8A 3KCQA 4BX0A 5K0CA 4AZTA 5JH7F 2EP8A 2XLCA 4KQJA 4OHCA 1OZHA 3E8XA 2ENWA 2EAUA 1MJHA 4DARA 2LP4Y 1AB5A 1GN9A 1QH0A 2J59A 3DMTA 1SIOA 1VKZA 1JGTA 3CBQA 3G0IA 5EAIA 4EVRA 2XTZA 1NW4A 3GUCA 4TKLA 4EUSA 2HF9A 3MT8A 1QVWA 1ZGAA 3V2GA 2I6GA 3JSAA 3LQ1A 1C1YA 3VTAA 2VLIA 3GUUA 3GH3A 5BW6B 4PQGA 2WJIA 3TS1A 4D43A 2NU8A 3LFHA 3O9MA 1Z62A 3O47A 3EZ9A 5EHXA 2QN7A 1I01A 1V41E 1M74A 1R3DA 2CDBA 4BMXA 4YCCA 1U7TA 4EHLA 5I7OA 1CQWA 1GGVA 4KV9A 4G0ZA 4BB5A 4GFDA 2GX6A 3JX9A 2L17A 5HKKD 3O1HB 4Q01A 2XI4A 1CY1A 4I1UA 1KDRA 2G9RA 3QYJA 4G86A 4MPJA 4P4UA 5HKLA 2X77A 1Z0ZA 2QHXA 3GUHA 3QYFA 4KXWA 2ZS7A 5HF9A 4K9DA 3VKUA 3A05A 3KCNA 4HG2A 1GA6A 4JP1A 4N5NA 4KBYA 2JAWA 3RVNA 1D1SA 4R5MA 3HXPA 1UDWA 1ZMXA 4IDDA 4ZOQI 1U7HA 3I76A 3DHNA 1NBMA 1D1QA 4IO1A 3PR3A 5JZBA 2JHGA 4KXYA 4K8OA 4MYCA 2Q6VA 1RQXA 3SDSA 2ZE6A 1YTLA 1O03A 3GQBB 4FHZA 3DBOB 3U39A 4BXOB 4LYDA 3W5JA 1XF9A 2C2BA 4JR2A 1WD5A 4M21A 4E5MA 2NW6A 5MFZA 1IULA 3CC8A 2Z98A 3RYTC 1RW4A 1IN4A 1HGXA 4FFRA 5BQFA 1M7GA 4DG5A 2O3TA 2VJYA 2DPYA 4EYQA 5DNCA 2QK4A 1MX9A 5JARA 5JMOA 2AN3A 3K6SB 1HI9A 2Y2VA 2QMYA 3P45A 4FQ8A 5KMGB 1DDGA 3LP8A 1VPWA 3CWCA 4HWPA 1KL7A 3P20A 1XC7A 3DGEC 4R1SA 1ZONA 2B99A 2R86A 2ZDGA 3GBVA 4LYEA 5EWLA 4BVJA 4NJOA 4B6GA 2RH5A 2BE7A 2GRJA 3LX4A 4J1SA 5HZHA 3GAAA 4K6MA 4TL6A 5EGSA 5HRAA 3VYSB 1Y1KE 5BSEA 2W83A 4JT2A 4MB0A 4URVR 1KBZA 2IP2A 4G1EB 5HE8A 4PLGA 4OH1A 2FJPA 4G1CA 3V8VA 3C4QA 2AOTB 4CKWB 1QPBA 2QR2A 2H7VA 2PWAA 5E7JA 1XRRA 3BHMA 4Q7EA 2XE6A 4XR9A 4R5HA 4X8OA 2IUUA 4QJ3A 2FVXA 4WVFA 3CLKA 5CK5A 4GQBA 4A9AA 2ESRA 1P1CA 3L1KA 1MQAA 5KSOA 2EQAA 2J7PA 2F3PA 1QG2A 4MB2A 1EBBA 3UAVA 5K6AC 1Z2PX 4DYVA 2ECPA 1L1FA 3VJMA 4H0CA 2MSEB 4XVQA 3ZKWB 2XY4A 1JAHA 1E9DA 3AHHA 3L49A 3PFIA 4DCSA 5A5DA 4MDEA 1RYNA 4J4TA 2V6JA 4CI0B 3OTIA 3CO0S 2OA0A 3N2EA 5A0VA 4DREA 1SQGA 4YAKA 1AA6A 4FQ7A 2QJOA 3P52A 2BTOA 2FFRA 1WCIB 2YJGA 2WDZA 3Q5GA 3R7WA 2OECA 3U31A 4QU9A 3PQ3A 2ZUDA 3HABA 4Q05A 4JK3A 4XQCA 3MWDB 1E3WB 4DUGA 2OO5A 4MQBA 1KOJA 3G0OA 1E6CA 3CSDA 3LIPA 4IILA 4R3WA 3ROZA 3KT0A 2V1XA 5D6OA 3UT0A 2O4CA 1WDLA 3JQAD 3C74A 4F8EA 1LB1B 2CFOA 4OI0A 1X2BA 3BN3A 4MCAA 3IELA 4I55B 2FQXA 4P7BA 4LX0A 4XIJA 4ALLA 5KOIA 1JQLB 2H2DA 2NXWA 3H5TA 3JRNA 3R3YA 1O1YA 3S2SA 1EEHA 2HIHA 3UGKA 1G9SA 5TMPA 2B8TA 3RJ5A 2QN8A 1MX5A 2DFNA 2I9PA 3I2YX 4C6HA 3G88A 4F1KA 5FX2A 2EERA 1H05A 1Z0FA 2FSFA 1SUCA 2WZQA 3P9QA 4JGIA 4XGIA 3HUDA 2PKQO 4QPCA 3CJRA 3ITDA 1E59A 3T5BA 4UM5A 5DFAA 5EMKA 2GM5A 2CZCA 2BI7A 1CRQA 3OCUA 1Y5NA 3E5MA 5IN4A 2QYHA 1N2BA 3EGXB 3F67A 4R2MA 1H4VB 1JSXA 3QVTA 4A36A 1FSPA 1YRLA 2IBMA 1QQAA 3COJA 3N2GA 2ZJ0A 4DNOA 2F9MA 1IOWA 1T5LA 2R7NA 2C78A 2W6ZA 3TZKA 3K2EA 4J6FA 4IMPA 4MKHA 5AR1A 4M1QA 4EMBA 1H5NA 4WPGA 1F6BA 4QYXA 1IZ9A 3IXQA 4YMWA 1DNPA 5DYWA 3G7NA 3OIVA 2GMWA 1S8NA 3KOMA 3VBCA 4UATA 4CV3A 4XCQA 2P5YA 4EYKA 2AI3A 1F0KA 4Q47A 2O06A 4AKHA 3RTCA 2HIAA 2ODWA 2WA2A 3RDPA 3TTSA 3ZTTA 2Q5QA 5JNUA 2IL1A 1H9CA 3GT3A 1XMOB 4NV3A 3CSSA 1MN6A 2VJMA 2GCEA 2XB4A 1P8JA 4KQ9A 4YP6A 4AFNA 3LE8A 2BTEA 4BLUA 3Q87B 1FP6A 2G7MC 2SKDA 3DLCA 2WKQA 1NIPA 1DZIA 5E8RA 4EX6A 2QD1A 4PBTA 1K06A 3Q11A 3RVSA 3U1TA 5CG1A 2HQ1A 1TYDE 2G9ZA 5BN5A 4HEA6 1J20A 5D01A 1G3UA 2YWHA 2R96A 5AM3A 2GPSA 2UVDA 3E1GA 3LM8A 3CUYA 3L7NA 5G4LA 2XKAA 3UAWA 2ZI5A 4M1KA 5B3KA 1MENA 4MRSA 2G6TA 5HTKA 3HK2A 2WB4A 5AT1A 3TRJA 1E32A 1CR6A 2P6UA 2QW8A 3FDJA 4MKFA 4CMJA 1TIKA 4B31A 3GFBA 3ZY3A 2JAQA 4ZZ1A 3BS4A 4LF6B 4Q66C 1DHTA 2VHJA 1A9XA 3AY0A 4NE2A 4RL6A 3ZCTA 1ZU5A 2WSYB 2YY6A 3JD2A 3F78A 5ILQA 1FX1A 1Z7YA 5B1YA 4MYUA 1L5FA 3FF4A 3ONFA 3ZG6A 4HADA 2IW3A 3HADA 1NDUA 5KS2A 2J3IA 3GWGA 5A1TA 1XCBA 5AUPB 4Q9KA 1WQ3A 4PZUA 4ZO9A 5KSWB 1ZA2A 3MQ2A 4JJEA 4I8DA 3BRSA 1PQPA 3VBEA 3FR7A 1YDMA 3I6YA 1TJNA 1P7ZA 2J5BA 5DNEA 4PO3X 1C29B 1VLZA 4YP7A 4BBJA 1Z6XA 3PT9A 3P27A 2H08A 2O07A 2VHXA 2XUIA 3VU9B 1HH4A 4DR4B 4CODB 1RC8A 1R0RE 3TUIC 3TKLA 3C41J 3ZWQA 5SZIA 5IUKC 4I3HA 2IX3A 4O0MA 1WBJB 5ENDA 1BGVA 2VYCA 3NTVA 2FGKA 4L8LA 4Q15A 5D1NA 1XPOA 3FOBA 5LZ9A 2PD4A 1H2RS 4HDOB 1MU0A 1LC0A 2DPLA 3L05A 4O4HB 2VBFA 4KN8A 3KZXA 4WLNA 1IAVA 3EBOA 2IH5A 3O4IA 1LXCA 1U1DA 5K0JA 5DV9A 5EJEA 4W5JA 3KFXA 4AP5A 4DEVA 3PJDA 4FWIB 3QOFA 1G9TA 1VKJA 4RENA 5BUQA 3NHZA 3G5AA 1EGQA 3VC3A 4U8GA 4DTCA 2ZSDA 4WH0A 5F77A 2VBCA 4KQKA 2I33A 5TGDA 4AO6A 4UASA 4BC0A 4N1AA 1PT8A 1K5DA 1Y6JA 3T9EA 3BB1A 1XN1A 1NVKA 4M0DA 5JDIA 5JD6A 1GCIA 2KLBA 1FFBA 3B48A 5DP1A 3RWOA 1MPXA 3FWKA 2GSDA 3GLRA 1JHUA 3L7JA 1C9JA 3HEMA 1OIXA 1EWRA 1MA3A 2C3OA 3NEPX 3PC7A 4Y7DA 5EIFA 1RABA 2DFKB 1XNRB 1ZLYA 3RV3A 1D8TA 4FSDA 3UJCA 2ZWOA 4R1NA 3L6BA 4W6QA 3BSWA 3JPWA 1U2DC 1PNTA 1P2BA 2X0IA 3BHIA 3EQ2A 3CNEA 1QM5A 1W2WB 2AYYA 3VQTA 3BE5A 3LHIA 1EUDB 4ZAFA 5C9ZA 1ZKDA 1GCAA 1EIWA 2HO4A 3DAPA 3VKVA 4CR6A 3DCIA 3CA8A 5FOWA 2CKDA 2QVXX 3JRXA 5CT5A 5FO0A 4RW0A 2BMJA 4BMZA 1L6RA 3H4IA 4QU0A 3H18A 3N3BC 4HFMA 1NL3A 4RYDA 4ER7A 4RMGA 1BXRA 3GQBA 4YRDA 5FRDA 2CL7X 2PO7A 2QX8A 3U1VA 4BMPB 1U5BB 4GVPA 1WHTB 4HQKA 4QUDA 1P77A 2RHMA 3P32A 3I8SA 5CK4A 1DEHA 3RT9A 5CA0B 4G5SA 1I0ZA 1YTUA 1D0IA 4MW0A 1R6VA 2ZYTX 5JTUA 4M1YA 4OYLA 5JJKA 1FDRA 3RE1A 5ICCA 1VCMA 2ATCA 1U7WA 3VC1A 1APBA 1T9GS 2O3RA 4NBWA 1H4TA 2HJGA 4I1VA 1FJ2A 2CXHA 4BBPA 1RQLA 4ZYTA 3HXLA 1WDWB 1X1SA 4UMDA 4RBNA 3LVRE 5ALDA 4KJZA 2HK6A 1OY1A 2AZMA 3WGLA 1VGQA 2AMYA 1RHQA 5H4HA 5TMEA 3RODA 1QS0B 4XWYA 4BTEA 4D97A 5JSYA 1EUYA 1MAVA 1HMPA 2V8BA 3F74A 3T54A 2ASEA 2YUTA 3BCUA 1DTEA 3R6GA 4G37A 3VI4B 3PNBA 3KP1A 3M81A 4XXHA 1IQRA 1HZZC 1RPJA 4HJXA 1NSFA 3FZGA 4HDRB 2J7PD 3B9QA 3BJRA 3V97A 3COPA 1B0AA 3HNPA 2XCLA 2V98A 3LXMA 4R7GA 3T95A 4LHWA 2YXBA 2C00A 1PGQA 1BWQA 2FPLA 1KFCB 1YS4A 2H3EA 1QRAA 2ZJAA 3AUAA 4EGJA 2P9EA 1GPDG 1ZN9A 4F2GA 2YQ4A 2V4UA 3DA8A 1W4CA 4ZO7A 1K4YA 2R66A 5TF0A 5E4FA 3CXRA 3UJDA 4Z7QB 3L7LA 3GIDA 4R51A 1W9MA 1TM7E 3JQ9A 2I91A 1IEQA 4H35A 1ISPA 2E4WA 1E2QA 2VOJA 1PT5A 3DLPX 3E2PA 3KOWA 4HWOA 1PD1A 3ZYCA 5FEUA 3WYFA 1QCDA 4YAIA 4GMDA 3OC0A 3WA7A 3U4CA 2JAOA 3QX7A 4ZCRA 4BZPA 5BMOA 1E64A 1IDN1 2XYRA 3TSZA 5AVYA 1UBMS 4I50A 4HLCA 3KT8A 1FEZA 3W5HA 1BCRB 3CH7A 2C7GA 2X7XA 2CEKA 3L6UA 3TW4A 4BPRA 1F8UA 4CHGA 3K70B 3M3HA 4NECA 1ESDA 1YQXA 3SQNA 2PX8A 2P77A 2HB6A 2I2DA 3X2SA 4W9MC 4F6RB 1COZA 4XWAA 1NVBA 1X3LA 5KTSA 2R8BA 4HVLA 3G68A 3ER8A 5D7BA 4ND8B 1QTRA 3ZU2A 2HA7A 2I3ZA 3GGCA 4RC9A 5DVZA 2JVIA 5K0GA 2UYCA 2YKGA 2WSLA 4ZIRB 3O31A 1ZFNA 3NIBA 1KEZA 1VSVA 1J56A 4JMPA 1PJZA 1NUTA 2EFJA 2PKWA 3I9JA 1RBQA 2AD5A 2HBYA 1R88A 2M6SA 2VXCA 4ZT6A 4B4UA 3CN9A 2KMLA 3OH8A 4HWGA 3R7BA 4LSGA 1YS7A 2I6UA 3WQQA 1N5DA 4JCCA 1I5RA 1THGA 2FN7A 4DR2B 1UDRA 2AYZA 1V3UA 2FHSA 3B9RA 4PW0A 3BWYA 1ABFA 4U9HS 3VHLB 1WCXA 1GTMA 1V1MB 3CUVA 4JDPA 1ZN7A 5E0OA 4QKQA 1GV0A 1XL1A 2PFGA 4GDFA 1OXTA 1GAWA 5CYOA 4QFBA 3QJYA 4GVLA 1TU4A 3A26A 4AZVA 8LDHA 2H92A 5IX8A 1QAQA 2FMFA 5FLEX 4ETMA 5ALGA 1AGPA 2JFZA 2ZSUA 1BVUA 2OV6A 1HXHA 1UKZA 1XCGB 4Q3AA 5FPQA 2VSFA 2ZJ8A 3VSBA 3WNZA 3ZXSA 4DR5B 1YUMA 3Q0IA 3GG2A 2Z09A 4HYTA 2GM3A 5CH8A 5BSGA 4S05A 3A31A 4QFMA 5FIUA 4IJUA 4M1WA 4V3BA 3A6LA 1FYXA 2E55A 2H16A 3CLSD 3OVMA 4OSEA 2BR5A 2E5LB 1L4LA 1T5TA 3UATA 2FF7A 1E62A 1GZ7A 2CJFA 2OV8A 3HL0A 1EGHA 1NQWA 4H7EA 4DUPA 3ELUA 2SNIE 1C8VB 2V3VA 3BWEA 1US8B 2JGFA 3MWLA 3P9NA 5FNVA 3U09A 1I2BA 1RNLA 4Y2GA 2R1TB 1ZR4A 1SIWA 3NHRA 2BP7A 3NLLA 1I2DA 3I9V1 2W6CX 1TW3A 1W5EA 4ID3A 2QNRA 3S7TA 2X40A 4CM1A 4EG4A 5B64A 1XPRA 3WQBA 4L07A 2W6OA 3PI7A 2VFAA 1JQAA 4TROA 1TCAA 5LYJF 1W93A 2DETA 1EWQA 1BX1A 1PJAA 3PUZA 1R6AA 1SHJA 3HKEB 5HILA 2ZUUA 4ZJPA 4IW3B 3V48A 5BV2P 4FM9A 1GKYA 4DQUA 2I7DA 2H2FA 3GLQA 4N7JA 4RQTA 4H1TA 1YD7A 3ZDFA 2XQGA 3KDAA 1GXSB 2XXAB 3EH1A 4E21A 1QIEA 4BFYA 2JAXA 3D7SA 3CW9A 2IYYA 4AKGA 3B6JA 1UM8A 1KAMA 4JI5B 4GOLD 5CNJA 5JBQA 3S2YA 1EWKA 2QR5A 3ETEA 3DP7A 1JYSA 3JARA 2QZPA 3K0EA 2AN9A 3EFEA 4IZ6A 5F5LA 5FADA 3DLAA 4E5PA 4KFUA 2ON6A 5C34B 4MYRA 3EVFA 5DX1A 3V8NA 4C3UA 5JFTA 3FOEC 4YS6A 4AJJA 4H9GA 2WFZA 3K0BA 4XGQA 1Z6YA 3ZUPA 1VG9B 3ZDBA 1FMLA 2E49A 3F90A 3IOMA 3CEPB 3KLNA 2PH7A 1ZHFA 5EJGA 5CYFA 1AGXA 1A2QA 5A7FA 4YTEA 1IN7A 2GNOA 3H1AA 2GEUA 2W6QA 4C29A 1P7WA 3A1DA 4UU8A 5DSTA 4E51A 5BQOA 3VZQA 4A2CA 2XWSA 4ZXFA 3Q15C 3LHDA 4EI7A 2FWRA 4HQFA 4L9SA 1VKOA 4XLLA 5HA5A 2IYZA 5CEEA 1ZMTA 2GEVA 4R69A 4OHZA 1OU4A 3FPHA 3IUPA 4DLYA 3UBTA 3K1AB 2B9EA 1P1KA 4LZWA 1E0DA 3AHDA 2REQB 2CDNA 4BUCA 4C78A 5JEEA 4YJKA 5B6IA 3E8MA 4FFBB 4INPA 3TLMA 5JNWA 1XDWA 3NBKA 4RA6A 2I7CA 4YWHA 3UMFA 4NFSA 3S2GA 4L75A 3UC9A 4ZJYA 1X8KA 2FMIA 3H75A 2WV7A 3MJDA 5JHGB 4A16A 1KTVA 4RVOA 1ST3A 3NAQA 4ID9A 1KEEA 2YJ6A 2WTAA 1E2MA 1DAMA 3NM4A 1SB8A 1OUMA 3SIPA 3B1JA 1XDZA 3MOGA 4URFA 3BEOA 1DKLA 2AG0A 4BX3A 6ADHA 4Z4CA 2XADA 4PV7A 5KHAA 2H1WA 3ELYA 4Q1AA 2H65A 3PHGA 3ZI7A 5B6PA 5EJ8A 1AM4D 3CRMA 4B79A 4F72A 1PWHA 1PG0A 4K40A 1S02A 4OCZA 3IR5A 3G2OA 5KTYA 1K7CA 3IS3A 3LECA 2ARKA 3MRVA 3DKIA 2WZCA 4OHOA 2W70A 3LUFA 4E08A 2CBGA 3C3KA 1L4HA 4G5RA 1QQBA 4XSHA 3GPIA 3NTUA 5KAPA 1BN7A 2V96A 4RTRA 3SN6A 2PBZA 2E37A 1VGVA 2DFDA 1AV7A 3FMVA 2GPJA 2HQBA 1T3LA 1VJ0A 1Y63A 2CNOA 1SUSA 2CFTA 2KS6A 4ND3A 1OI4A 1MRNA 5B4TA 2YZMA 3IFSA 2B35A 3JVVA 4Y1FA 3RNOA 2GEDA 5AM4A 4XB1A 1HRDA 1YZYA 5PGMA 3UJHA 3WMEA 4MGYR 1PVOA 1U4NA 2OG1A 4LI0A 2WJZB 3P9SA 3V1KA 2QNIA 1YQGA 1ODLA 2PM8A 1P1JA 1RWQA 3R9KA 2HH9A 3RVDA 1XU4A 1XZAA 3G1WA 4DNFA 1JQEA 1S1MA 2OZPA 4HV4A 2AF3C 1N2CB 3DW3X 4H3KB 1AMOA 2DUWA 4NCXA 4OX9Y 3NOOA 1QS0A 4JLUA 4H18A 1L4BA 5B37A 6REQA 2BBTA 3NV7A 1OAOC 4RY0A 1FUKA 4QGAA 1T91A 1PK9A 2JI6A 3PC3A 1NU8A 2VRCD 1LRJA 1L9XA 2VPIA 3IOBA 2Q2VA 3NGLA 1XMQB 3MBOA 3H5VA 1M6VB 2XGMA 4ZARA 1MOQA 2NSDA 5C31A 4CMIA 4HEQA 4YV1A 5CXUA 3AKZA 1GUDA 2KHZA 5EHNA 3M82A 4PXAA 4QQFA 6LDHA 1JKJA 1U3GA 3FMFA 1CQIA 2W4IA 5CRIA 2OD2A 5EXEA 4TWIA 3AY3A 2X5XA 3CLUD 4UUNA 5CVEA 5EG5A 5KI6A 3WLMA 5LP6F 1J0XO 4MYSA 3TLXA 4RA9A 3UV6A 2XQIA 3IUMA 3GLGA 2WU1A 3SFZA 1WUIS 1ZI8A 3RIEA 3N2ZB 5JJIA 4HDSA 1GSHA 2GEJA 5KUTA 4EJFA 3BWCA 3WADA 2VTBB 2GXQA 4RCZA 2ZRDA 3OFND 1JWLA 1F2VA 1Z4LA 2QM7A 2JGIA 3L8CA 1EP3B 3WRXC 3ZWMA 3ZCUA 4GOKA 2X13A 4O4JB 5JV5A 2D5LA 3MJFA 2HYIC 5CNIA 4GOXA 1NHGA 4WXRA 2FMTA 2AK2A 1G21B 1NRWA 1Q95A 3KPYA 3GEHA 1U1FA 4AO8A 3E3MA 3UAZA 3ABIA 1HKUA 2DUMA 3DEZA 3FGPA 3KV3O 3D8SA 4TRNA 4OYHA 3AWDA 4EAQA 1YI1A 3HUTA 1M2JA 2OVBA 3HP7A 3WLRA 4AQYB 5EPUA 2W6IA 5TT1A 3TNDA 1KH3A 2C0CA 1TMKA 2FOIA 2NU7A 3R6DA 4HNQA 1GQSA 4QHTA 3TQFA 4B73A 2O8EA 1DO2A 3PPVA 3IIEA 1PJBA 2VTVA 4DE5A 2FNAA 3L46A 2C9OA 1NUAA 3A4TA 4ZIRA 2GCIA 3V55A 1SXPA 1N2IA 1OC2A 4RELA 3HM9A 1E4OA 2GESA 3EIOA 3LHSA 5LNK6 3EIEA 2UUAB 1NUSA 3ECCA 3RLFA 1BMTA 4HBZA 1XHEA 4JQOA 2PXCA 4KJXA 3V1UA 1M10A 1ZH4A 3SHOA 4Z0NA 3TW6A 4LVOA 2RC6A 3FYUC 2DWCA 4G8DA 1U0OC 4GS5A 3TL3A 5B1EA 1MJGA 5AM0A 2Z5VA 1PX0A 2ERYA 1V8PA 1OREA 1YDWA 3QPDA 5B2ZA 1NUHA 3IHWA 1MO6A 2RMKA 2AL7A 5AW6A 3DYBA 2HPHA 4DMUB 1WW3A 2O3JA 1E8MA 3OZEA 5CYPA 1L7XA 3LC1O 3FFTA 5H0IA 2IZOA 1M83A 1ECLA 2FSIA 2O2YA 2I3BA 2VPPA 1P5RA 1WXXA 2WKPA 4PYLA 3CX6A 1A7JA 4QYIB 3WKCA 2D5IA 3DTVA 3CS3A 4WI1A 1V16B 3PHHA 2CHUA 1WDMA 3TLYA 4DQ0A 1GGHA 3OHMA 1YVRA 4X90A 3AF3A 2IDKA 4LHZA 4YRSA 2WF5A 3R3VA 1PR1A 1TM2A 4FGUA 3CPJB 2JK1A 4Z4IA 3PDJA 2QXUA 1Y0BA 4B33A 3U3JA 5KVVA 5E0KB 4EKGA 1Y37A 1LBTA 2PQ0A 2XGSA 4JBGA 1EP1B 4P08A 3NKLA 1R6XA 2RB5A 4LZZA 3B20A 3JQPA 4M7OA 3RU2A 5KVCA 4CEJB 4V39A 5CFMA 4XVHA 2CNLA 3F96A 4QDJA 5C7LO 3PDUA 3FD8A 4G4GA 3NBMA 4YA6A 1QKJA 1QUEA 1VL1A 1SHKA 3S2UA 3ACBA 4BP9A 2ZYDA 2WIGA 3D7MA 3KXDA 4YRQA 4DG8A 2EIXA 2CV0A 1QH8A 3RAGA 3EPHA 2XCQA 1W87A 5CT8A 2BGJA 4DPLA 2QAGB 5CXXA 5FPHA 1MOZA 3C8HA 3FDZB 3PC8A 1GCGA 3TO5A 3N75A 1JQBA 4X1KA 2AOXA 3P9RA 3D8TA 3C70A 3HI6A 3FZYA 2NU9B 4CEHA 3ESRA 3DDOA 4L0QA 5I7AA 3UBMA 4YROA 2P2YA 2I6QA 5CDYA 3NHYA 4LZNA 3T9FA 4W8HA 1JR3E 2FMHA 1KORA 1KVQA 1BW9A 1XJ5A 2OFPA 3QNMA 1WD7A 2MHCA 2H5EA 4IGFA 4XUDA 4Y1EA 2YJ3A 3TZHA 4ERNA 1L3BA 3WBKA 2UYGA 4ND7A 3IT0A 3Q5DA 4GMHA 4IY1A 3VX4A 3MF4A 1V35A 1VMDA 4ARSA 4HXFB 3PIRA 1JSZA 4CEJA 1DVRA 1Z8FA 3DUWA 4GGMX 3DFMA 2JHPA 2C88A 2FDRA 1VBNA 3NHMA 3OKCA 2YHIA 4JC8A 5M2QA 4AKIA 1L5GB 3TN7A 1Y8QA 3VH4A 4Q9JA 2WTMA 3ANNA 4PN7A 4JSYA 2GCOB 4A2PA 1RSZA 4ALNA 2BMEA 2J3EA 3ZV7A 3TW8A 3R3WA 1NPYA 3N2KA 4LDJA 3P2JA 1EVQA 3L43A 3VPFA 4AZ0B 1UFVA 4KREA 1PR4A 2P2GA 4C01A 4IIJA 1BFDA 1QU2A 4ZGWA 5DLPA 4AKTA 2CF6A 2ZQYA 4KE8A 4DLSA 2WJ4A 3N39C 3SP1A 3LKZA 1Z0DA 3K5HA 2XODA 3DAFA 3PDHA 3L1HA 2J0UB 1DCFA 2GAOA 3EWIA 1MC4A 3LQKA 1XNHA 4P58A 3O8LA 5FPYA 2WWYA 5CVVA 3HDTA 1POXA 3U37A 3U3MA 1KZGB 3L0DA 3O8OA 4V0ME 2GVZC 1C14A 2VHYA 3X1JA 3SVLA 3HKBA 4DWVA 1EDEA 1MZVA 1QH9A 3IKJA 5DHAA 4EMSA 1G63A 4Y6QA 5K09A 3OO1A 4GX0A 4B4WA 1LF0A 2FN4A 3ISTA 1GEGA 1E1YA 4RE5A 3CSUA 4EW6A 4Q16A 1M0SA 1KVTA 5EHZA 3NASA 1RD4A 3BAZA 3KJEA 2GERA 5JPDA 3WVNA 1DFHA 4L02A 1IFXA 1YA6A 4ZT3A 1H2BA 3RHFA 5EVJA 2B6HA 1D2EA 2VJAA 2BR4A 3EUEA 3LP6A 3AKYA 4G6ZA 2RDMA 4X97A 2Q07A 2C54A 4NCKA 4HDMA 4RHFA 4RHYA 4WY5A 5KQPA 1EB8A 3KQKA 1E99A 3SXUB 1FF9A 3T3IA 4WUTA 4RJTA 5KJFA 3CVUA 3HHPA 4M46A 2VPYA 2ZIXB 2Z6QA 3RKRA 4OHWA 1C7JA 1P19A 1PDWA 2CK3A 1K27A 4MIOA 3A1VA 3ADKA 3QE3A 4UD6A 5ALYA 1EFRD 5EFZA 5JH7A 4IMRA 1XD9A 2QRJA 1Z5ZA 2EG5A 4XJVA 4L76A 4G1VA 2IV3A 3SIXA 5JQWA 4DCGA 5J2TF 3EVTA 2AGVA 3KJHA 5ESXA 5KQMA 4JI4B 1BGWA 4AG6A 1YL6A 1RQ7A 5HJEA 2IOYA 4R1OA 3RFXA 3UJAA 1WXHA 1CDOA 2YIVX 2QYSA 2VDWB 3G9TA 3KKKA 4K6FA 1I0LA 4MQEA 2JFXA 4OFZA 2NAFA 1U8YA 1PLKA 4B3CA 2R60A 3QVGA 4W7HA 5J2UF 2BT4A 3TCXB 2G67A 4XX0B 3T4PA 3WHIA 3HS3A 2QWXA 4U3JA 1IZYA 1OWOA 1T25A 3VPGA 3B7GA 5DXJA 1AHIA 4AM8A 3FMPB 5IJXA 1WXWA 4I1YA 2PWPA 4CFZA 1FS5A 3H2JA 1FDVA 4RJJA 3ODPA 2OBMA 1XXHE 3D6UA 1IB6A 5EXDA 3HJAA 2CFIA 1EUCB 2EGGA 3AIOA 3WGZA 5BMVB 1RHMA 3DZKA 4XSVA 5KYXA 3RYCB 1XBTA 4HVTA 5F3DA 1H5QA 4HFNA 4O29A 4X91A 3SQMA 4CW7A 1QPZA 2O0LA 4PGFA 1MAUA 2F90A 4HEA1 4LJYA 4RQUA 2FB9A 5DYGA 4AJOA 3HR7A 4EMTA 5F98A 2IS1A 1E2FA 1F2UB 5G02A 4N47A 2GJ9A 4DA7A 1S3SA 3WQRA 3MCZA 3QM1A 1L5OA 1K7EB 3AVOA 1GYPA 4LEIA 1CUSA 1NE7A 4OQNA 4X1IA 1IRIA 4E46A 2YWXA 2Z43A 3BHNA 1XEWY 3I32A 4Z7OB 4F12A 4HH4A 1SXJA 3AETB 3D8UA 3GFVA 4DGSA 3GC6A 2D2FA 5E7IA 1KPGA 2NAPA 1NKVA 4EB6A 2XQVA 1J0DA 4P98A 4MQLA 4RHXA 4IYJA 3EMVA 4FZRA 1GQFA 2ODAA 4LXTA 2PT6A 2O3UA 1EM8A 2C82A 2X9VA 2P5UA 3SU8A 4MR9A 4PXSA 4MDYA 3WBBA 3PFBA 4H31A 1LRLA 3JTMA 5ITVA 3NOXA 1P9OA 1GPUA 1HYBA 4NBLA 1CQZA 1L7OA 4MHOA 1GZDA 2F1KA 3E05A 2V7EA 4LS3A 1G291 3AR7A 3SC3A 1W48A 4KR3A 3BE4A 3OT4A 4K26A 3IQGX 5EQTA 4JP2A 4OBEA 3B13B 3GLTA 4QTZA 4RF3A 2UUBB 3CW2A 1D03A 1IWPB 5DDIP 3AZQA 4URYR 4ZYWA 4TSFA 1O77A 1U8FO 3HSKA 4UCWA 1QSGA 4MKRA 4WKNA 5M34A 1QRSA