2VCOA

Crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Intervening with Urinary Tract Infections Using Anti-Adhesives Based on the Crystal Structure of the Fimh-Oligomannose-3 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2vcoA00
3RFZA 4X5PA 3ZL1A 2JMRA 4XOCA 4AVJA 1N12A 3BFQG 2WMPB 1KIUB 5ABZA 1N0LB 4AVHA 2XG4B 2JTYA 3BFWA 1UWFA 4AUUA 3ZPDA 4AUYA 4AVKA 2VCOA 3MCYA 5AALA 4AV0A 1KLFB 4J3OG 5LNGA 2J2ZB 5JQIB 2UY7B 4XOEA 4XOBA 4J3OH 4AV4A 5CGBA 4X5RA 4XODA 3JWNH 3ZL2A 4XO9A 3BWUF 4AVIA 1ZE3H 2W07B 4BUQA 4AUJA 4CSTA 5IQOA 3SQBB 1PDKB 4J3OF 5AAPA 5FLUA 3JWNG 5FWRA 3ME0B 2XG5B 4CA4A 4LOVA 4CSSA 4AV5A 5FS5A 5IQMA 4XO8A 4ATTA 1TR7A 3JWNE 5IQNA 1QUNB 5FX3A 5F3FA 5AB1A 4XOAA 5LNEA 4X5QA 4X50A 2UY6B 5F2FA
chains in the Genus database with same CATH superfamily
3CUPB 1XF1A 4PJ5D 1I1AD 4RGMB 3D0VB 4D8PB 4S1DC 3SDCB 3L9RA 4KZDL 3B6SA 1MZYA 4LNRB 4PRPA 4X6FA 3QQ9D 5CSZB 1RUPL 4LHJB 3AVEA 2WVUA 1JRHI 4QI3A 5I6LA 3NDYE 3MLZL 3CU1A 4JDTL 5L2KE 1OK8A 4XNUH 5DD5H 3GPEA 4IIQA 1V3MA 2VDLL 4R90L 2MTAA 2D0GA 2M83A 2QGBA 5AOIA 2RFXA 2VR9A 4JN1L 3HE6D 3RVXD 5DHYB 4CVXB 2ZWYA 3QIWA 2V3EA 4JFED 4XVJH 2J5WA 1IE5A 4G5ZH 4TL4A 1A1MB 1S7XB 1X6NA 4M1CC 5CJ8A 3W0WE 2ADGA 1WZKA 2AI0H 3MRMA 2V17H 3HC0A 1LWJA 3QNZB 1LGVA 3FT4B 1RU9H 3OMZA 5AW2B 1Y1UA 2H1LM 3BOVA 3GXTA 4YDJA 1QYGH 4L5FL 4NQSA 1MKFA 2DZEA 4OGYL 4X7SL 4XMZA 4TS6A 4F2MB 2XIIA 4JB9H 3VW3H 5EWIH 3L9RB 3RP1A 2ZXGA 3B6SB 1PBYA 3FQNA 1H5BC 4X6FB 1V7ML 4JR9H 4MLIA 1TPXC 3CH8A 3TYFA 4AQ1C 2Y1YA 5TDOA 2ZUQB 2MCPL 3TBYB 5ERWA 3TH2T 5K9QI 2IJ0C 2BNRE 3FQ4A 1INQA 1M2VA 1C5BL 1J9TA 1CQYA 1U4FA 5EBGA 2DQEH 1OSPL 4ELDA 4JX0A 4IIQB 4TVPH 3KYKH 1ZV9A 4G1EB 1DHKA 3SO5A 4AEHL 2HT3D 2LOEA 3FSWA 2ZYIA 3D2UB 5D5MF 2VDML 1FAKT 2P49B 4JFZH 5FWRA 2NTSP 4PJCE 3MLXH 4JAMA 5AOLA 3N44B 2ADGB 3MRMB 4S1RH 4LP4A 2Y7NA 1JHTA 5LQBH 2OSXA 2X10A 3C8KA 4U1HB 2G2NA 4UAOB 2A4EA 1BQSA 2YAEA 5LBSA 7TAAA 3TA3C 3D25B 2ADIA 1X6LA 3J27A 2ZD0A 3H6JA 2OK0H 4NQSB 3ARBD 5BV7L 4Y19E 3Q43A 4FFYL 4NKDA 3FQNB 3DJSA 2WBXA 2WLMA 2I5YL 3TYFB 1CDCA 5F7LB 5EO0A 2FEJA 3X1FA 4OCSL 5ERWB 4MGXA 1INQB 3MV11 5B39G 1M2VB 2JJWA 1J0KA 2P80A 2VXSH 4IBLT 1JFHA 4WCYL 1OLZA 3EHBB 5C0CD 4AGOA 4Y0GA 1N59B 2B16A 5I1CH 2BP8B 4KJYA 4NJAL 4BKLA 1EXUA 4K9EH 3KCPA 3F6LA 4WFFE 3TEWA 3BSGA 3HZMA 2VLJE 2DLTA 1OCOB 4JAMB 5EZLB 1FSKB 4MFHA 4ICWA 4ODUA 4RQQA 1I8MA 4QRPA 1OY3B 4NHCL 1JHTB 1F41A 3US1A 1UZ8B 3BRFA 3A6CL 5D7KD 3OB0H 3U7YL 1MLBA 5CZVL 3HZ3A 1KBKA 4HS6A 4D7BA 4WI2A 3ZRFC 1KGXA 2ADIB 3G5VB 5JHLH 4KY1H 2RIKA 5GZOC 4Z7UA 3WEMA 3FU6A 3CBRA 2DB8A 2ZT9C 2CGRL 3D85B 2OYMA 5I1EH 5F6IB 4JCWA 1JE6A 5M7QA 1NINA 1L9TA 5EO0B 4PB9H 1URIA 2K6WA 1BG9A 2G4GA 2VC2B 3WJLC 3S36H 1BQ5A 4HWBH 1TQWA 4OIIH 4OLUH 5HHVL 2WZAA 2XU9A 3RJDA 1QFWH 1XGYH 4FXKA 3KXFD 5CAYB 4FF9A 3ILPA 4DQAA 3FQYA 3EXJA 3A4EA 4BKLB 4F5CE 3NJKA 1EXUB 4CU7A 3KCPB 2Q2EB 2PW1A 3WEAA 3HZMB 5DJDA 4PIBA 1DL7H 2R2EB 3QXAA 1C5CL 5AG8A 4RQQB 1QI4A 4ODUB 1F6FB 2WXIA 4QRPB 2ZOUA 4E9WA 3SGEI 1AOHA 3TJEL 5ELIA 1MLBB 4OUUA 3DVNA 2G3ZA 3QUMA 3C2SA 1IC1A 1NQBA 3V0WH 4UTAH 4HS6B 5E5MA 5C2BL 3ILEA 2HXAA 4L8CA 5HI3D 1OWWA 4IKJA 3CDCA 3ZDZF 2LFGA 1A2YA 3Q1SH 4Z7UB 3W9EA 2NY0B 3QUKA 5D71H 4BK8A 2MQGA 3WENA 1JV5A 3IPBA 5J6HB 4FMVA 4MJ5B 2MPAL 2EDEA 4G8GB 4P99A 5KS9E 1ZEAH 3DGDA 3EYQD 4PJ8B 2V4LA 3V0VA 4G8AC 3D09A 5LKNA 1AGCA 2NY4D 3PWNA 3QSKB 1NM4A 1DQMH 2FIRT 2G60L 4AEFA 4U4IA 1R46A 3CVHB 4FXKB 5HYJE 2VO8A 5FHAH 2BOLA 4OLZH 4CRPA 5H4ZA 2CO3A 5I8EA 4B0MB 4KWUA 1UZ6E 1IE4A 4LCWA 5PCYA 5DJDB 3DGGB 4L18A 4KX9A 3QXAB 5F21B 3UAJA 4JL1A 4U0RB 3MLUL 3U2JA 4X6DF 3DVNB 1KXVC 2OULB 5B22A 4ZAKC 3MKGA 4OAWA 1CMOA 1AGFA 1K8DA 2OSLA 4WKZB 4JGNA 1FWXA 1KIRA 1EUTA 5E5MB 5DMKB 1O7DC 4L8CB 4L2YA 4ZSOA 4YSOA 3TIEA 2Z8SA 2QMJA 1A2YB 3QNXA 5T1JA 2Y5EA 3W9EB 1EQWA 3RU8H 2IH8A 1RZQA 4X0KB 3IMVA 3M17A 1JV5B 4LKCA 1B4LA 5ENWA 3NZ8A 4HZLA 2X2UA 2O61A 5KBDA 1TVBA 1DLFH 3EG9B 3ESUF 3I6LE 3ISYA 3RX7A 2H6OA 5BOZG 3V0VB 2HLFD 3KS0J 4FYSA 1TEYA 4D9QE 3PDDA 2Q86B 3SB3A 1YY8B 4A66A 2VR4A 3ZYJA 5ANHA 2NXZD 2VCOA 4D7PA 2NDGA 3PQYA 1M7DA 4HEPA 4JO5A 1XGQA 2JK5B 2EIJB 2WLJA 1QSFE 5I8EB 4FQ1H 3PWPA 1T03L 3MRJA 4Y7MA 5EUOF 1WFUA 4LCWB 4U31A 1BQKA 1WP6A 2EZ0D 2YOCA 2WP3T 5LNGA 1NLBL 4HCGA 3DNKA 4PRPE 5H94B 3O3UN 3II3A 4WI9A 4XMLH 3K2UL 1TJMA 2FBRA 2QMKA 5F8RC 4HH8A 4OAWB 1AGFB 1K8DB 1LDPL 2OSLB 4IRZL 1L9OA 5SX5K 5GZND 1U58B 3TIEB 2CG9X 2R56L 3BHBB 3NFPA 3THMH 2IBZX 3MV8D 3QFDA 1QLEL 4PGCA 4DP6X 4FZEL 1Q0EA 3FS9A 4LKCB 2CKBH 1JFQH 5ENWB 3NZ8B 4HZLB 4KI5F 1X9LA 4DN3L 3B2VL 1TVBB 3FO1B 4IJTA 2C5DC 4OV5A 4UAHA 4AKOA 1G87A 1QPXA 3V5HB 3ZBMA 4DF9A 1LWHA 2YAMA 3M1CA 5DSCA 2HJLA 2KMWA 3JTBA 3PQYB 1M7DB 1XGQB 1CFMA 2AAVA 2JF1A 1UGKA 3HG4A 3U9UA 1ZLVH 3DO7B 1IVTA 1NL0H 3PWPB 3S5ZA 1FPTL 4ABVA 1VENA 5AVXB 2R9HC 4FG6C 4HUWB 2YD8A 4E41E 4L9LA 4F7TA 2O30A 3QPXL 2APWA 5J11B 1PLBA 3GI8L 3GK8L 4GEJA 4PVLA 4WI8A 2NY5C 3H6AA 3KBFA 1Y07A 2RJMA 5L8LB 4EIBA 3FUJA 3L48A 5F9DC 2OTUA 1J9QA 5KYNA 1C5DA 3NFPB 5DZNA 4H7VA 4M1DH 4Q9CA 3DPBA 1BM3H 4J1UA 3SKUD 4EUPG 1JRHH 2UY7A 3NCEB 5IJBC 2AV1A 1TTFA 1MQKH 4GMTH 5IHUH 4KDTC 1YC7A 1PYWB 2ADFH 5AVRB 4EUPH 4OV5B 1I85C 3I2CL 4AZ8A 1KCVL 3UEQA 2VXVL 3ZZSA 5DSCB 2HJLB 4MCYB 3LD8C 1GSMA 1CL7L 2DN7A 4TQHA 4GQ9L 2V7HA 3RQ3A 3CC5A 3U9UB 4HAKA 4K71B 4YHKH 4A38A 1WWAX 1NAMA 1FGVL 4IQHA 5KVMC 3B9VA 3R1GL 5I75B 1YJDH 2JB5H 5IHBA 1K5NA 4BINA 3LHAA 4IK7A 4L9LB 4AYSA 4F7TB 3OG6B 1D9KA 5DUPL 5FYKD 2OR9H 4PJEA 3SCMA 1E5CA 1EANA 5GSVA 3TBVA 3CZJA 3FUHA 4Z7VB 1JNNH 1A7QH 4J28A 3LXAA 3Q5TA 3O11A 5KOVC 4X4MA 3RFRA 5FDWA 5K9QG 4LLQA 2OTUB 4XN7A 1C5DB 1GYWA 1GGIL 2W94A 4M8RA 3UROR 1AVAA 2HX7A 2XZAL 3DPBB 4MD4A 4J1UB 3T0DA 2UY7B 4G9FB 4LHQB 4XBEL 1SF5A 2AV1B 1FGNL 3U0TA 3V4PL 1YHPA 2UZIH 1RFDH 2UYLA 3VGDA 4U1NA 4AZ8B 5ANMA 3CQQA 1MAML 1MW0A 4OCWL 4QRPE 4UUJA 2MNJB 2E75C 3RWJA 4DK5A 3T4AB 2NOYA 2EDKA 5CCGE 2D03L 4Y1AD 4Z3FA 4JMNA 5JYLA 2A4ZA 1EMTL 2BM3A 3APNA 3L9BA 2RALA 3CC5B 4OV6F 5SWSA 2BPBA 2C9VA 1OT2A 4Q4IA 1AQMA 2F15A 2MQ3A 1K5NB 3C5JB 4Y4KC 1KIUA 4DZBA 2GI0A 2DYPA 3FTYA 3JWDC 1D9KB 2ATKB 2VQUA 3OR6A 4FN0A 4PJEB 4BD4A 5DFVD 2X42A 1BXVA 2JELH 1SJHA 2CUMA 3GFUA 5I1HH 4H0IA 4UM9D 2W80C 4Z7VF 2EIKB 3O11B 3O4LD 2FNWA 1L0PA 4LLQB 3VSTA 4B7LA 3MBXH 4U2ZA 5K9KA 4I3GA 1ZVHA 3FCSB 3HZKA 4K3HA 4MD4B 5IMKB 3E8VA 1PF3A 5HYFA 4PB0L 3DBXA 1MI5E 4JKPL 4YHMH 3L4CA 5F96L 3U0TB 2UYLB 2KH2B 1PX4A 4U1NB 2HFGH 3RWJB 3QDMA 4D9RD 3LPPA 5L2JB 1BVLA 1UEYA 3R18A 3GUTA 2FBJL 4N8VG 1G6RH 1WBZB 4ALAH 1NCDH 1FI8C 4HD9A 5F72S 5FGBA 1SEQL 3UP6A 3HS0C 3ULVL 4UZUA 3LHPL 4NEHB 1KELL 1NFKA 1J48A 3HRZA 4JM2A 2CRIA 3LKQA 4G43A 1Q1PA 1KIUB 1C1EL 4EIGB 1YEDB 4HC1L 4A2FA 1SJHB 2W9DH 5F71A 5EEZA 1EZVY 4NB7A 4XN4A 1XR8A 1QACA 2HRHA 4PVNA 5LCVL 3V55A 3T6VA 5JQ6H 3C08H 3F65A 3HR5A 1LEGB 1AQKH 2CLRA 3UPRA 2VDRL 5K9KB 1K72A 1BX2B 4BHUA 3HZKB 2AJXH 1DO6A 2X4TA 4APXB 2A74A 2OJ1A 3DBXB 2EC9U 1J5CA 3KBPA 5EZOH 3WS3A 2CQVA 5FM8A 3BPNC 5JHMA 3GXDA 3F83A 2CGZA 3TZVA 1BVKA 3M6DA 1TQCB 4G70B 2P52A 1BVLB 3GUTB 3GMLB 4H25B 3V0JA 3TV8A 4UQAA 2E27L 1BFVL 3IJEB 1BSIA 1CFNB 1FYTD 1QR4A 2SEBA 3PHOB 4MCZA 4GXUN 2IBBA 4ZSOE 2GQHA 3OGOE 4NO0A 2ZONA 2FSEA 4MZ3A 4P9HH 1ZIAA 2XBDA 3CPLA 4JM2B 3SGEH 3VFWB 4JM0A 1FYHB 4UT7H 1ZCRA 2IF7A 4K5MA 3MJ7A 4J23A 4ONHB 1NC4B 1U36A 4IYKA 1OANA 3MYJB 3VCLA 4NQEB 3L95B 3BSZL 4N0CC 4KROC 2VW6A 5I8CB 3HR5B 5DHMC 1IC5H 2CLRB 3UPRB 3PQYE 5T5FA 3FRUA 4U1JA 4OI7A 1TETL 5HXMA 2LLNA 2NX5A 2E59A 2X4TB 3PWPE 4Z7QE 4NUGH 2A74B 3U48A 4J8QA 2I85A 4DPRA 1G5AA 3WS3B 4WNQA 4WV1B 2C3HA 3TZVB 1KEGL 3ML8A 3VH8A 3QORD 3RPIA 3SD5A 5BV7C 2EXYD 3MODH 2VW4A 4ECNA 4LCUB 4ORZC 2SEBB 2WINA 4MCZB 4HFWA 1HCVA 2CE6A 2J1ZA 4NO0B 2EO9A 1TTGA 2FSEB 5JO5A 2NZIA 3LNFA 3K72B 2X4RB 4HFUL 3CPLB 4HSQA 1MG2C 2A77L 4X99A 4LEOA 4NJ9L 1F4AA 1WZAA 1Z7JA 3MJ7B 4HV8A 4A7SA 4ICXA 5HYSG 4N2HA 3UJTL 2IGFH 1CLOL 1R17A 2L8AA 3MGAA 4RFNC 3VCLB 5FYKH 1JGVH 4QGYA 3BJLA 4ETYA 3DUSA 1CWVA 1GSKA 5E1IA 1N7MH 1BD2D 3QG6A 3FRUB 3JV5A 4U1JB 3X13B 2I26N 2NX5B 5B7EA 3HA0A 2P7TA 3N41B 1JYWA 2V0AA 1MHCA 5BXFB 3QUHA 4WNQB 1AI1L 1VB9A 1EHKB 1Q72H 1WZ1L 5CUSL 5AW3B 3IXAA 3VFMB 4UYQA 2XDHA 3OKEA 3VH8B 3RPIB 2PYFA 1W16A 2VZSA 3B9KB 4AQ8A 4H2AA 1A3QA 3IS1X 4NKMA 3BSHA 2FATH 4DN4L 3S8FB 4IDLA 2YWYA 1B3IA 2VQTA 3GC3A 4HFWB 5CN1A 2VM9A 2XLLA 4YL4A 5JO5B 4ZBJA 2PR9A 3FU3A 4X99B 4XP4L 2HCZX 4LEOB 4M7KH 2HKHL 1JYVA 4FD0A 1VPOL 4HV8B 4AK1A 3BXNB 1DBMH 2H3KA 4MNQA 1IBBA 4AM0B 1TQUA 1PZDA 3HNVL 4M03A 5EC1A 2OSWA 3O3EA 3ZMNA 2FD6H 2GSIA 2QL1A 2BERA 1JGEA 1A4JA 3QYCA 3NJIA 1A9VA 3NFSL 4G2AA 4HHAA 2X1PA 5CP3A 4AMXA 4TUKH 2P7TB 2A3TA 3WY3A 1OGAA 1MHCB 4WU7B 2P5WD 4DPCX 3AAZB 3IXAB 4PWEA 2HN7A 3OKEB 3QEGH 4MDIA 3BN3B 3UMTA 5BUGA 2PYFB 2A6JA 1AC0A 4OZIA 5GHWH 2F6AA 4JRXA 4H88H 4ONFL 4OM1H 3DXAE 4MAYD 1QBML 4XH2A 1WPCA 3V4UL 2CO6A 3SQRA 2VWEC 2OLDA 2A7BA 4GP8B 4OCNC 4LPTA 2BS71 3TASA 4WLCA 2VRQA 1Q9KA 4UT6A 3VFTB 5C86A 1ACCA 4PJIF 3RDJA 4BSJA 4Z18A 4WUUD 5I73B 3M8OL 2YAOA 1M7IA 2ICEA 1TNMA 4MNQB 3KJ6L 5HI4C 5I0DA 3EYOA 1O9ZA 5ANME 4XP9L 5CKAA 5EN3A 5EC1B 5KVFH 5IHZA 3O3EB 5F7WC 2GSIB 3NN8A 1JGEB 1A4JB 1JNHB 5E99L 3ZKXC 4QRTA 5IEHA 2G3XA 1AXTH 4PTUB 3SDDB 3QDGE 1EFXD 4HHAB 3GDBA 3ARYA 5B1CA 5SWSE 3PDGA 3HUJA 1FO0L 4AI7A 2YMOA 4WZ9A 2GEQA 1LVEA 1IC7L 1OGAB 2KT6A 3W2DH 3UABA 4DSYA 1DSFH 4FFZH 2XG5A 1MJ7H 3I02A 2HN7B 1KBBA 2IO5A 2ZKXA 3TWYA 2JKSA 2WVSA 3BPLC 3LN4A 2YSTA 2L4OA 4GI8A 4JRXB 5DF0A 3VRLE 2X0VA 5TDNB 4XH2B 3TH4T 2CO6B 5F7UA 3QJUB 5E23A 5I6MA 5H35A 1VSCA 1H19A 3SE3C 5FA4B 1CBVL 2EDBA 3SGJC 1Q9KB 4AENA 3Q6GH 5ISZA 1H3PL 2BIMA 1M7IB 2ICEB 5D2LE 5EG6C 2ICWI 3EYOB 4UTBH 3D06A 5KZCD 1DQLL 2C4FT 3QDME 1NGQH 3HE7D 2ZWLT 4MTMA 4YL9A 2FGWH 5GGTA 2EICA 4XC3H 4W6YB 4K3EL 3RG1C 1RSYA 3M88A 3Q8CA 3HUJB 3RNQB 3RBGA 3VMPA 5KYWA 1U3HA 1NCCH 2BJML 1IGCH 1QFWM 1SJEA 2DOCA 2P5EA 3EYFB 1U3YA 2BC4A 4KI5D 1DFBH 1PCSA 3G5WA 1T83A 4OF7A 1EJ6A 2VUKA 4ZPVA 3I02B 5BO1L 1J1OL 3LN4B 3H9SA 4TPRL 4BUQA 1YMHA 2OXGA 2ZUTA 1D6VH 4NZUH 4R5XA 1MRDH 3R0MA 4HLZH 3VGAC 3BKCH 4CL7A 1CB4A 1W72L 1CBJA 3VFVA 3FO0H 3NZUA 4IKNA 1I1AC 2D3JA 4Z7WB 5HDBF 4NCDA 4L4VA 3AG3B 4WWOA 4AENB 2G5BB 2EDQA 1N68A 2A6DB 2N56A 5ISZB 1O0VA 4AMWA 4N2MA 5IROD 1R3IH 2CXGA 3A47A 1H3XA 1HHHA 4U1GC 3NFNB 3MRGB 4N0YH 4J3OC 1S46A 3MRHA 5JIKA 2YAQA 5KYWB 3MOQA 1U3HB 1B2WL 2CK0L 1SJEB 5GGQL 1IEBA 3P0GB 2Y4SA 3RVXC 4L05A 3IXTB 1NCHA 5I82A 3VDAA 5FCUH 4ZPVB 2I07B 1U8NA 1YEKL 4Y5XB 1MXDA 3BJ91 5DXWA 5GGRA 4LEXH 5DJ6A 3BMWA 2DWSA 5CJ5A 4V2CB 5AW1B 3QO1B 1YMHB 3WKQA 5FB8A 2WO4A 5I0VA 4JO2H 3GRBA 5DJAA 2WB1A 2NX5E 1FNEB 2X4PB 2FX7L 1MELA 4L4VB 4XI5D 3WKPA 1SFHA 3FCTA 3TBWA 4BK5C 2DWTA 4C56D 4E9TA 2A6IA 5I71B 4EN3A 1O6SB 3QEUA 2QGEA 4EN2A 4BXSV 4LSSL 1L9RA 4HUVA 3MNDA 5CMAA 4A39A 1ETB1 2PCFB 2WJ5A 1E7VA 3Q2WA 3KZ8A 1JTTA 1U6AL 5JXED 2PYEB 3Q48A 3S37H 1C7SA 1S9VA 3QIUA 1WFJA 2QKIC 4H13C 1IEBB 1A4CA 3DDFA 3GKZA 3VI4E 1O5PA 1L4IA 1TYEB 4AT6B 2YK1H 4HYTB 3U2SA 1ORSA 2HLAB 3GRWA 3HG1E 3QJHA 4JFDD 4EI6B 3ZQXA 1U8NB 1NFDA 5GGRB 5IWLC 3K8LA 3NRQA 5DZAA 4ZUVA 1Z0MA 4W6WB 5SX4I 2QDVA 1E40A 4R7DA 3GSUA 2JJSC 5DJAB 4YZWA 4RETB 1DO5A 1Q0YH 4LVOB 1LEKA 5JXAH 5F88B 1OQXA 2HJKB 5TK2A 4P46D 3TBWB 3ELQA 4Z5RA 3TT1H 3V8CA 2FQDA 2KZ1B 4EN3B 4AUJA 3QEUB 1UFGA 1PY0A 3BQVA 3EYSH 4ISVA 1WT5A 3DIFA 1P4IH 1NMCC 4HW6A 5LGHH 4RZKA 5CMAB 2GIYA 3MOBL 5I0ZA 1I4FB 4WW2A 4Z0BL 5FUCC 3QUYD 4GXVH 1DBKH 3NIFE 3KDMA 2IAMC 3M1BA 5FHBL 4PRIB 3PGFL 3PIQA 1F58H 4P23B 1S9VB 3N0PB 1XD1A 1AD9A 5E2UH 3QIUB 2P1YA 5C07A 1TZAA 5TD4A 3ABKB 5E08L 1G1OA 4AYBA 1NSNH 4BZ1H 3CMGA 3HC3H 3U2SB 4PH8A 1ORSB 3QJHB 2I9TA 4LGPB 2Y22A 4H20L 3BD4A 5EB9A 2XTJE 1VFAA 1XCXA 4ZUVB 3QS2A 1HHGB 1A22B 4YGAB 2VITA 2VDQH 3DYMA 4R7DB 3GSUB 2JXMA 2Q3XA 2XN9D 4YE4L 4EI5A 1TZOA 3G5XB 4LSRL 4BM7A 2CO7A 1UD3A 2E7LA 1DDHA 3ULVC 4WWID 5CEYA 4ZYKB 1IUZA 5CZXD 3UEZA 1XGUA 2KZBA 4HKJA 1TTAA 2QLVB 3PAYA 1KXHA 3TEXA 4ISVB 5A40E 1A3RH 3DIFB 5JUEH 2CBQA 4OZIE 3QCVL 3AREA 1RUMH 4WW2B 3AFLA 4KRPC 1T2QH 4XB8A 4E5XA 2YUZA 4FQLH 2DLHA 4BFFA 1VFMA 3M1BB 2WNWA 4P5MA 1QRND 2X9WA 4YZFE 5E95B 3OLEA 5EF3A 1AD9B 4EXPX 1IAKA 2OI9C 4HCRL 3FT9A 3L3OA 2AK1H 1V55B 2NT0A 3B8YA 2YEQA 5DQJA 4RAVA 4WWPA 5MENA 5FFGA 3AACA 2ZE0A 2VXQA 3QG7H 2I9TB 5HYEA 2Y07H 3QNFA 2Q0ZX 5KVEL 5E8OB 5TK4A 3B2UC 3DOHA 4JFHE 4GQQA 5EZJB 4NN5B 5IFHL 4FGMA 5BS0D 2GEEA 4P5TB 2VITB 5HI3C 5C3TA 4S1QL 1LO2H 2JXMB 5LN8A 3O2VH 4XPAL 4X8CA 2VDOL 2GFBB 3A5VA 4PYGA 4LSQL 4AC2A 2XWDA 3WTVA 2VQ4A 4OD1L 1FUNA 2QHLA 2CO7B 5KTEH 5DRNB 3HG3A 4OY9A 4IM8A 3K2IA 5EU6D 5IHLB 3AJ7A 3EYQC 1MREH 5DI8A 1Z6JT 5HP5A 1XGUB 4HKJB 4P4KD 5DURB 1RIHL 1ZA3A 4NXSA 2CALA 3O3BB 4JZJA 4XOEA 4MZ2A 1QUNA 1IM3D 5MEOA 3GTNA 4WTWA 5G4OA 5HHXH 1IGIH 2KQNA 4E5XB 1WTGT 3IGLA 1OSEA 1IL1B 2X41A 4NZJA 1IMHC 2HKFL 2MPVA 4UOZA 2EIZA 4P5MB 1RAMA 3WBDA 4B9IA 4D2NA 4F8OA 1ZE3H 1IAKB 3L3OB 4OJYA 3NCJH 1A64A 5E2WL 3FT2B 4FQJL 1URZA 4OLYL 5E9DD 5ISZE 3IDMA 4FQCH 4LPWA 4ZZKA 5TPWL 4PS7A 3P3SA 3RVWD 3EYVA 4E9VA 3NJJA 3QWNA 1TNNA 4IMKA 3WU1A 1S3KH 5I17B 4OD3L 3RY5A 3BWUC 2W88A 1VJSA 1NBYA 3OXRA 5EA0H 5HJ3A 3WE6A 1Z9MA 5DK0B 2B2XL 4MA3B 2I60H 3VXSB 1SXCA 2P5EE 1L5GA 2YN5A 3L3JA 2O6EA 4YFEA 1OTTD 3WFCH 1T21B 4PS4L 4D9LH 4GG6F 3RIFK 2MFNA 3Q6FB 1I7RA 5DI8B 3CSGA 4YHPA 3CVHL 3OZKA 3P30H 3VGGA 1YYML 4CC1A 2HG5A 1CFSA 1Q1JH 1CUOA 1QUNB 2G3MA 2R0KH 3FH5A 3H9SE 3HOGA 3LKPA 5T1LA 5HJGA 3TESA 1S5IH 2Y06H 4R6UA 3KW7A 5AB1A 5IY5B 3LXBA 2RR3A 1T0NB 2EIZB 2RCSH 5ADPL 2FO4A 3UC0H 5C6TH 4Z0XA 3T2NH 5FEBA 1IC4L 1MCPH 1GC1L 1VACA 2XZZA 4KHXH 5F1IB 2EZ0C 4XZUA 1GVIA 2DLFH 3NEXA 2OCFD 3IDMB 1F3JA 1HHJA 1QKZH 1QBBA 2N1TE 1BREA 3EYVB 4QDGA 1SEBA 4XCCL 5LWYH 3T8XA 5GS1A 3BZDA 1NCNA 3FTGB 1Z3RA 1AKJA 3B2PA 3ARRA 2F58L 2YRZA 2AGJL 1GGBH 1NBYB 3CHXA 4H26A 5DVPA 4YXKH 3WE6B 5GZNC 1KCSL 1OM3H 4DP2X 4JN2B 4P06A 1MFBL 4N0FA 5FYLE 1U0QA 2OYLA 4IOFD 1L5GB 1SJXA 3BKYL 1R3HB 3L3JB 4N5ED 4CKQA 4QLRA 3LS4H 4FXGB 4H8VA 4HAFA 3V8OA 3ESMA 3W3BA 1AGBA 5BOJA 4HBCH 3GZKA 2R69A 3O2DA 1I7RB 2QPEB 1E3FA 1OM9A 3AXIA 3WNPA 3CX5J 3WJJC 4YHPB 1T1YA 1A6WL 3AY4A 4M62H 2PXYA 4G6AC 3H7LA 1CFSB 2NW2B 4R7XA 2QVMA 3LKPB 1YPZA 3IBEA 5D7LD 3BVVA 3W9DA 2NY2C 3MXWL 3OAUL 1MHHA 2X0UA 5HGBA 4M7LL 4XO5A 1U92B 4M3KB 3ATAA 3U0WH 2FO4B 4IU2A 3NPZB 4Z0XB 2NQDA 3JXAA 1VACB 2E46A 3JWDH 1AE6H 5D1XA 4B9FA 1D5BA 5C7XL 1J0IA 3HI6L 3S3JA 3WGUB 2PR4L 3VI3A 4N1CA 3DX6A 1F3JB 1HHJB 3NUKA 2Z4TA 1JF5A 4NN7B 2XYBA 4YK4B 3BD5A 5I19L 4FQ2H 3EDDA 5D2NA 4BDVA 4CAGA 5GS1B 3ZO9A 4DGWC 1WFOA 5EIIA 1AKJB 1HL4A 5FM5M 5B38A 4NP4H 3RL1B 3DSNA 3OKLB 4OCRH 1JDDA 5DFWH 3ZHKA 4N0FB 1KGCE 1A3LL 1XXFC 4LP5A 4MXQC 1LP9A 4AEIL 2IWFA 1NFIA 2JI2A 2XVGA 1AGBB 2YD0A 4Y9EA 3FUNA 1KWKA 2K0RA 4ERSH 1T1YB 1UWGL 4MAUH 1VGKB 2EYRA 2PXYB 1NFDE 1ZOXA 3B1TA 4KZDH 4GO9A 2QFPA 3ZQWA 4Z7NB 5BVPL 3W9DB 3TF4A 5HGBB 4RMVA 1CURA 4KMTL 1TLKA 3RDTD 3LKRA 3SE6A 4PJCF 4IU2B 3HVNA 3MRBA 3BX7C 5D1XB 4F92B 3PWJA 1D5BB 2TRYA 3ARDA 3I9GL 5CEZE 3OC5A 4R90H 1MJUL 3VI3B 1OQOA 4E9QA 4JY4A 3VRJA 2BVOB 3UYPA 1M71A 4BH7A 1GS6X 5D2NB 1CL7I 4BDVB 2JKXA 3SE9L 4W9KC 2ZX9A 5DJYA 1OAYL 1ANUA 1WE5A 2BSBA 1SHMA 3HHSA 3X3GH 5I30H 4IIZA 5B38B 2APFA 4IW4C 3OL2A 1UOKA 3QAZC 4L2LA 5KWYC 1BZDA 1ASPA 1TTBA 4ZDHB 4ODWA 5C07E 4N2BA 5IBTL 1PZBA 5DRWA 1J8HE 4LMQE 4P3DA 2ZAHA 5EHFA 4NZFA 1CDYA 4I0KA 4OLVL 5HVFB 4FEIA 3RVUD 4NM4L 2FE0A 1X5KA 2M8XA 3IRPX 2EYRB 4HWUA 1L7IH 4DO4A 5K1VA 5T3ZD 3ZDXE 3DVGA 4AVHA 3H0TA 4E68A 2ITDB 4QCIA 1C7TA 1J8SA 3CK0L 4KUZL 4PJBE 3IGAA 1XSKA 3LKRB 3GXFA 4F7CB 1IZKA 2AQQA 1C5BH 3MRBB 1NKRA 5DLMH 3TF7C 1E8ZA 4WO4D 3LKNA 5F3BA 5F7DB 4NZRL 1OIOA 1H9DA 5SX4H 4JY4B 3GHBL 4JFFD 3UYPB 5KJRL 2PUQT 1M71B 4BH7B 4UILL 3N42F 5AB0A 5EF1A 1ACXA 4FCHA 4R84A 5DJYB 1FRGH 5AZ2L 5DEJA 4P04A 3LVTA 1EZVX 1PEZA 5IM7A 1QPPA 3RWEA 4GQPH 4M6OH 4WWKA 1XZWA 5H2BA 4U7MA 1A0QL 3IFLH 5T1KA 4HUCA 4GKZA 1BIIA 3B3IA 2VLRE 3KCWA 5MENE 4YVNA 2UWEA 2XWZA 1X7QB 2WC7A 3WSQL 4HISA 2CBTA 3C60A 3BIKB 1QLRA 3BDXA 4OIFA 1OK0A 4FFYH 5FYKU 2OMWB 4YDIL 1UA7A 4UM8A 4POYA 3DVGB 1TIUA 3H0TB 3NVQA 1O6VA 4OCSH 5E4EB 3D4ZA 3DYOA 3IGAB 4L3ED 3MLWH 3LIUA 2B1AL 4M48H 3ZE2B 3EJTA 3IRZA 1KNOA 3QZLA 4OT1H 5EC2A 3B7YA 3A3YB 2H7WA 3UO1L 4AYGA 4NGHL 5F3BB 1MHEB 2ESVD 3TWCH 4KUCF 2B3IA 3AS3A 2VN3A 1P2CA 3JV0A 3QS3A 2YHGA 4XE5B 1CLCA 2DLGA 1JZDC 4NQDA 4ZPTA 1LTXA 3RWEB 3BLBA 1EEUA 2W07A 4V1DD 5H2BB 2HH0H 5FAAA 1ZLWH 3L7EA 1A6VH 3VD7A 5KS9F 4G8IB 2N7BA 4OKVA 5DFTA 2HTLC 2YXMA 1BIIB 4GKZB 2DKMA 2UWEB 2ZUWA 3SDCC 3C60B 2Q10A 1GY2A 1QLRB 2O6CA 3FBQA 3UAFA 5GJSL 4J12A 3BUYB 3NABH 4HDIA 4BFOA 4QAWA 3FYIB 5JHLA 1UZ6F 4J4PA 4EDWH 5C0BE 3GPSA 1N12A 1KSRA 2VL5A 4WFED 1KNOB 3APFA 4J6RH 5EC2B 3B7SA 2D31B 4ZD3L 4ENED 1JUFA 4Z76A 1UM5L 4RRPM 1P2CB 3T77B 3CFIC 3VFPA 2YGPA 2HPTA 4HXBH 4DAGH 1LMKA 4NQDB 1C5CH 2E76C 2EDJA 2ODHA 3RTQC 3VFSA 3WIIL 4UT9L 1SMDA 4ZPTB 3MBEA 3KYMB 3U6XA 1EO5A 3MRKB 2ZOKB 4P2RD 4X9IA 1T1XA 4OKVB 1R5IA 4BZ2L 4C4KT 3UIYA 1OPGH 2PO6D 1BAFH 2BCMA 2WYIA 4A2MA 3L4XA 1EAQA 1QI5A 2H2SC 3J7HA 4LHUD 4A6YH 2AABL 2YQBA 4N6RA 3NZHL 1NEZB 2QQNL 1KENH 4HDIB 4BV1A 3NSCA 2IDFA 1XH0A 2QSQA 3CFKA 1FBIL 3K3QA 2NW3A 4AYDC 2VL5B 3AWGA 2VM4A 1XTLA 1KTJA 2XT1B 2G60H 1KYUA 3FB5B 3L4UA 4LXFA 1R5WA 2EXSA 4MX7B 4HOZA 3FN9A 4JHUA 1BFTA 4K5PA 2ENPA 1KB9K 3C6SB 4PCKA 2WD0A 3OB0K 1WCBA 3VFPB 4GINA 2LFEA 4Z7NE 4H4NA 4ZMNA 1YPZE 5JW3L 3GMOA 3OKMB 2HT2D 4OW6A 4BKSC 1HJBC 4H44C 4XCYA 3MBEB 5LO7A 5EIQA 4QRRA 2IQAA 4HXAH 5B21A 1T1XB 1R5IB 4XX1E 3ZT5A 1LNUA 3ECBA 4KTEL 1ZTMA 4FI6A 3P3YA 4A7QA 4AK2A 4PHZA 3VI3E 2NNCA 3GSRA 1GW0A 3ECQA 2YZ8A 1NAKL 5IMOA 2LE9A 4JPVH 5KSVA 5E6ID 1HC1A 1IEHA 4OGAD 3CFKB 3RGBA 3POHA 1PG7H 1HCFX 2F54E 3TBSA 3BP6A 4MVBD 3P9LA 1KB3A 5FKAB 1XIWB 1LP9E 5I66A 5EEWA 1N9PA 4FQXD 2CA3A 4M7JH 3FQRA 1RVFL 2VDKB 4MA1C 2DTMH 1I8IA 1T03H 4UIMA 1FNAA 1CD9B 3Q8BA 1CD1A 4FE9A 5AB9A 5JORA 1AR2A 1WD9A 2FL5A 1N5AA 3GMOB 3NJVA 3KHOA 3BT0A 1ZHNA 3K2UH 2G2RB 4XCYB 3F00A 4PUBL 2Q7YA 4QRRB 2IH3A 3ZUCA 1LDPH 4J3WA 4X6BA 1LNUB 1ZLUH 2R56H 4UV7H 2OL3A 3SYPA 3P2TA 1T0PB 5CILL 1Y18A 3BVNA 3TCXA 4PY7A 4AUUA 2EQDA 4PD4K 1FN4A 3K1DA 4MNGA 1DBJH 3CN0A 4DKFL 3QUZD 5ESVA 4DN3H 5TH2A 5IMOB 2CHWA 4MAYC 3G04B 3HKZA 4Z8FL 3B4NA 1M57B 3FFCD 3TBSB 1DJGA 2EEAA 2C8NA 3BP6B 4FTVA 4H8WH 4QXUL 3P9LB 1GJWA 1HESA 4Y2DD 4Q6IA 5KUMA 2Y0SA 2I7OA 2YLKA 4J3OG 1MCSA 5IT2L 3GKWH 3KPMA 4JQXA 4UIMB 2O5ZH 2WO2B 5JMRA 3TBTA 4M9PA 5T3XL 3T0EB 3S34L 2V8LA 4J3OH 4GKNA 1CD1B 4QRSA 1PG7X 4XR8C 3SE4C 1KXQA 2FL5B 1C16B 2VLLA 1T22A 2KDYA 3CWGA 1ZHNB 3GXNA 1GZPA 4IRSA 4XXWA 1TJHL 2Q7YB 7PCYA 1YLBB 2H2PC 2IH3B 5TFSH 3W5MA 2WWMD 3VG0L 2NY0C 1JPGA 1NDMA 4Y16D 1WD8A 1ZVSA 2OL3B 1I3GL 2BDNL 1B0WA 1E4KC 2ITFA 3BVNB 4QTHA 4HKZA 5DD0L 4MNGB 1UH3A 4PJ8C 4ZMTA 1NOFA 5ESVB 5TH2B 3ASWA 3ARGB 2HVJA 3OLIA 4TVPE 3PV7A 1A6PA 3DVIA 4FTVB 5I5MA 3QHZL 2APBA 4Q6IB 5T3ZL 5HHOE 2VSMB 1CL7H 3A67H 4YR6B 4EUPA 3UZEA 3P4LA 4DW2H 2V37A 2Y1VA 3KPMB 3BDYH 3EO1A 3F7LA 1FGVH 3L3IA 2HRLA 3R1GH 2TRHA 3BH8A 4FKHA 2Y2WA 3FUKA 3SSGA 4QRSB 1Q9OB 1GC1C 3LEYH 2OMXA 5IUCA 1T22B 2A9MH 1R3KA 1ORQB 1WV7T 1P0SE 1YQVL 1OAUH 5KJ7E 1GZPB 4RWYL 5JHDE 3N1GC 1PAMA 2CUIA 1QHQA 3ROLA 2E5EA 2C7UB 3V6OC 1NDMB 2FECL 3MRRA 1S6NA 4PBVC 2OZ4A 3ZO0A 5L2KD 4KI5C 2XZAH 1ZVSB 3P3RA 3PV6B 3SIKA 4QTHB 4MD5A 1S7RA 4HHGA 3KLQA 1FGNH 2DS4A 3A22A 4PP2A 4I77H 1C12A 5E1GA 4GAJH 1J0ZA 2HVJB 3NIDB 2YA2A 3Q8EA 4OCWH 1MAMH 5IW6B 4Z78A 1ZLVK 2ATPA 4PSRA 2W8CA 1CTOA 2G75A 3NDZE 5B1BB 1RZJL 1KPUA 4KK8C 3W0WD 3I74A 1F02I 5AAMA 1V3LA 3O2WH 5BRQA 1Y7VA 2D0FA 1REIA 3LIZL 3I6KA 3QYNA 3EO1B 3L3IB 4JZNA 5HHPA 3D5OF 4X9GA 1RP9A 4PPTA 4NX0A 3HMWL 1R3KB 1TEGA 1S7TB 2BWIA 4HLEA 3L2NA 1EHLH 4ZT1A 3ZSTA 3AB0B 4XWGH 2IGTA 2BOBA 3ROLB 1XSIA 3WE1A 5HHNA 3TYGH 2DQHH 1QHPA 2NNFA 2JCWA 2BNRD 1KTBA 1XB6A 4F8NA 2BW4A 1CLVA 3D9AH 3D50A 3GZPA 4G3YL 1BP3B 3BVWA 1P1ZA 1S7RB 1KDJA 4LIQL 2EUXA 4PP2B 1C12B 1NCUA 2QV4A 1ZWIA 1LM8V 4P9MH 2WBJD 5CR8A 2ENQA 2ATPB 2FBJH 1KPUB 1PIFA 12E8H 3WIHL 1JNLL 3I6GA 3ULVH 2APSA 4XI5C 2NYKA 2ICWJ 3I6KB 4NWUL 4GFXA 4LSUL 3G5ZA 3K91A 2NR6A 1OT1A 3BE1L 3RX5A 5J11C 4WEBH 4LP8A 15C8H 3KJ4B 4YXHH 4RWHA 4DJMA 3NH7H 4Z7QF 1R9FA 4Y19D 3VQ1C 5DJCA 4ZFOA 1RXLA 1ZLDA 3WN5A 4KNQA 3QEQE 4N8VA 4Z7AA 5JIHA 2GBVA 2EACA 4S1SL 4YC2B 1E6OH 5FGSA 3UZQA 1P9MC 3O45A 3BH4A 2AXFB 2GBUA 4ZFQA 2JWYA 1MCIA 3NQKA 4PY8I 5LCVH 1X5IA 5E8DL 5CP7A 3ALWA 5B3NA 5ESQA 2VDRH 3HAEH 1S7WA 3U30B 1XBRA 2DQFA 1P1ZB 1X5HA 1FE8L 3FHEA 5SWZA 5LNEA 2WQXA 4R2GB 5C0AA 2H3XC 1LL1A 1O75A 1ZWIB 3TTSA 4WFFD 5HD8D 5JPMA 2VLJD 4JPWL 1FLRH 4ZMXA 3EO9H 5I6KA 2FBOJ 3I6GB 5CN2A 4K71C 1DJYA 4P46C 3HTLX 3F12B 1W0VA 3S2AA 5I75C 4TTDD 1X5MA 4HMDA 5CLYA 2VLKB 1AR1D 3EFFA 3H3PL 4PIRF 3MZGB 5CWSB 5E5RB 1HN1A 3LSOA 2WP3O 4ZFOB 3WN5B 1OAJA 5IGXH 2VLME 1EGJH 4P2QA 3UZQB 3RPKA 3KGRA 1IBYA 3O45B 3EH5B 5KVGH 4KV5E 1WZLA 2GUOA 4F91B 5CP7B 3DHJA 3RYMA 5ESQB 5C7ZA 3T5WA 2ID5A 1PW3A 2DMGA 3L16A 5E0FA 1FZMA 4TLSA 3Q3GA 4RDQF 4X98A 3BZFA 1JZ8A 5SWZB 1SQMA 3WTUA 3BZ5A 3TIDA 1W8OA 4TSBH 2CBMA 4I3RH 4U05A 4F1ZA 4HGMA 3T4AC 4PJFB 3JUYA 5JPMB 2YQ3A 4PVMA 3Q5YA 3KPOA 2PTTA 5D1QE 4ZX4A 4GH7B 1HHKA 1XF5A 1FCGA 2YOAA 4FQQB 4JQIA 5DMJB 1I7ZB 1JD9A 4KUCD 1W0VB 3LEXB 4XBGA 1VIWA 1KJ2L 4JREB 1Z5LB 3UTTB 3CSYA 5ALCH 5CZXC 4NJ9H 5LB1A 3BD3A 5GGUA 4TQEL 4WK4B 1KB5H 4TYUA 2CJUH 3LSOB 4X83A 2FWSA 1AZUA 4GFTB 2AVFA 1MFDL 2NCEA 4XVTL 3UJTH 3RWIA 5I1AA 4P2QB 5EZPA 4DH2A 2IWKA 2CIKA 2B1OA 4LF3A 4HWZA 2B08A 3QIBD 2EH8L 2GUOB 4PJXA 1ZLEA 3TFBA 2C1PB 4I2XE 4MMXA 4YDNA 2NYZA 3SDAA 5L8JB 5J1SC 1HQRA 5GQBA 3MUHL 4N68A 2Z31A 4FNLL 2QTVA 3Q3GB 4Q2ZA 3B7RL 5B3JE 3PE9A 1A7PH 4IGBB 3BZFB 5HYJD 1CGUA 3WMPA 5HYSA 3TIDB 1PAZA 2BW5A 3FPYA 5ALBL 4OQ1A 4GT7A 4RGNE 3EJZD 1U95A 1OE2A 3GLAA 3TEZA 1UKQA 1TZHA 4J3BA 1U2CA 3NG5A 3CVCA 3GJFH 4M43L 2D2OA 2PTTB 1XF5B 3EYUL 1VRSA 4PCYA 3K8MA 4ZTPL 1UB6A 4FFVD 4FQIL 5IB5A 3CSYB 1SZNA 4GEIA 4K23H 3RGVD 3UTSD 1JHLL 2UY6B 4P4KC 1JTOA 5GGUB 2HKHH 2EP6A 4RFOH 5T5NG 3T2PA 5FF6A 1VPOH 2P5PA 3KPQA 3QJQB 4M7ZC 2ZG3A 4K8RD 5C0ND 3OGCA 2IALA 2QSCH 3UP1A 3RWIB 1MZZA 3WO3B 3A24A 1KTCA 1MPAH 2CIKB 2GUYA 4LF3B 4RNRA 4ZO9A 5FECB 3IDNB 3HKFA 4LK4A 3I6LD 4PJXB 2COQA 4JRYD 4I88A 1PLGH 2VRAA 4IBTA 3QNYA 4O9HL 4XN5A 4D9QD 2X38A 3SDAB 4NQCE 4ABQA 4PWHA 3LS5H 3VRLF 1BVNP 1LO0L 5I1LB 4UNVA 1DTUA 3I3BA 4Q2ZB 3C2AL 3EBAA 5HYSB 2NY3D 3FQ1A 1QSFD 2C3GA 1EXGA 3POCA 3ARPA 1TQCC 5CSBA 2YMXH 2OJZH 4F9LA 5DD3H 2EE2A 1U95B 5LBGA 3CLEL 3RI5K 4PRPD 2BH0A 4G8EA 3WFDH 1DVTA 1JZGA 4L8DA 3BEVA 1CFTA 5D2LF 1TQSA 4JO8A 1QBMH 3AXLB 3V4UH 1IKNC 1UB6B 1YYLH 2ZICA 1T7YA 5IB5B 4LCIH 4P59L 4PGBA 2WOYA 3FF8A 1L9PA 3F58H 3BEWA 4ANWA 3KPQB 5CINL 4ORGA 3FQTA 5HVWA 3KJ6H 3OGCB 2IALB 3QIWD 5CN3A 3ML9A 2A9BA 4UANA 3EGSA 4RNRB 5AVVB 2ERJB 4F80A 5E99H 5TDPA 3FB7B 3GMPA 2F74B 1RUKH 3FPXA 3QNYB 4TVUA 3HPLA 5EULV 3SZKC 1FH5L 3KMDA 1B88A 4WO0A 4X7DC 3VFGH 3ROOA 3TH3T 1QTSA 4HF5L 1P7QD 5DFAA 4WV1C 1IC7H 4BXVA 4KKCD 3IDJA 1F11A 4D8OA 1J1PL 1HTYA 1NPNA 1CDBA 4JFPA 1P5UB 4L9DA 2BP5M 4E41D 5GRYA 4LPUA 4L8DB 4NPKA 5MEQA 3BEVB 3FONB 4H40A 4AIZA 3TJHD 1QWUA 1FJ1A 5E2TH 4PJDF 2IV8A 1QFUL 1DQTA 3WELA 3GIZH 4PGBB 3HJ0A 3TM6A 1E8WA 2PP7A 3DHMA 1CBVH 3MV7B 4JY5H 4AJVA 3HMXL 1AS7A 1YSOA 3FQTB 4XHJD 1ZTXL 2IAAC 1NCAL 4JHAL 1H5BA 5C9JA 1DVFB 4AQ1A 3U1SL 3ZMRA 3QULB 3GMPB 4ZO7A 3SBPA 4XBMA 5AYUH 3RGHA 4F1SA 3O6KL 4K7PL 4KKBD 3WFBL 2MNUA 3IYLW 2CJTA 3ROOB 4XZ4A 1EDQA 5KSAD 1NWPA 2AVGA 4OZFG 4BGLA 3MN8A 5LVEA 3BAEH 4RA3A 1YEIL 4F7MA 2NXYD 3SDXE 3E9UA 4HVBA 5CGYD 4Z7OB 4HCIA 3PFQA 3K71A 3B9KC 2VXTH 1J1OH 4KQ3L 2R39A 3VO0A 2XQYG 5JZ7C 5MEQB 4DGYH 3F84A 4TPRH 4ZS7L 4ABUA 1FZKB 4HKBA 1HK6A 1FJ1B 1N8OE 4I0PA 2DQDL 4K4KA 2R1YB 3TA3A 5F9OL 3UTOA 3N1QC 1G4MA 4PBDA 5DA4A 5LAPA 1QR1A 3B56A 5SWZE 3CHQA 3X14A 2AXGA 1FL5A 3KPSA 4MSWA 5AWNH 5C0AE 3TV3H 2EAEA 3QWOA 3VI4F 1HL8A 1LHZA 3MCYA 5C9JB 1X7TA 4O5LL 3VFNA 1TPXB 4JFQB 3IS0X 2FJFB 3VXRE 4OZHB 4QRPD 4DKEL 4TNWF 1AO7B 5D9SA 5LGJB 2JIXB 1MEXL 2CK0H 2VN5A 1OP5H 5GGQH 3MJWA 2CZNA 4NLHA 3TEUA 4OFKA 4BK4A 2O5NA 4PJ9C 3PHQB 5JDJA 4DETA 1RZIA 3GBNL 1PZ2A 1XF4A 3K71B 4X6CF 1DQDL 4F2EA 2BFGA 1AAJA 4DFIA 4Z7OF 3GSNL 6CGTA 2XIDA 3BQUB 3CHOA 1NC2B 4HKBB 5IR1B 3OKOA 4XVSL 3OHXA 4BJLA 2YPVL 4OJCA 2NY7H 4I0PB 5B1JA 3KYOA 4P5SA 2PW2B 3O6FA 3IMBA 1U8HA 3TA3B 3RVUC 1S7SB 5FLUA 5F6HI 3WXWL 1PIGA 4PG9A 4JG5A 2O5YL 4RMRA 3FQWA 4KTGA 2FX7H 1AJ7H 3NIFF 5GZOA 1E3ZA 1RUQL 4YBQD 3D48R 3X14B 4AW7A 2FYVA 3PWUB 2AXGB 1FL5B 4MSWB 1DJIA 1NMBH 1PX3A 3QWOB 4OF8A 1A7NL 3VAEA 3FKUS 1MI5D 4XMKL 5C0RH 3R0NA 3SDDC 1RULH 5GS0D 1KYOJ 2DV6A 2ZX5A 4WO4C 3WJLA 1I9JL 1NIFA 2FHBA 1UUNA 4E9LA 1BLIA 1SBBA 3BUDA 4KKAD 5TE7L 4RSVA 1CLYL 3U9PH 1HIMH 1CK0H 2OYKA 5CEXA 2Z4QA 1XF4B 2HUHA 2YAFA 3I50L 4LCYA 3FDWA 2D73A 2UVFA 4W4OC 5GS2H 3OHXB 4PBWD 1P6AB 3KYOB 3O6FB 2XCMC 5CS7A 5JHBA 3DKHA 1WFIA 1UJ3C 2Z7ZA 2OS7A 2KZWA 1UQSB 3ZIYA 4MMYB 3FQWB 3FT3B 1XX9C 2ICEC 1RZJC 2R4SH 4H8HA 1Z66A 5EORL 4MASA 3H85A 5I6PA 1YUKB 4J7RA 1FAIH 2B14A 4LSTH 4I3SH 3CU7A 3F62A 1TZGH 5DZOA 1LYQA 3W5NA 2EC8A 2IPTL 5CBAB 3ET9F 5KYUB 1O7SA 2ITCB 2MH4A 2K3TA 3V7MA 5C09E 5FFLA 2DQIH 1UT2A 4HT1H 3WUWB 5FO8A 3QFJB 3BISA 3S5LB 1OALA 3DI3B 1G7PA 3RA7H 5CEXB 4MRBA 2QFRA 3WAJA 2MEJB 5EU7C 4BRVA 3MSPA 1VERA 3VD1A 5CFAA 1P84J 5TQ0L 3RKDC 3B5TA 4UF7C 5T1DH 2BSTB 3L17A 4QYAA 1KXVA 2L3BA 4YE4H 1MLCB 4ZAKA 3ETBJ 2BIQA 2P4AB 1CTNA 3PGDA 1V7NL 2AQ1A 1MIEH 3KGSA 2NY1D 4A04A 4PJHA 3EGDB 3N40P 4NO5A 1JZ5A 4MAZA 5D4JA 4XC1L 4UQEA 1XGPA 2X89A 4HQQL 3A23A 2M2DA 4ZUSA 1SOXA 3MRQA 1OGTB 4D0DB 5CLXA 3E8UL 2V33A 4K8RL 3DX7A 1LE5A 3MA7A 5DDHA 3R4RA 4JW3A 2PKDA 2OZNA 3WKYA 5FO8B 2MOQA 4HCRH 2WYHA 1GA2A 1MWAL 1AZCA 5BMFL 4KK5D 4U6YA 1TQTA 4C8XA 1YZZA 1G7PB 4Y5XC 2P8PA 4U1LB 2JKRM 4LSVL 1G94A 3GS0A 1OAQL 4JQVC 1JXJA 5AOJA 2ZKHH 2H0PA 5A6IA 5EEVA 1XCWA 2WUBH 4R83A 3RWHA 2WZ5A 3K2KA 4S1QH 2PO6C 4ZAKB 3GHPA 4L8SA 3BPCB 1MIMH 1W9XA 4LSQH 3U6RA 2PCPA 2PTUA 3G5YA 1CTMA 1WA0X 1TENA 2VC2H 3PGDB 1CLZH 4X5PA 2A1WH 1QVOA 4LCVA 4ODHL 1RIHH 3VFUB 2FQGA 2OA9A 5GRXG 3WDJA 3VD0A 2Y7MA 4N8PA 1DVQA 2FB4L 2AJ3A 43C9A 1HH6A 2E7HA 4ZXBB 1F4XL 4QKXB 3JQOB 4P0DA 3J07A 2HKFH 5CXPA 2VTFA 2XN0A 3MA7B 3K74B 5KBPA 2Z35A 2VMCA 1KIQA 4LPYA 3N1FC 4U6YB 5E2WH 4FQJH 4G6JL 1KJ3H 1NGYA 2P8PB 3KYNA 1JIBA 1YEFH 2HT2C 5GGRY 3GGWA 3VTMA 3IFNL 3JTSB 4HIPA 4OD3H 3D3VD 3KPTA 2Y9RT 3RWHB 3RY6C 2E0PA 4BHUI 2KI6A 3O3DA 4TQPA 4L8SB 4JFXA 4Z23A 3U6RB 2EVHA 3U4AA 2PCPB 3G5YB 4CMHB 1KFAL 2Y6SC 4PRHB 5B1KA 4EN3C 4PS4H 5B3SB 2BVPA 2EO1A 2VR5A 3T0BA 5E6IC 1QVOB 2ARWA 1AXSB 3CVHH 4OGAC 1NCGA 2B59A 2QZQA 5FYJE 5EDSA 2OM5A 5ITBL 1YYMH 3NPSB 3PUUA 2HZHA 2VN4A 4KDTA 3NMEA 4MVBC 2AJ3B 4QJ4B 3DJ9A 3SCMD 43C9B 1HH6B 1I85A 4YBLB 5AW8B 1I8AA 1CICD 1VADA 2WXJA 4P23C 3DUHA 4FQXC 5MHSE 5L7XH 2ZPKL 3GSVA 1KIQB 3DXAD 1GC1H 2A9NH 4FP8L 5IP4A 4LFHG 3K81A 3W11D 3TS8A 4H8QA 1B4JL 1Y6KR 2ALWA 4N2EA 1S7VB 3KPSE 1PJWA 2BOCA 1ND0A 1QG3A 4AOFA 1A25A 4D0CA 2X2HA 2PPDA 3B3BA 2WY3B 3MUGA 3W39B 4K94L 1IQDB 3CFDA 5KG9A 3B8SA 1MFBH 3F01A 3O3DB 3WMQA 3LH9A 4J6IA 4JFXB 4WY7L 3E38A 1KV3A 2EABA 3QDGD 2VAAA 4HJEA 3LDBB 5H8DA 5SWSD 2B4CL 5ETUA 2FH6A 3QUZC 4J2XA 2X53A 3O6LL 2D4DA 1W8EA 4HAGA 4BQCA 4RMWA 5HDWA 1A6WH 1HXMA 4QXTB 2B59B 2ICWA 1WHOA 2VDKL 1ZIBA 2DYPD 4JEGB 1UYWL 3HG2A 1HZHL 4QXGL 4Y2DC 1JDAA 2QPSA 1NBZA 2R59A 1VADB 1GIGL 1NOAA 2DQTH 3OAUH 3UAAA 3IMWA 1HWGB 2FO1A 1H3VA 1NEUA 3U0PA 2BIIA 3GSVB 3ZZLA 1NICA 3KDPB 5E8EB 2W91A 4EVNA 3HI6H 3ZTJH 2IMNA 2GIMA 1RJYA 3U36A 2DLEA 2BP3A 2BOCB 2F53A 4Y4KA 1I1FA 4JO3H 4NN5C 5EOCL 4D0CB 3CHPA 4Z6AT 4Q9QH 3AMKA 4YSCA 2DJSA 1R5VB 3MJ6A 3MUGB 4P5TC 4Z3JA 2IG2H 2WWMC 4MNHA 4N1HB 3CFDB 1T7WA 2EVFA 2X6CA 3KH4A 3QDMD 4MMZB 3AQZA 4U3XA 2MTPA 1NGPL 2A0LD 3ZDXF 3GS7A 1FIGL 1IU1A 1H3WM 4AEIH 2C26A 4PJBF 2CR0A 3GJEA 2FSDA 4LQFH 4N2KA 4JPKH 4B9PA 5ETUB 4X7CC 2QGDA 3ARUA 5IW1B 3GBML 1HXMB 2DQUL 5I1IL 2H1PH 4FHBD 4IK6A 3SPVA 1JYNA 5DWPA 3HR6A 4BWWA 4KQ4H 1XAKA 5DU7A 1NBZB 1AYRA 4F3FB 3STZB 3PWVA 2UX6A 1HOCB 4WHYH 3U0PB 5D7EA 3HS0A 3MO1A 4NPYA 4QRAA 2FYYA 4EVNB 4PLNC 1GYCA 1LILA 5GS0L 3N85L 2YPLB 3HZYA 2D9CA 4GMSL 2Q8BL 3U36B 5LXGL 1CGSH 1MJUH 1MCBA 1UCBL 6FABH 2F53B 3QR0A 1E4XL 3MJ9L 1I1FB 3QPQD 4Y4KB 3BUBA 3RIFF 1H6TA 5HGDB 5HYQB 1DVXA 4P4RA 1OAYH 4MNHB 2KHAA 4QAMB 4YDLB 2VJ8A 4KTDH 1OCRB 3PP3H 4FNTA 4HJSA 3SY0B 1UM6H 4FNUA 1FVEA 4K7FA 1G7QA 4OJDH 3TEYA 3GJEB 2VR3A 1YRKA 4S2SB 3H8NA 3KPRE 5IG7A 1F3DH 1AG0A 1E5ZA 1S5HA 2QADD 2QQLL 5FO7B 4NM4H 5FR3A 1QQDB 2TSAA 3LRHA 1M2OA 4J3TA 1SY6L 2FECI 4URTB 3SPVB 2J73A 3LH2L 2R8SL 2XWBB 3PWVB 4G71B 1OHQA 1ETA1 3ARFB 4P5RA 4WVRA 3W56A 4WIQA 3NOIA 1FDLL 3HS0B 4NPYB 4ELME 2IV9A 1CD0A 4XT1C 1O7DE 2FYYB 5JR1L 2BLFA 4NNPL 3Q05A 2BHFA 1WRFA 3V52H 4JE4B 1MCOL 3HZYB 3QJFB 4RIRA 4PJ7A 4LCCC 3EZJB 3GHBH 4PMEA 4PJHE 2KBGA 3I75A 5KJRH 5DHVA 4I8DA 3OPZL 4K7PY 3OMNB 4P4RB 2VDLB 3WLBB 4WWNA 1IBGL 2JMRA 1C8PA 5D1ZB 4FXGC 1A0QH 1G7QB 3OB8A 2ADJA 2HG0A 5IG7B 3RLSA 1S5HB 5DMYA 4I7ZC 1W91A 1ASOA 4JL2A 5LXVA 4JFUA 4TSCL 3M86A 3TO4B 3AW5A 3WSQH 3P4NA 3UBXI 4JM4H 1MFCH 3P77A 4QGTA 2X7LA 1U8QA 3BPNB 4YDIH 3ABZA 4PV9B 1NAMH 3HG1D 1ZSDB 3WNMA 4DK3A 4DP4X 1WA2X 5I1JH 3LX9A 2F7QA 4U6XB 4WK0B 2E9GA 2WUCL 1E5AA 3BAKA 4FFYA 1H8OA 2EVGA 1IKOP 3WDIA 4CADA 1CYWA 4AVKA 3GO1L 1CDIA 3LN9A 1AH1A 4PJ7B 4JDZA 3C87A 2ROYA 3I75B 2FT6A 5DHVB 1NA8A 2Y6TE 4GSXA 1KWGA 2LU4A 3ZKNC 1JYXA 4YQXH 3VGBA 3WNKA 2IMMA 4IOIA 1A6ZA 4KRMB 5C0DA 5F9WB 2VMEA 3QCUL 4I87A 3AS1A 4LQ1A 3AQDA 3P0YH 4JFSA 5HDQH 2QQKL 5H37G 1PNDA 1RZ7L 4YOKA 1IM9D 1SVCP 5ACLA 4OR1A 4M1GH 4P2YA 3QQ3A 4D0BA 4WJ5A 3KVQA 3QXTA 4P2OD 2C4FU 1SVZA 1D5MA 5HD8C 3QB7C 3P77B 1UA6L 1BQUA 1HE8A 3RZCB 5BPPA 5F1KC 2X6UA 3D0LA 5IHWA 2BK8A 5HPMA 3F5WA 4HIJA 3ZHNA 4Z77A 1MVUB 1ROWA 5BV7B 2XTJD 3ES6A 4TTDC 4XNQA 4CADB 4YAQA 1YPZF 2J2ZA 2GSMB 4LOUC 5D7JB 5I1GH 3O41A 2WSPA 3D39A 3GI9H 1JBJA 4ZMQA 1MFEH 2OMVA 3S6CA 3ESPA 5D7IA 1YNTB 3CAFA 4XO4A 4HPHA 3FZUD 4IOIB 1A6ZB 4UT9H 5HHME 1GCFA 5C0DB 2OP4H 4ZMOA 1IIKA 2CU9A 1KG0A 2CM6A 4YXLH 2DQJL 3P54A 1LO3L 3CFTA 4APQC 4DIXA 3Q1EA 3DETD 3QQ3B 2X4QA 4D0BB 1A47A 1LP9F 4WJ5B 2FUQA 4CBPA 1D5MB 1E8YA 3V4VL 1XL4A 3JV4A 1PD0A 1GOFA 1BEXA 2ZAIA 3JWNC 4UU9A 2R2BA 5C8JB 4HIJB 4Z77B 2QEJA 4JFHD 3ES6B 1BJ1J 1JNJA 2EUVA 4DGVL 3ULAB 2UXFA 2J1YA 4YAQB 2WXRA 5FWQA 5BW7C 4WW1A 5LJYH 5LAXA 4QLWA 1U3ZA 3MV9E 2D3LA 5CU9A 2X88A 3D39B 4FC3E 2IADA 3JYCA 4BFNA 3ORJA 3NIGB 4Q9RH 2OMVB 1NDTA 3QRBA 4PY8J 5D7IB 3VGFA 4MB5A 1UOVA 1ZLWK 4OCYH 3QQ4A 1P5VB 1TSRA 3QIBC 4JHWL 2CLZA 1FNGA 2YGNA 5GRUL 3JV6A 1SBSH 2R2HB 4PRNB 1BCIA 4MDRA 3FOMA 3ENEA 3HBQA 4HIIA 2Y36L 3OV6A 5FGCB 1KULA 2XZQH 3VXPA 1Q9WA 3QK0A 1SFDA 4YEEA 5HJBA 1PQZA 1JI2A 3X2QB 2F53E 4XGZA 4QOKE 3G6AA 1UJTA 3JV4B 4I18C 2C9XA 5E4EC 1NAKH 2NPLX 4UU9B 3PLYA 2P8LA 3C6EA 1ADWA 2IOOA 4ZS6C 3NEOA 4JG9A 1EO8L 1INEL 3U4BH 5I15H 2WCGA 3RUGE 3G6DH 3LEVL 2F5BH 2NYYD 5IESL 2F8IA 2VL4A 3MOAH 5CIPA 2KLSA 4XPHH 5AKTA 1RVFH 2E9BA 3NAAL 3SE3A 2P5ED 5EF0A 2P3YA 3SGJA 4G7YH 5T5FH 4KJQC 3T0XA 4OGXL 1UXWA 4ZI8A 3OR7B 2CLZB 3KL5A 1MCWM 1HSAA 2RD0A 3JV6B 5DEFA 4YS4A 3VH8G 2BFVL 2WXHA 2KERA 3ZKXB 3H9SD 2H6PA 3FOMB 4JVWA 1EDHA 4HIIB 1DP0A 3VXPB 3WIAA 5I0YA 4JGJA 5DK2A 1Q9WB 2Y2YA 4B9ZA 1MCLA 1PPIA 2NY3C 4GUOA 4NNXA 3GLEA 1PQZB 5CILH 25C8L 4OM0H 3T3ME 4KDVA 4XGZB 2P26A 3BWZA 5BVJA 3G6AB 4IRZA 4WHTA 4DTGH 3KWXA 4BCXA 2VQ1A 1UTDA 3RVTD 2P8LB 4RAUA 3FRPG 5MERA 1WUNT 3JT2A 4NO3A 3S35L 2X40A 4P3CL 2JKLA 3TCLB 2Y3AA 4N0UB 4QXUH 2JCCA 2VN7A 2EH7L 3PREA 1FHNA 3CFCL 1QPKA 4KKRA 4FJ6A 4PJAA 5CIPB 5FYLD 1ZT4A 1I1AA 4PJ5A 1DN0A 5TQ2L 3ZXAC 4OGQC 2FQEA 3D0AA 4OJFL 5T3XH 2CPUA 3CZLA 1UXWB 4XNYL 2IWEA 1HSAB 2PN5A 4L5FE 2C9QA 2DMBA 1UFUA 4CU8A 1RH8A 2K6YA 2WNGA 2H6PB 3PPSA 1D5XB 3NJLA 1I3RA 1I9RL 2IANB 2HSIA 3IJHA 4KKCC 2VRKA 3V6FA 4PJ7E 1ZV2A 1B0GA 5PAZA 1CGXA 2ZWZA 2N0MA 3FJTA 3HE6A 4JFEA 5KSUA 4WHTB 3GM0A 3ULUL 4LBAA 4NRZA 2VQ1B 4NN6B 1ECZA 1R19A 3TNMA 1HKLH 1OL0A 2KYIA 5DLLA 5IFJB 3TJHC 2F19L 5AALA 1TYRA 4KJPC 1GGUA 2B15A 1DEEA 3MRFA 1YDPA 3OZLA 1AHKA 1F4WH 1CE6A 4PJAB 5EOQH 1E9PB 1KGCD 4RMTA 1ZT4B 1I1AB 3L3KA 3PF2A 4PJ5B 4ZX5A 1PFCA 4XHJC 4AKPA 5EV7A 4AGPA 4NZDA 4I9WE 4XPGL 1CIDA 2CLVB 4TSAH 5CP3H 2GYSA 1PTZA 3NSJA 3RIAF 1HYSD 3BUTA 5FOJA 5K1NA 1YQVH 4DKDC 3MR9A 1F13A 5J1TC 4NI3A 2OMYA 1OB0A 1VEMA 3WFEL 1I3RB 3DARA 2JKNA 2FX8H 1HINH 1PSKH 5FFOA 2NXYC 2GIXA 2QKIA 3HI5H 1B3JA 5CGYC 1RL1A 4D3CH 3HE6B 1ZKAA 2ZXDA 4JFEB 3MCLL 5CEZD 3H42H 4NRZB 4RZCB 3SDYH 4HJIA 1OT4A 3TNMB 1NUFA 5KSBB 4G7VH 5AFAA 1JMXA 2DI8A 2AJZB 4HPOL 3OJVC 2R0LL 3P69A 3WDHA 4CSSA 4TOYH 1XIWC 5IWLA 4ODSH 4QJ3B 1DEEB 3UADA 4XP1L 1USZA 1J0HA 3V5DA 1S7UA 1YDPB 2IFFL 4Y2OA 4JKMA 3V4PA 4HOXA 4M8UA 4JJ5B 3NTCH 3P73A 1SUHA 1IFRA 4U3CA 2BRRH 3UJIL 3L3KB 3B1UA 3LIZH 5C07D 2ZKMX 2XVBA 3NJGA 4Y2LA 1J8HD 2VKXA 1FNFA 3KHQA 4NFBA 4TULH 5D8JL 1EIBA 3HMWH 5MEPA 3BP7A 2B77A 3UBXG 4JFVA 3MR9B 3QJRB 1NOLA 4GP5B 4AYMC 2OMYB 3VM5A 4BFKA 3ZL1A 1IAOA 2EXTA 3AZUA 3RIKA 1NBQA 2IAMA 1NCWL 4ZOCA 4EI5D 3MNZB 1SLUA 3TT3H 4C4KO 2QKIB 3BESR 1L6PA 4PRBA 5ABZA 5I16B 5DJZA 2R0ZH 4U7KA 4CN1A 4JPSA 4UQ9A 5D7IE 1GAFH 4LIQH 4XRCA 3BFWA 4PJGA 3SHSA 4Q58C 3L2MA 3AABA 1GKOA 2IC2A 2BNQA 3FCGA 4OQTL 1M4KA 2KS0A 4JG0L 3ARED 3V5DB 3V4PB 4RX4D 3T3PE 3D52A 3P73B 5DR5L 3GMQA 1MJ8H 4LGSB 5IVXA 4QY8A 5GGTH 3ARBB 1FIEA 1U3JA 2W59A 3BN9C 3BPOC 4KAQL 4KV5F 3T0EC 1G9NH 1G7JB 3BE1H 1I53A 3CVIL 4AG4L 1F45A 2VLRD 5MEND 1E7UA 1IGMH 3ZE0E 5DC9B 5MEPB 3BP7B 4IMLA 4KKLC 3VUAA 5GS0C 1RD6A 3IE4A 1QFOA 1NMCB 1IAOB 4AV4A 1QHOA 1BBDL 2W9EH 1L9MA 5C0CB 3QO0B 5E8DH 3O0RL 2IAMB 3NBNA 4LAQL 3KXFA 1T7ZA 2VWEE 4HC1A 3CIAA 5SV3A 2AQSA 3IGKA 4M8QA 4FG4A 4GY4A 5DJZB 5D93B 4YSAA 3TVMD 4LHUG 1BXAA 4M5ZH 1FE8H 3ARGC 4LRIC 1U2HA 4Q9BA 1K85A 4X6EA 3VX1A 4O51A 4PJGB 3RJQB 2VH5L 1S78C 5J89A 4GQZA 4Q6IC 4JPWH 1K3IA 2DIBA 2DEYX 1N0XH 3LZRA 1DQKA 4NUJB 2XV0A 3S96A 1YECL 4JQXC 1AY1L 3HC4H 5FGRA 3GMQB 1QZ1A 2D7TH 2QHRH 2LQRA 4WNSA 5IVXB 3EJYC 3BT2L 1JZIA 2E47A 3ZU8A 2VERN 3N9GL 4PGDA 1RUAL 4IMLB 3IJYA 2V2TA 1RJZA 4XXWC 1PEWA 5B3JF 3HC2A 3GIVA 1YEGL 2YKLH 3S8WA 5GIRA 1IBHA 5C0BD 1DQVA 5CD5C 1NCIA 2K6ZA 3HLAA 3KXFB 3LV3A 4OZGE 3H9ZA 1WEJL 5ICXA 3BGMB 3EADA 4PLKC 4FDWA 4XWOD 5INDB 1OW0C 5DYOA 2V5TA 4ONGL 1AP2B 2V2WB 4GRWB 4LOEA 1KBPA 2WWNA 3BSZA 4X42A 4BCZA 4OZ4A 1BQLL 4NDMA 3PUCA 2WAHA 4X6EB 1VFBA 1N64H 1U8LA 4MJIE 4O51B 3KWTA 1C08A 1GGCL 2Y7QA 1NMAL 1YEHH 3OZ9H 3U7AA 5T1LD 3AU1A 3D4YA 1VAHA 3UZEC 4JVUA 3GINA 3S96B 1AFVH 3X11A 3G9AB 2QLYA 3N43F 5IBLD 1TTUA 2NY1C 3PL6D 4M5YL 5IKCB 3N04A 4ZFZB 3CN3A 2H32A 4KVPA 5A2JH 2DICA 3VD2A 32C2A 4U6TA 4MHHI 4KVCL 4LLUA 5AOMA 5AW4B 5J13B 3IJYB 4KBPA 1PD1A 1RJZB 2G0KA 4ZMAT 5B8CC 4WTZG 3AB0C 2DM4A 2NY4B 1MFDH 1TO5A 3GB7A 4UBDD 5F7NC 2WTRA 1YY9D 3IE9A 3GRWH 3QBTB 1IB5A 2D9QB 5GIRB 2DDQH 3STLA 2JCCE 2F5AL 3C9NA 5DD6A 2O72A 4KK5C 5ICXB 2GJ6E 1QTPA 4PWFA 4OCMC 3RL2B 5DYOB 4E0RB 4FNLH 3IETA 3ZDYE 3ZKQD 4KO7A 2Z3FA 2ZYSA 4OZ4B 3IFPA 3DX9A 5FXCH 1TZ8A 1F2XK 1NUGA 5ALBH 5ID1A 4IHOA 5F7YC 3KS0H 2BIHA 4JLRA 9PCYA 3BKML 4Y5VC 2V5YA 1JGLH 1L3WA 2Y7QB 2NUTB 3AU1B 5GZNA 1GS8A 4ZTPH 1ASQA 3KGTA 4N1EA 1O9VA 2H32B 2WYTA 1UGNA 1OF2B 3KJ4C 1J7VR 32C2B 3CDZA 3GJFA 3L1OL 4LLUB 1G6RB 3VD3A 2E3VA 4JHZA 3UBHA 2D7QA 2DQGL 4YC2C 4NUMA 4F58L 3GB7B 2A83A 4M61B 2RAMA 3GM8A 1DVYA 2NXZB 4UV4L 4YDKH 3STLB 5LGYA 3LZFL 3U30C 1DCEA 4O9HH 2F54D 1QATA 3IB4A 4ESKA 3E80A 3UPAA 3ZYOA 4B3VA 5KVDH 4DUVA 3DTUB 3IETB 3F6IA 3MUY1 4HJ1A 3IFPB 1I8LC 4ELKA 2CO4A 5FX3A 2R4RH 5ID1B 3T8MA 4IHOB 4JANA 1Q9LA 1DR9A 1E6JH 1GH7A 1VFOA 4L4JA 2Z7WA 4Q0XH 3QRGH 1XL6A 1YUHA 1WITA 3TA4D 1ZHLB 3MV8B 5AG9A 5FDYA 5E8PB 2XWXA 3DV4A 4P59H 1BQHG 4PN6A 5ECGA 1J8KA 1HAWA 1CVRA 1QO3A 1EBAA 3CDZB 3ZKMC 3ARDD 1R0AL 1LQBC 1MCRA 1JPSL 1SXNA 3QUGA 5CINH 5LG1A 4FADA 4JKNA 4ADGA 1IRAY 5CHNA 1CICC 2CKNA 4JGUA 2YD3A 3SKOA 2A83B 4BH8B 4TUOA 2VXQH 1YEEL 4FLHA 3SDXF 3NCMA 1HT6A 1NGZA 4GIAA 3W11C 1UWFA 4LE8A 5DTFB 3WIFA 4JFWA 5DMIL 4HF5H 4PRDA 2C1OA 3OWRA 4UB0H 1JL8A 3DK0A 1IX2A 5FV1L 4FLQA 2GG1A 1OF0A 4JANB 2DD8L 2HRPL 1Q9LB 1BEYH 4M00A 4YEFA 1A9BA 1FO0A 2Q8AL 1ZXKA 4RA0C 1YUHB 5CEZL 4WDIA 1UWEH 4Z3HA 3MLYH 2FRGP 4JREC 1SMOA 4O02B 1QNZH 2J25A 4ZRGA 4LDOB 4LARH 1QFUH 3DHPA 1FZJA 1XTMA 3G6JE 4YLBA 4U33A 1ZLSL 1I1YA 1QO3B 2XN1A 3PP4L 4WSJA 1WAAA 4YX2L 2KKQA 4KX8A 1DDTA 2WANA 3NGBB 4R3SA 1NCAH 3ZE1E 1OV8A 4JHAH 2WV3A 3FT1A 3B7TA 2BNUA 5C08E 2XA3A 1AQ8A 2BNQE 2VMDA 3S88L 3UGXA 4TVPD 4Y1AA 4OFYD 3V0IA 2XV3A 4FRWA 4XXCC 1NGZB 3NYKA 4FHJA 1OARH 4HU2A 3CMOL 3O6KH 4K7PH 2YGVA 2VM3A 4WWKD 3WIFB 4IGBC 4NZ8A 4P49A 5T1KD 5HHOD 4RISH 2C3VA 3VACA 2LU5A 3LXUX 1L7TL 3MXVL 4ZFGL 2BZCA 3ULVE 4YHZH 4JY6A 2Y69B 3NZSA 4UM9A 4X8XA 1FO0B 1AGEA 4GNKB 1PLAA 1UM4H 2A0LC 3O4LA 4XP5L 5K9OA 5GGVY 5FS5A 1PFOA 4WDIB 4ZS7H 2YLHA 1G9HA 3WTWA 5I1KH 1DUYA 1P4BL 1F6AA 5JHDD 2DQDH 3QCTH 4OZFA 5F9OH 2Q7NA 4HEME 2KZKA 1ZHKA 4GI6A 5EMYA 4QHMA 2E8ZA 1JPST 1FNSH 1IQWH 2AJUL 2H26A 1RI8A 3UYRL 1T1WA 3MREA 1W72A 2VDNL 4KXCA 4NS0A 2E7BA 2XQYA 1TYJA 1W80A 3PAUA 2RHEA 2B1HL 1BYPA 2BNUB 4O5LH 5DVMA 3T08A 4ODVL 4Y1AB 2R23B 3RI5F 2G9HA 4R8WH 4JO1H 2NCMA 2BCKA 3FQUB 3Q13A 4XNZB 4I13B 1MEXH 4JZOB 3TN0D 3CFJA 3QPQC 4ETQA 4NQXA 4MKMA 3AG1B 4X80L 5A3ID 5IOPB 3BLKA 1RIUH 4JY6B 4I48B 4JHBA 4KPHL 5D7HA 4UM9B 3VWKD 1AGEB 1FVDA 3NCCB 3S9DB 5F1OB 2FT8A 3O4LB 3CZGA 2R69H 3O2DH 5K9OB 1SJMA 2FWOB 3EJJX 5F70A 1U41A 3QDJA 3ULUC 4TV3A 5DS2A 1DUYB 1F6AB 4ODTH 4E36A 3HZVB 2DPKA 3KVPA 3H4FA 2QADC 4OZFB 3WXWH 3UOAB 4WI6A 2QBWA 1CZ8L 3L1FA 1T89A 2R29L 4D8PA 4Z95H 5EFIA 1RUQH 4QHMB 5IREA 2ZUXA 3B7UX 3I6SA 3E0GA 4LNRA 3IMUA 2XZCL 4R4ND 4XP6H 2J20A 4XMKH 4CN4A 4XOBA 4QJ5B 1IKFH 1FYTA 4M6MH 3C75A 4DP7X 5FUZL 7FABH 2G9HB 4LL1A 1J5DA 1F4YH 1SGKA 2AQRA 4N0RA 3IWUA 2L7QA 3UTPD 3L5XH 3HBPA 4K2UH 4EI0A 2IDCA 4ETQB 2VZTA 1T0MA 1JWUA 2OSYA 1CLYH 4NQXB 5K93A 1EK3A 5IVOA 1P5UC 4FXLA 1A1MA 2BIOA 4LVEA 5A2AA 4LDLB 3L3GB 1FVDB 2YXWA 5C97A 5IB2A 1KF9B 2XQYK 3IJSB 4BCYA 3RTQA 3JWNG 3S98A 4IBQA 3QEQD 1JF6A 3QQNA 2X4OA 1KLUB 2PCXA 1DBBH 4F2MA 4JE0A 2GJRA 3G7TA 5EFIB 2QVTA 2OMBA 4HG4K 1HNFA 3SOBL 4I5BA 4C83A 1DVFC 1N3NA 3TBYA 2YUWA 3KR3L 1EHXA 1FYTB 1OP5K 2ZCLH 4HWEL 3C8HA 4B96A 3E3QE 4FJZA 3ZIMA 4ZOAA 2K7QA 1KLFA 4G1EA 4RGOL 5D5MB 1YMMD 1SLWA 2OCCB 2WXGA 3TO2A 3L3HA 1T0MB 1JWUB 3D2UA 1K4DA 1WO2A 2B5IC 1T66C 2EKSB 4KK9D 4F24A 4OIBA 2MRYA 2Y23A 3EH3B 3U79A 5HHQA 5I18L 4MHHG 2W92A 1KV7A 1UA3A 1JZFA 5IB2B 3NRPA 4PS8A 3RTQB 2AJSL 2Y5TA 3BYTA 4QHLB 4U1HA 3QZPA 2WQAA 1BD2A 4ZUUA 1HOEA 2VLMD 2X6BA 2X4OB 3D25A 1TVDA 3BFOA 2AQPA 2ZNXA 2FEEI 2IOIA 3GNMH 2BMKA 1IVLA 1V7NH 1BHGA 3BCDA 3SBQA 3PABA 3K6IA 5CJOL 4I5BB 4C83B 3ETSA 1N3NB 1BM7A 1J9RA 1CO1A 3OAWA 5GISL 4K15A 3T2QA 4XC1H 1T6BX 2DMCA 1SN5A 5T33L 3E8UH 4NM8L 1FP5A 1N59A 1YEWA 2BP8A 5D1QD 1KLFB 1TOXA 5FIEA 3TO2B 3L3HB 1YNKL 1K4DB 1FFQA 1TTRA 3HHRB 1G7HA 1G7LA 3V0DA 5HHQB 5EZLA 2R0WL 2D7PA 3FZUC 4AC4A 1AS6A 4LSVH 4NBZB 3Q2VA 3BQUC 4HCRA 4L3FA 1BFSA 1UZ8A 2FJHB 2Y5TB 3IAQA 3H9HB 4I0PC 3KE0A 5EEUA 3NEEA 1BD2B 1QRKA 4ZUUB 1MFAH 3FTVA 3RAJL 3QJTB 1WGOA 4P48A 1FORH 1LMIA 1V8HA 3DETC 1LXMA 2IQ9L 3G5VA 4GAYB 3L81A 1L6XA 3QYMA 1GOGA 4GSDL 4XCFH 1B9KA 2BMKB 4QRQA 3D85A 4UOW0 2AQ3A 2Y7LA 3PABB 4DT2A 5EOTB 2BHYA 3S3DB 4ODHH 1GJIA 1RHFA 3SQOH 1SM3L 2XI9A 4MAYA 3ZK0A 4XPFH 2DRUA 4RGND 1EAJA 1N6UA 5F7EH 4ZUTA 1KCWA 4IRSD 1X5GA 1SPDA 3EBGA 4XNUL 1JJUA 3EJQA 3JZYA 5DD5L 4RBPH 1E4HA 1WHPA 2F9BT 2OR7A 3FYEB 4MA1B 1WAAE 1G7HB 1G7LB 1NEZG 2N01B 4QRFA 2R2EA 2QV2A 4X6DA 2Y7SA 4XVJL 1DZBA 5IB4A 3SE4A 1JP5A 3OHXC 1GRWA 4NKIH 4AQOA 3VD9A 5B1JC 3O6FC 2V17L 4R7LA 2ZWNA 2J1XA 2XY1A 3ZDZB 1EFXA 2OMTB 2K8MA 2ZCHH 5HGAA 1Q4NX 1MFNA 1RU9L 4R26H 3OF6A 4QRQB 2F7OA 3IDIA 4NQCD 2WM0A 3HLKA 5J6HA 1KCRL 4MJ5A 1E4KA 4JB9L 4G8GA 5DHEA 3VW3L 5EWIL 2QSTA 5FPIA 2VDOB 2WLNA 1CI5A 4JR9L 4PJ8A 4KRLB 3O4LE 2BVQA 4MAYB 5C3IA 2NYYC 5CZRA 4GRLD 4ZUTB 4DP5X 1BMGA 3CVHA 4AJ0A 2QDWA 2J8UE 2DQEL 1XAUA 1U8MA 1SLXA 2XJLA 1AQHA 4WUUB 5F44A 1ETJA 1HCYA 1HWWA 4MQ7A 3DGGA 4X6DB 3WO4C 1SOSA 5IB4B 4JFZL 2GY5A 4KH9A 4BFBD 4X0NA 3GTTA 3MACH 1ZVNA 5HVGB 1XDTT 3T04D 4S1RL 3X3FH 1SRDA 5LQBL 4WKZA 1EFXB 1KZQA 5DMKA 5HGAB 4HJJL 3JWOL 4P5KA 4L0ZA 2V5SA 3V6OA 1MCWW 4EZJA 4KFZC 4NENA 4X0KA 3IDIB 2OK0L 4XODA 1CCZA 3EO0B 2DL9A 4AXWB 4P2AA 4WJG3 3FQXB 1SHWA 4U1IA 4POZD 4LRNL 3EG9A 4FYQA 4BE6A 2DQCH 4OTXH 2VDKH 1MVFA 4DP8X 2PNDA 1HZHH 2BVQB 2Q86A 2YD7A 3HNTH 1PKOA 3QDJE 1YY8A 1EAOA 2JQZA 4CVWA 1F8TL 3EKCA 3GHEL 2VXSL 2FIKB 2R7EA 2APXA 4U6VH 2JK5A 5EUOB 4YLQT 4PG2C 2OMUA 1PZCA 1U8MB 2XKSA 5I1CL 3IBOA 1EBPA 3KPPB 3WNIA 3FU5A 2XPYA 3KL3A 4MQ7B 3KWWA 4QR7A 1S8DA 3LVEA 4K9EL 5H94A 3S36X 3NT0A 4G6ML 3A6BL 1GL4B 3HE7B 1O5DT 5FO2A 1A6UH 3UH8A 4W9CC 5L9DH 3GT6A