2VCOA

Crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Intervening with Urinary Tract Infections Using Anti-Adhesives Based on the Crystal Structure of the Fimh-Oligomannose-3 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2vcoA00
1QUNB 4AUJA 1KIUB 4X5RA 1N12A 1KLFB 3RFZA 4XO9A 5FWRA 2JTYA 3BWUF 4J3OF 4X5PA 4XOCA 2XG4B 5FLUA 4XOBA 3JWNE 2JMRA 4LOVA 5F2FA 4XOAA 4CA4A 4XO8A 4CSSA 5AALA 4AVJA 2WMPB 1N0LB 2W07B 4ATTA 4BUQA 5JQIB 4AV4A 5F3FA 4AUUA 4AV5A 5IQNA 5IQMA 2UY6B 4XODA 5AAPA 5IQOA 5ABZA 4XOEA 4J3OH 3ZL2A 2J2ZB 2VCOA 5AB1A 3ME0B 5CGBA 3JWNH 3BFWA 2XG5B 3ZL1A 4X50A 4J3OG 1TR7A 5FX3A 3MCYA 5LNGA 4CSTA 4AVIA 3JWNG 2UY7B 3SQBB 3ZPDA 4AVKA 4AV0A 1UWFA 5FS5A 3BFQG 5LNEA 1ZE3H 4AUYA 1PDKB 4X5QA 4AVHA
chains in the Genus database with same CATH superfamily
4PJXA 1RLWA 3EHBD 3TEXA 2HMID 4UQ2A 1RK7A 5KYYB 3T77A 5LJYH 1DN0B 1WRFA 2QVKA 3VFPA 1QASA 1FFTB 5E6YA 5B1BB 4A6YA 4LOFA 3UAAA 2AXWA 5D5MB 2YAEA 5L8LB 2YR3A 4PP2A 1JERA 3RHWF 1XL4A 3A23A 4NM8H 3S3CB 4HQQH 2A1WL 2I5YH 5F7KC 4PY8J 2K3TA 4KI5E 1S7UA 3IMUA 4FADA 2C4XA 4LEOB 4MDJB 4PJEB 3LIZA 2ZUUA 2BFVL 3A6CL 1BW8A 4EXKA 4RWYL 1OW0C 2R27A 2OQJA 3C12A 3KL3A 4XNXH 4NGHH 3HR5A 2AK4B 2GSGA 2BRRH 4TLUA 3QULB 1GGUA 5JW3L 2JWYA 1BQRA 4P5TC 1JPSH 4PJDE 3ZR6A 4F24A 4MXVE 3GBEA 4ODBD 4GAJH 3EADA 3ZX1A 2NY4B 5D96C 2X09A 2OJ1A 3RP1A 1OCCB 1SMOA 2AXHA 2PUQT 5EEXA 1UA6L 1PZ5A 4AQ1A 5JNYA 4L4TE 3EG9B 1WEJL 2ZXCA 2APWA 5T8IA 2J56A 1R3JA 1IC0A 2DWYA 4B41A 2WBJA 4HUMB 4AGMA 3H0TA 4L9LA 3DROB 1P4LA 5BW7A 1Q9KB 5FOBA 2P49B 4X7SL 3EYVA 2APTA 2VE6B 5FKPB 1V7ML 1WYJA 3HR6A 1F4XL 2EH7L 4RZCA 2CK0H 4PGJA 4R8WL 4NQSA 4QRPD 8CGTA 1JPTL 2EYRB 3CXFA 4FI8A 1BXVA 5I6MA 2WBKA 4O2FB 3AXLB 2ODIA 4U4BA 3IMSA 5AUMA 1MLCB 1RUMH 2QVMA 3NIDE 4LRNL 5GGTL 3UAFA 3VFWA 4ELMF 4G59C 2DJMA 3S5LA 5BCAA 1TFHA 1RP9A 3MRGA 2CHXA 3RJDA 3TCXA 3UJTL 4E5XG 4F33A 1PLGH 2W91A 4XP4H 1EQWA 2BHUA 3CFCL 1Y0LA 4UINL 4P57A 3TJHC 4ZXBA 2C3HA 2VJ0A 3FUEA 3P4NA 2WSDA 3MREB 6CGTA 2J8HA 2VSMB 3L95A 4HUXA 5SWSB 3UFIA 3VM7A 1OQXA 3N41B 1BQHB 3U1QA 1DJHA 4MJIA 3ZZQA 2XC8A 2BSSB 1M7XA 4PV1C 5F8QC 1QUPA 3KLSA 5C07A 1EEYB 4UAOB 4YHIB 5C0RL 1DDHB 4ELMA 1KUMA 2W07A 1IC1A 5HYSA 4HT1H 4N5ED 3FTUA 2X4SA 1JGUH 3V10A 3ZMNA 4AQEA 3DGDA 1MCOL 4MXWH 4E9YA 5LXGL 1UXSA 1BVZA 1U3HB 3OKMA 2HUHA 3LPOA 1Z9PA 1LGVA 2JCCB 2ZUXA 3U0TB 2OXGB 5ID1B 2Y1YA 4N6QA 2C26A 3UIZA 4KKNA 1Z5HA 5CD3A 2D9QB 1GGBL 1ZS2A 1RIHL 4FYQA 4F2FA 2CO4A 2K78A 2Y2WA 3SOTA 4FNPA 2FJSA 4P2RD 2H7WA 4OGYH 4B3EA 4K71C 1OD9A 1TNNA 1FJ1A 1QBML 1PY4A 1ZHBB 2UWEF 1D2OA 2UVFA 4W68A 5TQ2L 3V5HA 4CMHC 5ADOL 2BVOB 5BRZA 2ZUQB 2F8OA 3OLIA 3CD4A 1XCQB 3QIWB 1XDTT 4JO3L 4BFJA 1RZQA 2Y72A 4MAZA 4ONOA 2B0SL 2DMBA 4LCCA 5H37G 3BZ4B 2R8SH 5CEZH 1MFVA 4N5UA 4AQ1C 3BD4A 1T04B 2V4LA 1IC4L 2XRAH 3HI6H 2W9EH 4JM4H 1SY6A 3HE7A 2VR7A 4MJ6A 4F8OA 3O6ML 4DPAX 4GRMB 1QSZA 5DVPA 1CTNA 2WBJC 3T4AA 3VU1A 3MAWA 5DQJA 3FQRA 5T1LB 4XXDA 4L9LC 4H8UA 5BW7C 2UWEA 4PJHA 1Q72H 5ISZA 2WWOA 3NJHA 4PJBF 4BCYA 3D12B 2FD6L 2NYYC 1PBYA 1PJ9A 5FB8B 2DOCA 3B1TA 4PJAF 4XGZA 4Y16A 3ZTNH 3KJ4C 2DLHA 1FN4A 2E56A 4FA7B 2CJUL 3LQAL 3QPXL 4GRLD 3MOBH 2NW3B 1FBIH 5CINL 1F4YH 4PP1D 1BD2E 2BOLA 4P9HH 2GKIA 4BYHA 2F53E 3QUZB 3V6ZB 2WTRB 3OWEA 2WLNA 4FTDA 4ZXBC 5KSUB 3R0NA 4PJBA 1DQVA 3VH8A 2HB0A 3AW5A 2WQRA 4W70A 4AYFB 2DY2A 2COVD 2XY2A 1RK0A 3KVDD 1XBDA 2K7PA 5I1KL 2F15A 4PJAA 3RGBA 1IMHC 4WHTA 3UPCA 2CDFB 4MNQB 5F7UA 1CZ8L 4WW1A 2COQA 5I6NA 4QKXB 2VUOA 2Q6WB 4BE6A 3HS9A 3LKSB 4I18B 5E7FA 1N0XH 4FFWD 3EDDA 5EU4B 3BP7A 4U0RC 2HTKC 5GRVL 3U4BL 1PZ2A 1N4XH 3E7JA 3FH8A 1MCIA 2NQCA 3MTXA 3OGCB 3L3KB 3OSKA 4EDWH 4ZFFB 1U93A 5EBGA 1S5IL 3THMH 4M62H 2WKLA 5I1IL 3NCJL 3L3JB 4PS3A 1WA1X 3DX9B 3GIZH 3T08A 5I5MA 4YSCA 1M2VB 2VN5A 2OMZB 3Q3GA 3X17A 4TNGA 4ZX5A 4HXBL 1MELA 4DJMA 1Z5LA 1B4JH 2J1WA 5HDQH 2RMNA 2FZ3A 1DR9A 1YC7A 4I1RA 3QUKA 4FP8L 4LNRA 3IDYB 4M7LH 3D30A 2HVKB 5EULV 4IMLB 1KJVB 4S1DC 5CSZB 5HD8C 4LCCC 4NWTH 3BIKB 5D9SB 5FM4A 3DOSB 5D7LB 1ACCA 1J18A 4FXGB 5E9AA 1D2PA 1T7WA 3HE7C 4JFEE 1ZWIB 2BNRE 3X11A 2JCWA 3FB7A 4XMPH 1HI6A 3ERXA 3T4AC 5CN1A 3ARBA 2XJLA 2AABL 1C8PA 1DBBH 4U6HB 4KX7A 2DAVA 3TS8A 3JV6B 3BDBA 3FBKA 5IFHH 3EGSB 2KMWA 3D85B 2YZ8A 1A4KB 3FQ4A 2AP2A 1JK8A 3DHPA 3H2QA 4W9LC 5KBLA 1OPGH 4LSQL 3DGGB 2IWGA 4OI7A 4Y16C 1Z9SB 4FLQA 5EU6E 2X4RB 2GABA 1FFPB 3C75A 1FVEA 3IYLW 1H9DA 5GS1B 2HLAB 4NJ9H 2YK1H 5KW9L 1W0VA 1RMFL 1MJJB 1RHFA 2R39A 4B9YA 2EINB 4OLZL 4OZGE 1ECYA 1UM6H 4FJYA 4WJ5A 4Y9BA 2VLRE 5D7KE 4NQEB 1CD9B 4GIPD 3ZN6A 3LN5B 3MMEB 2IFFH 2Y0SA 4MNGE 3DYMA 3SCMD 3UYRH 4IU3A 3FB5B 5LVEA 3IE9A 3S4SG 1AHWA 2AFNA 4OCWH 2GJ6A 1MFBH 3DJRA 4N3TA 1X6LA 1PAMA 2AQ3A 4NZRL 3QNXB 4K7PH 5EHFA 2Q86B 4C56D 1VENA 2FEEL 4QI3A 2DH2A 1TR7A 1OAXL 3OQ3B 5DRWA 1LO4L 1S7XB 3HNTH 3CX5K 5A2AA 3TNNB 5B3JE 3QYNA 4JFUA 4UZSA 3WFBH 2JJVA 4I4WB 2J7LA 4MS8D 1NSNL 4JG0H 3EHBB 1QWUA 3UZVB 3OF6D 1NIDA 4LKCA 1GC1C 2OJEB 1K9TA 1U8NA 4Z0BH 3O3EA 4XNQA 4F8NA 4CJ0A 3O8XD 1R4XA 2FHBA 5F3BB 4ABQA 5DJ8B 5B39A 1MFAH 3ORJA 1FVCA 1U0QA 4NRXB 3GSXA 2QJDA 4R4NC 3LEYL 2IEPA 3TT3H 3B7SA 4FQHB 5I76A 5FEBA 2NY1D 3HS0B 4UNTA 1FG2A 1XGQB 5JHDE 1ZV2A 3IWVA 3FCTA 3TTYA 1LD9A 3ATBA 3KYNA 3WJJA 4K8RC 2BNRD 3EYOB 3NDZE 5CZXC 3US9A 3I9AA 3BKMH 5EFIA 1M7IB 4P4RA 1AG0A 4NYLB 3QZWB 1RULL 2DN7A 3IDXH 3U0WL 5IOPA 4NXSA 1M05B 2QQKL 1XSJA 2P8LA 5I30L 3VD5A 3ARBC 1CIDA 2Z7UA 1GMEA 3BUTA 4ZT1A 5CKGA 3CZJA 2AQPA 4JRYA 5D72L 4O00A 3UZEA 1W0WB 5FGCE 5DQ9B 2XTJE 4JFDB 5BZZA 3ZTCC 2PWEA 3IDJB 5I16B 1PEZA 1UM4L 3LVEA 3IU3A 3MUJA 5AEAA 4OZ4B 2Q3AA 3CFIC 3K71B 2OZ4H 4HJSA 3HI6L 4LP5A 2FBJH 2W9EL 1SJVA 4JM4L 1BG9A 1JGEB 1P5UB 4MQXD 1AR2A 2AEPH 2J73A 2VABB 3ZYOA 3X14A 2QEJA 2Y6TE 4X6CF 3HHSA 3M07A 1QO3A 4IU2B 3HMWH 1CD1B 3IU4H 1VFOA 3PAVA 4Z7OB 1FORL 1GHFL 2TSAA 4LASH 1FL5B 1HHIB 4S2SB 5D70L 1TQCC 2R2EA 1D9KA 4UF7C 4Y5YA 4MDRA 4DKTA 1VZIA 3WJMB 1CU4H 3RA7L 4QLRA 1KYOK 4PD4J 2UZPA 1QR1A 4UILH 3ZTNL 3QPQD 3S88H 3QUXA 4KK5D 2PO6A 4DGIH 3F2LA 3IVKB 2Q3ZA 1NL0L 3L2MA 1AHWC 3IDNA 2B77A 4BM7A 3T3MF 2ZPKL 2PW1A 1S9VB 3JYCA 4I88A 3WKMH 1S7SB 3PQYB 1EA9C 1F4YL 5D2LF 3QRGH 4AL8C 1U8QA 5HHNB 5D2NA 2HKAA 3UIYA 5B38G 4MHHG 2H9GA 2KLTA 4NHUB 1D6VL 1OP3H 3RTLA 1UZ6F 2ZAIA 1NAMH 2BSBA 3PP3H 2UXVA 4OCLC 2V17H 3VMPA 2UXTA 5KWYC 3WFDL 1U8IA 3D69A 3ZL4H 5T3ZH 2K6YA 1AIZA 3QNZB 4POZC 4L18A 5T3XE 5L2JB 4PLKD 1A4BA 1E28A 5JLZA 2I7OA 4OAWA 1SEBA 3KXFE 3VRIA 1YNKH 3LYRA 1ASPA 3NSFA 5JHDD 3ZDYF 4QGYA 5J89A 3FT9A 5DURD 6FABH 3Q6GH 3T6QC 5BUAA 1E6JL 4GW4B 5DT1H 3O3BB 3RB5A 4FX5A 1P53A 3WJJC 1F5WA 2J25A 3MFFB 4Y2DC 5E9DA 1CFMA 1K2DA 1N5AB 2F58L 1AR1C 4FOMA 2IC2A 5EZOL 2I7SA 4PJDB 3N9GL 3NH7L 3RFZA 4P2RB 1KN4H 2X4TA 3QFDB 2R2HB 4M1GL 1J0YA 5L4FA 2KPWA 4NBXB 1KGJA 5GRVK 3A67H 2Y3NA 4QRRA 2BW5A 4NO3B 4AEHL 2LR4A 5JW4Q 3LPWA 4UQ9A 3WN5A 3TA3B 1T66D 3OTTA 5GS0H 5I0VA 4L4TB 2Z93A 4M7LL 4TQEL 1ZK9A 1DFXA 4BFFA 3LEVL 1RJLB 2X4QA 4NWTL 3EFOB 4H1LH 4XN5A 3BP5B 5MEQB 5JIKA 2WXJA 1XGTB 3BP4A 2YC1A 5A16A 2XWBA 5JHAA 5MEOB 1IJ9A 4JZJB 3QJTB 3RPKA 1AGCA 1BX2B 3DHJA 2D9CA 3ATFA 2B59A 4NLAA 4N20A 4GY4A 4UT9L 1PZCA 4NKMA 4XCYA 4E0RB 3CZLA 3JVGA 3GLAA 5IFHL 1P4BH 1OTSD 1D9KC 4Y5YC 1GZPB 4I13B 2LLLA 2CKBB 3UG3A 4JHUA 4WK4B 3NIDB 5I1CH 3KPSD 3EH5B 3U1SH 1KBKA 1U41A 1B2WH 3GBNL 3CZFB 2PO6C 4FHJA 4GRLB 3S8FB 1F8TL 1SRDA 4L8SB 3TFKC 1UJ3A 4NJ9L 3B2PA 2PYFA 3K7UA 4Z7UB 4UUJB 4G8IB 4POUB 2D0FA 4YSQA 3L3IB 1Z1WA 3BRGC 5D2NC 1EMTL 5A2BA 3MV9E 1UM6L 4JW3A 3D87B 5HY9B 5E8EB 5EPMB 4P49A 3VFUB 3FTYA 3MRCB 3BD3A 4OGAD 4WHYG 1SFDA 4B0MM 2A0LD 1TLMA 2QGDA 3FQYA 5TF0A 2JB5L 1JGIA 1QLEL 2OMXB 1YUKB 3GSWB 2D4FA 2GIXA 2YPVA 3GHEL 4XMZA 3MCG1 3I6SA 4WSJA 2FEDD 1P1ZB 2UXGA 3GJEA 5DFAA 3ZTDC 1LLAA 2CDGA 4WSGA 3KWUA 5F70A 1FL3B 2EDYA 5BO0D 2ERJC 4I1PA 3FB8A 2F5BL 1JXFA 1A9EB 2EDFA 2BW4A 4H5SB 2OW6A 3KLAB 1V27A 4X42A 1N3NB 3V4PB 5JW5B 5EU5B 1D5XB 1NDGA 2CUHA 2YD7A 1Y18A 2FUTA 2VXVL 4N6RA 2I69A 1WC7A 2Y69B 1SDYA 1H3PH 3DHUA 4J3BA 4OKVA 3WNMA 1NUGA 3STZA 3MV8E 5DRZA 3TBSA 1LEKA 3RFZC 2Z31D 3MLUL 4D8OA 4Z0BL 5I1AB 4IRSA 3KPLB 3SDCB 4AT6B 3R4RA 1BZ7A 1TJIH 4GKZA 4N0UA 3WN5C 5J1SC 2LU3A 3H4HA 1CF8L 3P3UA 4GKSA 1YPZF 1OTUD 4ZQKB 5HHMD 4P5KA 3O9WD 5AW7B 7CGTA 1KTRL 3CFBA 1IGFL 3PJLA 1KF9B 1SXBA 2IG2H 4L1BA 1T1XB 2LTQC 2WXGA 2XWJB 4M3JA 1LP9E 2ARJQ 1U2YA 3FMGL 3IDXL 2V2XB 3I75A 1ACYL 1DBMH 2F9BT 5FUOL 4JJOA 3R19A 4NQXB 3IJEA 4OLVH 2VDML 3JVGC 2EH8L 3NCWA 3TYFB 3FUHA 1T4WA 4QJ3B 4FYRA 2RHEA 5D1ZD 3KYOA 1TO5A 3BN9D 3TYGL 1I3GL 3SKOB 2CSPA 1M6UA 4IGBA 3EO9L 2L04A 4HIXL 4KKPA 3LY6A 4WKXA 2EIMB 2Y7MA 4OM0H 1BD2B 4TQPA 3V6FA 4R83A 1IGCH 2F53B 3ECQA 1UJ3C 3HG1D 1AJ7H 3MV9D 4GQZA 3SYCA 4MLIA 5BVPH 1EH9A 1LO0H 2D7TL 4ELKA 4AOFA 1PFOA 1FIGH 2VC2H 1NFDA 4FFYH 1C5BL 4L1LA 3KLHC 3CN1A 4LLQB 3K6DA 4B60A 4G3YL 3L5HA 2F18A 3DURB 3KE0A 2XVGA 1XZWA 2JB6B 2ZOTA 4IOIA 4WWKD 2E47A 1UVQA 4UILL 5LG6A 3GMNA 2AJ3A 4RX4A 5DVKA 4PRBA 5K33A 2ADGA 1X4ZA 4C56B 4KROD 4PV9B 4MJ5A 1NBQA 2WLZA 4GMTH 1LMKA 4DK6A 3H3BC 1X44A 2Q2LA 4LLWA 3CUPA 3U83A 3EDFA 3P9LA 1NMCB 4NENB 1D6EA 1B90A 1YRKA 2N3JA 4OZHE 5LBSL 3WY2A 5KN5A 2ZX8A 3P2BA 2NX5E 5C0ND 4KXZH 4L8DA 4PJ9B 4NJAL 3MLVL 4E5XB 4TVPD 1WFUA 5I24A 2P26A 3WEAA 4MKMA 4ORZC 4EVNA 2Q8BL 2HXAA 1DDTA 3G5XA 3E38A 3O8XB 2E76C 4IRSC 5A2IH 1NMAL 1NINA 4LHJB 3QH3B 4FFVC 4NSKB 2B4CC 4R7NA 3N04A 5E5MA 3TBVB 4QOKE 2ARJB 6FABL 3CDGA 3Q6GL 2BH0A 5DTFA 2X9ZA 4HWUA 5DT1L 2IDUA 3SO3C 4JFEB 1DCLA 2BNRB 5K59E 1D5BA 4HH8A 4KJPD 4MAYB 1DBAH 1A14H 2WZ0A 3P3TA 4LMQI 3C8DA 2J6EH 3A24A 4HKJB 5DUBB 7FABL 2W92A 4NPJA 3KMDA 4YO0B 2GBTA 5BVJB 3D8MA 5D4IA 1Q38A 2B08A 2B7DT 3C8KA 3CVHH 1REIA 3VFNA 1IGIL 2JELL 4LEBA 1N19A 3IPFA 2CQVA 5FFLA 5EU6B 2XFXA 2NTFA 3PWNA 4LIQE 7TAAA 1L0YA 5LG1A 2WUBH 5IREA 3PAYA 4DVRH 4B7IA 4CNIB 4PRID 3QI9C 4IGBC 4XAWH 3O6FB 5CAYB 2YSSA 3ZSTA 4ENED 5LGKA 3N42B 4QPEA 2FIKB 5E8NA 1YY9D 4OZGB 3B9EA 4E9VA 4JHAH 4WTQA 5FDWA 5AYUL 2K4AA 3DSFL 4UANA 4MNGB 5K69A 3T6ZA 1E65A 2YEZB 4ODWA 2B39A 4DN3H 2Q8AL 4GQRA 1R24B 2DM4A 1QEWA 2NT0A 3CZGA 5I1CL 2AITA 3MLRH 2A9ML 4ZMZA 1S78C 4YDMA 1TQVA 2DWDB 1M57B 3LDBB 3BUPA 3OR6B 3VFGH 3U9UB 4PMFA 4NWUH 3HNVH 4KRLB 3N44F 2ARWA 2WGNB 3BLKA 3L9RB 5EBWA 4CC1A 4MWFA 4OVVA 2VSKB 4JAMB 4LPCA 4JFHE 2WCGA 1RZKH 4WAFA 4BRVA 1HS6A 3KYKL 2VNCA 2NY3D 4F7KA 1MZZA 2FECI 5FM5M 3I74A 2GSIA 1TUPA 1WCBA 2X2JA 1MFNA 1SXNA 5JHDB 2XOTA 3SGDH 4L5FE 5DURB 3K46A 5EC2B 4S1QL 3MCYA 4Q6YA 3K91A 4NCC2 1PL3A 4F58L 1HINH 3IGAA 2X9YA 2G3XA 3ABZA 4L1DA 4NC2B 3DUSB 1ADWA 2V9TA 1C16B 5F3HB 2H0EA 3I9PA 3J2PA 4L9DA 5TE7L 4HK0B 5KYWA 1RZFH 5EZIL 1KT2B 5I6XB 3FFDB 3K74B 3LNFA 5D1XD 5FGCB 3ARGA 5DI8A 3QQ9D 3NCMA 1PLAA 5AVVB 4LAJH 3WIHA 4CKQA 1SOKA 1TJIL 1FP5A 4G7VL 4JY5L 4HSCX 1F41A 3V0FA 1S3KL 5HYJD 1M7DA 3POCA 1S7QA 4DKAA 1EO8H 2OMYA 4EPSA 4UWQB 2NNCA 3DARA 4IK7A 4JMXA 3UG4A 4M4RA 3I9IA 4NFBA 1PAZA 1XEDA 2YN5A 4TOYL 3RTQD 4PLJD 1FDLH 3MNWA 3MO1B 4P04A 2QMJA 1KY7A 4QCIB 2XXGA 1IUZA 1Z0MA 4DGYL 3H8NA 1XB3A 5FR3A 4Z7WA 1YJDC 2HKFL 2GUYA 4HBQA 2IDQA 1JHKH 3MLTB 4D8PB 1AZUA 3KPSB 1ZGLA 5E2WH 2WXIA 3LNGA 3OXRB 4M03A 4KAQL 2YXVA 1SYSB 4OM0L 1OCRB 2H2PC 2DQEL 1DANT 1SN0A 2ZCHL 4N8CH 4OQ1A 3TNMA 3VTTA 4BZYA 3TV3H 3HA0A 1VERA 1U8MB 4OLXH 1CFSB 1NAKL 1AJ7L 1E30A 2HUEA 5BVPL 2DQUH 2J57A 3GSOA 3IFLL 3MCKB 5HI4C 5AVRB 4M5ZL 4FFYL 2E8ZA 1LEIB 3R0MA 2XZAH 2F5AL 3SPIA 2O6CA 1HNFA 1RY7B 1MOEA 4MX7B 1DVUA 2QMKA 3FFCE 3QE5A 2X42A 5C1MB 2ZCLL 3D6GA 4WJG3 2BZCA 4FLHA 4HGKC 2B1OA 4MA3B 3KXFB 4PGCB 4PVMA 3KLKA 4KTDH 3VE0A 1E27A 1G6RL 4J12A 1RPKA 1NDMB 1I7UB 1S9YB 5DHVB 5HHQA 2LQRA 4YHKH 3FQXB 1FRGH 1WP6A 5LCVH 1EHLH 2HLFD 1ORQB 3CX2A 4OJAA 3WHXA 3WGVB 1FO0A 2A9NL 3PNWA 2FQEA 4UM9A 3T0BA 5CJQH 5CGBA 1FNAA 3MRDB 2XZZA 3F7QA 1RPQA 3ALWA 2QVTA 4U1SA 1YY8B 4NKIH 2HFEB 1J0JA 1KPUA 1LL1A 3S4SB 2LT9A 3ZTJH 4HJGA 3ULUD 5TE6H 1XX9C 4P5MA 3LHPL 3G9VA 1MQ8A 4NO2A 4P2OA 1N7ML 4PWGA 2CMRH 4OD3L 1PZSA 4OBSA 1V7NH 1VGEH 3ZUCA 1SNRA 2QPFA 2Z31B 1DVSA 3CFQA 2F7QA 2ORBH 3EOAA 3FHAA 4ZAKA 4U6YB 4X4ZA 4HJTA 4DGUA 1P7QD 3ARGC 4YL4A 2DICA 2EZ0C 4XP6H 3VXUA 2E6QA 4DESA 3S5LG 1Z0NA 5KUMA 5F7EH 5JPMB 4R90H 1T20B 1GS8A 1F18A 1MCKA 4Z78B 4FXKB 4HEPG 4IS6B 2BNUB 4X4XA 4QY8B 3PUUA 2KZWA 4JFXB 1T7XA 1IAKA 5ERWB 3D34A 4B9IA 1J0KA 5GGQH 43C9A 3KBEA 3N0AA 2FX7H 4Y4FD 3U36B 4IRJA 3BT2L 4KXZI 2B5IB 4X0KB 3VWJA 2CO3A 3MRRA 1RJZB 1ETJA 4U6TA 4BH7B 5HYSG 3W9DA 3RRQA 4D0DA 4LOUC 5D1ZB 4RMTA 2DV6A 1JXJA 8PAZA 3WL9A 4YJZL 1WFJA 4HUKB 2EYSA 3CFJB 2ZYHA 4OJFL 5DK0A 3QIUD 4GRWF 5E4AA 5DZPA 4LARH 1JL8A 4I9WE 1JN6A 2PYEE 4V2BA 4KFMA 5DLML 1Q0EA 3BUYA 4H8WC 5IMKB 3MV9B 1ZGLM 3VRJA 5LQBL 2FGZA 3L16A 4LT7A 4DP8X 2P7TB 4RDBA 3FSOA 3VX1A 3G5VA 1XAUA 3TH4T 4IHOA 5F72S 2CGRL 4AG4H 4XMKH 4WWKB 2OA9A 5EEYA 4BD4A 4PJXE 2R56H 3CLEL 3MLRL 4YDVA 3BOVA 1Q1JL 4CC0A 2ZXWB 4NN6C 1MAKA 1K8IA 3LIZH 2X1QA 3WLWD 4EUPA 1DVXA 2W8CA 1MDTA 2BMKB 3LNHA 4KROB 4M43L 1RHHA 3RWDB 1PCXA 5CHNA 4NAQA 3BH8A 2HJKA 4IDJH 3EO0A 3QC5X 3CXDL 4JFYB 5C0CD 5ID0B 3N3EA 4BZ2H 1I8MB 5LWYL 2APBA 2LHAA 5CJ8A 5DHEA 4JQIL 2MQ0A 2B14A 4URKA 5DZ9A 4CUCA 1EERB 3IN0A 3MV8B 1KIUA 3MLWH 4U3SA 3O41B 1G7LA 2WXRA 4P2OC 5G5DA 2XXCB 3RWGB 5E5RB 4BH8B 3HB3D 3FQ2A 2UV3A 5B38B 4TUKL 3HNSH 4ZAKC 4GSUA 3FHEA 4F7MA 3TIEB 4RGOL 4GAYA 2VAAA 1KLGA 4MCZB 1FH5L 1IVTA 2ZNXA 1H8LA 1BOGA 4B9KC 1E6OH 3MRNA 1HAUA 1O7DC 2AJYH 4MJ2A 2VITA 5H35A 2NDGA 4JY4B 4KDVA 3F7VA 2WWMD 3GB7B 1LP9B 4KDTA 5FO8B 2XTSA 1YMHA 1WG3A 3MLSL 3U46B 4FS0A 3BWAB 5FW8A 5JIDA 5MP6H 4E9WA 1BXUA 1HDMA 1KGCE 1KFGA 2BHZA 2YA2A 3CHPA 5IB4A 2W38A 1AKJD 2WC7A 4NZ8A 4IRJC 4GFXA 1JNHB 3VWJC 5K9OA 3IAQA 2W9DH 4TKWA 1FAIH 5C2UB 4NS0A 3F05A 1N68A 3TEWA 1YG9A 3CQPA 2V2WA 2ZOWA 4JPKL 1QWHA 4Z7VF 1EO8L 3MNZB 2MCAA 3G08B 3ZQXA 3RNQA 2J8UF 4UU9A 3SGDI 1PQZB 4AGOA 3JTSA 4XCNA 1JIBA 2WXHA 3BGMB 3ARYA 4R97C 3BEWA 3HPLA 4RIRA 3E3QC 3J7HA 2A7BA 5AZEL 3GMOA 1KV3A 3TXAA 4JPWL 4DETA 4HBCH 4LGSB 2YRPA 1NCBL 5F0MB 2Q5BA 4HV8B 4PTTA 2DPKA 3DJ9A 1R5IA 3QQDB 5E8PA 1GIGL 2FR4A 4G82A 1I9RH 5E2WL 3JWDC 3R1GL 4MJIE 3GIVB 1H9VA 4GFTB 3HOGA 3BYTA 4NC0B 5FHBL 1G7QA 5FA4A 5C07E 5FYLL 2QDVA 4YBQC 1E5CA 4OCSH 1M4KA 3T3PF 4BJLA 3RAJL 4YHML 1ND0B 4OZHB 4U1JA 2ICWB 3L3GA 5DJXA 4F5CA 3FU7A 3AMLA 1ZVYA 2J1KA 3FBQA 1V3JA 3VXRA 2XZAL 2WSPA 2H47C 1EEUA 3JT2A 1MREH 2BP0A 4QWWD 1PFCA 1ZEAH 4X6BB 4XRCB 2NY3B 4D7PA 5IQMA 4G1EB 4JM2D 1ACZA 2MHAA 1I8KB 2H8PA 4V1DD 2O61B 1I1YB 4DKDC 1CDYA 5D6CB 3PCYA 1Z9OA 3FU3A 4OFPA 3O3UN 3RUGE 1XBRA 3LNDA 4AQAB 4QOKB 1QABA 1ONQB 1SY6H 3HJEA 4YR6A 4JDVB 1CXHA 2FJUB 4BWWA 4LDLB 5FCUH 3MGOA 2J55A 3PJSA 3ZKND 4HLZG 5JIPA 1SYVB 4U1KA 2HH0L 3RVXC 1CGWA 5DCCA 5BRZE 4L4JA 2JI1A 5EIVA 3U9WA 4MA8H 3LPFA 3NJKA 3T0EA 4KDTC 2HT3C 1KYDA 3BVDB 4L8BB 4M02A 1KGCD 4DN4L 4Z0XA 3F7YB 1LWRA 1N70A 4Z7QF 5DS8B 4TV3A 3QHFL 5D1XB 5FCSH 1LMIA 3TEYA 2WO2B 2OYKA 3L45A 2P1YA 3RWIA 1AYOA 3SHSA 5IFAL 2J3SA 4OV5B 2FX8H 4XC1L 1C12B 3KHQA 3FONA 4FZ8L 2ZYIA 5AZ2H 1ASOA 1G7IB 2K4WA 2YPLA 5JORA 4OD1H 5D7EA 5AWNH 5KTEL 4HLJA 4KJYB 2X4UB 2BP8B 3BSZA 4LNVA 1XF2A 3NPSB 3OAZH 1ADQL 1EUUA 4TVSa 4CGTA 3Q44A 5BOZG 5C3LD 1Z3GH 2CJTA 3U4EB 4M8QB 1KCBA 3M45A 3FUJA 5IM7A 5IROD 4AEEA 4ZO8A 4O2EB 3S96A 3MXWH 4I0PA 3CHRA 3L4CA 1G0XA 4IDLA 4A1RA 1ZT4B 4XPGH 4OLUH 1EJ6A 5J11C 2G9HA 5FECB 3BAWA 1WBYB 4HP5A 1E8YA 5ESVB 3K1KC 4HKZB 3C9NA 4ZG1A 1C5DB 3LV3B 1OO2A 4NZUL 3IGFA 4F15B 5I8CB 4JO5A 1KJMA 3QZPA 3UBXB 1GC1H 1QZ1A 1G9ML 5B22A 1ADQA 4IOSD 3D4GA 3G5ZB 3HE6D 1JZ4A 1OAQH 4DP9X 2F7OA 1N59A 2IDFA 3BCDA 3L4WA 1AY1L 3B9VA 1QQDB 4KK6D 2VLME 4IKJA 2IV8A 4MVBD 3MRFA 1TYEB 5EZJA 4K15A 3MJ9A 4PG2A 4K8RH 3MRLB 5A6LA 2FSDA 3AWGA 4BKSC 3LD8B 2CIKB 1IFGA 1NFIA 3NGBC 1ZA6B 3I2CH 2UUDH 1WFNA 1P69B 3UBGA 4IDJL 4YXKH 3B9KB 1NOAA 4H4NA 2NY6D 1S7VA 3TU6A 2P42B 3NVQA 3T0EC 4F7TA 3U7YH 1NKGA 1OGAD 2E6JA 1U8HA 4JL1A 2TRYA 2VZ3A 1JRHH 1U8OB 2ZYSA 5FGRA 3RZCB 1JF5A 3MJ6A 2PWFA 4QNPF 3BPLB 1CGUA 3JWOC 5I0YA 5FYJD 3UAEA 4UTBA 2VDRH 4HX1B 3Q5TA 4X4ME 4FQJL 3OR7B 1JNJA 1E6OL 4F37F 1Q94B 2AJYL 3GMMA 3KWXA 1FQ9C 5FFOA 1J88A 3BVXA 4FNRA 3FL7A 4O58H 1YMME 5C0EB 5ANMA 1UFUA 2R0WL 3SQRA 5C0GA 3UTTA 4ZODA 3CFEA 1GYAA 4Y4FB 2EDNA 1MCWW 3HZMA 3BPOC 3N1QC 4UB0L 1DJXA 1E5UI 3RIAF 3UC0H 3F5WA 4I0PC 3RB7A 4EI6B 2CRIA 3LKQA 4LCWA 4E41D 4G5ZH 1FAIL 5H2BA 4P2QA 1BZDA 3GINA 4TXVB 4AL8H 5EF0A 1KBWA 3R7RA 1UACH 3E6FA 1HNYA 5GRYA 1I75A 5FW7A 4HD5A 1GRWA 4NFCA 4ANUA 2R29A 3DPBB 3ET9F 1CDUA 5FA3A 5IK3A 3UJJL 4OI9A 1MWAL 2WINB 3GRWL 3GXNA 2GJ6E 5T1MB 3ARFD 2C1PB 4JVWA 5BUGA 3F62A 3TO4D 1T0MA 2WVUA 3N6YA 4MCYA 4QXTA 2QHRL 3AM8A 2Z7ZA 4NFDA 4CJ1A 4ZRGA 4JKKA 4HBCL 3QEQA 4YGAB 3CN3A 4W6WB 2VERA 2EUZA 3G5YB 3QCUH 1PGRB 4X4YB 4MAUH 2HG0A 4ZYKB 4U1NB 3GJFA 3C2AL 5CWSA 3JVFC 4PG2C 3FT4B 3UMTA 1GVIA 3MBXL 1BEYL 2EDRA 3D06A 2DQFB 4LQFH 5DVOA 4EI5D 5GXBB 4L3EE 4ZMVA 1ZLEA 2LU4A 3C5SB 4OZFH 1KCRL 2J5LB 1CDCA 4IOFC 5IMOA 5C0CB 4WTZG 3VG0H 2P9RA 5FKAA 3T8VA 3RWFB 3BQUB 3NPZB 1IFHH 3HN5A 5LDSA 3NTCL 4BSJA 2NXYC 3LKRA 2EECA 4UMSA 5PAZA 3S37L 4NPKA 5HGGS 2PLTA 1BZ9A 3T6XA 3QFJE 2B1AH 2VQ4A 3DIVA 3HB3B 3WFZA 2B9AA 4FE9A 1KCKA 4NUJA 4PWIA 4G7RB 4HK3N 2DJSA 1JWSA 4L3FA 4KO9A 3RX7A 3UH8A 1I4FB 2I26N 1AAJA 4ZFZA 3Q6FB 2UX7A 3WY4A 2DM2A 3QXTA 4K7FA 2G5UA 4WF7A 4HULB 1TKWA 1HESA 1YMMD 2PR4H 2VOTA 2E74C 1Z5YD 3FQ1A 1WWCA 1SQ2N 2QSCH 4GAGH 3ULSB 2HJFA 4ZFOB 2F54D 4WCYL 1YHPA 2H1PH 4OSUH 3KG5A 5HHOD 1KOAA 2P5WA 3K81A 3DDFA 2XZCH 3UBFA 4OIFA 3P77A 4CVZB 1WGVA 4PJ7B 3L2LA 1AKJB 1Z3RA 1OTTD 1NCDH 3FO0H 4U6VH 1GS6X 5AG9A 4I2XE 3HPJA 5BQ7B 1M56B 2DI7A 3PWVA 3B8YA 5DD3L 4JHWH 4DUXA 4HA1A 1PYWB 1FVDB 1OM9A 1MCPH 4EIGB 4FG2A 1YEKH 4Y4HD 2JK5A 5ALCH 2A6KA 1I3VA 3MACH 4UM8B 4AZ8A 3KPNA 3PWJA 4X6EB 1YQ2A 3L5XL 1A3RL 5D7JD 1CQYA 4P5RA 1KCVH 4ADJA 3QORA 4Y5XB 3BGFB 5F1IB 2YGNA 3MNDA 4MXQC 3TPKA 5AVUB 3AM8C 3FQNB 3MXWL 5C2BH 3CHOA 1ZT7A 4PJXB 4FQ1H 3A3YB 3F84A 3QHTC 1NCGA 1HVXA 4G43A 3SOBL 3B34A 4UQ2B 4L3ED 4NQQA 4BCZA 4K3JL 4NP4L 4WUKL 4OCXL 3RNKB 3VMNA 2JH2A 5EF3A 4GEIA 1CXKA 3QGVA 4K3HA 1FFOB 4P4KD 5CJOH 2X3CA 3RJQB 1G4MA 4NZTH 4C57C 4PREB 2BHFA 4AH2A 3BMWA 5BJTA 2GAZB 3ECWA 2FRGP 1BVLB 2EACA 3QCVH 3RKDD 2YXWA 4FDWA 3MNVA 3O2VH 4G80B 2V3DA 3QFJD 3VXME 3VVWA 5IG7B 2X6VA 1BQLH 4Z76B 1AHKA 1MHPH 2ZUTA 3V4LA 1BREA 3MUGA 5BZXA 1J1XH 3NN8A 4FKHA 3OMAB 2QTVA 2W60B 1HU8A 2FUQA 1NUNB 2GBUA 3I2CL 3OJDA 4A55A 4ICWA 4JCLA 4NC1E 4FNUA 5IHUL 4YXKL 2WVVB 1SM3H 4LDOB 3T04D 4AGQA 5AAPA 1BCIA 2VDQH 1H3XA 3WELA 2EVFA 4M9OA 3LRHA 1UZ8B 4E9LA 4X8CA 3FCGA 1KTCA 4WI7A 2K6WA 4WV1A 1S7WA 4WVRA 5KANG 4AJ0A 4YZFF 2APVA 4PS4L 1KJ2L 2VM9A 1URIA 4NNPL 1L7IL 5FOBB 1M53A 4PYGA 3BRFA 3BJLA 3OLGA 2JJTA 5TQ0H 3EYVB 1FNEA 4YHZH 3CNKA 1KNOA 5F9JA 2BY3A 1HEJC 3L1GA 5FFGA 4TSAH 2VWEC 4KZDL 4UOW0 3QWRA 1I3RA 1TETH 3TLRA 4DZ8B 5DS1A 2NLJB 2NY5C 3P40A 2Y7OA 3W1ZA 4F3FB 4JLRA 5TTRA 1T2QH 2WQUA 3S5LB 1PNCA 4CRPA 3VD4A 3V0AC 2FB4L 2L8AA 4R2GC 1GJUA 2YPVH 1HILB 2R0LL 2EIZB 1BFVH 1GPOL 3DETC 3GMLB 3GRGA 1ZE3H 3LN9A 3QORC 4LSUH 3GNMH 5LNDA 4KZEH 2MEJB 1KJ2A 3ULVL 4LLYA 4HJJL 1K72A 2C9VA 1NM9A 2VDOL 4B7LA 3NBNA 3M17B 1JRHI 1XGPB 4G5ZL 4TPRH 4UQDA 4PJ5E 5KAQF 5HGHA 1KLFB 5IBUG 3S34H 4OFDA 5KVFL 1AD9B 3NP3A 4WTXA 3WU1A 4NQVB 1VCAA 1BGXH 3TCLB 1TEGA 3UG5A 3ZKXC 3G6DH 4DP2X 1ZCRA 4R6UA 3HE6B 4LQ1A 2C3XA 3ZQ9A 3GJFK 1G0YR 1E7UA 4M7KH 2CK2A 2ZSVA 2B4CH 4E2OA 1T03L 3NCFB 3GMRB 1X9QA 2OBGA 1UA3A 1JDAA 1F86A 1YNLH 3RUGB 2P3YA 4LCIL 2OCJA 3CPLB 4MMZA 1XIWA 2IMMA 1JF1A 2E9IA 2G4EA 4QRQB 2F1EA 5IQ7L 5FW6A 2NY2C 1FYTA 3VI4B 2A74B 5J6GB 5KYUA 2ESVE 3L7EA 4O5LH 4WI4A 1A6TA 4KQ3H 2WZPA 5FO2A 1JCKA 4HLEA 3VJ6A 4F8PA 4Z7NF 2Y2TA 2YPKA 3F6IA 1AQDB 1IFHL 2YD9A 3OPZL 4UQEA 2NY6B 3F7LA 4YGVA 3IXAA 3FUDA 2BM3A 2R7EB 5JHBA 1OGTA 4G8EB 2Y36H 1N6VA 3QUMH 2MPAH 3K6OA 4P99A 4WV1C 4APXB 2XKNA 3C60B 3O2DL 3O6KH 2Z8RA 1KYOJ 3N1MC 4AYGA 2NXZC 3Q1EA 3VRLF 4Y0GA 5DK3A 3CIAA 1CFTB 2VM3A 2JJTC 1D5MA 3U2SB 4IRZA 2EILB 3EJSA 3U6XA 5IEKA 1XGYH 2E0PA 1LE9B 1AXSB 4MKTA 5BV7C 1UTDA 4UDTB 3JUYA 1RK1B 1KMGA 1OWWA 3F58L 4NQDD 3FTGB 2PR4L 2OJZH 4KKCD 1K4CA 3UZQB 2AQQA 4GAGL 3WOVA 1IILE 1NBYB 1UB6B 3KPQB 3U30B 2IANE 4W9FC 5JDSA 3ATEA 2N0MA 2BVQB 4OM1H 4ZMOA 1E4XH 5F7WC 3A6BH 1K5WA 2P43B 5FPIA 3I6KB 1WLHA 1AXTL 2E9BA 2EXWD 2YAPA 3UPAA 1CLVA 4FQXA 1HNGA 2ZCKH 2QGEA 3MN8A 4GMSL 4PJ5D 1EXHA 3MYJB 4YDIL 1JPFB 4I3RH 3UYOD 1NFDE 3UOAB 5MERB 1MHHB 1DJSA 1DJZA 1NKOA 5A7EA 2VLLB 3GSNA 1Z7JA 2WMPA 1ZS8B 4ETYA 5ACLA 3E1ZA 4LESA 2CBOA 3V52L 2EO9A 1HN1A 4JO1H 3L1OL 1P4IH 3LRMA 5CBEB 3BE1L 4C58B 3ARFB 3P54A 1MEXL 1XQ4A 3TO4B 2M1KA 1CT8B 3CDZB 3FPYA 3F6LA 2WVSA 4N0CD 4PRHA 4G6KH 4L1SA 3JV0A 2R4RH 2AXFB 4XVTL 2EUXA 4G9FD 4FQ1L 4MQ7A 5CGMA 4KMTL 5IB3A 2DEYX 4CADA 3X1NA 2M2DA 2AC0A 1WD8A 1OAUH 4MMZC 2ESVD 4AEIL 5L9DH 1XIWC 2APSA 4EI5B 5HDOA 2PCXA 3S36L 2GTWA 1UZGA 1X5KA 1UKSA 5DEGA 3LMJH 3EJRA 5CN2A 2DJUA 3UTSD 4O4YL 4UV7H 1TU2A 1NLBH 4OTXL 5DJ0A 4WI8A 2Z4QA 3R06A 2B3IA 5EOCH 5GGSA 4DTGH 4M61B 1QOKA 3J07A 1A22B 1OB1A 2VRQA 3ILPB 4Y9FA 4BZ1H 4LSRH 2ADIA 5GQBA 3L1FA 2GJJA 2YQ3A 2AJZB 3B2MA 3FK3A 2IAMA 4PRNB 1QSEA 5INCA 3BD5A 1FCGA 2ZXBA 3CCHB 4MYPA 3T0AA 4YX2L 2WLLA 2VXQH 2HJLA 4G8FB 4QF1B 3OB0H 1J1XL 2BERA 1NCCH 4LP8A 3RPIB 4UOW1 2M8XA 1BVNT 5C86A 2MCPH 2R1WA 3P4MA 4QXUH 1NCOA 4YHPA 1J0IA 1KB5A 4PHZA 3DUUB 1YMMB 1JZHA 1MJ7H 3E80A 4LPWA 2IAND 5GRUH 1NDTA 1OOAA 4F2MB 2OR9H 1YJDH 3RY4A 2F54B 2VCOA 3D08A 1OCWL 5LN8A 1P5VB 3SGEH 5KYYA 4LSSH 1DN0A 3QJSB 5TK2A 1T6WA 2X89A 4XCEB 5KYXB 2AW2A 4FQXC 1JHTB 3CAFA 5CUSH 5D5MA 5KJRH 1J9CT 3FZUC 2WLMA 1DVQA 1IGYB 1TTRA 4P2CG 1IEHA 1T1YB 1TEYA 1GW0A 4J3OG 2Z7WA 4YHZL 5JR1L 2EICA 2KLRA 5FWQA 3MRPB 1M3IA 4YHYC 4ADIA 2GJ6B 4LEOA 4MDJA 4PJEA 4W9HC 3ABMB 2PTTB 2ZF8A 4OJCA 4QD2E 4WFED 4YVNA 5DXWA 2XVBA 1JZ3A 5B7FA 1GH7A 2J88H 2CRZA 3MRMB 2AK4A 5D7IE 4QYOB 5KSVB 3QULA 3G7TA 1EO5A 3H2PA 4WK0B 2I07B 3JV4B 4MJJA 4MA1C 3UO1L 4JCMA 4KZEL 4Q6KA 3ETSA 3D07A 4HG4K 1WA0X 2J21A 3QYMA 4L3EB 3VFTB 3GXFA 2FWOB 5IW1B 3EG9A 1J87A 2Z4TA 4XHJC 4P4KB 1NEZA 1FPTH 2FJHB 3VQMA 2J4WL 3SY0B 2BIQA 5EDSA 1E4HA 3DROA 1CGTA 5HVHC 1Q9KA 1WS7A 1XSIA 5LB1A 4G8GD 3L54A 3UGEA 4ZUTB 5FKPA 2VE6A 4PI0A 3MU3A 4LL4A 3QFJB 3OKKB 5T1DL 3BC9A 2G2RB 4R7DB 3H4FA 2EYRA 2IAMC 3T6WA 1BP3B 2BWIA 5AL8A 4U3HA 1S9WB 4ODTH 4O2FA 3AXLA 5F89B 4HCRA 1MLCA 4ZDHB 3RPBA 2EIBA 4IKNA 2ITEA 1K85A 5D7SH 3B5TA 5CKAA 2BS9A 3MOAH 4BQ8A 1ZANH 5DHMC 1B3IA 2YIHA 2JCCF 5BS0D 5K9QI 3MREA 3IU3B 1EO7A 1KPVB 1PKQA 5SWSA 5I5IA 2NY7H 1U6AL 2VISB 1BQHA 1NIEA 3UTOA 3P11H 5D71L 2BSSA 5B3NA 5EEZA 1EEYA 2D03H 4FI6A 3DO7B 1KCLA 4G6MH 4JO2H 1DDHA 4PTUB 4I2XB 2A73B 4YSTA 1MCDA 4F57L 2WLIB 2Z92B 1TTUA 3K72B 4H8WH 4EUPG 1U3HA 3LXAA 1XGYL 4ONFL 2JCCA 2HRGA 3U0TA 2OXGA 5ID1A 1OWRM 4Z7WE 4AXWB 3MJ7B 2R0KL 2VO8A 3Q2WA 3QUXB 1MH5B 4G7YL 4W4NA 4OR1A 1JFHA 1W6WA 2QR0B 1Q8MA 3RX9A 5GS0D 1RUPH 3WHE0 2ZXGA 3QRFM 2ATPB 4GUCA 1BM3H 4G6FB 4G71B 1RUAL 3RI5K 5KBNC 1A7PH 1ZHBA 3UZEC 4D9LH 3OMZA 3QVAA 4ANXA 1A4AA 2BVOA 2VRKA 1JP5A 2YXFA 4I3RL 1XCQA 3QIWA 2NY4C 2VDLH 4PWJA 3WJLA 1F1GA 3S3BB 5IV2B 5DDHB 3BZ4A 2OLDA 2N1KA 1PSKL 1EJOL 3DSNB 4XZUA 1E28B 1T04A 5FAAA 3MV11 2JKLA 4LBAA 4AENB 2NCMA 4GRMA 3RDTB 1P4IL 1QFWM 1NGZB 3ZHLA 1EGJA 4HSQA 5IGXH 1KACB 1TQWA 5T1LA 4PGZA 1CE1H 3I02B 1IV8A 4NUGH 4BGDA 4KI1A 3VXMB 4PJIF 4EZLA 3BVNB 5D1QE 1E4XI 3AGWA 5IMMA 1W15A 3MR9B 2VXTH 5EWIH 3CVCA 1PNDA 5FB8A 5DFVC 2EE6A 3MYZA 5DK2B 1GYWA 1TPXB 2X4TB 3ARSA 3RZWA 5L9DL 3ABLB 2NW3A 4ANVA 1A7BA 3PS6A 1UOWA 3TH2T 3D9AL 2XQBH 3LMJL 4LLDB 1TVDA 3BJ91 4UV7L 4HF5H 2VZSA 3QUZA 3UL4A 3VXUE 3V6ZA 2WTRA 1OAYL 4PB0L 5KSUA 4P2AA 1MVYA 2X4QB 1UOLA 3D7PA 1J8HE 1R1CA 5LBGA 1O7DE 3J8F7 4AYFA 4M6ML 2DWEB 4PYHA 5T1KB 4ATTA 4LSRL 3VFRB 3EBIA 1IM3D 4ANKA 4MLSA 3IJYB 3MUUA 4UAOC 2CDFA 3MBWB 4MNQA 3HBZA 1ZPUA 4PCSA 2VXQL 2Q6WA 2JE8A 5IT2L 3LKSA 4I18A 4DNLA 5EU4A 5CEYB 3NIFE 2XV2A 3WIFB 4JPVH 5E5LA 4KQ4H 1U3HC 2G30A 4HEME 2WAHA 1UH2A 2HTLD 4HWBA 5HHPB 1YCSA 3ZRCC 1MJ7L 5GRUL 3RL2B 3OGCA 1A0QL 3L3KA 3BH4A 4ZFFA 1A1NB 3P30L 3EDKA 3H9SD 4FKKA 2QPUA 3RFRA 1M9SA 3L3JA 2X70B 4QRTB 1QMUA 3DX9A 3JWDH 4LB8A 2CHZA 4GO6B 1M2VA 2WXNA 4HAFA 2YZ1A 2OMZA 3DVGB 4GRWH 1GS7A 4L1HA 5GIRB 5ILTH 5KJRL 4PJ5B 2IDTA 2Y7QB 3LRSB 1RVFH 4TSCL 3KNBB 2ZUQC 5TPWL 3ZYZA 3QIWC 3WJLC 5I15L 2H2SD 2HVKA 4IMLA 1B9KA 1KJVA 3BEVB 3OJ2C 2ED7A 5CSZA 3ZKSD 3BIKA 5J13B 5D9SA 3U2IA 2VR5A 3DOSA 4KGJA 2WO4A 5D7LA 4FXGA 1AGEB 5HGBB 3C6LD 4JB9L 4P46D 1ZWIA 1MCJA 5D1QD 5HHVH 3ZDWA 3KM1A 2FIRT 4H88L 4U6HA 4XHQA 1YYMH 2CO1A 1T2XA 2IBBA 3JV6A 3SGEI 3EGSA 2OSXA 2VW4A 1CICD 2HWZH 3ABGA 1PD6A 3D85A 1JWMB 2X4OB 2XPYA 1A4KA 2YGPA 4G9FB 4RRPA 2Y1ZA 3FF8A 2AJVL 4DKEL 1GZQB 1MFDH 3DGGA 4YWGH 3MXVH 4OZIE 1JXKA 1IBGL 4HFWB 1Z9SA 2X4RA 2ESVB 1O7VA 1I9JH 1NBVL 1PZBA 1XH2A 4ZTEA 1FFPA 4Z6AT 4IBUA 1QLEB 2MNJB 5GS1A 3GO1L 1XF3B 2HLAA 3GKWL 3UTSB 1EHNA 5PCYA 1NGQH 3WIHH 3PRZA 1FC1A 1FLTX 4LPTA 3QUZC 2EXYD 4GEJA 4GKLA 1KLUA 4WO4D 4EKJA 4PGEB 1F13A 2IH8A 1UB5B 3NJNA 4NQEA 1XXFC 5I0ZA 3US1A 3LN5A 3MMEA 3IRPX 4K3EH 1IQWH 1F58H 1GJWA 4QHKJ 3BAEL 2XHNA 5DRNB 1FHGA 1N6UA 5JXED 1R5VB 3FB5A 2O6EA 1XSKA 3CVDA 3HUJE 3FH7A 3M46A 4I18C 3QNXA 2Q86A 3BKJH 5K9JH 2E7BA 2XVKA 2VH5H 2PWGA 2OTWB 4TNWK 2EDOA 4K5MA 3TBWB 3TNNA 3TONA 1S5HB 3VD9A 4TQ8A 2IANB 1B88A 4XN2A 2Z8WC 4FG0A 5T1JA 4I4WA 2O5XL 2NY0B 3RBSA 3BIAX 3UZVA 3ZE2E 3DVNB 3ZHFA 4PN6A 1M9WA 1I3UA 1WZMA 4ELKB 4JQXA 5L88H 5F3BA 1SJEB 4Q89A 5DJ8A 4Z3HA 5CU9A 4NRXA 4PGDB 2DMHA 4KJWD 2VDMB 4FQHA 4XNBA 3HS0A 3IDYC 3EYQD 1XGQA 3S2AA 2BSTB 1IC5H 2UYLB 5GSVB 5CILH 1TJHH 3EYOA 4XPTL 4PRBB 4FXGC 4Z5RB 1M7IA 5DMIH 1BDYA 4NYLA 1YEFL 5B1CA 3QZWA 5AQ0A 1M05A 1FHNA 1JGVL 1RU9H 2GI0A 3FCSB 3PJNA 4A7VA 5C6PB 3CUPB 2CXKA 4CSTA 2N59A 4BGLA 3ILQD 4D9LL 5BXFB 1W0WA 5DQ9A 4F7PB 4JFDA 3IDJA 5I16A 5AZUA 5CF3A 5LNEA 4JMNA 4OZ4A 1WE5A 3KJ6L 3OVUB 3K71A 3NK4A 3GBLA 3QDJD 1P5UA 1JGEA 5GS1C 4RRPM 3ABKB 2VABA 4OFKA 4PJGB 2WQVA 4IU2A 1CD1A 2OMWB 4NUGL 3DRTA 1FL5A 4S2SA 5FYLE 4WFFE 3S5ZA 3K6NA 4BXVA 2WY3B 2VXTL 4FFZA 3WJMA 5EWIL 1GGIL 1KTKE 2HT2C 4S1SL 2P5EE 7PCYA 2N7SA 4GG6E 2Z6FA 3EH3B 4K9JA 3BSZH 3IVKA 2BOBB 2E9JA 3LHAA 1EDQA 3AGVA 3S8GB 1MW3A 5EUOE 4N3UA 1S9VA 1DBKH 1S7SA 3PQYA 2XQBL 2A4CA 4BUHA 4KI5F 2CBTA 1AI1H 1Q1PA 2OMTB 5HHNA 5BS0B 1YEHH 1W80A 1Y07A 1NH6A 2CBPA 1MRCL 1RIUH 2EE9A 5HTSA 3U2JA 4NHUA 1KIRB 2C34A 4OT1L 4N9OB 3T2NL 4YMPA 4RMWA 4KK9D 3T0VA 4J8QA 1DVYA 3EHBC 4GAFB 2HMIC 2G60L 3D2TA 1TT6A 3QNZA 1XFPA 2DYPD 4PJDF 5GGSY 4MXVF 1I9IL 5L2JA 1EFXD 2AV7B 4JQXC 2O1AA 1BBJB 3QJFB 4WU5B 4ZMLA 4A7GF 3BP6B 4HOZA 1IGJB 3MV7E 3NACL 3LOWA 2Y5EA 5DU7A 3JXAA 3HS0C 4GW4A 1QRNE 1KENH 2WYIA 4RMQA 5KJ4A 3O3BA 4LL9A 3G3LA 2XY1A 3MFFA 3OMIB 1OE1A 5D7IB 1TCRB 1N5AA 1RZJC 3PGCA 3ROOB 5H4ZA 5F7YC 2XV0A 3MJ9H 3HZVB 4PJDA 4ZOAA 4P2RA 3QFDA 4MWFB 1NM4A 1PVHA 1SMAA 2R2HA 3PLYA 3DPDA 3ZXAC 3HMXL 3ZO9A 1EAQA 4ETQB 4KGLA 4NO3A 4WW2B 3HFML 3NJFA 5GSRB 3ZTEA 3KWTA 3TA3A 1R0AH 4ISVB 1PY9A 1QAWA 3NIDF 3PXLA 1IX2A 1F4WH 2EO7A 1TZOA 1RJLA 2VMEA 5MEQA 2RCSH 3EFOA 1NGPL 2VQUA 3BP5A 1E2ZA 3HBGA 3BQVA 1XGTA 4RGND 3H9YA 1S6NA 2VMCA 5MEOA 1P5UC 1JWUB 2PPFA 1QKZH 1BX2A 5FYLD 1O9WA 5HHVL 4JCWA 5IOKA 5JUEL 4G42B 4E0RA 2V7NB 1DSFH 3K6FA 2CIIB 4JN2B 3IGAB 4KRNA 2BY1A 4GP8B 4UTBH 1IEBB 4XT1C 3B6SA 2HWZL 1Q9WB 3M7FB 1GZPA 2CKBA 5J0BA 5D4QA 3N1PC 4LO9A 4TLKA 4YWGL 4HIEB 3LZFH 3CZFA 4K55A 2NNAB 2JQAA 3CQFA 4C83B 5AG8A 5H94B 1NCAH 4GRLA 4DZBB 1N67A 1GTNA 4L8SA 4BELD 4Z7UA 4UUJA 4G8IA 1NGQL 3L3IA 1II4E 1N10A 4K3DH 5HY9A 1OSYA 5E8EA 5EPMA 1BZ8A 2F08A 1DQDL 5B1AB 5I9QB 3VFUA 3MBED 3MRCA 4B9PA 3CMOL 7PAZA 1IAIL 4JPQA 2VSCA 2VW6A 1IM3B 2PTUA 4HKBB 3VDAA 2OMXA 1J7VR 3GSWA 4GLRH 3IKCB 1HL4A 2YAMA 4ES9A 1P2CB 3GLDA 5BMFH 2E3VA 1CYXA 4EN2A 1P1ZA 5HVGB 4AVJA 1WVZA 2R29H 2DTMH 3MV7D 2G2NA 4JRXE 4N5EC 1J9SA 4LCUB 5DUPH 4WEBH 4Q9CA 4Z7WB 4M48H 1FL3A 1QRND 4XP9H 4JFFE 1AIFB 1A9EA 2VH5L 2NDFA 4H5SA 4AK1A 2PW2B 4LCWE 3HCVB 3KLAA 1COBA 3V4PA 1N3NA 1OB0A 5JW5A 5EU5A 5GISL 1D5XA 3EYSH 5KVGH 4PV8B 4TQIA 2GI7A 1J8SA 2MKLC 4TVUA 4YUEL 3VFVB 2QFPA 1YZZA 1FNSL 5DFTA 4QTFA 3FHQA 4XBEH 4MA7L 4FF9A 3LNIA 4K2UH 1ZLUK 5I1AA 4XOEA 5A2KH 3STLB 5L0QB 2PCFB 2W0KA 3KPLA 4JRFA 4AT6A 4OLEA 3V0VB 1TITA 3CK0H 3EW3B 1D5ZB 2Z91B 4WUUE 3TA3C 1WTGT 2VLKD 3EUUA 4Z0XB 3BKCL 3RWHB 2P24B 3RL1B 3ZE1E 2Z65C 4ZQKA 4FABL 3TJHD 5F7FA 5I75B 1JTTA 1TJHL 2EDXA 2L4OA 4BIKA 1A6UL 1H8NA 1T1XA 5DZVA 3RVWC 2QLYA 2XWJA 2WVTA 2RQ8A 2CA4A 3O3AB 2V2XA 4JZJC 5D1QB 5FUZH 5HVWA 4ZUUB 1BVKB 1F2QA 4ZK8A 1UM5L 4ZUVB 5E00B 2CO7A 4NQXA 3RWCB 3SPHA 5ITBL 2VDKL 1KPUB 3VW3H 4LSVL 3TYFA 3IAPA 1JF6A 4P5MB 3KCWA 4G83A 5CGTA 2ZNWA 4Z3IA 1INQB 3SKOA 1RJCA 1KGIA 2YQ2A 4UT6L 3FUKA 4WI2A 4WQOA 5L4IA 1BD2A 3HG5A 2ZCZA 2F53A 4GRLC 5IB5B 3VXNB 5IB1B 4J5VA 1G6RB 4BHUA 4L8SC 1XXDC 1BJ1H 4PP1C 4XCCL 1J8HB 2YFOA 4S0TD 1EBAA 2H4EA 2E7DA 2YWYA 4WO4B 1R17A 2HFGL 5SX5K 4KUZH 4LLQA 1J0ZA 1JGDB 3B56A 1CJYA 3S6CA 5I1EH 3DURA 4GJTB 2JB6A 2ADJB 1TQUA 4DAGH 1GCYA 3OHMB 1J1PL 4JRXD 2JMRA 2NY5H 4OFVA 2ICEB 4N28A 5E03A 1EEZB 2YGOA 4XC3L 2AI0L 3FO1B 3PXHA 4FFWC 1YC8A 1OARH 4PV9A 5DEZA 5F7DB 3EBAA 4C56A 5EBMB 2WYHA 1XMEB 4CA4A 4N2IA 1BBDH 3V0DA 1WFMA 3N40F 2BJMH 1XV8A 3U9PH 3Q43A 2VMFA 2WQAA 2RTTA 4P3CH 5DO2D 4NENA 1KPRB 3EOTL 1RIUL 3LJ3A 1A3LL 3WDIA 1JBJA 4PJ9A 2RFXB 3AQYA 1FL6B 3VAEA 4E5XA 12E8L 2IGLA 2AGJH 1DCEA 3MRKB 3ALXA 3O8XA 2V8MA 2WYTA 2A38A 3SDCC 5HHXH 4M1CD 3QH3A 4NSKA 3TBVA 3OZ9H 2A9AA 1T21A 2IGTA 2JXMA 4HPYH 5JW4M 1ETZB 2ARJA 5K9KB 5IMLB 3VD2A 2DQTL 3ZMEA 3CVBA 4PRAB 1CFBA 1IFRA 3DA0A 4JFEA 5F1SA 4ZMTA 3P0YL 2BNRA 4MAYA 1O7SA 2H41A 5ALBL 1WTLA 2VR3A 4AGLA 4ZI8A 4HKJA 4EUPB 5C6TL 3N42F 5DUBA 3T8XB 1HYSD 4YO0A 5BVJA 2YD6A 3HEIB 3VNZA 1T83A 2DWXA 4OZGF 1KC5H 5JQ6L 1SEQL 3MLXL 3SKJH 3W56A 1UH4A 5G4OA 4JEGB 3INUL 2XG5B 4OZIB 1ES0B 3I85A 2QQNH 5KS9E 1CK0H 5EU6A 3QUYD 5IKCB 1HL9A 2BS8A 1MRFH 1Q0XH 4WFGD 1JPST 1F4WL 3O6LH 5F6HI 3QAQA 3O6FA 4EE2A 4ONGL 5C0JB 1QSFD 1LO2H 1BVNP 2IADB 4GOSA 4WIQA 3QDJB 1K5NB 3UJIH 2FIKA 2Y7SA 2VZUA 5DC9B 1MIEL 4OZGA 4BEIA 1QKZL 5B21A 4G7SB 2WLYA 5ICXB 2Q7NA 2VR6A 4QRFA 5C0AD 2IFGA 3W5MA 4MNGA 5DJ2B 5A40E 3JBG7 4X6DF 5BV7H 2GK0B 3SY6A 2WWKT 3SYOA 3HUJB 4M56A 1AGDB 1R24A 2B9BA 3GRBA 5GGRY 2PWDA 3SKUD 5I8OH 1LQSR 4TTDD 3T6VA 3MODH 2DQCH 1PCSA 2DWDA 3OR6A 2AVFA 4S1DD 5HD8D 3U9UA 4YDKH 1NCAL 4LKXB 2MMXA 2Y7LA 3VSUA 4HK3J 4GB9A 4XOBA 4Z8FH 3L9RA 4UQ3B 4JKNA 3REVB 5HJBA 4ZNEE 2YAOA 2WANA 4TQHA 4JKMA 4JAMA 1X5XA 4Q8BA 1UD4A 2X88A 1NMCC 1MW0A 4PRDB 1EAPB 5E6RB 3W3BA 5I73B 3ZE2B 1LK3L 3BXNB 4MS8C 5B4MD 2E27H 5ISZD 4PJ9C 4HXAH 2BSED 3LZPA 1H3GA 2VDNH 3QEHA 2ROYA 4NN7B 5BMFL 4F20A 4Y4KB 1TNMA 2X7LB 2DTML 3O8XC 4XXWA 3F83A 5KUKA 4P9ML 5DUPL 1E5YA 3FU8A 4PMEA 4WEBL 2OL3H 9CGTA 5JHDA 3TM6A 1J5OH 5E8PB 4AE0A 3EF7A 5EC2A 3AABA 1I8UA 2FO8A 3EJPA 4X5LA 1FLRH 4KJQD 4AWJC 3SJVE 3OD3A 4DKFL 1TTGA 1U21A 2HKHH 2OX5B 2ZT9C 1F3DH 3EYSL 4MAYC 3DUSA 5CLZA 3SN6N 5KVGL 5CD5C 1Y1DA 3Q9PA 4HMEA 1C16A 5F3HA 1CGSH 3SBPA 5JOPE 2CLVB 2G5BB 4JFZL 5J1TC 2Y22A 4HK0A 1T83C 2MTPA 4XODA 1KT2A 3ESOA 3FFDA 3FJTA 1DJIA 3GXTA 3K8KA 3L3GB 4K2UL 5DD0H 4AM0Q 2ODHA 1T0NB 3FQUB 3GK8H 2XA8L 3BMVA 4GLRI 2BOCB 4FYTA 3CK0L 3VTAA 6PAZA 1L6ZA 1XZ0B 3ME0B 1BJMA 2EYTB 1K3IA 4WFHE 4RISL 4AYID 3ULVE 1CLZH 2OXHB 3O6FC 4RGNB 4UQCA 5IW6B 1W9XA 4FZEL 3B2UC 1DUZB 1YEDB 4MQXC 3JTTB 3VCLB 1UXLA 3QDHA 5KVFE 3MO1A 1FYTE 2Z8SA 2NSXA 1RERA 3WNNA 1CLCA 4QCIA 3VYPA 2FX9L 3FRPG 4W9GC 4YQXH 4GG6B 3C8HA 2P5EB 4IRZH 2NR6D 2R59A 4PRPE 4NAMA 2O5ZH 3DO3A 4D8PA 3KPSA 5KBKA 4GQ9H 4X7DC 4R4ND 5J57B 4KQ0A 5EUOB 4KKZA 3OXRA 2RAMA 4G2AA 1HZHH 1C08B 1SYSA 3LDBC 3O45B 1T7ZA 2SODB 4UTAA 1U8MA 2WWKO 3ARDD 4MBOA 1CFSA 4NUMA 2BSRB 4X5RA 2LVEA 1CGVA 3RDJA 4DOHE 5J56B 4RMSA 4PH8A 3MCKA 1EHKB 2Q7YB 4D2NA 4X9GA 1LEIA 5TJWK 1JGLH 3LNEA 5FYKL 3ARBD 2J5WA 1FV1B 5LGJB 3MBEB 2FATH 2ZX9A 4MX7A 4X5XB 2WQWA 2OSYA 4ACPA 4MA3A 3KXFA 4PGCA 3GSNH 1NDMA 1I7UA 1S9YA 2ZX5A 4PLKC 5DHVA 3RVUD 1B9ZA 3MV7B 1G7JB 3FQXA 1NEZG 1MZYA 2QQQA 2E9WA 4QIRA 4XXWC 1ORQA 5ABZA 1QRNB 5HI3D 4WWNA 3IRZA 4BCXA 2ENQA 1GYCA 2WCPA 4L05A 3TF4A 3U9PL 3MRDA 4H0HB 4MD0B 1J8RA 1FZMB 1ICTA 4GQPH 2BZDA 1YY8A 4U4IA 2HFEA 3S4SA 5IFJB 4O51A 1RUQH 4AM0B 3TN0D 5A43C 1PEWA 3GSUB 3HZYB 1ESOA 1OM3L 4NKDB 2AGJL 5AOMA 3ZR5A 2L7EA 2Z31A 4A67A 3BUIA 4XPAH 5I6XC 4U6YA 1EIBA 1G1CA 2B2XH 1WGOA 4OLWL 5GGVL 4EOWH 2CD0A 2F19L 1WZ1H 3CFTA 3OZ9L 1U3JA 4WFHD 5JPMA 1T20A 3LQMA 4NO0D 1AD0B 4Z78A 4FXKA 25C8L 4IS6A 4A2LA 2BNUA 1LK2B 1TZGH 5AAMA 5IEHB 4QY8A 3NOIA 1IIIA 2WB1A 3ARXA 4JFXA 4JVPA 1JHLH 2K70A 4M7LT 5ERWA 5KSBF 5HP5A 4WU7B 5I1DB 1MRDL 1KSRA 4ZD3L 5DWPA 4YLQT 3U36A 4X0KA 3QZMA 4O9HH 4FRWA 4POZD 1RJZA 2N01B 3GLEA 4K73A 4BH7A 1EVTC 4DP4X 1SXAA 3OV6A 1OTSC 1GA2A 2IPTL 5D1ZA 3IN2A 1Q0XL 4IW4C 1KB5H 3COOA 3RIKA 3PP4H 1IBBA 1GOFA 1ML0A 4WI9A 2BSCA 4WY7H 2L0DA 3CFJA 3NCYS 3VWKD 3ZKQD 4QXVA 1W72L 4TNVF 1A6WL 1IKNA 3BH9B 3L4YA 3UJIL 3FT0A 3VNYA 2H3KA 5IMKA 3MV9A 3S97C 4Y2DD 5K1VA 1AR1D 4ODVH 5DJDB 4ZQTA 1UZ6E 2P7TA 3V4UH 4DF9A 5EZLB 2CHWA 4KVPA 5CS7A 2VR9A 4OGAC 3FTZA 4WWKA 3CLFH 2A0LC 4RFOH 3SE9L 3VVVA 2MQGA 5E99L 3KGRA 4JRXB 5HBBA 5I8OL 5BO1H 3ZE0E 2ICES 3MODL 4XO9A 1NC4D 4XO4A 4J3UA 5LGHL 2FEDC 3ALPA 4LLAA 4JFFB 3VM5A 2BMKA 3LKQB 3B3IB 3RWDA 5D5ME 4JFYA 4UDUB 4ZPTB 5ID0A 1I8MA 1J9TA 4QO1B 4DFHA 3WV0A 2F7PA 4X80H 1WWBX 4J2QA 3FDWA 3R8QA 2H0FA 2ITCB 3C5ZD 1ET5A 3ASWA 1LP9F 4HKXB 4I77L 1QFWH 3MV8A 1E4WH 5DGRA 3SQOL 4ENZA 2QQLL 3O41A 2K9FB 1OK8A 2EADA 2X9WA 2C8NA 3BZFB 3Q8BA 3RWGA 4HC1H 1KEMH 2VDNL 5IBTL 4BH8A 4Q9QH 4HS8L 5B38A 1SHWA 5I1HH 2Z31C 1JVLA 4F80A 4HALA 4WUUB 4YNYB 2P5PA 2BWDA 3TIEA 2PO6D 4MCZA 1XL6A 2W0FB 3VXOB 4Z23A 4CMMB 4GSRA 5JPMC 3CV5A 1QR4A 1NKRA 1OTUC 2BY0A 4JY4A 1BYPA 1JTPA 1QBLL 1K8DB 4FXKC 3GB7A 1AQKH 1LP9A 2H32B 4XTRD 3STBA 2XV3A 4F37K 3GZQA 5AAMC 5AD0B 5FO8A 5DQDL 3UYPB 3U46A 1MHEB 3SDYL 3BWAA 3QUHA 4MZ3A 4YE4H 5CZVL 2WQXA 4WEEA 1MWAB 1F02I 4HCRH 3CN2A 1QI5A 2B5IC 2MFNA 4XNUH 1JNHA 1HQRB 2D0HA 2OW7A 3BUDA 3WLBB 4NBYB 5I6KA 3QUYB 4LSTH 5D1ZC 4K5PA 3BN9C 3MNZA 3DWTA 3G08A 5IESH 2QDWA 1CLZL 1QSFB 5DD6B 1BJ1J 5DR5H 1PQZA 5GHWH 2HPOA 2NUTB 2X4NB 1IKNC 2C7FA 1T1WB 5E9DD 4OZHF 2EP6A 3IDGB 5C0AB 4AVIA 3V8CA 3OXSA 1UHVA 2F6AA 3AU1A 5K39A 4HV8A 1Y6MR 1Z6JT 3QQDA 1PKQE 1I82A 3D25B 4WWKC 1JZ2A 2CCVA 1F56A 4IJ3B 2VDPH 3GIVA 1BFSA 4B9ZA 2AQSA 1GTFA 1T0OA 2YSTA 3DX0A 5HYQB 5J9PB 1HZHL 3MJGX 3F64A 3FYIB 1DL7L 5IVXA 5EA0H 4LP4A 3IT8D 2X1OA 4KROC 5I0DA 5DZJA 4ZX3A 1ND0A 4OZHA 1X5HA 3QEGL 4R9HA 5EN2B 3TBYB 3I6LE 1DQJB 5K59F 1E3FA 2ICWA 4N2AA 2WNGA 1NPNA 5TE4L 1JGLL 2JK5B 2XN0A 4H8QA 4TSBL 5FGSA 3PWJB 3E0GA 4X6BA 4XRCA 4FL4B 4G1EA 1AZZC 3MX0B 1I8KA 2JLPA 3H54A 3AQDA 2O61A 1I1YA 1PG7W 5IJVB 3Q0HA 5D6CA 1ITBB 4EMZA 4GKOA 3L2NA 3FOLB 5I0XA 4QTIH 4KH9A 4QOKA 4AQAA 1ONQA 5LGYA 4JDVA 4Y1AE 1ZT7B 3M88A 1YPZE 5AVYB 2C9AA 1EGJH 4WGKA 4E9XA 4N8VG 2ZUVA 1SYVA 1UT1A 1MAMH 3H9ZA 2ZJSH 4TF4A 3K4ZA 1QRKA 3V0HA 4PJFF 1MG2C 1RUQL 4KJPC 4L8BA 5FGBA 5FO9B 3KLHD 4IBYA 3QDGD 3F7YA 4I1NB 1BQ5A 2YBRB 4LU5H 4Q0XH 3EXJA 3NFSL 3P0VH 3T4YA 2VR8A 5JIQA 3DECA 2VN6A 5KS9B 5KVEH 3HG4A 3FN0H 3NEXA 1SVZA 5DS8A 1DEDA 5D1XA 2XYBA 1JZIA 2W65B 2G9KA 2QSQA 1JMZA 4LAQH 3IGUA 4HJ1A 3OAYK 4OV5A 1C12A 5ADPL 4YPGB 5HYJA 1OSZB 1G7IA 5GRJH 3L3OB 3HC4L 1E9QB 1MFEL 5MHSE 4IBZA 4X99B 1FIEA 4KJYA 5IJBC 2BP8A 3S98A 1TZGL 3GZPA 3ZL2A 3SE4A 4ENEC 3AG1B 5IUSA 1YY9C 1Z9MA 4J4PD 3U4EA 4M8QA 3DXAD 1X5JA 1NTDA 2GQHA 4O2EA 3ZKMD 2DDQL 1RURH 1MI5E 3ZYIA 1ZT4A 1N64L 3S9DB 1MQKL 5SX4H 5FECA 1O6SB 3DX2A 4HWBH 1WBYA 3PP4L 4J6RH 3FNKA 3ZOAA 5ESVA 1ZLVK 4NPYB 3CMGA 1VDGA 4JJ5B 4TLTA 1JZGA 4HKZA 5GJSL 4CILA 1C5DA 3LV3A 4YAQB 2YKKA 3M7OA 2WAQA 3QXUA 3I6LD 1CYGA 5B1JA 3ARDB 1TLKA 1UYWH 1BMGA 2HN7B 3SQBB 3NA9H 3UBXA 5CEXB 2X6AA 3G5ZA 4L0ZA 3KH4A 3Q01A 5DFWH 5DMGC 1QQDA 5KVDH 2CRYA 1OAKL 5HYFA 3V4VL 4Z1PA 2NY3C 3PWPE 1E67A 5LUMA 1X5MA 4NO5B 4RFOL 5C0IB 5I1GH 4LHUG 3T71A 2DQDH 1WSST 2V9RA 3MRLA 4UNIA 1GY2A 1KJ2B 2CIKA 4OGXL 2YGVA 3QI9D 4IGBD 4ERSH 5IHLB 4BV1A 1ZA6A 3MTRA 3OX8B 1RSYA 1UT2A 2JI3A 3CSYB 4MRCA 4U7SA 4MZRA 3SJVB 3SZKC 4A2EA 4DWHA 1A7QH 5F96H 3B9KA 1VZHA 4GXVH 3FFOA 4MNHB 1WZKA 1ZSDB 5FO7B 4X7EC 2WQSA 5FGBC 3TN0B 3NFNB 1IKFL 3B2VL 3I3BA 1F00I 1L9SA 4J8RB 4HC1L 3UGUA 4JFVA 1A4CA 1U8OA 3VA6A 3RZCA 2KZ1B 2QGCA 4XR8C 1CLOH 3DMMD 1Q0YH 5D1XC 1J9RA 2UVEA 1XGRA 4KNSA 2XIDA 3QQ9C 4HX1A 5GJTL 3VTMA 1D5IL 5CO1A 4YSSA 3L5IA 3OR7A 1WIUA 1YQVH 2ZP8A 3TJEL 3UEQA 2VDOB 4NO0B 1Q94A 1L0XA 4Z3JA 3UO8B 3VXSD 3S48A 1AQKL 5C71A 3K80A 5C0EA 3NPSC 3SE4C 4W4OA 2VN3A 4UCFA 4PLJC 1MI5D 3SBQA 5I19H 3O3DB 3C2SA 4Y4FA 4DGWC 1QFWI 4PRPB 1AC6A 2VZ1A 4PY8I 3BZEB 4N0YL 2B8OT 1JD9A 4XPHH 5AOJA 3DK2A 4EI6A 5D4HA 3H55A 3QG7H 5FM8A 2A6JB 4FQCH 2AK1H 3PFQA 3WKYA 2OP4H 5AOKA 3CVIH 3EZJB 4JN1H 4GO9A 4Z95H 1KULA 3NEEA 3AITA 4L48A 3WDHA 2Y1VA 3V0JA 3VWKB 5J3HD 1X5IA 4DOHB 3F7RA 1KDIA 3DPBA 5DR5L 2AEQH 5GHWL 4YXLH 2ZX6A 5TFSH 1MWOA 2WINA 5B1JC 5T1MA 3HBPA 3TX4A 1PPIA 4UZUA 3IKKA 2FGWH 1SXSA 1G84A 5EUKB 3PWPD 3L3DB 4PVNA 3JWNG 1HJCA 3TC9A 1EHXA 2R1XB 4X4YA 2OYMA 1JZ7A 4YH6A 4U1NA 4ZYKA 1JK9B 1A2YB 1HIMH 3FXIC 3FT4A 1MVUB 2VDPL 1NC4B 2X2HA 2YXMA 2DQFA 4XMLH 4NHCH 1BQKA 3HS8A 1L7TL 1MUJB 3LD8C 4UT7L 1LDPH 3C5SA 3IDMB 2HLFC 5GS2D 5C0CA 2XG4A 1N12A 3VU2A 4EZKA 3F85A 5E1HB 3RWFA 3BQUA 2XKUA 3Q7JA 3B9KC 3IFOB 2CHDA 3PIQB 5EU7E 4FNSA 5FWRA 3C5ZB 2VRAA 1RIVL 4HWZB 3ULUC 4ALAL 4G9DB 1DHKA 4ECNA 2B20A 2WSKA 2Z35B 5FC9A 3RZCC 3BPLC 4KNUA 1I4FA 2VXSL 5FV2A 3ZT5A 1XF5B 3Q6FA 2H2PD 2K0RA 4QRUB 5SWZD 2O93L 1NBZB 1G9NC 3HI5H 2ZJSL 4X6CB 2Y06H 5JPNB 1E9PB 4H8PA 3CXHK 3U4KA 1PX3A 5SWQA 4PJCE 3ULSA 1QYGH 4ZFOA 1JD7A 4BA0A 5L6YH 3ATAA 3PABB 3OKLB 1ZTXL 4Q0XL 3FN9A 4W4OC 1TZHB 4WGWB 3P0VL 5I74B 4CVZA 4PJ7A 3SKNB 5KVEL 3T0DA 1AKJA 4BUGA 4Y4FC 1FGVH 4MD4B 4A7TA 2DQJL 4F93B 2OK0H 4Z7OE 5BQ7A 4YHLL 1FNHA 4PJXF 3T3MB 2ZOLB 1R34A 5CR8A 2JVUA 4H2AA 3KBPA 4QJ5B 1FVDA 2VN4A 1CLYL 2HJLB 4UM8A 4JQVA 4QRPE 1O5DT 4X6EA 3DDGA 2V6HA 4XPFH 1NCTA 4Y5XA 2AS5M 5F1IA 2G3ZA 1BQSA 3P9MB 1GGCL 4U6XA 1QA9B 1FGNL 2R1YB 3FQNA 3NZSA 3UPRB 4G11A 4KUCD 15C8H 4HUCA 2BFGA 4KNQA 2OYLA 4NN5B 3ZE0B 3N85H 1BA9A 2EZ0D 5EIQA 5JQHC 3RNKA 4FXLA 5I8KL 3NRQA 3FRPB 4ZS7H 35C8L 1VSCA 2MWCA 2VN7A 1FFOA 5E8DL 5BZDB 2AJSL 2ZKMX 2I85A 3WLWC 4NZFA 4R26L 3NAAH 5DHDA 1T2JA 4PREA 2J5LC 5GS3A 2WD0A 3OG4B 4ZTPH 2GAZA 4KU1A 3GEWB 5AFAA 3BQUC 1BVLA 2XN9D 4XVJH 4XCFH 2R15A 4PSPA 4U3XA 4I48A 1LO3H 3M8OL 4FULA 2DKSA 4GUPB 4X5QA 4G80A 1BG1A 1N8OE 1G0DA 3VX0A 2WIIB 5IG7A 1A5FH 4Z76A 3IMTA 2JIXD 5I1GL 1XD0A 5JIMA 3HB3C 1Q4NX 4F15C 2W60A 5SX4I 4U1GB 2DI8A 5J7CC 5IVOA 3CZUB 4P2RE 1RFDH 5E6ZA 2YD8A 3TPUA 1NICA 1T6VN 3UGXA 3JWNE 2WVVA 4TUOA 4LHUD 1A7QL 4I3SL 2YAFA 3MA9H 1SVBA 4B5ZA 1RSFA 2WWMC 1PZDA 1UZ8A 5KZCB 4JR9L 3G04B 4JGUA 1NEZB 4KKAD 1KYFA 2X28A 3QDGB 5L2KE 4QRAA 4DGVH 5DF0A 1H3TA 2A83B 3D48R 2RD0A 1F2XK 4PHXA 1QNZL 2UZXB 3T5WA 1QVOB 2H3NB 5DMKB 5IY5B 1FF5A 4IHBA 1KJ3H 4HIPA 2BVPB 3WN6A 4DK3A 1CXLA 1YQVL 1NLDL 1T3FB 1YYLH 2AQNA 2DB8A 5KSAB 4KC3B 4DZ8A 5FUCC 1UQSA 3DYOA 2NLJA 1HHGB 1IQDB 4UM9D 4Q2ZB 2CJSA 4F3FA 1UXWB 4AMKL 4JQVC 4OFYD 1BLIA 3HC3H 4PBXA 4YDZA 5FYKU 1HILA 4FNTA 4N2HA 2EIZA 5CCKL 4Y5XC 3DXAB 3GMLA 1YNTB 3BGFC 4P2OD 1OGSA 4HEPA 5DD1L 4GT7A 3OBAA 1PKQB 1INDH 4Z7UE 4QRBA 4W9JC 3M17A 4XP1H 3RGVD 4FQCL 1XGPA 5ETUB 2QVFB 4XVSH 1KLFA 3GXMA 2I9TB 1VB9A 1RPUA 2E8YA 3WO3B 1AD9A 3VI3A 5C08D 3IMBA 4NQVA 2FO4B 5DD5L 3V4PH 3BDYH 3TCLA 3BHBB 5CJXA 3VSQA 4RQQB 2P47B 1V55B 3LS4H 5GGTA 4Y1SA 5TFSL 2C1OB 2L7UA 1ZLSL 4IOSA 4KKRA 3HE6A 1P9MA 3ES6B 2IPKB 1ZIAA 1WA2X 2FGWL 2KHAA 4ZTOL 5E8OB 4UZGA 4IRJD 3GMRA 4YOKA 5FHAH 4PB9H 3WFHB 4JG1L 2CUIA 4QWWC 2DEXX 3RUGA 4MZIA 3SYPA 1MIML 3WD5L 2BIIA 3CPLA 3GI8L 4Y1AB 3D0LB 5FYJL 4HUNB 1YPZB 3TFBA 2UXFA 3DI2B 4QRQA 4O02L 4H25B 5EG6C 4NHCL 4PJHF 3VI4A 2A74A 5J6GA 1AGFB 1O75A 2CUAA 5I0WA 3O2WL 2DD8L 1JNNH 1Q9LB 4HU8A 4KPHL 3WSQL 2C7UB 1AQDA 1VFUA 3NCXA 2KKQA 3MV01 1OAZL 3FQWB 2BIHA 2YJLA 3I6GB 5DC4B 5T5FH 4XZUB 2R7EA 5L2KD 1A64A 1IBDA 2YEQA 4G8EA 2HSIA 1F0LA 1P1VA 3DOHA 2CR0A 5EO0B 5KOMC 1HCZA 3B7TA 1OGAA 1JFQL 4APXA 1PG7H 1UEYA 3C60A 3VMOA 5A2FA 3LS5H 2QTEA 4MMYB 1CR9L 3IAGC 1KWGA 4Q9RH 5D8JL 2K8MA 3DMMB 3ROLB 1CFTA 3MGAA 4WI3A 4HVBA 3U2SA 5IMMB 5HDWA 1LE9A 1AXSA 4UDTA 4YHOL 1RK1A 4YBQD 1JZEA 2WXFA 1MJ8L 1CXIA 1YEGH 3FTGA 2WTOA 3OB8A 4M7JH 2CR3A 3D4ZA 3ZGHA 4NNXB 3FYEB 3GBDA 3UZQA 3VXSB 5AALA 5IWLA 1KEGL 1QYGL 1UB6A 1NBYA 3KPQA 3L4XA 3WFEL 5KBPA 2OI9B 4YC2B 4XP5H 4B3VA 2BVQA 3SBRA 1OSPL 1MI5B 1TTAA 3I6KA 3E8VA 2YUXA 5ICYB 3Q06A 3CIQA 4YFLF 4EAEA 4HETA 1FGVL 2HT4C 3CFDB 4UIKL 3MYJA 3TBTB 3B7YA 1UA7A 4KVNL 1JPFA 2JKNA 2OK0L 2FTAA 4QHMB 4ZFGL 3MOQA 4ZOBA 5MERA 1MHHA 3GQFA 4LF3A 5AYQA 3IPBA 2VLLA 1BF8A 1J48A