2VCOA

Crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intervening with Urinary Tract Infections Using Anti-Adhesives Based on the Crystal Structure of the Fimh-Oligomannose-3 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords PROTEIN FIMH
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2vcoA00
1ZE3H 3JWNH 4AUYA 2XG5B 5FWRA 4J3OG 5AALA 4BUQA 4AV4A 5LNGA 5AAPA 4XOEA 1TR7A 4XO9A 1QUNB 4X50A 4CA4A 4XOCA 3ZL1A 4CSTA 2JMRA 2UY7B 5LNEA 3MCYA 3ZPDA 4AUJA 1PDKB 4XO8A 3JWNG 4XODA 4XOBA 4CSSA 5IQMA 4ATTA 1UWFA 4AV5A 3SQBB 2UY6B 1KIUB 3BWUF 2VCOA 2J2ZB 2JTYA 5FLUA 5FS5A 5FX3A 1N12A 4AVJA 4AVKA 2WMPB 4X5QA 4X5PA 5F2FA 3ME0B 4AV0A 3RFZA 5IQNA 3BFQG 5AB1A 4AUUA 4AVHA 4LOVA 3JWNE 4J3OH 3ZL2A 1KLFB 4AVIA 2XG4B 4XOAA 5F3FA 5ABZA 2W07B 4X5RA 5JQIB 4J3OF 5CGBA 1N0LB 3BFWA 5IQOA
chains in the Genus database with same CATH superfamily
2ADIA 3VQ1C 2BY0A 4LPWA 1TQTA 3FUDA 4TTDD 5DRNA 4X42A 4QXUL 5EOTB 2ENYA 4PJ5E 5LB1A 5FDYA 2EDNA 1DN2A 1GH7A 1NMBH 1WHOA 7FABH 1JF1A 2D4FA 4AZUA 2EEAA 5F1KC 4YHNB 1FNGB 2HVKB 4DHLA 3KR3L 5BUAA 5HYSG 1AGBA 4Z3GA 5CEXA 3MRFB 3H42L 3QH3A 5I8OL 3HAEA 2WAQA 1H8SA 2OQJB 4FKKA 4G42B 3CE1A 2JB5L 4DEUA 4FQLL 4TQPA 4HOZA 3H9HA 2FEDC 1VFBB 2IMNA 3P0YL 2A4ZA 4GLRH 4MA1C 2DQHL 3BGMB 3SBRA 3WEOA 1XO8A 4OLVL 3GDCA 4LPYA 2WCPA 5M7QA 5T5FA 1FFQA 1E4HA 3QIBD 1ADQA 4L9DA 3M88A 2X4NA 5GGRA 3RHWF 2WO2B 3RZCC 2IBZX 5DR5L 3ARWA 4OM0H 1ND0A 1CDCA 1U8QB 1N8OE 5CNHA 3CXHK 4Y19D 5HHPA 1NOLA 2JJSC 4MQXC 2FD6L 4U6HB 2IALA 3BT0A 3F00A 3V0GA 1IKFH 4FNTA 5J3HC 3U2SB 4XPTL 4JM2F 1PCXA 4JKKA 2COQA 2Z7YA 3IMSA 4ODTL 3D69B 3W9EA 1DBBH 4OLYH 2IFFH 2VDQH 1AVAA 1MEXL 4ANKA 4ZXBA 2H7WA 4LMQE 5I8KH 3RGVD 4OM1L 2ERJB 1SQMA 2ZNXA 4ANXA 4F58H 4QXUH 5DFVD 3QQ3A 4BK4A 5A2FA 3NQKA 4Y1TA 4JFEA 3IJSB 2DD8L 2R0LH 2WXFA 4W81A 4NO3A 1XGQB 3P2TA 4NJAH 5F1SA 1OLLA 1U33A 1WAAE 4JDVA 4ONHB 5IHBA 2ZAGA 3QG6A 1IAIL 5T3ZL 4XNYL 3EH1A 1GYAA 4CILA 1OWRM 2EQDA 2PCYA 4DP7X 4PW4A 1RPKA 1LGVA 4URTB 3CCHA 2MEJB 4BGDA 2FGWL 1FYTD 2JJVA 3L7FB 4RZKA 4APQC 2DLEA 3IJYA 2CHNA 2Y5TB 4JPVL 3PHQB 1DDTA 1G7JA 1I3RB 4M6NL 4JREC 1EAPA 4FFZH 5FYLH 4P46D 1UEMA 5ILTH 2WQRA 3E8UL 5DO2D 1Z3GH 5JXED 2ISDA 1NBVL 1FFNB 3QCVL 1IBGL 5T1LB 1ADQH 4K3JL 4BBWA 5JHAA 2D0GA 2EIKB 4P48A 4WU5B 3QCTL 2FD6H 1KV3A 1NUDA 4NZTH 1DVZA 1L9TA 3L4XA 5DEJA 4ETYA 1O75A 2OXHA 4Z78A 3II1A 1H15A 3X1FA 1F42A 3K46A 4XN5A 3VVWA 1FL6A 4L0PB 3TFBA 3GXMA 3UO1L 1ASOA 1RK0A 2AF2A 2VQ1A 5CUSL 3LN5A 1MCWM 3NDZE 4BV1A 5IJKC 2JIXD 4XHJD 3EOAB 1P7QA 3L4YA 3HMXL 1DJSA 2ERJC 2ED8A 4KVPA 3KBHE 3KPTA 3L9BA 3LQAH 5DRNB 2CIKA 1U95A 4XAKE 4LCCA 4Z76A 5EOQL 4HWUA 3TYGH 3ESNA 4GO6B 1FH2A 5D5MB 2D7NA 4EN3A 4GO9A 3PY9A 1OTTC 3MGOA 1EUTA 3GMLB 2ZIDA 2VDRB 1AG6A 5DQDH 1X5ZA 5B39A 2N0KA 4K7FA 4PRID 5IIEB 3FF7A 4F3FA 4XPBL 3GEFA 1N67A 3MRLA 1WZMA 1N59A 5EDSA 1I9IH 1TLMA 1VFBA 3LHAA 1J9RA 4TUJA 4F1SA 5CJQL 2UYLA 1W72L 4IOSD 3WUWA 3UZVA 3TP4A 1X6LA 1L6ZA 2NUTA 3EJPA 1S3KL 3OQRA 4C56A 4YE0A 5TE6H 2F54E 3PWUA 3DSFH 3EH5B 4GY4A 1NKGA 2J88L 1HQRA 3HC4L 2IBZY 4UZGA 3B9AA 4K9EC 5I1DB 1H3PL 2GITB 1FL6B 4MVBC 4QWWC 5DUBB 4PBXA 1KCSH 5EOTA 1GPOH 1OEZW 1QEWB 2YPVH 3V52H 3P9LA 5F1NB 4N0FA 4O02B 2X6MA 5A40E 1DQDL 4PJGE 2BCKA 2EKSA 5AOJA 2BP0B 3KEHA 4PJ6A 2BS71 4GXVH 2UXTA 1FFNA 3R4DA 3BISA 1E5BA 2KI6A 2XN2A 3CFEA 4B95C 3BKYL 4DUWA 2DWYA 4R84A 3VD0A 4IBLT 1TKWB 2ATKB 5DWUH 5L8JB 5HD8C 1HS6A 4HIJB 1KEGH 2RB8A 1KTRL 2B0SL 3ARXA 4X4KA 1NDTA 1JGLL 1Z3RA 5MEQA 1BF5A 2ESVB 1I8IB 2PW1A 3T8VA 2V3DA 1LLAA 4HKBB 1OGTA 2VSKB 3BVXA 2QPFA 5KS9F 1T0MA 1VPOH 5FUCE 3D85A 3KCPA 4PJ9C 3V4LA 1QFUH 1BVKB 3O4LD 4KTDH 1JPST 2RBLA 4JZJC 4MD0A 3GBDA 3H2QA 4IK7A 1FO0B 3FTXA 4YX2H 2OTWB 3ETTA 2IFFL 1CN4A 3A4DA 5DD6A 3I84A 2AABH 3H0TB 4K5MA 1IGML 3B9KB 4DCQB 4JFEB 1FWXA 1M2VB 4BQ9A 1B6DA 2JH2A 2ZSWA 1K3ZA 1JCKA 1R3IL 4L8SB 4QLRA 5ISZB 1H3GA 2O72A 3U4KA 3T2PA 3PV6A 2Z93B 2GIMA 2EECA 2EH8L 4Y4HA 1BLIA 4YSSA 1PLAA 3MV8E 4XH2A 1MI5E 4WK4B 4ODSH 4ZFQA 4C47A 2PXYC 3A0OA 3DHPA 3JV6B 4RGMC 1SEBA 5I19H 2Q87A 3HLAB 5LGKA 3C9NB 2FQGA 2P26A 4UQ2B 5C0AA 3FT4B 1JIBA 2AANA 3OKKA 2X4NB 5EUOE 5E08H 3MREA 2CO3A 1J8SA 3CTTA 3CVHL 3TVMB 3QDGE 3GLAA 4J3BA 5INCA 1PY9A 3FO1B 3Q1EA 4HIXH 1A6AA 1QBBA 3P11H 3UAJD 5CGMA 5DRZB 3NZHH 4YSTA 3I9GL 3IBEA 5BV7H 3C5SB 2LU7A 4BD4A 1MAML 1KB5L 2LLLA 2OW6A 3H6JA 3HAEB 2IH9A 4MA3A 3V7AE 4AIXA 5JQ6H 2XWRA 1R0AH 4JGNA 4M6NH 4WI5A 1T83A 1P7KB 4OD2A 3W38A 3LKNA 5F7EL 1J9QA 4M00A 3N85L 3TBSB 5C08A 4WKXA 3RWGB 4P49A 2NXYD 3P73B 1MZYA 1F4HA 3C5JA 5D93C 1U8MA 1F4XH 3QFJB 4W4OA 1RQ5A 4BKTC 4AZ8B 3D0AA 2WNXA 1CDJA 2NX5B 1PZ5B 5JIQA 1CLZH 1HILA 5SX4H 1UH2A 5CKGA 2CRMA 1GGBL 3BVWA 5BJTA 2WYZA 1W80A 2X87A 3VG9B 4P3DB 3VXTB 4J2XA 3MO1A 4LLVA 3FMGH 1KTLA 5D1XC 4MAUH 4R0LC 1CPUA 2IAMA 2A4CA 1ZE3H 1GVIA 4WHTA 4K55A 3SY0A 1PD6A 1ZHLB 1BMZA 4G6AD 5DURD 2Q7YB 4YWGL 4MJ4A 2IH3A 1Q9WA 2IFGA 2EICA 1IILE 4FNQA 5AW9B 4JHBA 4KKLD 2I69A 4TVUA 1SJEA 3WTUA 4NO0B 4FKEA 2D0FA 4XPFL 4HG4K 4TSCH 4GSDL 1A14H 5HJGA 2HKFL 4QJ3B 4PGCB 3X3GL 3DUSB 3AGWA 3GYRA 3ESVF 1MLCB 4QXTA 3VMOA 3VXNB 5J56B 4XPGH 2NR6A 1RXLA 3QDMB 4X4XB 1BMWA 4OSUH 5E1GA 1TUPA 1UZ6E 2XRAH 3D05A 3KHOA 1URZA 2J88H 1G6RL 3HC4H 3LXUX 1XIWA 4PM1A 1HZKA 1IC4L 3MLRL 4G6KH 4NI6A 3IMBA 2HH0L 3HZMB 1LO0L 1MJUL 3CFCH 5E6ZA 5HDBF 3HRZB 3L3IA 3C5ZC 3MRNA 3O2VL 3G6AA 2NTFB 2D2OA 2ZSWB 4L2YA 4XNQB 1WZLA 1D5MA 1WWCA 2R2BA 4P46B 3T04D 2VXTH 3WJLA 3C6SA 2BP5M 4P5KB 2EAEA 3QEQE 1AS8A 3DJRA 5IF0B 1JVOA 1NAKL 5HHME 4ELMB 3J27A 5E1IA 3TL5A 2FR4A 2BK8A 1QASA 2BHYA 1QSFB 3BDXA 4P5SA 3GSNA 3OMAB 4G9FA 1JUFB 2ZWYA 4TSBL 2NNAA 1J1PH 3QR2A 5DD5L 4DTGL 1AE6L 4KKAC 1UB5B 4L29B 3U79A 5CD3B 2EDHA 2VL5A 2DM2A 4HKXA 3MLXH 4H0HB 1N64H 1RLWA 5FYLD 2DEWX 1UATA 5CZRA 4S1QH 1TQBB 5E8OB 2ZP8A 3D0VB 5EEUA 2FSEB 3QZWB 3ZQXA 5DJZB 1HCZA 1ACCA 2HFGH 2VDPB 1ONQB 4Y4KC 4AEEA 3RIFF 1ADWA 3S96B 5DMKB 2EE6A 3T2OA 3AFLA 1GGIL 3CFBA 4Q9CA 3MLSH 4IKKA 4L4VB 1FP5A 3L3GB 4OCXH 5AUMA 1BF8A 1I1YA 1GAFH 3HRZC 3S2CA 3BDYH 4QRQB 4U1NB 5ECJE 1YEDB 3RVUD 3TCLB 3V8OA 2WVVA 2HXAA 4ZMVA 2ZX9A 5IFAL 3OSKA 2NUTB 1Z3GL 1OAQL 1QABA 4F8QA 5KSBF 5C08E 4UIKH 2C26A 4A68A 4P2AA 2O1AA 12E8H 3POHA 3K2UL 4QOKD 3NBNA 1PG7L 1IEBA 3EHBC 4H8WH 2NZIA 4JRYE 3FN0L 4XXWA 5C70A 1B88A 3OJDB 4WF7A 3KPPA 2IV8A 3ECBB 4U33A 1WH0A 2WCSA 4H1LA 5DC0A 1N0XL 4LSPH 2XN0A 1J0YA 4HWNA 2PWEA 2J1YA 4M8RA 3VI3E 1LD9B 2FJGB 3PLYA 4RAHA 1ROWA 2FIRT 4AMKH 3SCMC 5KVEL 2K6ZA 1SM3L 2WD0A 4DN4L 5SWZB 1O6VA 4L18A 2BOCB 4XCYB 5IEHA 3ALXA 4JFED 4O5LL 5FV2A 5CBAA 3CBJB 3UJJL 4YPGA 3EYQC 3PV7A 3GRWH 3QDJA 4OCWH 3WDJA 3DPDA 4Y4KB 4HSQA 2GTQA 3IFOB 4P9ML 3MV9B 1G6RH 3IMTA 4PY8J 3SDYH 1WFJA 2N1TE 2CLVB 3V9EA 3CSGA 5IJVA 5T33L 1HHHB 3ZHDA 2A6DB 4XPGL 5CCKH 2C3VB 4M1CC 1MIEH 2VH5L 1ITBB 1IKOP 5ANMB 5MI0B 4M5TA 1HL8A 4LHUD 4QRSB 2YD9A 5HYQA 3WLBA 4WNQB 3VXOA 4N3TA 4XBPB 4Y19E 2XYCA 1CDIA 5FDWB 3QFJE 2HX7A 5ISZD 1T2QH 2VJ8A 4PR5B 4E9LA 1QSED 4X5WA 5C8JB 3V6ZA 3FT3A 3QISA 3DV4B 4N0CC 2ZUSA 5L88H 4MQSB 3P3TA 1XGYL 2WTRA 1FVDA 2M8XA 5HJ3A 3UJTH 4IRJB 5HI4C 3FUMA 4HV8A 3NIGF 2X88A 5HYEA 2XWEA 4H0LC 3GSUB 3P77A 2VNCA 3P30H 3ILQD 5DO2C 1KTDB 3RWFA 1XGQA 2FQFA 5HPMB 4FYTA 3DIDA 4XP5H 1F6AB 4KMTH 1JG9A 1T20B 2VW7A 3Q9PA 3G6JE 3ROLB 1MFBL 4L4VD 2WO3B 3UGXA 2OI9B 4R26L 3DROA 4KI5F 1PVHA 3BPLB 3LS4H 5F93C 4MQ7A 2ZE0A 3T8MA 5CMAB 1PCSA 3PDDA 5CGTA 4MD4A 5D2NC 1TTCA 4WTWA 3O6LH 1M7DB 3IKCA 1BM3H 1SOXA 3UBXB 4GJTB 3STZA 1JFQH 1B9ZA 4L3AA 5HYSA 2G2RA 3S34L 3V4VA 1ND0B 1WIPA 1ZV2A 4NT6B 4UBDD 5AQ0A 3RVVC 5KBDA 1L9OA 4LEOA 5HHVH 3NZHL 3IMRA 1UQSB 3AQYA 1U21A 1T03L 3GO1L 4DPCX 1RZJH 2Z8SA 4O02L 1J0ZA 2G3NA 4KGLA 5SWZA 1VEOA 3I3EA 1OPGH 3L4CA 5IHUL 1JK9B 1I85A 2FLBT 3H85A 3IU4L 5C6WH 1JYXA 2ZJSL 1AZUA 4Z7WB 1NGPL 2BRQA 2FWOA 3IS1X 3MR9A 1ZT7B 2IAMC 1QSEB 1ZDQA 3MXVH 5CJ5A 2OMTB 1DBJL 1J87A 3S5LB 1WFNA 4P9HH 5JZ7C 4FNUA 1DVSA 4HMDA 2EVJA 1QX1A 1CU4L 3NIFE 1HSBB 3MUUA 3CSTA 2DYPB 2W91A 2EE9A 3RWHB 5IV2A 1NSNH 2ZCHH 1JPGB 4BXVA 4AKQA 4PLOB 2OX5B 1TTGA 4NQEA 2Y2YA 4GP8B 3SDXB 5FOBB 1J5HA 4QPEA 1ZEAH 1XCWA 4LZKA 4HULB 1TG8A 1GZQA 5C71A 4PJ9D 3NPZB 3C8KA 4IGBC 3L3GA 5DZAA 3K3QA 2DQEH 3KH4A 1KBGH 5EDXA 5T1KD 4EKXA 1A9BA 2E4FA 5MERB 1RPUA 4IEFA 3FULA 3JT0A 4K3DL 4WDIA 5HHOB 2P43B 4ODUA 3KPMB 3HNTH 4AI7A 1MJUH 1O6SB 3FQXA 3ZMEA 4WNJA 1JPSL 1T1XB 4F7CA 3OGCB 2O61A 1P9MC 3PP4L 3K74B 1T22B 4RAVB 2KLRA 2YGVA 2VDKB 5FGCE 5AKVA 1PD0A 4ZFZA 2K78A 3GI8L 4XZUA 2HLFD 4KK9C 3VXOB 4JAMB 4K0OA 4U3CA 2Y06L 3I02A 2UZYA 4IBWA 2ADYA 4BUGA 4TSCL 5TK2A 5BOZG 3TTSA 1KCUL 5AW0B 5D7LA 2P5ED 1MCQA 3NOIA 2XWJB 1XTMA 3QVAA 5AVRB 3QJFB 3BYTA 4OFQA 3DKHA 2I9TA 1P1ZA 2WCGA 4PRHB 1TZHA 3MMEB 1BZ7B 5D6DC 5CN3A 2VXVL 1I3GH 2YWZA 1GS6X 2AGJH 4RMUA 4J3OC 1BGXH 3ARTA 3CUPB 4NQDE 3NIDB 1NBYB 2CDGB 3FMGL 3D06A 3TESA 3OAYH 4JZJA 5C0BA 4QF1A 5F96H 4YSEA 2JQAA 4K8RC 2X4PB 2YC1A 4PJ9A 3Q0HA 2BIPA 2QV4A 2OJEB 5CBAB 5FF6A 1P1VA 1EGJH 4X6CF 3AG1B 1HU8A 4HQQL 3DVNA 1K5WA 1PZBA 3X12A 3IXAA 3NT0A 2GFBB 2GJJA 1FZOA 4CW1A 4YFLI 3OZ9H 1ZMYA 4FFVC 5C0BD 3IETA 3PABA 1MAKA 4JCLA 3T0EA 2JB6A 1DVTA 3RL2A 4HAFA 1NAMA 1NBZA 4Z7QE 1GJIA 1H8OA 2DWTA 3UAAA 4OFYD 1YYLH 3QDGB 1GKOA 3DXAA 1FNSH 1U0QA 2AJZB 4JCMA 4B7LA 3FU0A 4M7JH 2AHIA 1CGXA 3KYOA 3FKUS 3HFML 4P4RA 5CINH 3CV5A 1KZQA 3UZQA 4E5XA 4RRPG 1QNZH 1S7VB 1LK2B 2W5PA 2WP3T 3IB4A 3IGLA 3CN1A 1U4EA 3BQUA 5BVJA 3BZEB 3CK0H 1KWKA 3CHQA 1VGKB 1UXLA 1S3RA 1WA2X 1XH1A 3M17B 4L3FA 4NHCL 4GQRA 4RIRB 3HC0A 4Z18A 4U1SB 2IWFA 2F54D 35C8H 5IEKB 4H1LH 2AK1H 4ENED 3WNJA 4ZFOB 2DQIL 2J4WL 1FE8L 4LKCA 5CIPB 1Q72L 2E86A 5FS5A 4IIQC 1BBDL 4UBDC 4JDTL 5B1BB 1KBWA 4X7DC 4KXCA 3BVDB 3Q2WA 4Z23A 3SOBL 4NM8H 2FWOB 3PE9A 4O58L 4U6XA 4JHAL 1VRSA 3MV7A 5AB2A 5J9PA 3KVQA 1N18A 1NEUA 2PCFB 2JKSA 1OE3A 1WZ1L 5KSBE 2A0LC 5A2LH 4DKTA 2WYTA 5FF6B 4YSAA 5CSGA 3ZL1A 3OAZK 4TSAH 4ZNEA 4ONOA 1NPJA 3GNML 3HS0B 4PTUB 1ZSDA 2G75A 2LOEA 4L8SC 3FO9A 1BYNA 3LKRB 2BVQA 1CLOL 5IF0A 2IWEA 4TOYL 4PRHE 2XPYA 3QCUH 4GQZA 4X6DF 1TZHB 3B9KC 4D0CA 2WB1A 4I88A 1T80A 3KPSD 1RH8A 1QO3A 3EYSH 1JVLA 3CPLB 1AHWB 4N24A 4M7KH 3DDFA 1EHKB 4YQXL 4M29A 5IVXB 1R19A 4PJDE 4W9GC 1KFGA 5CJOH 5F6HI 4A2HA 1RMFH 1LO4H 5E08L 3N1FC 3QPXH 1YECL 1JWSA 1IM3B 1GSKA 2ZSVB 4Z8FH 2A6IB 2RGSA 4UQEA 2ITEA 3B9KA 2YD6A 3QPQC 5FECB 3UIYA 2DQCL 2IDQA 2LVCA 2N0MA 1NC4B 4L8DA 3AG4B 5GRUH 3WD5L 3AXLA 4Y2OB 3LEVH 4YUEH 1IGJB 5E6IA 2J1WA 4KUZL 5F1IB 2ADGB 2PTTB 1T0MB 1XD1A 1CG9A 1AOHA 4JPQA 4UUJA 5E2VH 2XQ0A 2FHCA 4R6UA 1IC7H 2OMWB 3ZQ9A 1BJMA 4GSRA 2CLRB 1BQHB 3P3YA 5CJQH 3VFVB 4NRXA 3W37A 3SY0B 4QR7A 5EB9A 4FQLH 1FLRL 5DRXA 4XPAL 1NCTA 4PJCB 2ZUWA 1XTLA 4DFHA 4QNPF 3P4OA 4WNQA 4JHVA 3L9RB 4JHWH 1T7VA 3N91A 2VLRE 4KRPB 2A74C 2PPEA 3MNDA 1TMCB 4G6AC 4GW4A 5ANMA 5HI5D 1PEWA 1YNTF 3FAWA 2FO4B 4ZMPA 1SXBA 3LD8B 2EEBA 4JRWA 5LVEA 5L2JB 4G5ZL 3ELAT 2AQRA 5I6KA 1QEWA 2OCFD 2ZP9A 5BQ7A 2XKNA 5F6IB 3EO0B 4ZD3L 3VI3F 5EEYA 1HNGA 1Z0MA 4R4FL 3C5JB 2XFGB 2R1YA 3DXAE 4OFVA 4PV9A 3Q8AA 3CX5K 3AS1A 3IDGA 2XWDA 1E5ZA 1KGXA 1MF2H 2AGJL 2DWEB 1I9JL 5EC2B 3VQLA 2FBJH 5D7JD 1FG9C 2WM0A 4YL9A 1XDTT 5I0VA 3HNSL 4M4RB 3IWVA 2BLFA 5IEHB 2OV0A 2F18A 2QFPA 1Z9LA 5IWLC 4K7PY 3B9VA 3ML9A 2ESVD 4K7PH 1MREL 3SD5A 4FZEL 5FW8A 1UGNA 3U7WL 4EI5C 2GSGB 4I77L 3HS8A 2PWDA 3HAEH 4RA3A 4F3FB 4EEEA 3K71A 1DJXA 2BW5A 3CN3A 4ZTEA 4XB8A 1Y6NR 1JGIA 4XRCB 4N8VB 4CVUA 3WSQH 1TLKA 2X0UA 3GMLA 5BCAA 2A9BA 3QRGL 3O11B 4JJ5B 4TLSA 1V7NL 5B3JF 3MRIA 4MKMA 3AWFA 3FCGA 5IQ7L 3E8VA 4QGYA 1QHPA 3AG3B 4K9EH 4OZHE 4PRAA 1M7DA 3IKCB 1UXSA 3SKMB 2AK4E 3L3OA 3Q2LA 5IVXE 5FHBL 4O9HL 4UTBL 3N41F 2CBOA 3QJOA 5EFIB 4ADJA 4EJ1C 4YSPA 2DKMA 4KX7A 3ZRCC 2Z3FA 1J48A 5DK3A 3UTTD 1W72H 1MY5A 3PGCB 4CRPA 4Z5RB 2BSSB 5I15L 1G9HA 4E2OA 4M61A 5FEBA 1CFTB 1JWUB 3VD5A 2GSIB 1UWFA 4M7ZC 5GSVB 4HGKC 1CQYA 4WV1B 4NKQB 1KNOA 4LSQL 4U0RC 4BZ2L 1NCGA 2B3RA 4OQTL 1AS6A 2IIJA 3Q3GA 2OXHB 3NRFA 1I8LC 3RP1A 1MFEH 1KLGB 2ZF9A 3QUYD 1WA1X 2XICA 3HN5A 3HE6A 5DJYB 3ZTJH 3BOVA 1CE6B 4XP9L 5D2NE 2FHFA 5LGHH 3TYGL 2WNGA 2X4RB 3QG7H 3ZW3A 1G5AA 3HHRB 5FWRA 2ED7A 3SY6A 3O2DH 4HS8L 1NPUA 3MCLL 2Q9OA 4N2GA 1UB6A 2BOBB 4LGPB 1AIZA 4AJVA 2NMSA 3BP4B 4ANWA 3P9MB 1PNDA 3QIBA 4A7SA 2AXHA 1J9SA 3NA4A 3CSBA 4X6BB 3GJEB 4PJAF 4WUKL 4U3XA 4UTAH 4OLZL 3OPZL 2AMGA 2HFFB 1PAMA 4ONHA 4XNXL 5LXGL 5GZNC 3MFFB 3CFJA 1RZGA 3QAQA 3RLSA 3ZKQD 3M46A 4I1PA 4EZKA 4FFZL 4LPCA 1KLUA 4IW4C 4LP5A 1RMFL 5GSVA 5I82A 1MDTA 3T6VA 3T08A 3QDMD 3PXHA 3HI1A 1D5MB 2DIBA 2N56A 2R2BB 3N40P 1RUAH 1S9VA 3DBXB 3PGCA 1MCPL 3WMQA 4RWYH 1IUZA 1DDHB 4DK5A 4FULA 4GS7B 4N2BA 4XVJL 4PRPE 3QCUL 1IVLA 5D1XE 3CFUA 4NENB 3IBOA 2GAZB 1HE8A 3STLA 4C55A 1MRDH 2EDBA 4ZUVB 1J88A 3PGDA 4R4FH 3GNMH 3UDWA 1MG2C 1WEJH 4AMXA 2C3GA 4GSQA 4LHJB 4DZ8B 1I82A 2A9AA 4XP4L 4RGOH 4G5ZH 3KPPB 5HXMA 1XSIA 4MDJB 5C97A 4NZRH 2ZOKA 1E7UA 1K2DB 1QFWI 1D7DA 1TTFA 4RRPA 5ESQA 2Q3AA 4E5XG 4GFXA 3S3PA 2XXGA 5D72H 4WAFA 5GZOD 4KQ3H 2VZ1A 4W1TA 1CXEA 4ZOAA 1GCFA 3A4AA 1FJ1A 1U95B 3FUNA 3NP4A 5FPIA 2ICEC 1WF5A 1W91A 2IXQA 5DHXB 5AAMA 1E5AA 3DURA 3OKNA 3OZLA 1AR1D 5JW4N 3ZKSD 1YEKL 1XB8A 1Q72H 2VDKL 5KVDL 1U30A 3NTCL 3OAYK 3EJYD 2NY7L 3VGHA 5BV7C 1IO4C 1PW3A 3BZFA 3FCBA 5IROD 5L8KB 2XX1A 4JKPL 2EDEA 4MRCA 1LQSR 1KV7A 4GIAA 5EA0H 1NLBL 5CU5A 5FFOA 2JMRA 5IVZB 5TDPA 3TBTA 4FXGC 5I28A 3IRPX 3LXBA 1MHPH 1E50A 3PL6B 4UU9B 4KUZH 2CKNA 1TSHA 1M1XA 3FN9A 1HE7A 3ZL4H 4AVKA 3JUZA 3VWJD 3RVWD 1JK8A 2B1OA 1UHVA 1MCFA 4S2SA 5FM8A 1FCGA 1FN4A 1JN6B 4LVOB 4HYTB 3SEPA 1T4KB 3FRPG 1LO2H 1OWWA 4PGJA 3MRBA 1KFAH 1FNSL 2W88A 2YSSA 5D1XB 3ARDC 5T5NF 3WXWH 5FUZL 2VDQB 3DX6A 3LKSB 2ADJA 1QPXA 3C2AL 2BZCA 5CD3A 3FQYA 3T6XA 3VJ6B 3VXRA 4HCRL 1MFCL 2KDGA 4L8CB 2EP6A 3KYKL 3ZKND 2QV2A 2XA8H 4JO2L 3T1FB 1DTUA 1DVYA 5D72L 2D4DA 3JUYA 4QAMB 3GUFA 3LZPA 3WFDH 4TOYH 2XI9A 1O0VA 4NNPH 1ETZA 1HESA 1IGJA 1V3KA 4HXAL 5E6IB 1A7OL 3DX3A 1CZ8H 4HH9B 1LE5B 1ZS2A 2YRPA 3H4FA 3AY4C 3DRTA 1OV8A 4WKZA 4XMTA 1P53A 1LE9B 1UXWB 1KPUB 1Q8MA 5JW4M 4UIMB 1Z9SA 3VRJA 3WMPA 4OZGF 5I1GH 4Q9QH 2WXOA 5A2JH 1U8HA 1J10A 2NT0A 5DMYA 3J7HA 4OKDA 1VFMA 2I60H 4E9TA 1AANA 3HAEG 2XPZA 4OZ4A 2IC2A 1S6NA 3EOYG 3ZYZA 4Y5YC 2XTJE 5DU7A 3ZDXF 3QZLA 4AEFA 2MMXA 1I7UA 2Q20A 1LNUA 3E6HB 5EU3B 4UIMA 3BIKA 1P2CB 2B16A 3PG2A 2H26A 3DIVA 5AAMC 3V5HA 4H1LG 1BG1A 2KYIA 2BVQB 1DBML 2WUBH 2BY1A 3EYOB 4EI0A 2A83A 3SPVA 4A2EA 1CIUA 3JWOC 4KDTA 3TVMD 3FQWA 3GSVB 1GGCL 1Y0LA 1R5WB 4G7SB 3ARGD 1WUZA 4A6YH 5BVPH 3QK0A 1HH6B 3UTTE 3PWNB 1NMCC 4YR6A 3APDA 2JWYA 1A6VL 3EYVA 3OKYA 4UQIM 2VZOA 3BSZL 1OSPH 2G60H 4OVVA 3UBXG 2IAMB 2AKRA 2AV1A 2APXA 3D25A 3DTXB 3MCG1 3SDCC 3V9CA 4LCWA 1P7BA 3LKOA 1RJYB 3O4LA 1DO5A 3WHE1 1RIVH 4UNUA 3PWJA 2FEEL 1QUNB 3AUWB 1OP3H 2GBTA 2X0WA 3K80A 1BVZA 1R47A 1XCQB 2KBGA 2H8PA 4Z7QB 4QT5A 5K1VA 3VWKA 1AY1H 3UCRA 4YZFE 2H3XC 4HJSA 5T1KA 1XF1A 1EEUA 3DX7A 4GUPB 4NCC2 5JW5A 1G9EA 1RJYA 3O4LB 3A21A 4F8TA 2DZEA 5C08B 5GS1C 7TAAA 2JCWA 1S7VA 1MFCH 3CBRA 5TQ2H 2HFEB 1J0JA 4BM7A 1MCWW 5JHDD 2AJSH 2CPCA 3EADA 2Z64C 1D9KD 4HF5H 4J23A 1O5PA 3TBBA 4JFPA 1A6WH 2AJZA 3UABA 1EBPA 4PJ8A 4YR6B 1NIEA 3VGAC 1HCFX 3APNA 3LRSB 2G5RA 1T1ZB 3FQWB 1BREA 1WT5A 1X7QB 1VERA 2B2XL 3LJ3A 4QTHB 5IIEA 4WI0B 1JYWA 1M6UA 4G8EA 4JFUA 1IC4H 2V5TA 4G6KL 2ZXCA 3K6IA 1U8NB 1J1OL 5GJTL 3FT4A 4HX1A 5ICXB 2FJSA 4IU3A 1QI5A 4EN3B 4JFDD 3H8NA 4JG5A 4DZBA 5I1EL 1RZJC 1O9VA 3LH9A 2YD4A 3DLQR 5DJ2B 2Z35A 3H6AA 3TH4T 1FAKT 5IY5B 2RR3A 1JZJA 3X13A 4MXWL 5E00B 4AL8C 5HYJE 4RFOL 5J3HD 3MJ8A 1AZNA 1PX3A 1YECH 5EBMB 2UX6A 4LB8A 3SKNB 2PN5A 4H5SB 3LN4B 3BLBA 1UA6L 1R24A 2FECL 4X7SH 3V4PH 3GBML 4JPIA 4Y2DA 2B3IA 3QIWD 4IKLA 3SGJA 2P4AB 4HZAA 1ZHNB 1QHOA 4X9HA 2M26A 1MNNA 3HCVB 1P4UA 3LS4L 2G0KA 4PRHA 4F57H 1LE5A 2YD0A 2CO7A 3EYVB 1HAWA 1NCNA 4H88L 1SUJA 5DK0B 1GHFH 5H37A 1NANI 4XMWA 1IGYA 3S98A 2AJXH 3BSGA 3HFFA 3MNWB 1H5BC 4PJDA 3W3BA 3FQUA 3S35X 5D70L 2LFGA 4YDLB 2EDRA 3B7RL 4GBXC 4PVLA 1IT9H 3BUIA 4JHUA 3TBCA 3EYOA 4ZO8A 1G7LB 4A7GF 2WOBA 4Y88A 5D7IA 1UB6B 2H26B 4KKAD 4J4PC 4B5EA 2EIDA 3Q2CA 4ETQA 4PP2A 5L88L 2HLAA 1F11B 2FCBA 1ZANL 1UZ6F 4NPYA 1Z9PA 4PGBA 2WVSA 4NO5A 1RI8A 2BCKB 3MRQA 4P59L 2ZOOA 2DL2A 3QNXA 3K4ZA 4Y7OC 1U8HB 4IYKA 2XZAH 1FL5A 2F8VA 1M1XB 1EMTH 3U4EA 3WV0A 4OF0A 2NX5D 4IJ3B 3EFOB 4LSVH 2EYSB 3SKOB 2GTWA 4IMKC 5IB2B 1PZ2A 1JWUA 5DA4A 5CGYC 2DW5A 4W9KC 4ZTOL 3SKUD 5I73B 1U93B 3BZFB 3GSXA 4C4KO 4EPSA 2APVA 5F8RC 4ZW5A 1I8MA 1B4LA 2PP9A 1ZHKA 1I8KB 1CD9B 3K8MA 2DJUA 2CK0H 2IVFC 1MVYA 1OF2A 2XTJB 1X7TA 5FO7B 3RI5K 3GMPB 4PJHA 4GRWH 5HGAB 4L0ZA 1HJCA 1EX0A 1CGWA 3M8OH 3QIWB 4N1EA 1ZLSH 3SBQA 1SXCA 4WK2B 3GSRA 2X70B 3CFNA 3KM1A 1H5BB 1S46A 3BPOC 3LKSA 4IRZH 3ZE0E 5B39B 2FB4L 2OMTA 2ZXDA 2OSXA 1NCIA 2FK9A 2R29A 5F6HJ 5FHAH 4KXAA 4NBXB 5DT1L 2W59A 3FOLB 1IM9A 1IGMH 3P4LA 3KS0H 2HMID 5TF0A 5LKNA 5T3XD 2WBWB 4OTXL 1MW0A 2W0FB 4M1DH 1QWUA 4N5EC 2J6WA 4O51A 5GS2D 5A7BA 3MV8D 5IB5B 1F1DA 3L5IA 4YO0B 2A38A 4M62H 1OGPA 1T5WA 5L9DL 2QGCA 3WTSA 4Q9BA 2R29L 1CBVL 4ES8A 2COVD 1NFAA 1KC5L 3UTZA 1N10A 2QEJA 2GTZA 4CJ0A 2VN7A 1ACZA 3QDGD 4X4YA 4I2XE 5HDBE 5F6IC 3AREA 3X3FL 3S5YA 4J12A 2ILLA 4LKXA 5J4MA 4ONFH 4Y4HC 5L2JA 2V2WB 5KANG 2ZYRA 2ADFH 5DJCA 3EGXB 1XR9A 4CVXB 4YHML 4BFEA 1XGRA 4JKNA 5ID1B 4OLWL 3EJQA 4PEEA 2DIAA 4HPOL 4GW4B 3Q9QA 1G0YR 4AEHH 1SDDA 3BT2H 3U4BL 3SKJH 1JPSH 4ZOBA 4X6FB 3ULVC 2YD8A 1Z9OA 5I1JH 3BEVB 3WTXA 1G7JB 2F8IA 1SY6H 1I9IL 2E7LC 1A3ZA 3CFTA 4HV8B 4WO4A 4LESA 5ALBH 4YOKA 3N44F 1TSRA 3QG6B 3QUYA 4P05A 2IWGA 5ITBL 3BCDA 2VERA 4F9PC 1A6WL 2BCMA 3BVTA 3CH1B 1AGFB 5JA9A 3EGSB 4MJ5A 4OAWB 3MA9H 4TL4A 3DX9A 4MHHG 4LHUG 4ZX3A 4G9FD 1TJXA 3TA3C 2YAMA 3DRQB 4JMXA 1YY8A 1AHWC 2HFTA 2XIDA 4RMVA 3VTAA 2OMZA 1XR9B 4ZS6C 4CVXA 4HH8A 4P2RB 4DKFL 1MI5B 1DQJA 4FLQA 3DI2B 2HT4C 2VDMB 3L3HA 5T5FH 4CGUB 4YN3A 4PRAB 5DVMA 3SKMA 5ADOH 5E9AA 4M93C 2OR7A 2GK0A 2J1XA 2AVFA 4XO3A 3ETBJ 3RDTB 1JZ3A 3O0LA 2UWEA 4OF3A 3IFOA 4QHLA 4WW1B 5TF1H 5HSFA 3M45A 4G1EB 4LLUA 4X6DB 2WZPA 2BFGA 4PTUA 3NPSC 4JG1L 4KH9A 1DQQB 1MRFH 3QQXA 4FL4B 4YSDA 1U9KA 2NSXA 2IF7A 3ETSA 4FJYA 4K71C 1LDSA 2BOCA 3E3QC 3PWPA 1HHKA 4XCYA 5DSCB 5JIIA 3ARSA 3IK2A 3PP3H 1VFAB 2UXGA 3W39B 3AZUA 2J3SA 3X14A 2WZ6A 4JQIH 3A22A 4M6OL 4P59H 4UNTA 2PYFB 4GRLB 4LCIL 4IHOA 4PJHE 3GZPA 2AXFA 3HJ0A 2QMJA 1FNGA 5AOZA 4YWGH 1OD9A 5I5IA 4ERSH 2G5UA 4MAYB 5KN5B 2NZ9D 4DW2L 3FAXA 2YOAA 4C83B 3FU5A 1VGEL 2Y7LA 3UPCA 1KT2A 3SE8L 3OR6A 4GRMB 1SHXA 2FX8L 1BOGA 4Y9EA 3B6SB 1T89C 4ABQA 4X8JA 2E4TA 5IJKA 3ARFB 3TZVB 2N3JA 4OCNC 1FPTH 2UVFA 4JM2C 3MRIB 4NLHA 4GB9A 4NXSA 4WY7L 4AIZB 3PYCA 3E80A 3QXDB 1LK2A 3UG4A 1UJTA 3S3BB 3LS5L 2PXYB 1JGUH 3LB6D 5AUMB 4XO9A 4LLWA 5DRXB 2NXZC 2WIMA 4BK8A 3QWOA 3RDTC 2GSGA 2R1XB 2HLFC 2ZXWB 5FLUA 1XF4A 2HRGA 5C0EA 1H19A 1AQMA 5I1LB 2FSEA 3QZWA 5HVFB 1QZNA 1VHPA 5IOPB 4WGVB 4NO5B 4ZPVB 1CG9B 2BNQE 1NBCA 3Q13A 2FYVA 1JXDA 3IETB 3ERXA 3IDGB 3VI3B 1ZT1B 2NY4D 1UJ3B 1L9SA 4FNRA 4HUVB 1S7XB 4AUYA 3E3QE 3NRPA 4C4UA 5AALA 3ASWA 3WN5C 2BRRL 3QJVB 3MLRH 4OT1L 5IK3A 1M56B 4YZWA 5EF3A 1G6RA 3KPOB 3O6FD 1S7SA 4TNFA 4HZLA 1ROCA 1XMEB 4Z7UA 4BRVA 2R0WH 4WCYH 1WISA 3RJOA 2NUPB 5C0BB 2VDLL 3DOSA 4FQCH 1EMTL 2VISB 5A1AA 4OCWL 1UA7A 1Z5YD 5DVKA 3RWIB 1KDIA 1SBBA 1HDMB 1JTPA 1AFVH 4P46A 3IF1B 3U9WA 4P9MH 2XFXB 5C0IA 3KG5A 1R3HB 5I6PA 2J71A 1TR7A 1EH9A 5B3SB 4NYLB 1F3DJ 1TO4A 3FF8A 3RU8H 1EFXB 2V9RA 2AJUL 1B4JH 1EO8H 4KX9A 4YX2L 4HXBL 4NO0D 4X9YA 5G4MA 3K72B 1I7ZA 3IMVA 5E99H 1J5IA 2I85A 1TJIL 3AXLB 4HS3B 4DZBB 5J5EA 4Q14A 4ZMYA 1XEDA 3IFNH 4AEIH 3WL9A 3BGFC 1IGCL 4TL5A 4H40A 3P4MB 4A37A 4UIKL 3F12B 2AQSA 2HRHA 2WP3O 4ABVA 3TV3L 2X4QA 2WUCH 3U46B 2UWEE 4FS0A 4PJ5A 5CIPA 3S88H 1NIFA 2QKSA 3FRUA 2Y07H 3NCJL 3ATAA 4MJ2A 5LAXA 4HPYH 2CJSA 4FMVA 1DQLL 4PJXB 5DI8B 5EEVA 2GJ6B 2YAFA 1GAFL 3M6DA 2H1PL 2YAOA 5JNYB 4A55A 4F7TA 2VUKA 3L54A 2VR6A 4I0KA 1BX2B 2WWKO 4I0PD 3EDDA 1XH0A 3QXDA 5JOPE 5KUMA 5FGBC 4OLZH 1LHZA 5DVLA 2PLTA 4HISA 1PZ3A 4JFFD 3MAWA 2HWZL 4X8JB 2ZKMX 4JO3H 1PLCA 1K8IB 4NQSA 5HDOA 3POCA 5KVFE 3U1SL 4FLSA 1NQBA 2BSRB 3FPYA 3HN8A 5SWSB 4AE0A 4V1DA 5EU5A 5CEYB 1PZ5A 5SWQA 1A1NA 1D7BA 2B4CH 2LQRA 3LPFA 1NGZA 2AQPA 4LCWB 2FWSA 4B60A 2GKIA 1QP1A 1A65A 2BVTA 1VZHA 2VWEC 4U3SB 2CJUL 5AW7B 1PD1A 4BWWA 1F4WH 2IAAC 3OKMB 4XCNB 3WIHH 2E46A 4CC1A 1AGCA 3O6ML 3M17A 1VGKA 5E9DB 3L4UA 3BH9A 3GTNA 4DO4A 1UJ3C 3EYFB 4S1DC 2WQWA 3SODB 5BV7B 3S36L 3ULSA 4BFNA 3MV7D 5DGQA 2AQ1A 1Q1PA 1PG7H 1NWOA 4YL4A 1F8TL 1VEMA 1BYOA 4FI7A 4JFXB 4UNIA 4S0SD 3MRMB 1LNUB 5J1AB 3IU3A 2EVFA 1RZ8A 3RDTD 1NEZA 2A9ML 5CJ8A 3QB7C 4UNVA 1BOYA 4HKZA 1UACL 5I0DA 2YZ1A 4IIZA 1YEEH 3PABB 3L4TA 2E8ZA 1LP9B 1L9PA 4WJKB 1GOFA 1HTYA 2V6HA 4TQEH 1KJ2A 3BPCB 3ZTJG 4WKZB 3GXDA 1FFOB 2GT9A 3QUYC 5CEZD 3KJ6H 1HQ4A 1ZTXE 4G83A 2KHAA 4GS7C 1U3HA 3OGCA 1J1XL 3KBFA 1QATA 5MHSD 1I1FA 4AEHL 1JZ7A 2WTRB 1L0XA 4QF1B 3ULUE 1BVLA 2HPOA 4WW2F 1T3FA 3NCFB 3ABKB 3RY5A 3OG4B 3TIDA 1MCCA 3B3IB 5IBLD 3T3PB 5F9AC 4M62L 4ZMNA 4EMZA 3N1MC 4BQ6A 1XF3A 3QNYB 4RMBA 5CR1A 4NO2A 3ARBC 3G7TA 4AQZA 3CFEB 3B37A 2DM7A 3NP3A 1K6QL 2XXCB 1D5RA 4KMTL 2X4SB 2AXJA 4L5FE 2NT1A 3LH2H 3QNZB 5T3XE 2Q3ZA 5HDRA 3QZBA 3C87A 4XAWH 4P57B 4PB0H 3NYKA 3ULVE 1BD2D 3ZHKA 2WXKA 3QHZL 5DK2B 2R15A 1IM9D 1B4JL 3DGCR 3BKJH 1DBBL 5B3JE 2ENSA 4XE0A 1A3LL 1G7HA 3PWUB 2V9UA 4XBEH 3H4HA 4ZMLA 4ELKA 4ZS6D 1RHHA 4LVOC 1KPVB 2GJPA 4AXWB 2L8AA 3JWDL 4XN2A 3VG0L 4YO0A 1NAMH 2Y2TA 1QPPA 3C6LA 4XNAA 3RL1A 3WXWL 2HRPH 1XGZA 3VB8A 3R1GH 3QP3A 5T1MA 2P8PB 2Y3NA 4PD4K 2MOVA 2WXJA 3UTQB 3R7QA 3ZX1A 3ILEA 1OAKL 5CILL 4S10A 2KL6A 3FB6B 1NWPA 4A7VA 1M7IA 4PY7B 3ORJA 3QI9D 4LOEA 4AQEB 5IQ9B 1DQTA 2PO6C 4GXFA 2YPLB 3NZUA 1Q9KB 1OIOA 1CDBA 4ZOEA 1VADA 4JO4H 2DQDH 4JM2A 3PGDB 2CHDA 4KWUA 3DSNA 1F45A 2JI3A 1BOGB 4IK6A 3V0HA 4HEMA 1SJHB 3CFKA 4O4YH 1JMXA 1T89A 2TSAA 1OCWL 1NIAA 3KYNB 3O2WL 2NY7H 1OARL 4Z6AT 1H3WM 2BINA 4R90H 4DGIL 1ZHKB 1BM3L 3LS5H 4JFDE 1CT8A 1EA9C 1Q9KA 2QLVB 4WI6A 4IMKA 1K4CA 4BQCA 2OI9C 4BHUI 4PJBB 5KVEH 1IAKA 4QRQA 2PMZA 4U1NA 3ARFD 5FKPA 1A3QA 4WW2B 5E5MB 4NCC1 1OAYL 4JL1A 1ODAA 1XIWC 3QJZA 2FX8H 3SE4A 4RX4A 4XNZC 1DVFB 5C2BL 4DETA 4KI5C 4PJ7A 3W5MA 4TRPL 1JDCA 1L3NA 1S2EA 1EZSA 4XN4A 2RTTA 5EWIL 1JZ5A 3QBTB 2XYBA 3BKYH 3P30L 1X3DA 1B2WH 4W9HC 4F58L 4Q9RL 1N3NB 2XY1A 1N7MH 2X4UA 1XVSA 5EO0B 3NSXA 2X7LA 3VGDA 4RMQA 3NSFA 2CUHA 4I48A 5K33A 4O58H 5I26A 3V52L 1G7LA 5BMFH 4LLMA 4M43L 1MI5A 4NHCH 2W60B 5E4AA 4YDZA 3CVHH 4IRZA 1H3PH 3GSNB 1GR7A 4IKIA 3MLTA 1KLGA 1TZGH 2VAAB 5D7KE 1IAOB 3GJFK 1AD9B 1U8PA 5J89A 1A7PH 3U6XS 4KHTH 2CRYA 4I18A 1Z66A 3E0GA 3FU7B 4R5VA 1I1AB 2CWRA 4Z7VB 4QHMB 1Z1WA 1NAML 3N06B 4JKLA 4U2ZA 3CXDL 2VZ3A 2WMPB 4CBPA 4OB5H 3RPIA 3WLWC 5EZIH 2W9LA 4F15B 3HFMH 4P06A 2WBKA 1RL1A 3IJEB 3MV11 3BMWA 2MCPH 3DV4A 1CFNA 3BFWA 2H6PB 5C7ZA 3C12A 5J06A 4B27A 3HE6D 3V6OC 4HF5L 1V8HA 1DQVA 4J8QA 2R4RH 3UOAB 3V0VB 2VXQA 1EQWA 3C6LC 4DQAA 2APFA 4G8EB 1H3TA 2BY3A 4JFDB 1BQKA 3TA4D 4BKLB 1J7VR 1CICA 2WQAA 3V55A 5CWSB 2OCCB 5JHLL 5IJVB 3V4PA 5T3XL 3MA7A 4BQBA 2ZF8A 4NQEE 3DX8A 4J4PD 1F6LL 4CC0A 1HYSC 3MV9A 5EC2A 1M05A 5HVHC 1AGBB 4P5TA 2LT9A 3II3A 4LHQB 1HKLL 4HPOH 1T6VN 3VXQA 5E70A 2LAGB 4D0DA 3W5NA 4KO7A 2XZZA 4HUUB 1EZUA 1CYGA 5BO0D 5FX3A 4PJFF 1I1AC 4LAJH 1MCEA 1B0RB 1XGTB 4LCYB 5FM4A 2ADIB 4XGZA 2A7BA 1IVTA 3KPQA 2IDTA 3FOLA 1XGUA 1KWGA 2EVIA 4ISVB 4N8CH 1WTGT 3WFBL 4YMPA 2A77L 5KEZA 4K5LA 2PCPB 4JANA 2WZPD 4GMTL 2YXVA 1CL7I 1SXZA 4DP4X 1EHAA 4P5MA 1WFUA 1MKFA 2DQTH 3X3FH 4DT2A 4A7UA 4ZUSB 3AM8C 5GRZA 4ZJ9A 4E36A 4UV7L 1KCLA 1DSFH 2V2TB 1GY1A 1YNKH 4KFZC 4YK4C 4DP8X 5D1QC 1JHTB 4U3HA 1OAYH 2OZ4L 3R0MA 3B4NA 2CM5A 5IMOB 5E7BA 4B5ZA 5L9DH 3RYMA 4FXTA 5H2BA 4PJ7E 1MFAH 1ML0A 4GKZA 1KN2H 2HX9A 2X42A 5EZLB 2E76C 3ARGB 3B9DA 1MCDA 5D5MF 3WFHA 1K85A 1CLCA 4FJZA 4BZ1H 1OARH 1G9MH 4D9QD 3E6FA 1QKZL 1TVBA 2HUEA 5JNYA 1KEMH 1PBYA 2UY6A 1Z5LB 1CGYA 4Y89A 3QUKA 3TT3H 3AC0A 1N2RB 5C0BE 5F7EH 3OM3B 5AWNL 1QFPA 4KDWA 2VUYA 2J2ZB 4ZMXA 2Q8BL 1VKXB 5BV7L 4JRXD 1JXFA 4Y1AE 4JPWL 2J7LA 5KYXB 2GIYA 3P54A 5CILH 1TVBB 1KOAA 2K70A 4FXKB 2HG5A 1LO0H 3RGBA 1UOKA 3QJXA 1TNNA 3V2AR 9CGTA 2Y6TE 3CLFL 1AO7E 1QVOB 5FLVA 1HXMA 1GGYA 2DQGH 2LU5A 5GS0H 1J5CA 3AJ7A 5BS0D 5IFJB 2APSA 2I7SA 4ZS7L 3WN5B 3K1DA 3MGTB 3AWEA 1IB5A 1BFSA 3K6NA 4N0YL 1Q9WB 2BDNL 2QADB 1KGIA 3MJ9L 2VLKB 4GAGH 4JDEB 4JY6A 4KKNA 1D6VH 4WHTB 2E7CA 4W6YB 5A16A 1TQCB 5C0DB 4KJYA 2E7DA 3S36X 3DX6B 3MBEC 4LCCC 2A4EA 4MCZA 2VSDA 2VISA 2WLJA 3P0VL 2YD5A 3VD9A 1A7NH 4FQXD 1DFXA 2AJXL 3L3IB 1BCIA 1JP5A 1P69B 1S7TB 1SFDA 4G9DB 1AQDB 4XMZA 5FCSH 2YPVA 4WVRA 4YXKH 4IS6A 2WSKA 1PYWA 2DQUH 5JW4Q 1W2KT 4EN3D 1CJYA 4KUCD 1J9TA 2IDFA 3THML 4KTYA 2R69H 1ZVSB 1BJ1H 4RIRA 2FEDD 2BNRD 2ZUYA 5DUBA 4U4BA 4L8BB 4UYQA 2E74C 1MLCA 1YVLA 5BVJB 4LBAA 3T4AC 1QLRB 3N1QC 4K15A 43C9B 1FNAA 1GMIA 4X5RA 3BW9A 4YHZH 3VXSA 4ABWA 4JO5A 1VF5C 1C9SA 4B0MM 1D9KB 1AIFB 2R0KL 4FGMA 1EO7A 3KJ6L 4ZMWA 5F89B 3LKQB 3NGBC 2FYYA 4IIQB 4TF4A 3PNWB 2JB6B 3RL2B 3TVMA 3GT6A 4G43A 1QD0A 1OGAA 3MRJA 3IDNB 4JGUA 2NY4C 3VXSB 5KBKA 4JFFB 1YY9C 5KSAA 1HYSD 4GAYA 4JANB 3U6XA 1OW0A 1D5BA 1AKJA 1NCOA 35C8L 4XN7A 3UXFA 4EZJA 4YHYB 2J8OA 1OP5H 3DX7B 1EJFA 5JW5B 4WK0B 5C3IA 4NN6B 2HTKD 2H1XA 4G6ML 4CN6A 3D18A 2J57A 4OV6F 3D3VB 4XBGB 3T5WA 2YGNA 5KVGH 1F4AA 1KT2B 3Q7JA 2XWTA 2Z93A 3ALPA 3HPJB 2WMPA 2X1PA 3QFJA 1E4XH 1WK0A 4N2OA 4G80A 5T5FL 3SO3C 1FQ9C 4BFJA 1AS7A 4NN5C 4R3SB 2DMCA 2ZPKH 5F3HA 5BZZA 2NW2B 3UJJH 4TXVB 4C56D 4JE0A 3WTYA 1ERNA 1MJJA 4OBSA 1BFVL 3QUZA 3FOMA 2Y36L 2VLKA 5TGBB 2HN7A 2YA1A 1TPXC 4U0RB 3TEYA 2XWJA 3NN8B 3D85D 2DLGA 4JB9L 3L6FB 5FUOH 4JFTA 4ICWA 4ZMZA 3NJKA 3QUXC 5AKSA 5JPNC 3AQZA 2Z7UA 2VMDA 1U58A 4DP1X 1NFKA 4HIJA 2BOBA 4J28A 2XLLA 4S0HA 5DTFB 1ZTXL 4EOWL 3QWRD 1XAKA 2Q10A 4RMSA 2RACA 5C08D 3NFNB 4IRSB 5G5DB 2O6PA 5GS0C 1V3LA 4MA8H 3UH8A 2ICEB 3LRMA 1DBJH 2VLRA 3OBAA 5ANME 2G5BB 2BC4A 4R5TA 2QSTA 4X4ME 3PIQB 1INEL 2OMZB 4AC4A 2ZCZA 4ZTPL 1G7IA 3IFLH 3ZKXC 4UQ3B 1CE6A 1A47A 1R17A 1WC7A 4PJ7B 1N2RA 3MJWA 5IHLB 1DZ0A 3DRQA 3U4BH 5KANI 4QHMA 2KZ1B 3D52A 5EBWB 1C16B 4EAEA 3KH3A 3TEWA 1QA9B 3AS0A 5IUCA 3CH1A 5DMIL 5F72S 2ICWA 4HVBA 5J6HB 1C5BL 1CFTA 3HVNA 5E2UL 5C0GA 3UAJA 2BNRB 2EH7L 5ETUB 1CDYA 3BUYB 3WIIL 3TGXA 2IAMD 4HKJB 4YSUA 3HNSH 3S2AA 2A2QT 5CGBA 1WGVA 4D8PB 2OX5A 1NCAL 2D3VA 3JZ7A 4I77H 4UZSA 4XT1C 4YHPA 3R7RA 1KCBA 3IPEA 1N64L 4JPVH 3C5ZD 3U2SA 4N9GA 3BEVA 4UQCA 2BIQA 4PRDB 5CBEB 5HHPB 3AT8A 2H6OA 2DLFL 4PG9A 1JE6A 3VTTA 4ZFOL 1LEKA 1BEYL 1WPCA 2X4UB 3I6LD 4ABUA 1YQVH 1UM4L 1MFBH 3N50A 4PY7A 5JHLH 4X98A 3GB7B 4NRZA 4HK3N 4KV5E 3NDYE 1JAEA 2YEQA 5TDNB 4YDKL 3BFQG 4F9LA 4JM0A 1WIUA 2AK4A 4S2SB 4N5UA 1GS7A 4N0FB 2X1XR 3P9LB 1WCQA 2XQYA 5F1NA 2ZOWA 2VABB 2XU9A 4XC3L 4M4RA 2DMBA 1Q90A 4RLDA 4M9OA 1KBPA 2ZPKL 1NFDA 4ZDHA 2VZTA 4BSVA 3VXMD 2GTZB 1LO2L 3KYKH 4XBMA 2Y36H 1JPTL 4PTTA 5FO9A 3L45A 4KRNA 3LRLA 3VFRB 5K59F 2BVOB 3QI9A 3IGAA 1GIGL 4FEMA 4PJDF 2IBBA 2HJFB 4NZJA 4P57A 3UYOD 3KBEA 3DSNB 4LMQI 4WWKD 4EKJA 4P2CG 3MUJA 1E4XL 2W0FA 4JM2D 5I1JL 5HYJD 3TBWA 1VADB 2FX7L 4KRLB 4JFDA 3ZGIA 4AV4A 5E6ID 2WWNA 5IB4B 1RZKL 2C1OA 3LB6C 1UUSA 1ZXQA 3QULA 4L3CB 1OO2A 4DZ8A 1FORL 4E41A 1S9WB 3AM8A 2PO6B 3L5JA 6FABH 1FSKC 1QWNA 1ZS8B 3L5HA 1CUOA 3AU1A 5F0JB 1X9LA 2EZ0D 1QBML 4ONFL 2R0KH 2VIRA 3ZDYF 4JPWH 3NESA 2W8CA 5KBMA 3BWUC 3RA7L 3HA0A 4AM0B 4TTGA 3ZYJA 5K9KA 1PLGL 32C2A 2XZCH 3SDCB 4M5ZL 1OT1A 3WIFA 3ISWA 1Y07A 2I32A 2Z8VC 1M3IA 4N90D 1E0OB 2NDFA 1Y6MR 1SOSA 2H1LM 2Y23A 2MTPA 4I18B 5GJSL 3JVGC 5KZCD 4GUQA 1RZGB 1G1CA 1F3JA 2AI0L 3QQ3B 3UYRH 1N5AA 1WS7A 2IEPA 3NFSL 4HHAA 1RIHH 4HJJL 2R8SH 4LOVA 4JQXC 4TQHA 5GRJL 3L9YA 5JR1L 2P24B 5L2KE 3AW5A 4NJ9L 2YJLA 3VXMB 1OB0A 2R69L 4Y4FD 4LLMB 4GSXA 1FC1A 1WD9A 4PRPB 5F70A 1UA6H 3KVDD 3HC3L 2MQ0A 4CN4A 4NWUL 3P3RA 3LTVA 3B3IA 3O9WD 1IE4A 5DHDA 1OPOA 5BZDA 1A6PA 2JCCB 2A5UA 1DE4A 4FQJL 5D7KD 5JHBA 1OK0A 2WOYA 3HE6C 1QNZL 3ZE1F 4I3SH 1LD9A 3FJTA 4CC4C 3BGFB 4JM4L 5I17B 1OSZB 3GSOB 3U83A 5HP5A 3UCQA 1G87A 1IAKB 2DQGL 2HKAA 2WXNA 4AT6A 4G80B 2VE6A 2GJ6E 4XO5A 2WXMA 1OL0A 4FQPA 1N8ZB 3KS0J 1IBBA 2VDNB 2BSRA 1SJHA 1UFGA 7PAZA 5DS2A 2X44D 5IQNA 3D3VA 2AABL 1BIIB 4RQQA 1P4BL 1L0QA 3NCBB 5DEZA 5F7HA 3ESUF 3QHZH 3LIZH 1UUNA 1P6FA 2GQHA 4KH2A 4MJID 2AV7B 2Z92A 4IU3B 3ZIYA 1EGJL 2QQKL 3ASOB 3T3PF 4TS6A 3F64A 2V17H 3VXRE 3FYEB 2JKWA 3ZT6A 2VM4A 3D3VD 5F89A 3DMMC 1YQVL 4Z78B 2H2SC 3C6LB 5LAXB 1JBJA 2WZAA 5DWUL 3DMMA 3BSZH 3VDCA 2KDYA 4FFWD 4U1GC 5HDLA 4R7NB 5IZ7A 1DEDA 3KLHD 2YOCA 1WE5A 4P8QA 1MIMH 1BZ9B 4QOKA 2UZIL 1NCAH 2B1AL 1IRAY 2OMUA 3QJHA 5D9SA 5KYUB 3D39B 1M9SA 1U42A 5KJRL 2YHGA 4JNXA 1UG9A 3X3GH 1NIDA 5C09B 1A02N 2XQYG 4HT1L 3TA3D 1P4IH 2NY6C 2ZOLA 4G9FB 3CFMA 4KAQH 4OCXL 2PABA 1KPRB 3FBKA 1KXQE 4WSGA 1CL7H 1QLEH 3CQPA 2OA9A 1N70A 2X2YA 3UIZA 3GIVB 1SDAB 3KW8A 3MGAA 2JCCF 2FR4B 5D6DA 4OZIE 2WHVA 2E59A 3T0WA 4BDVA 2NPLX 2WQSA 1HDMA 3H7BA 5CHNB 1R4XA 2EYTA 3DARA 5B1JC 5IB1A 3WHXA 2I9TB 3SDXE 3D2TA 3DO7B 1V7MH 2OK0L 3KXFE 2P3YA 3LZRA 3T3MB 2LLGA 4I5BA 5SX5H 1S8DB 4PP1D 1EFXD 1EZLA 2VQUA 1S3KH 1ZPUA 3G6JA 3DX0A 5H8DA 3E1ZA 1JHLH 3SPVB 1KGYE 3KPOA 4F8OA 1ZA3B 2UUDK 4WTQA 4YDMA 5MEPA 1WT5C 1GTNA 4TVPL 2V3EA 1UXMA 4XZUB 4Z3TA 4FQXA 4OGQC 4OTXH 5JQIB 1NMAH 1CD0A 5C2UB 3JTTA 1YCSA 2WBJB 5D1XD 3VFPA 1A7NL 2MHAA 2OULB 4ZFGH 4ATWA 3TO4B 4PJCE 4W9ZA 1TTRA 4OB5L 4NO0A 3MTRA 2BFVH 3FYIB 3MZGB 3K6DA 1UT9A 2Q7NA 1NEZB 1FHNA 4OUUB 1BV8A 1R5IB 2WZ0A 3LEVL 3M1BB 3ZDZE 5GS1A 4KJQC 3GRWA 4XVTL 2Q7YA 5D55A 1WVZA 1QO3B 4KTEL 1D6EA 3LQMA 1SDYA 3H7BB 1PSKH 3CJJA 3V5DA 2GPZA 3LRKA 2N59A 3W9DB 1GZQB 1SPDA 4Z9KB 4XP6H 5H2BB 2ARWA 1E2ZA 5DS8A 4PJXE 2OTUB 2O6CA 2Y7NA 3GS7A 5BJTB 1QYGL 1IZJA 1KTJA 2VDRH 4H13C 4KHTL 3V6FB 3ZBMA 1AKPA 2J55A 2AEIT 4N0UB 5E24E 2YMXH 4X7FC 1XXDC 5BRZD 1LWHA 3OKDB 3U0PA 2Y6SD 4MAYA 1W6WA 5CJOL 4HUVA 3FW6A 1IIKA 5HHQA 3D48R 5HD8D 5GRJH 5JR1H 3WXVH 3T6ZA 2Y7MA 1FZMB 2O5ZH 2I9LB 3L2MA 3MYZA 4GXUM 1LO5B 5F7NC 4G3YL 1M71B 3FSWA 2YXFA 1LP9E 4Y2LA 1ECYA 2DM3A 5J12B 1F00I 1JK8B 2OBGA 3L5XH 4XCCH 5DJXB 1CDHA 1OKEA 1TENA 1IAII 2VDOL 7CGTA 1LM8V 2NY2C 3G5VA 3ULVL 2IBGA 3QI9C 4CU8A 1AH1A 2C9SA 3FTGB 3QUZD 1CXHA 5F2FA 3KNBA 2FEEI 2WQVA 2KH2B 4X9GA 3RA7H 1XSKA 4JHAH 1XR8A 1IGFH 5D2NA 4AQ1B 1TETL 4I8DA 2IG2H 2IXQB 4Q2ZB 2C1PB 2DQFA 1QBLH 1KIPA 3E1F1 4JDTH 2PTVA 4Y4HB 2PYEB 3WTVA 2YEVB 4AGQA 1QSVA 1JF5A 1E4JA 4G1MB 1QRNB 3UJTL 1BHGA 3FT2A 1WRFA 5D7IE 1T20A 1YPZF 2KZKA 4X8CA 3RWEB 3NGBB 2A6KB 4DF9A 3O4OC 3RX8A 3EDFA 1Q0XL 4XR8C 4GRLC 5K9OB 1X4ZA 1CE1H 2BJMH 2BIOA 1J8HB 5DR5H 5ELIA 3UC0L 1E4XI 5SWZD 1DE4B 3ME0A 3B2DC 4JFQA 1NC2D 4HFUL 1AGDA 1KJMB 3BYYA 3MCKB 3OGOE 4PJFB 4XBEL 3BGAA 5I74B 5KYWA 3DXAD 3NACL 3FFCB 4HMEA 2O93L 3DNKA 2M83A 4ZSOB 3H9SD 3EBHA 1YYCA 4FD0A 1YEKH 5H94A 1A7QH 2CZNA 3GEWB 3IMWA 4ZZFA 5FDWA 5ERWB 3ESPA 4LFHG 4BDVB 4MHHI 1AZVA 3KLQA 4G6FB 3DOSB 5FWQA 4OZGE 2Y5EA 1JJUA 4C58B 1UVQB 2RA1A 4P2RE 2BXZA 4OQ1A 5DLML 3BJ91 2EILB 4QJ4B 5DO8A 5LBSA 1S7UA 3GSQB 4JRLA 4V2BA 1GYWA 2CR0A 3CXDH 4MJJA 4AE1A 4G59C 4YHLH 2JJTC 3T3ME 1WSST 32C2B 2ARJB 2YRBA 4K9EL 4DVRL 1WFOA 4Q7DA 4Q52A 4LU5H 4H8WL 5EOCH 3QR1A 2UYLB 3QRGH 1RUAL 2WINA 5G4NA 3RUGB 4J5VA 1IIIA 1YQ2A 4R4BB 3HHSA 1KGJA 5EIVA 4CBZA 1W0VB 1BQ5A 5DFWH 1MSPA 3L4ZA 2WWOA 4UDTA 4D9LH 1G9NL 4MSWA 2K6WA 1GCYA 2IQ9L 5DFAA 2FBRA 4PRIE 3A6BL 3C6LD 5EN3A 1X44A 3B2XA 4NZUL 5CXPA 3WY1A 1OK8A 4UT6L 4QEGA 4ZG1A 5CLYA 3L3OB 1RULL 4UQBA 4ZUTA 5BS0E 3EW3B 4BFFA 4ZXBC 3B2UD 3WEXB 4KK6D 4IHBA 3C6EA 4NUPA 3GMOA 4CMHB 1EAOA 1OT4A 5CJBA 5F7BA 4RFEB 1ZVNA 4AQEA 4F7MB 1SJXA 1JHKH 1ZT7A 2AXFB 2HTLD 1RIUH 4G7YL 4GO8A 3T2QA 4LVHB 1KN4H 2N4IA 5EUOB 3FQRA 4LRIC 5MENA 3TVMC 2VABA 4BCZA 4LASL 1TJIH 5I75C 4FFYH 3GS4A 1I85C 1NGWB 3V0WL 3OMZA 5DJZA 3D50A 2DLTA 4JO1H 3GSWB 1CR9H 1U2CA 3GLEA 2GABA 1AR1C 1IKNA 1ZLSL 3OAUL 2W65A 4HUNB 4Z7VE 4BHUA 5ESAB 4Y2DD 3DIFB 4K2UL 5ALBL 5IROC 3UPRA 4E41E 3AADB 3GSRB 3UACA 4QRAA 3UC0H 5M95B 1PZDA 3GUTA 1XSOA 3P9WB 3AXIA 3U6RA 3WFEL 4MMZA 4AUUA 2H3NB 3NACH 4NFBA 2NQDA 3VDAA 1KY7A 3CAFA 1KULA 1QSFA 4KO9A 1YY8B 4WI9A 2ZONA 2Z4QA 1QHQA 4UI2A 1U93A 3P0YH 3K7UA 3E2HB 2ZWLT 1QA9A 1D5IH 3D9AL 3TIDB 1C1EL 1YEGL 3RHWK 1XFPA 5GIRB 1H6TA 4Z0XA 1TETH 1IQDB 4U1LB 5HHMB 4ELME 1JFQL 1I9JH 5LG1A 3MRQB 3TBVA 3TV3H 4KROB 5HI5C 5I6XB 4QNPE 3D69A 1HNFA 4PGBB 3S3DB 2ARJQ 1DJZA 2FT6A 4K73A 5KZCB 2FUQA 2AXGB 2NR6C 1MPAH 4L8DB 4WI7A 3IE4A 3AU0A 3HE7A 5EO1B 1S9WA 2R0ZH 3EZ8A 4FLOA 4M9PA 4DGVL 3UTSE 5DC2A 4JJHA 4C54A 1EV2E 5J7CC 4UILL 4LLYB 4LSRL 1CLZL 3QPKA 5FYJU 2YGOA 3RKPA 2XVBA 1YN7A 2AEQH 3A24A 2VLMD 3MXWL 4OF5A 1PDKA 3VE0A 5B1CA 4ONGH 2WWKT 3RX7A 4Y5XC 2AEOA 4Q2ZA 5EIQA 4NAQA 5IMMB 4Y4KD 2Q76A 2XG5A 3LNIA 1S78C 4F2MA 3G5XA 4XXDA 2DQIH 2J4WH 3D6GA 2ITCA 3QSKB 4PJIB 3LPPA 1J18A 4FQCL 3QEQB 4H2AA 2K3TA 5I6NA 3U9UB 2VDRL 2ZXGA 2NY5H 3ZRSA 5FYJE 4KJQD 3MNZB 2JVUA 4PH8A 3BKCL 3X13B 5F7FA 4MNGA 3VM5A 1EHLL 3U9PL 4FFWC 4JQVC 4O51B 3BO8A 1E30A 5I71C 4CMHC 3MUHL 3QEHA 4PJ7F 1E6OH 3FN3A 4WO4C 5LWYH 5EN2B 3C60C 5GSRB 3A3YB 1MW3A 1T83C 4HJUA 4QRTB 2PKDA 1LEKB 4JEGB 1NCUA 4QYOB 4OT1H 4ZQKA 4N5ED 4G43B 5DZLA 3MJ6A 3M1OA 5TF1L 1AAJA 4BFGA 1NKRA 2MQGA 1A8JH 3ARED 1NFIB 4H0GA 1ZANH 5SX5K 3UG5A 2PPFA 1OAZL 4U1SA 5E9DE 1KN4L 2XJLA 3QQNA 1Y0LB 1JGUL 3P02A 5IBTH 4WFED 3ECVA 1INDL 4FI8A 4Z7WE 4DH2A 1YEDA 1R3IH 2X3CA 1U36A 3KPRB 4QOKE 43C9A 4L1BA 2QZ5A 5T8IA 4A38A 2H2PC 3IFPA 2WGNB 1Z9NA 4MQTB 5EHFA 3M7FB 2MCG1 4L48A 3FQNB 1ZVSA 3I6LE 4U6VL 2Y1AA 1DHKA 3JV4A 4CA4A 1E5CA 1LVEA 4OZFB 2VDOB 3DPBA 4OZ4B 3VXPA 3PJSA 4XWOD 4DO5A 1JHLL 5F21B 2WLZA 4DWHA 2IQ9H 4MD5B 4I85A 1TF4A 1B6UA 3MHZA 5GGRY 4AV0A 3RVTD 4EDXB 2WBJA 2B0SH 1YC8A 2OTPA 5DTFA 5CLXA 1EJOH 1NOFA 4KJWC 3ZVVA 4D0BA 4DEPC 2V9TA 1SQ2N 3QEQD 3OX8B 4HS3A 3V6OA 3WKMH 2XVGA 2ZOUA 4JCWA 5FAAA 1MCNA 5IHZA 4M1GL 4I3RL 1HH6A 4AC2A 2VR8A 2B9BA 2E8YA 2ZP0T 4GXVL 4PJDB 4HAGA 4MAZA 3V10A 4V2CB 1GGIH 4NNYA 2D3JA 4PJBE 1YJDL 4ELMA 1TQBC 5FOJA 1U3YA 5LBGA 4O2CB 1RU9H 3T65B 5L6YH 3ECQA 3K6SA 3LSOB 4JFHE 4LU5L 3KPSB 5ACLA 1G7MB 5KYXA 4QY8A 4FRWA 1JGVL 2Q0ZX 5TJWK 1WFTA 2MSPA 4Y1AB 2P24A 2EC9U 3GRBA 3SKNA 4X8GA 1JXKA 3FT9A 3AQDA 3K8KA 3OKEA 4Q6IA 4KITB 3IFNL 4AEIL 2CM6A 2MPAH 5EF0A 1UWEH 3ULVF 4O02A 1DUYB 1OSYA 2MOGA 4FNLL 4R97B 4V1DE 3QEGH 2XWBA 4XBGA 1AZZC 2PWFA 3AS2A 2JTYA 4Y8AA 2GUOA 4HIEB 1KB5B 5FYKU 5KW9H 2FATH 1OZUA 3UGUA 1F1GA 4NPKA 3UBGA 3TJEL 3OKOA 4KNTA 1QFWH 3O3EA 1LDPL 3FB7B 1NAKH 3N55A 3QUMA 3F7YA 3BWAA 1Q9OA 2QL1A 1RERA 2C9QA 2EIEA 4KKLC 4DAGL 1Z5HA 2BSEA 3QR0A 1UOLA 3T1FA 4KKCC 5HTSA 5MERA 3VQ2C 2B4CC 4NOFA 4GBXA 4XNMA 5AOLA 4DGWC 5LWYL 1W0WB 1BJ1J 2KT6A 2R59A 3QE5A 3G08A 4MNGE 2AQNA 1E40A 3VNZA 4J3VA 1IARB 3S5ZA 4JK0D 3EFDH 3U9PH 4AIZA 4QRRD 3MRCB 3IDIB 4RBPH 4BH7A 1JMZA 5EIIA 3PWPD 5T1KB 2NYYC 2VDML 4NQEB 2DQ6A 3IJ7A 3US0A 2W0PA 4HHGA 4Z76B 1UCBL 4K8RD 5FYJL 3STLB 1XCQA 3W56A 3EFFA 5CP7B 1CFSB 4EQ2A 4UYPA 5MHSE 1FFPA 1QRKA 3VFRA 1O7VA 4JRXA 4MMYB 1BQUA 4NQCE 2QADD 2J20A 2WYIA 2ZICA 2HTLC 2QPDB 1PJ9A 2ITFA 3FSOA 4UOW0 3WUZA 5IFHH 3O3DB 2QELA 3OR7A 5AZUA 4MASA 2D9QB 2OMXB 4Z7WA 4TLUA 4FG2A 4HJ0C 4YC2C 1FRGL 2R83A 4RNRA 1S7QB 3O3AA 4E9VA 5GGVH 5JMOC 3O8XC 2G2NA 2Z0BA 3BUBA 3ZKNC 4A6YA 1M9WA 1R5WA 2WXGA 4PHXA 1YN7B 2R8SL 1HZHL 4H44C 3MREB 4TSAL 5DVOA 1E65A 2A83B 3GB7A 1WA0X 4NRZB 4IOIA 3B8YA 1NMCB 4U1JB 4X0KB 1PLGH 4QHLB 4G8GE 2XUWA 3GBNH 1MAMH 4Q97A 3ARUA 2WXRA 3HE7B 5F44A 2VLKD 2GK0B 1ZJBA 5PAZA 4APQA 1CFBA 4HJEA 5D1ZA 2VUOA 4QJ5B 3OMIB 1CFNB 1F0LA 1XZ0A 2BHFA 4XCFH 3RIFK 1G0DA 2IQAB 3P11L 2IGTA 2MQ3A 4ZMOA 5J1TC 2WQ8A 3ZT5A 1O9WA 4X7SL 3V4PL 3Q5TA 4YDIL 3TM6A 1T2QL 3VUAA 1PZAA 3VXRD 1M3JA 1BBDH 2GJZA 3IGFA 4N9OB 4DGIH 2Y2WA 1UENA 1KB5H 3RIKA 3LZQA 4BA0A 3EJZD 2VRQA 4O4YL 3LQAC 4F7EA 3I3DA 3H0TA 5C09D 4UTAL 2ICWB 2VQTA 4WI3A 4GLRI 5IG7A 2ITDB 2H5UA 3WOVA 2Y24A 5D4QA 3ARGA 2WSDA 1F2QA 2YRLA 1BDYA 2NXZD 4H7VA 2FWLB 3SDCA 1JNLL 4JLRB 1L3WA 2BFVL 5IMOA 1G7IB 4B7IA 3MRPB 4ZAKA 2XN9A 1JPTH 4MZ3A 3KYMA 5ADOL 2JKNA 1QFWM 1NL0H 1ORSA 2YA0A 3IDYC 4WEEA 2ATAA 2AVGA 3FT1A 3H55A 3OLEA 2L7JA 2PTUA 5LDSA 2VC2B 4U6HA 1I4FA 3JWDH 1ZLWK 2VW6A 1U8QA 3AAZA 1KJVB 1HWGB 3NIGE 4KDTC 5DUML 1G9NC 4MLSA 4UCFA 2VDNL 3K91A 2NZ9C 4L5FL 4F7KA 4WEMB 1EDYA 4OQTH 3BKML 3UTPE 4YJZL 1UOWA 3K2IA 4HJJH 4U1KA 4Z77B 2X4RA 5HGBA 4OI7A 2FATL 4U1GB 5J12C 1KXVA 5KG9A 3VX0A 4HEME 3BSHA 3DV6B 3Q8EA 3CC5A 1CBJA 4YDVA 1NCCH 4ZUWA 2F53E 3I2CH 4NKOA 5CJXC 2X3BA 2XXMB 3MOAL 4UOW1 3JYBA 4WW2A 4BE5A 2P8MA 3RDJA 5FGRA 4LPTA 1ZCRA 3REVB 4CSSA 4OGZA 4O9HH 4UTBH 1HQRB 1AMXA 4J7RA 1S5IH 1DSFL 4O2FB 1FRGH 3DI3B 1S5HB 1CT8B 1VGEH 2QVIA 3BUDA 4ADIA 2DOCA 3ZMRA 4JFZH 3VH8G 1T0PB 4JFSA 2CH8A 4NX0A 1NEZG 5ABZA 5EC1A 1FBIH 4L4TD 3VB9A 2XETA 1KTCA 1HL4A 3PDGA 1K8DA 2AK4B 1HIML 3MACL 4MZRA 4AG4L 1RFDH 2FL5A 3GMMB 1E28B 3FPXA 2YPLA 2XN9D 3N42B 3DTDA 4NP4H 2DH2A 3RGVC 4Q74A 1OTTD 3U7YL 4KZDH 3CFDA 1HL9A 2GY5A 1E28A 5D5MA 3HG1B 4NQCA 1EO5A 3KHQA 3ABLB 5C6TH 1B9KA 4PSRA 3SQBB 4EZLA 3RJQB 4GBXB 1U41A 2VXUL 4NN6C 4AQAA 1SXSA 4GT0A 2YKLL 3IJ9A 2HRLA 3MQIA 5HGDB 2D7TL 4N0CD 4W9IC 5GGUB 3W0WB 1D9KA 4ANVA 1MQKL 2WBJC 5E9NA 5K1NA 3E9TA 5H4ZA 2DM4A 5LNGA 2Z1KA 4W6WB 2VR9A 4HDIA 4K3DH 1OLZA 4Z7VA 3AMKA 2F1EA 2R1YB 3CDGA 3GSQA 2F7QA 3PGFL 4N2KA 43CAA 2EINB 4FXGA 3NABH 4NKOB 1H9VA 1M7UA 1U8PB 1LDPH 1BD2A 3OXRA 3GS0A 1IM3A 2ZSVA 1INDH 3TNNA 1O7DC 3OTTA 4NNPL 5EUKA 4TQIA 2V5MA 2GBVA 4YHIB 1FZJA 3D7PA 3H3PL 2YO3A 3TCTA 1OTSD 2EXTA 2ICEA 2AQTA 4FCHA 1U8OB 2BMKB 3KM2A 3S37X 2OL3B 3PWLB 4N2MA 1A6ZA 3CIAA 4GKSA 3NK4A 3QQDA 5I8EA 5D7IB 3CSFA 3L13A 5IGXH 3ZE0B 2TRHA 1ZSDB 2G75B 3LNEA 5GZOC 1BQHA 2A1WH 3O0RH 4P2OC 4JY5H 3VI4A 2NW3B 5EBGA 2PYED 2LTQC 1IC1A 4XVSL 5DJDA 4JLRA 4NQCD 2BHUA 3NN8A 2J6EH 2R1WB 2XOTA 1OM9A 1TQCC 3ZUCA 2ZKYA 1MOEA 2GBUA 2V5YA 5JYMA 3T6QC 3E8UH 4AK2A 3BPNB 2X9XA 3CZJA 4YVNA 4NS0A 1AZRA 4NO3B 3EJTA 2R2EA 4O02H 5AYUL 1RUQH 1MJ8H 2GSIA 5C0AD 1QW8A 3V79C 2XBTA 4OZIF 3C8DA 2Y07L 2A6JB 3NCJH 4Y5VA 4GKLA 3E2HC 4RFNB 2P9RA 4M7ZB 3OQ3B 2VN5A 4BJLA 5CIPH 5CP7A 5D7JA 4AGLA 4IJ3C 5E2JA 3FXIC 4Y9CA 3SDDC 1X5LA 2BPBA 3QUML 2P45B 2OYPA 3N44B 1HKFA 1CZ8L 4F2ME 1N19A 4KQ3L 3QIUA 1F58L 1U3JA 1HCYA 4LLQB 5EH1A 3KNBB 4PGCA 5FYLE 2CIIA 1P6WA 1TCRA 2X4TA 2EXYC 1ZV5A 2PWGA 5HGHA 4IOIB 4PS7A 3EYFA 2KUTA 4N0UE 4LEBA 3FB6A 4X80L 4JHZA 1X7QA 5C07D 3IMUA 4OIAA 1LEGA 1SJEB 3MVSA 3RVWC 2J1ZA 5AVWB 1V3JA 4FQ1H 1E5UI 1QTYT 5IESL 1JI1A 4I2XA 1S7QA 4B9IA 2NRDA 4FFTA 1C5DA 1U91B 4X5PA 5SV4A 5JO5A 2W81C 1YLBB 5L0QC 4RFOH 2UVEA 2R51A 3FH5A 3JTBA 1J11A 2AK1L 4HIHA 5IBUB 3TJHC 5DQJB 2NY4B 1P0SE 2L3BA 3EDJA 5HHQB 5EN2A 5DLLA 4UT9H 2IH1B 3KLSA 3AB0C 4K07A 5AYUH 3P4NB 3C2AH 5HHXH 3SDYL 3OAZH 2DI9A 3IEAA 3EFFB 4PLJD 1L4IA 5D7IF 1MHPL 3QGVA 1JGEA 1T1YB 4YFDB 5LXGH 1QG3A 3HC0B 5I23A 4LL4A 4N0YH 4LLDB 2NX5A 4HUCA 5AZ2H 1IEAA 4E41D 1C12B 4Y1AA 3JBG7 5DD1H 2VR7A 3F62A 1RSFA 3ES6A 2LHAA 3B9KD 3QEQA 4YEEA 3RUGE 1BWWA 1E4WL 5KVDH 3R0NA 1XF3B 4LPXA 1GW6A 4HFWB 4Q0XL 3F7PC 1D6EB 4YDIH 1P1ZB 2X1OA 2V33A 2C4FU 4XNMB 3QJFA 3VFVA 4G9FE 3T4AB 1A3LH 5EULV 1RZFH 1X5IA 1MW2A 3QDGA 2OMWA 7FABL 4FTVA 3H3PH 3KWTA 1NAMB 3B3BA 4BZ1L 1LWRA 1VESA 2V5RA 4DK3A 5JIMA 3PDOB 4NQVA 3BVUA 4WTXA 2FJUB 4GW5B 3TPKA 4KKBC 4Z7NE 3KGRA 1VPOL 4W9CC 4ONGL 3ARZA 3WNKA 2P1YA 4M8UA 5GS3A 4AIEA 3MRKA 2C5DC 3SD2A 4OR1A 3I6KA 4AGMA 1K6QH 1SEBB 4OKVB 2IGLA 4GKNA 5IB3A 2AXGA 1KCKA 4L1SA 1EHNA 5ICZB 5IMKB 2P5EB 2NY3D 4MCMA 2O61B 4M8VA 1EZVY 5IOKA 4IRSD 4ERSL 2O5ZL 3G5YA 4Q6IB 4ODWA 1SF5A 2BNUA 2J1KA 4KGJA 1FYHB 3CQFA 1R3HA 3QYMA 3RPKA 4LOFA 4WO4D 3FU7A 4H25B 1TITA 4FA6A 1BZ7A 3TA3A 2HLEB 3EXJA 2VM3A 4MXWH 1L5GB 2YMXL 4O2CA 4RBPK 2ID5A 4NP9A 2J6EL 2A74A 1JF6A 1DVQA 3DYMA 5AOKA 2ICCA 2YXMA 3GXPA 4NDMB 4D9LL 3D85B 3KCPB 4F9PA 4HK0B 3JWDC 3ASNB 4RDBA 1OGTB 3FHEA 2ZX6A 2NXZB 4PQXA 2DDQL 1D7CA 2XY2A 1JPGA 2RJMA 4UF7C 4ATTA 1JNHA 1TCMA 3DMMD 4S1RL 4QRRA 3ZDZF 4LHUA 2E7LA 3P4NA 3ZTNH 1YMHA 4GYBA 3VFSA 1RY7B 2DH3A 5KSAC 5F88A 2G3XA 4OLXL 5C0ND 4Z1PA 5JUEH 4OI9A 1Y7VA 2ZXBA 3VI3A 2ETWA 1J1PL 3H56A 1NGZB 1S5IL 2X40A 3GSNL 4EIBA 2ZCKL 5IGXL 2HT3D 1SY6A 4JKMA 4EDWL 3MKKA 3MLUH 1LJMA 1IEHA 2ZX8A 4ZODA 4UTBA 2WQUA 2QQKH 5AW6B 4HEPG 4IEFB 4MNGB 4IJTA 2BO0A 1H6FA 2UV3A 1DJIA 3V0FA 3EZJB 1A1MB 4D0DB 4LIQH 3PS6A 5ICUA 3A23A 5CLTA 4LEOB 4NBYB 4ALAC 4QKTA 4UM9D 4NKMA 4A2MA 5IT2H 4PJIA 1XD0A 2MPVA 4GQPH 5DMGD 2WKGA 2FBOJ 1W0YT 5CEZL 3P2DA 5CP3A 4E9QA 1IGTB 3IDMB 3KBPA 4ZUTB 4Z3HA 1N4XH 1J12A 3CFKB 4YGVA 1WCBA 1RUML 4KNSA 5CUSH 1X5KA 1N8ZA 5IHHA 5I2IB 1HSBA 4YS4A 5IJDC 4DP6X 1I9EA 1E6OL 1MQKH 4Y19A 1L9RA 1OCOB 5D4HA 5GGQL 3T0EB 3L3DA 3TWCH 3MBEA 1I1CA 4AJ0A 3FONA 5JTWA 5D1ZI 4DEPB 4GI8A 2HTKC 1F3DH 3EJSA 3GKWH 3V5KA 4NZUH 1SMDA 3U82B 3N1GC 3OLIA 3D34A 4GIPD 1OZTG 5I0ZA 2ENPA 4ZUVA 5LCVA 1V54B 3RUGA 1ID5I 1BVNP 3GMNB 1INQA 1GPOL 3QRFM 1HSAA 2CIKB 4WHYH 3SCMB