2VCOA

Crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Intervening with Urinary Tract Infections Using Anti-Adhesives Based on the Crystal Structure of the Fimh-Oligomannose-3 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2vcoA00
4ATTA 4XOBA 3SQBB 4AV5A 1PDKB 3ZL2A 4AV0A 4AUUA 3ZPDA 2JTYA 1QUNB 4AUYA 4CSTA 4XO8A 4X5PA 1KLFB 4AUJA 5IQOA 4XOAA 2WMPB 5CGBA 5FS5A 2VCOA 4AVJA 4BUQA 4LOVA 2JMRA 4J3OG 5F3FA 5AB1A 4J3OH 4AV4A 5F2FA 1TR7A 4J3OF 2J2ZB 2XG5B 4AVHA 5LNGA 4XODA 3MCYA 5FWRA 5IQMA 3JWNG 3JWNH 1ZE3H 4AVKA 4AVIA 2W07B 4XOCA 5AAPA 5FLUA 1UWFA 4CSSA 2UY7B 5IQNA 5FX3A 3BWUF 5LNEA 4XO9A 1N12A 3JWNE 4X5RA 3BFQG 3BFWA 2XG4B 4X5QA 3ME0B 5ABZA 5JQIB 4X50A 4XOEA 1N0LB 4CA4A 1KIUB 5AALA 3RFZA 3ZL1A 2UY6B
chains in the Genus database with same CATH superfamily
1EZVY 5HHMD 3TL5A 4UAHA 5ANMB 3ERXA 1YECH 3VGAB 3WS3A 4XNAA 3PABA 3LEYL 1NLDH 3D09A 3CHOA 1JN6B 4XR8C 4YSTA 3FCSB 3L81A 4WU7B 3TZVC 1OO2A 3SDCC 1KEGH 4M1CC 4POYA 2VLRE 2XZCL 3P3UA 5CUSH 2VDNH 4GYBA 1E27B 1V3JA 1F3JA 1MAKA 5E0QA 4FXTA 4L4TD 2P47B 5F9WB 2DWYA 2X5PA 3QIUB 3RX9A 4BFKA 3NCJH 5L8JB 5CFAA 4M02A 3JUZA 2BP8A 1I7RA 5HJBA 2P44B 3QFJB 4KHTH 5J06A 5J6HB 1UFUA 2NUPA 4RIRA 3V6OC 4DEWA 4HMCA 2EDFA 4DKDC 2WVVA 3MLUL 3QJVB 2EXTA 4YFLF 5FHAH 4LDCA 5DUMH 2ICWI 3RKDC 3R18A 1MAJA 4AG4L 1CFVH 1U58B 4XWGH 4YGAB 2GITA 1A6WL 2WXPA 4FTVA 1IC4L 4NQEA 3VRIB 2VQ1B 2UYLA 1RP8A 1IFHH 1OLLA 2OFQA 3GLEA 3UROR 4HS6A 4DGIH 3FT2A 4JFFD 1C12A 1OWWA 1IV8A 1P4LA 3FW6A 3MNVB 4EQ2A 1T6VN 4PJGA 3KW8A 1QLRB 1LO0L 1IKFH 5KANG 5CP3A 1SBSL 3MA9L 5DU7A 4DOHB 4FFWC 5HHPA 3HG2A 3VXQB 2C9XA 4AQ8C 1XF2B 4XMPL 5IWLA 3PWJA 2DQUL 2XWTB 3H9YA 5J6SA 1RPKA 2NNRA 4P3DB 4Q4EA 5SWZE 3L5XH 1JV5A 1IO4C 1QRNE 4JGUA 4FLSA 3UACA 3TEZA 3GIVB 1A6UL 3BP5A 3C6LB 2J6WA 2LFGA 3DARA 4ZNCD 3V0FA 4CKQA 4MAYC 1TZIB 1YPZF 1EEYB 3ARGC 1H0DB 3CVHB 2HX7A 1DL7L 3MRJA 4F1SA 5INDB 4AKOA 3Q2NA 5C0IB 3KPQB 4TNWK 4XCNB 2EYTA 5E5RB 1XGTB 3LRSA 4WEUD 4CJ0A 1UT9A 4RFOH 1LEKB 1S78C 2YK1H 1KB5B 3F00A 1Y07A 3WS3B 3VXOB 5CKAA 2X4NA 2Q1EA 3PABB 4FKHA 4URKA 4ZFGL 5AYQA 3WIIL 2Q76A 3E8VA 2OW7A 3QIWA 3LEYH 4OZHA 4WW2C 1F3JB 2PYFA 4FFVD 5EIIG 3QJXA 2XZCH 1I8AA 3O6FC 3UPRA 4M62L 1DJWA 3DX1A 4X6DF 2BP8B 1CDUA 3FFCA 4DP9X 1I7RB 3P2DA 3HMWL 3U9PL 2PETA 1JS4A 5FCUL 1QFUH 2NUPB 4RIRB 2VL5A 3QORC 2B1HL 5F9DC 1CFSA 2WVVB 5IHBA 3TFKC 5AW2B 2MMXA 3IGKA 3HBQA 1K5WA 5CGMA 1HAUA 3MLUH 2FB4H 3KLAA 4LOFA 4N22A 5CCGE 4L4VA 3OR7A 4NPJA 4KKLD 3PU7A 3P11L 2J1XA 4PV8A 4AG4H 4PJ7F 4FTVB 1UTDA 4NQEB 3TF4A 3LKOA 1BF5A 2UYLB 3T8MA 1MCEA 4GP5B 1IC4H 3H55A 3JWNC 4HS6B 1LHZA 5T1MA 1C12B 3D8MA 2FO4A 2EDQA 5TD4A 4FAAB 2YEVB 3BXNA 4PJGB 5HGAA 3B9KC 1UWGL 4BA0A 2YAQA 5JIHA 1GS8A 4QRRE 3S4SA 5CFHA 5HHPB 3M6DA 2QQLL 3QCVL 2NTSP 1LO0H 1I9JL 2K3HA 3RNKA 4ZW3A 3GUTA 1SBSH 3MA9H 3PWJB 4LAJH 3VQLA 3ZVVA 2HMID 5KYWA 3VM5A 5JQHC 5DJ8A 1G9EA 1BXAA 4XMPH 1JV5B 2DQUH 3VXMB 3SKJL 2CIIA 3AUVA 3BP5B 3QSKB 1B3JA 5IR1B 3GLDA 4WU5A 2CXKA 2OZNA 1A6UH 1BG1A 3WXVL 5I15L 3BUIA 5LGHL 2EXWD 3TEUA 3SCMA 2DI8A 4LP5A 1L3WA 4R5XA 1S9WA 1L4IA 3MRJB 2QMKA 2OPCA 5JW5A 3NIFB 4XN7A 4NPYB 5JIIA 3LRSB 3UBHA 1BMZA 1DL7H 4OQTL 3ARUA 5D7JD 1B0WA 3SJVD 3HS9A 2X4NB 5AW6B 4FD0A 4MS8C 5F6HI 3RWFA 5LDUA 3M7OA 5AW4B 2Q76B 3QIWB 4OZHB 3VMPA 1SBBA 4HIIA 3LZOA 4PD4J 4ZFGH 5GGRY 3AS2A 2FJFA 2PYFB 3WIIH 4EQ3A 1IGTA 3UPRB 1F18A 5EBLA 2DQFA 2LV4A 1CDHA 3FQ2A 4K3HA 1V27A 3NJKA 5C09E 5IG7A 2WQWA 2DH3A 3DO7A 1OARL 4UINL 1NBCA 3FFCB 4OBRA 4M62H 3CFNA 5MHSE 5I16A 1UOLA 1PQZA 3PY9A 2H1PL 2VL5B 1AIZA 3HMWH 3TX4A 2OYPA 3U9PH 1MFCL 4XMUA 5FCUH 2YAMA 2Y1VA 2H32A 5A1AA 2B1HH 3GZOA 5CAYB 2DMHA 2V3FA 2DIBA 3KLAB 4L4VB 3OR7B 1RUKL 5I23A 4PV8B 1DVXA 1TQBC 2K3TA 3CHSA 2PWFA 3P11H 5TE4L 3LKOB 5EU4A 4BGDA 2NZ9D 2VDKB 2EYSA 1TYRA 4JDVA 2DIJA 4WFEE 2A9BA 4AYBA 5C9KA 2PP9A 4HWBA 4YSOA 4U31A 5F1NA 5T1MB 2BH0A 1BPVA 1SHSA 4RGNC 2AJUL 2FO4B 2JLLA 2H6PA 2KLSA 4P59L 2N7SA 4JFYB 1D6VL 2A0LD 3BXNB 4W4OC 4WW2F 5HGAB 4AVJA 4C8XA 4CGUB 5AOMA 5JHBA 2F8VA 4D3CL 1KXHA 1YPZA 1Z9SA 3E2HC 5GGSY 3S4SB 3SQOL 1BYNA 2BXZA 1UWGH 3FB6A 2CDFA 3VI3A 2NDFA 3RNKB 2WHVA 2WXKA 2UZPA 3CFKA 2QQLH 5KYWB 1I9JH 5DJ8B 4UT6A 5F1KC 3N9GL 3ZZLA 3RU8L 2CIIB 4PJ8A 2H6UA 3MO1A 3VVWA 4WU5B 1MI5D 3SKJH 1A6ZA 5I1HL 3IMWA 1RSFA 5T8IA 5CEZD 4N85A 3SCMB 5IJCC 3RHWF 5BMFL 1EBPA 3WXVH 5I15H 5LGHH 1PPIA 1SXSA 1S9WB 3I6KA 4GMTL 4QGTA 3T77A 4W9HC 1QKZL 1IJ9A 5JW5B 1WFJA 4X6DA 5FYJD 3OMZA 3MCG1 2XN2A 3ILEA 2F9BT 5IMKA 4OQTH 1AP2A 5I0VA 3RWFB 3ABKB 3HPJB 1TZAA 2YS4A 5AZUA 3GXIA 1G43A 3CN2A 2GW5A 3W11D 4HIIB 3CXHK 3O4OB 2I25N 1P6AB 2GTZA 2FJFB 1R46A 3QUZC 1BAGA 1CD8A 1GH7A 1AO7E 1IGTB 5E4EB 5EBLB 2DQFB 4YWGL 2NXYB 1MZYA 5IG7B 3DO7B 1NBVL 5HYEA 2NNXA 2Z9TA 5I16B 1PQZB 1FN4A 4WIQA 4Y2LA 1OARH 3JVGC 4UINH 2ESVA 5E51A 3MLWL 4QHNA 5IUCA 4TUOA 5TGBA 3SDCA 2C4FT 2H1PH 3C2AL 4EUPH 1MFCH 2GJ6B 2UY6A 3D12B 1QQDA 1XIWC 4JGMA 1SN5A 4LESA 5F7UA 4FKKA 4ODWA 4NI6A 3W0WA 2MPVA 3T2PA 3OLDA 2APFA 4RRPG 4QWWC 4GT0A 1RUKH 1HNYA 1G0YR 5EU4B 1BZ9A 1E5YA 1CXKA 2EYSB 4JDVB 3W39A 4PWJA 1XBRA 1CD9B 5HJDA 2CCWA 5TE4H 2WIMA 5F1NB 3DPBA 2X4UA 1JWSA 5D1ZC 3LZQA 1VEOA 2H6PB 3M1BA 1GYUA 3P2BA 4HSQA 4TUKL 1ETJA 3A6BL 5CN3A 2AJUH 5D1XC 4P59H 1YPZB 1Z9SB 2DWEA 2WWKO 1D6VH 3S3PA 4KZEL 1LVEA 1L9QA 3ZUNC 3FB6B 1AHWC 2CDFB 4D3CH 5IJDC 3FBQA 3FUFA 4N24A 3SQOH 4X9GA 2OMZA 3CFKB 3KE0A 5BQ7A 5JPNC 1JPFB 2AQRA 4W9DC 4HK3N 1CG9A 3IDYC 2DAVA 4NERA 3FB8A 1ERNA 3FUIA 4PJ8B 2ISDA 3RJDA 2XN0A 3MO1B 3N9GH 3QJQB 1TXKA 3RU8H 3DXAE 1A6ZB 2DWXA 2J21A 3BP6A 2HT2D 5H37A 2A1WL 2LVEA 5I1HH 4FADA 1ET8A 2XVBA 3BQUA 3QDMA 1U2HA 3CIQA 3JBG7 3VFVA 3I6KB 4AQ8A 5E95B 5IJBC 3T77B 3KDMA 5BMFH 5JA9A 1MFMA 2DN7A 3QDGE 3QJSB 3WGVB 4P57A 4X6DB 4OD1L 5C7ZA 5E1IA 4GMTH 3VQ1C 3TO2A 2WWKT 1QKZH 1WK0A 4FLRA 1SDYA 4Y8AA 2I9TA 4L1SA 5IMKB 1OPGL 1NPJA 2J8OA 1P7BA 1AP2B 5BNXD 1JZEA 1MHEA 4MNGE 3T4AC 4ELMF 2B3RA 4U4BA 1UWFA 4HHWA 4YDVA 3Q44A 3ARGA 1BZQK 4K9JA 3BVVA 4NJ9L 1SEQL 2GTZB 4J3OD 3VXUA 3DJ9A 5C92A 2UZYA 2RCSL 2WYZA 3K6NA 1BMWA 2P28B 1W80A 3DMMA 4PJ7B 4QMEA 2ZUSA 4YWGH 2ZICA 4FLQA 3DPDA 1FN4B 1NBVH 3ZRSA 2ESVB 1MCQA 3JVFC 1TQVA 4QHNB 3S0PA 2JXMA 3TZVB 4TUOB 5TGBB 5DA0B 3SDCB 4WW2A 4YXLL 2O1AA 3EADA 3MLWH 2UY6B 3PAUA 3JSSA 5AW7B 1QASA 3C2AH 2R2EA 3O6FA 5AW5B 3W0WB 1U3NA 1UA3A 4ZMAT 1T20A 3BAEL 3N5AA 3EJQA 1BZ9B 4HV8A 3KM2A 4XI5D 5GSRA 4A2FA 3QYNA 3W39B 5I30L 3SSGA 2XTJD 2QPDB 3DPBB 5CXPA 2X4UB 1JWSB 4PP2A 4BWTA 2DQCL 4CKVX 5DEZA 3M1BB 3Q06A 5ERWA 4L3ED 2DWEB 3WTVA 1XH0A 4TUKH 3A6BH 4JN2A 4G42A 2GVYA 4JCWA 4UDUA 4BQ8A 4G8IA 4OCYL 2PXYD 3RTQD 2OMZB 5BQ7B 4KZEH 2J56A 1FRGL 2YPVL 2EKSA 3A6OA 5HI5D 3VG9C 1F11A 2VITA 3FTSA 1CG9B 1Q9LA 4L1TA 3RIAF 3D3VD 3ARSA 5F7KC 2V2WA 1ZGLP 3FB8B 4QYAA 3W81A 3ARBD 2NY3D 3KPRE 4RDBA 3SYCA 4YL4A 3UH8A 1D5IL 2Z1PA 4R9HA 3B9KA 3LQZA 3BP6B 3IMVA 4H44C 5G5DA 1JTOA 3ARDD 3PDOA 3AXIA 4IRZA 4ADGA 4PJEE 3VFVB 2A1WH 4Z7VF 2XA8L 3BJLA 4FFVC 1ED3A 1TKWA 2QADD 3LKNA 4P57B 3ZE0F 5B39B 3JTSA 2AITA 1L0PA 2I9TB 1SY6L 2F5BL 3KS0H 4OD1H 4N90D 3B8YA 1MHEB 1S8DA 4MAYB 1AJ7L 2WKLA 1OPGH 4YDVB 5DMGD 5T1LD 2L7UA 2K45A 3ARGB 5ILTL 3VXUB 3QIBD 4G6AC 3SYOA 2UZYB 4EI6A 2BC4A 4NJ9H 3RWGA 1SEQH 4ZW5A 4KKLC 1VENA 2RCSH 4KKAD 5IQNA 3VXTA 5J56B 4FXLA 1OHQA 1Q72L 1SEBA 3QUYD 5M7QA 1MF2L 3CFIC 3CZGA 3WY2A 1J10A 4IMLA 3MV9D 1A4KA 2JXMB 4WW2B 3B5HA 4K3JL 9CGTA 3WKQA 4BQ6A 3PWUA 2J25A 2G60L 4JO3L 4YXLH 2XXCB 4N0CD 3O6FB 2CO4A 4LHUA 4Q56A 2B59A 4KNUA 2CUAA 2GSIA 2B20A 1T83A 1EEQA 1QI4A 1XGRA 1T20B 3ABGA 2ICWJ 4PG2C 5GSRB 4HV8B 4Q14A 4IHOA 4WW1A 4KKCC 3WIFA 3CXHJ 3HJ0A 4Y9CA 2EEXA 3BAEH 4JFDB 4KXCA 4GJTB 2VDRL 3QORB 4LPVA 4UU9A 1ET7A 1X9RA 4PP2B 3QHZL 5I30H 1ACZA 5ERWB 4X5LA 5E2JA 2DQCH 3TWCL 2H41A 3MLVL 2D3LA 1SXNA 4MD4A 2OQJA 4JN2B 4G42B 4Y16A 4UDUB 2NNAA 2EXWC 1P4BL 3IN2A 1J9CT 3L9RA 4G8IB 1LK3L 4BIKA 2ZOUA 2EKSB 4D9LL 2K0RA 2Q7YA 1F11B 2VITB 1N5AA 4DK6A 1Q9LB 3A4EA 1WFNA 4OCYH 1O7SA 1UOWA 2OBGA 1FRGH 2YPVH 1BVLA 4J28A 5DJ2A 5E9DE 2V2WB 3II2A 3K8KA 2ADGA 4ZSOB 4Z7QE 1XX9C 2D2OA 2VLJE 4NM8L 1X5HA 4R7LA 3B2MA 2X4RA 4ELMA 2O6DA 4I8DA 4NGHL 3B9KB 5D7JC 1HHKA 2E6QA 1D5IH 1ZA3A 3TNNA 3ZHLA 5E56A 4WTZA 4XXWC 3IE4A 1TKWB 4WCYL 3IDIA 2AXHA 3LKNB 1ID2A 3I84A 1VFOA 3JTSB 2Y3AA 1SXZA 3ELAT 4Y2OA 3SB3A 1JZGA 2ZAGA 3IPEA 1JYXA 1KGCD 2ZTBA 3ZKND 5G4OA 2JKNA 3RY5A 1E9QA 4APQD 4IQHA 2R83A 4QRAA 4G6FD 4WWPA 1S8DB 1SY6H 2F5BH 2JCCF 2OM5A 3K5RA 1ZEAL 4LEOB 1IU1A 3ZKSD 1AJ7H 1BAWA 4CADA 2NX5E 4EI6B 3UTSE 3UERA 5ILTH 3RWGB 4O51A 3C5ZA 3TNMA 4MJ6B 4AYFA 1XSIA 1ZCRA 4YDZA 3DOSA 5CS7A 3U7YL 3VXTB 2WANA 2CHDA 5DFAA 3VDCA 3RZCD 4HJJL 3B7UX 1SEBB 2D0FA 1NGYA 5E6YA 1Q72H 1L0XA 4UTCA 4LLDA 2NZ9C 1MF2H 4IMLB 1A4KB 1HZHL 3QEUA 1S9YA 5EU6D 4XBMA 3CZNA 5E8OA 3D85A 3PWUB 1PAMA 4HF5L 5JHDA 4MZRA 3QA3A 4K3JH 2DM7A 3CBJB 3KLLA 4YGVA 2L04A 4LHUB 2B59B 4NQDD 2CLZA 2G60H 2GSIB 4JO3H 4OFDA 4B95C 2JSFA 3PYCA 1XGRB 2MQGA 1OE1A 3T2NL 5CIPB 5FHBL 1AD0A 1G9NC 5ECGA 4IHOB 4OH2A 4M7JL 2G2NA 2IQ9L 2KQNA 3AU0A 4WW1B 2G5RA 3JVGA 4OLZL 2OR8A 3PHSA 1UASA 4LSTL 1RHFA 3Q13A 4N4YB 2VT0A 4JPWL 2VDRH 3WEMA 3QHZH 4NKDA 2MQCA 5CWSA 5KUMA 4JDTL 3VYOA 4KJYA 2O5ZL 5DJDA 5T5NG 5HJGA 4MD4B 2AXJA 4Y16B 5C08E 3TWCH 2NNAB 3MLVH 1ANUA 1I7TA 3L9RB 4Z7VA 3BN9D 2VZOA 4FGMA 2Q7YB 3S3JA 2ED6A 1N5AB 1P4BH 1LK3H 4N2CA 1OP4A 1BVLB 3HI6L 3GXUB 3QBTB 5DJ2B 2IAND 4D9LH 2ADGB 2WYHA 4RGNB 5HVWA 2FNWA 1KSRA 1IAIM 1R6VA 4ELMB 2X4RB 3I02A 4AEHL 5D1XA 3LNDA 2C9PA 4AGPA 1HHKB 4FFYL 1EZSA 4NM8H 1RVFL 2CMRL 1ZA3B 2Y7SA 2A6KA 4NGHH 3D9AL 5T5FL 3TNNB 3I6LD 4UT7L 3L4TA 1F4YL 2I85A 2X6AA 3CZSA 3IDIB 1UVQA 1OAZL 1KBVA 4Y2OB 4WCYH 5E70A 4PJCF 3HS8A 3ARWA 4ECNA 4GIAA 4I9WD 4AV4A 5HHQA 2EIKB 4CADB 1ZEAH 4M8UA 4HUVA 5AVYB 1DUYB 3C5ZB 2V5RA 4O51B 3TNMB 1W72L 4AYFB 5F6HJ 4L4TA 3DOSB 4OZFA 1K8IA 4LSVL 2DTML 1SJVA 3U7YH 1X5YA 2CO2A 4HJJH 3BGFC 1BZ8A 1IGJA 1P7QD 1YN6A 1OOWA 1S9YB 3QEUB 3VFUA 3JV4A 3WU1A 3TT3L 1A7OL 5KVGL 2X4PA 5JHDB 1HZHH 2DWDA 4L3FA 3QUZB 3QA3B 4XMVA 3IVKA 4HF5H 4YGVB 4V1DA 2CLZB 4J1UA 1ZIBA 1EHNA 1BQ5A 2GT9B 1AD0B 1XCXA 2GEEA 3DNKA 3LRMA 4FEMA 4G7RB 3ZTNL 3T2NH 1BJ1H 3QDHA 5FHBH 1QSED 5M94B 3VNZA 4M7JH 2IADA 2IQ9H 2CNYA 3P02A 3DVGA 4OLZH 4JFFA 4WKZA 2DJSA 4XOEA 3A4AA 1YCSA 1FNEA 4LSTH 4NKDB 5CWSB 3SE3A 2VRAA 2WTPA 5C1MB 2EUZA 2XXFA 1XIWB 1QSFE 4JPWH 4KJYB 5DJDB 2GUOA 1UD5A 3NRQA 4QHLA 4RVBA 4JDTH 4AGMA 3MNDA 2HT2C 1I7TB 3N40F 3RY4A 2O5ZH 4Z7VB 4OJYA 4XO5A 1ACYL 4GKZA 4IW4C 3MGAA 1HKLL 5AAWC 2VKWA 3ZE0B 2X2JA 4QRPD 1BDYA 1U8QA 5IJKA 4AYSA 5D1ZB 3H42L 3HI6H 3P9LA 3T1WA 5TQ2L 5TF0A 3R8QA 1JZ3A 2ZOLA 3I02B 1E8ZA 5D1XB 3FUDA 2DKSA 2PO6D 1E4JA 2A6KB 1WHPA 4AEHH 5L2JA 1AHWB 4QNPE 1CTOA 3BPOC 4KQ3L 2AQNA 4FFYH 1RVFH 2CMRH 1E90A 1MFVA 3BW9A 4J3OC 3HAEA 3D9AH 5T5FH 1HOEA 4BFGA 3IDYB 1U8HA 1Q4NX 2YXVA 1UVQB 1VSCA 4DFHA 4GG6F 5HYQA 4UT7H 1F4YH 3UDWC 4CGTA 4ODUA 1OAZH 1ADWA 3QUHA 2VLRD 5HHMB 2YKLL 2Z7UA 4NAQA 1BREA 1U93A 2F15A 4G6KL 5DC0A 4W81A 2NMSA 2VKXA 3INOA 2E75C 1ZJAA 2R1YA 4O58L 5K5YA 3LNIA 4LU5L 1EH9A 2OMWA 3D48R 3SE8L 4L4TB 1IGIL 3EGSA 1UJ3C 4G11A 4OZFB 4U1SA 2XUWA 4R7DA 1QRKA 4G43A 1K8IB 4WJG3 1W72H 5JOPE 2YD0A 5D4QA 4Z8FL 4U6VL 1MCJA 4MA3A 3FSVA 4DERA 1ORSA 4LSVH 5EULV 2DTMH 1OF0A 4XI5C 1IGJB 3KR3L 3WKYA 4N2EA 4QPEA 4Y1AE 5CJQL 3N1GC 1CCZA 3JV4B 3BD5A 2XTJC 1EAOA 5AL0A 3U25A 2UXVA 2X4PB 4JL1A 2DWDB 4KDTC 5DQDL 2C7FA 1EZVX 2CQVA 3TT3H 3MCYA 1ITCA 1A7OH 4U1IA 5KVGH 3IVKB 3C75A 4OCSL 3HRZC 4LP4A 1G1CA 1JI2A 4J1UB 3U6RA 4ETQA 2FQGA 1N8ZA 4Z7OF 2PXYC 3RTQC 4PCSA 1VADA 5HI5C 3KWWA 2NY7L 4MX7A 5FO9A 3ZTNH 2J71A 2IADB 3DVGB 3OB0K 4JFFB 4WKZB 3ARBC 3ZZSA 1FNEB 4HJ0D 5I0YA 1SOKA 3NIDF 2X2YA 2GUOB 4Q9RL 2ED8A 2CGYA 4QHLB 1HE8A 5SWZD 2BOBA 3WFZA 1QRND 1BX2A 4GKZB 3PWPE 4PG2A 5LG1A 2JELL 4PQXA 3FHAA 3OKYA 4X98A 1ACYH 1HKLH 1U8QB 2QADC 4HFUL 1PY9A 3A23A 2BNQE 4I13B 1FVDA 1P1VA 1A4CA 2ID5A 6CGTA 2ZOLB 3SGEI 2JCCB 3H42H 4OFVA 1H6TA 1E9OA 5TQ2H 4XP4L 4D0CA 2O5XL 3HKZA 1XMEB 1M3JA 5L2JB 3LRGA 1QPKA 4F2FA 3LJ3A 3BW9B 3VG9B 3WKPA 4C56E 3QIBC 3HC2A 4KQ3H 5HYQB 5KVEE 1G84A 3A5VA 4N2BA 1KCBA 3AQDA 4ODUB 5KYNA 3IDXL 2CO3A 4KKAC 3QZMA 4OQTA 3QZLA 1BMGA 2AQTA 3QUYC 2KZ1B 3ASOB 1U93B 5D7JA 2NW2A 2GPZA 3SGKA 5IROD 2YKLH 4NLAA 1YG9A 4G6KH 2R1YB 2OMWB 3OHMB 3B7SA 1V7NL 4O58H 2VZ3A 2ATPB 3EGSB 4U1SB 4ICXA 4LU5H 4R7DB 4G43B 3SE8H 4M29A 2V37A 1IGIH 4MA3B 4NC1C 4MLSA 1COBA 1ORSB 1Z3RA 2N1KA 5KYUA 3ATFA 1FG2A 3RL2A 4Z8FH 4U6VH 3MRRA 3II1A 2HPTA 4KFZC 4YS4A 3KR3H 3TPKA 1EVTC 1DP0A 2GHWB 3QEGL 2BY2A 5CJQH 3K72A 1HEJC 3RGVA 4NQUA 4Q8BA 5E1AA 4U1IB 2FBOJ 4J3OF 5DQDH 5C2UB 4XN5A 2VO5A 5INCA 3U6RB 4ETQB 4L9DA 1XGYL 2OZ4L 2BY3A 4OI8A 1N8ZB 4OCSH 5IVOA 1GJIA 3UP1A 4X9HA 1VADB 1FIGL 1J5HA 2E7LC 1U0QA 3FO1B 4XZUA 2MCAA 3KWWB 1GVIA 5F7AA 4B6ZA 4MX7B 3FTYA 1QOKA 2X41A 3T0WA 3WE6A 4W9CC 4BBWA 4QRRD 2NY7H 1RV6X 4L8CB 4YIQA 3ECQA 3CUPA 2L3BA 2ZX7A 1SLUA 4ZOAA 3EJPA 1D7DA 1CDCA 2HSIA 4BUGA 2D73A 3LS4L 4Q9RH 2Q86A 3C12A 1BX2B 1GOFA 1MY5A 1UACL 4EEEA 1FE8L 4NKIL 1W8OA 4OZGF 4U1NA 4X98B 4GG6A 1WAAE 4LMQI 3TJEL 3NP4A 1FCCA 4NIKB 3WFHA 2JELH 1VACA 4XMKL 3IMTA 1MQKL 1FVDB 4HFUH 4OY9A 3ZKNC 3CFJA 1E9OB 3BAYA 3QXUA 4APQC 1MI5A 4OW6A 3JYCA 2EZ0D 4D0CB 2C9RA 3MYJA 3U36B 3ZYIA 1PX8A 1BOGA 1FFOA 4MGXA 4DN3L 1S9XA 3AXLB 4XP4H 2O5XH 5L9DL 1IAKB 2VM4A 2KDYA 4W9IC 5HYSA 5EEZA 4QRFA 3UAAA 1NDTA 4GEIA 3VWKC 2QDVA 2Q8AL 3HCVA 2VRQA 4I3GA 3PAVA 4GI9A 3IDXH 5D7JB 1MJJA 4ZXBD 4OIAA 3SJVB 2NW2B 1WIPA 1O7DC 1UM6L 4LNVA 5TFSL 1ZV9A 4P05A 5C09D 4U7SA 3RJQB 4A2GA 2GAZB 1G9ML 3SGDI 3Q7JA 1X6NA 2HXAA 5MHSD 5FGRA 3NEOA 1V7NH 3DDFA 5A2CA 4H26A 5KYUB 3TN0D 1JGUL 4YO0A 3RL2B 6TAAA 3UMTA 3MRRB 3MRCB 2ZQKA 2HG0A 1OCRB 4KK6C 3FQNA 4ISVA 4XX1G 5AVUB 4HPYL 3VFRA 3BZEA 4JO1L 1IKOP 1RUPL 4JUTA 4PRIE 5E8NA 4X8CA 3K72B 1RIHL 3QEGH 4BCYA 4WO4C 5INCB 4XVUD 2VERA 4QHUA 4TL5A 2OZ4H 4K73A 1T80A 1F1GA 3VD0A 3WNIA 5G55A 3WE6B 1FIGH 1CDYA 5JW3L 2DL9A 2QZQA 4KITB 3C5JB 1AY1L 4XN8A 2R0LL 1NUGA 4YIQB 3LN4A 1ZLEA 3CUPB 1OAQL 1F58L 1EO8L 1SQ2N 2C3HA 2CLVA 2FEEL 4HUUA 4MJ4A 1E3FA 2M8XA 3KWVA 4JMXA 2Q86B 2MWCA 4OZIF 1OT1A 1A7BA 4PJDE 5I6KA 3LS4H 1DBJL 4U1NB 4GG6B 4H0HB 5AENA 1UACH 1N70A 4JAMA 1FDLL 1FE8H 3FCBA 4NKIH 4FI6A 3PIQA 4NSKA 2DQDL 3WFHB 4BSWA 5F44A 3BKJL 3TJEH 4YHOL 4OBSA 4XMKH 1MCKA 1MQKH 1MI5B 4JFPA 3MYJB 5C9JA 3LPFA 1FFOB 3NSDA 4QRBA 4R3SA 1S9XB 3EYFA 3B3IA 1OP3K 1ZY9A 2FJHA 4NZDA 1BJMA 5HYSB 3NJLA 4DN3H 4LLVA 2XG4A 5IMLA 1UZGA 3BH8B 3NJXA 5L9DH 5FV1L 1KZQA 1TIUA 4M6OL 4JHAL 3HCVB 3DRQA 3GWJA 4DKTA 2Q8AH 2YHGA 5SV3A 1NC4D 1MJJB 3C6SA 5AW0B 1JXFA 3WTTA 4JFZL 2ZYIA 1AO7D 5FR3A 3QQNA 3Q1SL 4WFGE 5FV2A 2PUQT 1RUAL 2Y5TA 1PTZA 1F2XK 1IBHA 1UM6H 2XC8A 5TFSH 5BUAA 3AS3A 1ZVYA 3FK3A 2ZXWB 1MRDL 2NT1A 2PF6A 3UDWA 1G9MH 5ALBL 4Z7OB 2WW8A 1D5MA 3A22A 3ILQD 3OLGA 5LG6A 2HJLB 4HJGB 4H26B 4I0KA 1FNLA 3D5OF 4MXWL 4MKTA 4FE9A 1ASPA 4HLZH 4YO0B 4AGLA 4KRMB 3S48A 4TSCL 4QJ5B 4LPTA 3FQNB 3L3IA 1JGUH 4H2CA 4ISVB 4H8HA 3VFRB 3BZEB 5ETUA 2A6IA 1PG7W 4LMQE 4HPYH 1GMEA 2JB6A 3NIDB 4JO1H 1RUPH 4KH9A 4UQ3A 3FFOA 1E0OB 3BHBA 3WKML 4BWUA 1AGCA 1UJ3A 3Q3GA 2E9JA 1RIHH 3BVUA 2VCOA 3G9VA 4PJIE 5HJ3A 1NIBA 4Z18A 2NUTA 1GYVA 4LGRB 5C0AE 4Y4FC 1Q0YL 5L2KE 3BGFB 3VSUA 2VRKA 3AW5A 5GZOD 5D8JL 4XNMB 2ZX5A 3FQWA 1OGAE 3L7EA 1AQMA 2YGQA 1J18A 1Y18A 3S88L 1UT2A 1QBML 1A2YA 3HS0C 5GIRA 2WLLA 2WB7A 4KDTA 4CMMA 4JJOA 3LN4B 5JW3H 4B0MM 5EUKA 5IW6A 1JGDA 3WTSA 4L3EA 1AY1H 2R0LH 4IKNA 3KYOA 3RDJA 3HRZA 1NJ9B 1G7PA 4HUUB 5DJ0A 2DM3A 2YD8A 2PO6C 1V10A 1OAQH 1F58H 2AP2A 1EO8H 3T3MF 5CD5C 3LKRA 1FQ9C 3ML8A 2PXYA 3RTQA 2IH1A 1ROWA 4ANUA 1N19A 4JAMB 3D3VA 1B0RA 1DBJH 3PIQB 4NNPL 1SXAA 4NSKB 4BSWB 1FDLH 2C9AA 3O6LL 3ARBA 1F2QA 4ODXA 4EN2A 2VOTA 2QQKL 2DQDH 3RX8A 4RAUA 2ITEA 3BKJH 3NGBC 4H25A 4JFPB 4WRLA 3RWCB 4YHOH 5BV7C 5C9JB 4R3SB 4XNYL 4Y1TA 1U8KA 3QDGD 1T0NA 3EYFB 5KSAD 5JXEA 2VR3A 3B3IB 2FJHB 4ZUVA 3FF7A 3ARDA 2DYPD 3CVCA 3LVTA 4LLVB 2XG4B 3RVTD 3QJFA 5IMLB 5KVDE 4ETYA 3FDWA 5JUEL 3TA3A 5EN3A 4YSRA 2DJUA 1CZ8L 4FNUA 3IGLA 3DRQB 4UYPA 3HZYB 3TA4D 4M6OH 4JHAH 3C6SB 3OMAB 2O5NA 4D0DA 3B5GA 2VDOB 3QO1A 5D2LF 2Y23A 1CDIA 5T1LA 4GXUM 3RUGE 3QW9A 3BEVA 3BPOB 2Y5TB 3LB6C 4JFZH 1CIDA 4ONHA 3K7UA 3TBWA 3Q1SH 4GAAA 3QIBA 1RUAH 4K5LA 3OAZH 5JDJA 3FHEA 4IKJA 4XO4A 1JPGA 1Y0LA 2E4FA 2HKHL 4HOZA 1MRDH 1D5MB 2X10A 3SDDC 4PS7A 5AOJA 5ALBH 1FYTE 4KO6A 3SY0A 3J27A 3UO1L 4UQEA 4A04A 3L3IB 4MXWH 4P46D 1RZKL 5ETUB 2A6IB 4ATWA 4TSCH 2DLIA 2X4SA 4LARL 1EXHA 1A66A 1BFOA 2HPOA 4HJ0C 3BHBB 5DRZA 1AGCB 1NCTA 1UJ3B 3LN9A 3Q3GB 4PJHF 3UXFA 5I66A 5JYMA 4QDGA 1RERA 1PX4A 5HJ3B 3WKMH 5I1KL 4OZIA 2NUTB 2BP5M 3MZGB 4IBWA 2M1KA 1JFHA 3R4DA 1ZSDA 3X2QB 2QEJA 5LGYA 35C8L 4WEBL 2VH5L 2WP3O 3FQWB 5J89A 4D7BA 2K4AA 1Q0YH 3L7EB 4M8QA 4P9HC 3RIFK 2XTJB 1Y18B 1UGNA 1BFVL 4W6WB 1A2YB 5D8JH 4F7TA 5FO7A 3MRKA 4H8QA 2CE6A 1JGDB 3S88H 1QBMH 2Q7NA 4JW3A 1U4EA 4L3EB 1LE9A 4N68A 3KYOB 4QEGA 3HRZB 1G7PB 5DJ0B 1Q1JL 5HDWA 1HXMA 4OJCA 3O3DA 2QV4A 5LN8A 1OALA 2PXYB 3KPRD 3RTQB 2IH1B 4YSCA 2WLKA 4GUOA 4C59B 2R39A 2K78A 4Q9QL 1DN0A 3HJEA 3NCEB 1TQUA 3D3VB 1B0RB 2X7LA 3ULVL 4K3EL 4OFYD 3QXDA 3S3BB 3ARBB 4ODXB 2NY3B 1VZGA 4NNPH 1X3DA 4RAUB 4OFPA 3US0A 4C4KO 4KV5E 2F61A 5TPWL 3O6LH 2YZ8A 3ZHNA 2QQKH 3MRQA 5B39G 1EGJL 1U8KB 4NQQA 1T0NB 4MZIA 5IROC 2WP3T 5E1GA 3VTMA 5BW7C 4ZUVB 4JHVA 3ARDB 4XNYH 4M03A 4HGWB 1EERB 3LIZA 4P06A 3QJFB 1F3DH 2QADB 2WBWB 2HTLD 5TK4A 1CGUA 2XPGA 5JUEH 4GNKB 5E9NA 4OGQC 3LOWA 4B50A 2CXGA 1CZ8H 4TNWF 2HJKA 3S9DB 1VFAA 4J3VA 3AU1A 3GC3A 3WEAA 1JPST 4OFIA 4APQA 3HC4L 3QO1B 4D0DB 5CEXA 4P3WA 5T1LB 5FYKL 4OLXL 5GJTL 1ZAGA 4ZFOL 3TBWB 3TIDB 3IAQA 3QIBB 3BRGC 4IM8A 1E5BA 3VD5A 1SYSA 3OM3B 4NN6C 4C4KT 4G1EA 1QMUA 4K8RL 3UG5A 5BQDA 1OW0A 3RZCA 3PXLA 2HKHH 4XB7A 3QUYB 3SY0B 3Q0HA 4NB7A 1BVNT 3SODB 1QFWL 2Y6SC 3N3EA 1NUNB 3DSNA 3MV9B 3UO1H 5D93B 5EU6A 2OSWA 5H4ZA 3MPCA 3J8F7 1KWGA 3GINA 1RZKH 4B9IA 1MNNA 1BFOB 5KOVC 4LARH 5DS8A 5DRZB 5I66B 5MI0B 2VMCA 5K9OA 5FFOA 2WBJD 1JPSL 4NRXA 4UZUA 4OZIB 5DXWA 1FP5A 3PFUA 4FNRA 5HI3D 3MV8A 5CN1A 5I1KH 4BD4A 4L05A 4U4IA 1O7VA 2AXFA 2B15A 4OV5A 1Y6MR 4M8QB 35C8H 4WEBH 5IQOA 2VH5H 4GSDL 4PTTA 4F7TB 5FO7B 3CU1A 3MRKB 3UZQA 3VSQA 3HE7D 1BFVH 1LE9B 3BUQA 1HAWA 2J8HA 3CSGA 5I5JA 1JF6A 2EZ0C 5DGQA 5E9DD 1HXMB 4MQXC 3O3DB 1G7JA 3HB3D 1QBBA 3P3SA 1Q1JH 4NXKA 2AK4E 4Y4KD 2IDUA 2VLJD 1RZJC 1DN0B 1DQDL 2X7LB 3WMSA 2EEAA 2IANA 5CKGA 4Q9QH 3QXDB 2BSED 4N2NA 2SODB 2EAEA 5JPMC 4HGKC 4K3EH 3ULVH 3O4LE 5EEUA 2VDML 2WPGA 1N0XL 3MRQB 5D2LA 4ZXBC 5TPWH 4XODA 4JPQA 1JHLL 3EXJA 3WTXA 1EGJH 2CGZA 2OMXA 1FHNA 1YC8A 4FNPA 1T3FA 3MRIA 4B9FA 3DROA 2YQ2A 5B3NA 4XP9L 2YEZA 3EOTL 3CLEL 2EE6A 1PLAA 3KPMA 4IIZA 1JXGA 2XPGB 4PW3A 1T1YB 2XT1B 4CN6A 2EACA 2BIPA 2HJKB 4GSUA 4WK2B 5HDOA 2NX5D 2O6CA 1VFAB 2OR7A 3AU1B 3TN0C 3CZKA 4G6FB 1JGIA 5E7BA 3UTSD 4APQB 5CZRA 1MVUA 3MRPA 5CEXB 3AMKA 1ZT7B 3HC4H 4N5UA 2C3VA 2IAMD 5GS3A 5FYKH 5DVKA 3IXAA 1L9MA 4PJHA 3U1SL 4OLXH 5GJTH 1SYSB 4UBDD 3K5SA 4XVUC 3RZCB 2MCG1 1YDPA 4LSUL 2Z0BA 1LEGA 4OFQA 4ZMWA 4K8RH 3EO9L 4JQXC 1BG9A 2E7MA 1P7QA 5DRXA 3DSNB 1VIWA 2C3GA 5EU6B 1QFWH 2P3YA 2P5WE 3MBXL 2WD0A 5DS8B 1P9MC 3T3MB 5K9OB 2YARA 1OAYL 1Z6JT 1HS6A 1CXIA 4MYPA 4NQDB 4NRXB 3KPTA 4ZTOL 2KC0A 5HDBE 4ZQKB 3ZPDA 1JPSH 3BVNB 4XCEA 1WWCA 2A99A 1DVFA 2AXFB 3JTTA 4U0RB 1QSEA 3FTVA 3M1OA 5TDOA 2EVIA 5C08D 1UD2A 3VFSB 1E4HA 1W0WA 4BFIA 3UZQB 2VW7A 3PHAA 2A83A 1FCGA 3ALPA 3FF8A 4GSDH 1PG7X 2I7OA 3NJMA 2G3XA 1NGZB 1BHGA 2XZQL 4X4ME 2VM3A 1A3RL 1G7JB 2ZNXA 2W81C 3NAAH 5TE6L 4GUPA 3SO5A 2NQCA 1OCWL 2DV6A 3L8QA 3TCXA 1BYOA 1NEUA 3ARRA 2J5LB 4JEGB 4P99A 2CPUA 2YSTA 3S35X 4FQ2L 3I9GL 4QRPA 1ZRUA 1UB6B 2IANB 1QUPA 3HS0A 1DQDH 2D4FA 3NEXA 3DRTA 1L9PA 3DKHA 4OM1L 5ELIA 2V9RA 1J88A 3EUUA 1KBKA 3UIYA 2ZXEB 5D2LB 1R34A 4FFZA 4IRSC 1RCYA 2NW3B 2X0UA 3TXAA 2VDMH 1WP6A 4FCHA 4LEEA 3QH3A 4L29A 1N0XH 3CWGA 2QGCA 2X6MA 1Y6NR 3MRIB 1JHLH 3DROB 3CHXA 2YEZB 2P5EE 3BVWA 4KTDL 4GFXA 3CNKA 1X7SA 3MV01 4XP9H 3BD4A 4WHYH 1PJWA 3B4NA 3EOTH 3ILQC 3I75A 1TO5A 3CLEH 2PWDA 2CRMA 5EDSA 3RKPA 2YD4A 2VLRA 2ZZUT 5G2NA 1TSRA 1GSMA 1MVUB 3FYIB 3MRPB 3NQKA 5AYUL 5I19L 4JO8A 1GMIA 2BWQA 2C3VB 2VUOA 2F7RA 3QWOB 3IXAB 5DHYA 4PJHB 3MRDA 5C07E 3VXNA 1QX1A 3S3CB 4QJ3B 5A40E 2XIBA 3RX7A 3U1SH 4A2MA 1GC1L 1YDPB 3QR1A 1LEGB 1OSYA 3GO1L 4GQQA 4M3KB 3RJOA 2QHLA 2CM6A 2AJVL 2Z92A 1AYRA 4LSUH 1P7QB 5BRZE 5DRXB 5GZOC 1MG2C 5JR1L 5T3XL 3V9CA 1SN0A 3EO9H 4NZUL 2P42B 2F7QA 3KNBA 5GRJL 3OAYK 2GY5A 1MCBA 5AYTA 1F0LA 2EUVA 2JV6A 4XVOA 3SPGA 3L6FA 3MBXH 2ILLA 4OIFA 1KGYE 6PAZA 5SX5K 1NAMB 4YEFA 1A1NA 2AJZA 4ZOCA 4A37A 2QV2A 3HUJE 1OAYH 4U2YA 4XCEB 2K70A 4UMSA 3ZE2E 4ZTOH 1PEZA 3GSOA 3JTTB 4IMKC 1JV2A 2MCPL 1QSFD 2HKAA 1QSEB 1WIUA 4EIGB 5TDOB 4LLYA 5LHDA 1CXHA 3RBGA 4ALAC 3DUHA 4BFIB 2A83B 3RL1A 1XSOA 3WIHL 2E6JA 4EJ1C 1HSAA 4YXHL 4HLEA 2X4QA 1G1KA 1RSYA 4G2AA 2XVLA 4RH4A 5KSAC 1AR1D 2VN6A 4GUPB 2V3DA 4G9FA 3OX8B 1CGWA 4KZ0A 2XZQH 1QRNA 4K23L 4Z9KB 3CSPA 4B3VA 1A3RH 2JI1A 4PUBL 5TE6H 1KCUL 2YC1A 4QT5A 3RVTC 1OCWH 2VC2B 4BKTC 1NFKA 1BAFL 3NG5A 4U1GC 2QQNL 4QRPB 1RJLA 3V9FA 5F0JB 3HS0B 1J8RA 4QTIL 3SEPA 3I9GH 3BMWA 3DRTB 3DV4A 5CLYA 2GKIA 1DSWA 4GS7B 4OAWA 4OM1H 3NJVA 3DVIA 3CDYA 2PO6B 1GGBL 3QH3B 1ZWIA 4L29B 4WI5A 3ZO0A 1P2CA 3DDGA 5HDLA 1HVXA 1OB1A 2R2CA 3TV3L 5DO2D 1IILE 1JZ8A 2HLEB 4TQIA 5ESQA 3MJ7A 3STBA 1TR7A 4Y2NA 1NMAL 4PJXE 4PRDA 3MLYL 3IYLW 4KTDH 4XX1E 3VFGL 3K46A 4GH7B 4GXUN 5T1KD 1KDIA 3P4LA 2VLRB 1TG8A 3KPSA 3WN5A 3V6BR 1EHXA 4Z7UE 1T03L 4JRXA 3GLAA 5JO5A 4FQ1L 5IROA 5BW7A 4RGOL 4P46C 1OAUL 3AADB 2Y2TA 4LEBA 2FVNA 5AYUH 5FLVA 5I19H 5DHYB 1OV8A 3MRDB 3VXNB 4Z78B 4JRWA 4GW5A 4U1KA 2VW6A 3GJFK 4Y1AD 2Z35A 2QTVA 2AXWA 2YLHA 3N85L 1HWWA 4DUVA 1A4JA 4WI3A 2AJYL 3LSOA 2OCJA 1GC1H 2EIZA 2I9LA 2Z92B 1FFQA 3GO1H 1AAJA 3U4KA 2AJVH 1IARB 5JR1H 1T1ZA 3KNBB 5T3XH 4HJIA 1SGKA 3PNRB 3DX4A 4NZUH 4R6UA 2XWCA 1AOZA 5GRJH 1NLBL 3E6FA 3L6FB 3P0VL 1NDGB 3ESMA 4XE0A 3X3GL 1M7DA 2B7DT 3CFCL 1A1NB 1OZTG 2AJZB 3P9MA 4NCDA 4YPGA 5B4MD 3CAFA 4IU3A 5F71A 1TCMA 3D1MC 4KJPD 1DVTA 3GSOB 4X7DC 3BZ4A 3S36L 1JV2B 3FC8A 5D7IE 2PWEA 4ANWA 4LLYB 1Q1PA 3DX8A 2MCPH 4M6AA 4QRRA 3QZNA 5MERA 3RL1B 2HT3C 4IRJC 4ATTA 1NWPA 3PWPD 4ODHL 3NSXA 1HSAB 2X4QB 2F7PA 3FAXA 3MLZL 1RAMA 1R24A 3P3TA 3WIHH 1GSKA 3MRMA 4P2OD 4YXHH 5SWZB 4ZI8A 2BNQD 2CA3A 1QRNB 1KGWA 1RZPA 4KTGA 1TYJA 5EBGA 4QT5B 4J27A 1C1EL 4OUUB 2JJUA 4K23H 4N26A 3ARFD 4PUBH 1RJLB 1J9QA 1KCUH 2HTLC 4OSUL 4HJ1A 1U92A 1BAFH 4N8VG 2QQNH 3MRBA 4P2QE 4PCTA 1CXFA 5FYKE 3ZY7A 4QTIH 2RB8A 4C56D 5AVTB 4AUJA 2APWA 3MQIA 1U8MA 1X9QA 4S1DD 2KUTA 3RE0A 3QNFA 4WK4B 5TTRA 1P2CB 4X83A 1JG9A 2HT4D 2ICWA 5AVXB 1OB1B 1TFPA 1GGBH 2ZSVA 4UNVA 1RUQL 3LNGA 5ESQB 3V79C 2N7BA 3BKML 4HIHA 3L9EA 2YAPA 3OKDA 4TVPL 3TV3H 2Y1YA 4PRDB 1TUPA 3G5ZA 3GNML 1S6NA 4S10A 1JPTL 1NMAH 3WN5B 3MLYH 4DPBX 3VFGH 4ZXBA 4JRXB 4IBLT 2VQUA 5JO5B 1JD9A 1TNMA 4G72B 4UV4L 4HK3J 4KU1A 1M7IA 2WC7A 1T03H 1FC1A 5C09A 1IC7L 4FQ1H 2YBGA 4RGOH 1OAUH 3B2PA 4TKWA 1I1AD 1SZNA 2PYEE 1R75A 4K5MA 3FO0L 4GW5B 4U1KB 3OR6A 1NUFA 4QTHA 1VZHA 2Z35B 3JXAA 4N0UE 2WBJC 4OD3L 2NXZD 1A4JB 3DYOA 4AWJC 4ENED 4ELKA 3LSOB 2VJ8A 2LU7A 1R19A 2EIZB 2I9LB 4KO9A 5HI3C 3TN0A 1JBJA 3N85H 1FI8C 3D69A 2AJYH 2E9WA 2O5YL 1T1ZB 3WMQA 1QSZA 1KN4L 2QT6A 3HE7C 5IQ9A 1A8ZA 4NN6B 4NC0B 2ZWLT 3E6FB 4NLHA 3I85A 5GZNA 2PCYA 1M7DB 1ZDQA 1NLBH 3D52A 3P9MB 4QO1A 4YPGB 3HB3C 3P0VH 5GS2D 4IU3B 4TL4A 1KN2L 1J8HE 2UWEE 3CFCH 4Y4KC 3SE4A 3BZ4B 3X3GH 2I69A 2F6AA 2W0KA 1OEZW 3S36H 1OAJA 3AUWB 3DX8B 4QRRB 5MERB 4M1DL 4EDXA 4OD2A 3VYNA 32C2A 2GI0A 1T1XA 4HC1L 1LWJA 2W1NA 4PTUA 3MROA 5E99L 1R24B 4ODHH 3MRMB 4BJLA 3K74B 4JFXA 3MLZH 1BVZA 2VR4A 5E4IA 3QJUB 4JFTA 3GPEA 3LNEA 4CVWA 43CAA 4FG2A 3BCDA 1BWWA 5F0MB 2CKBL 1XGQA 3CDGA 2JK5A 1LEIA 4DCQA 1MZZA 5DK2A 1C1EH 4PWEA 4AUUA 2P4AB 2E76C 3E6HB 3MRBB 4YSDA 3U79A 4OSUH 1HDMA 3G5YA 3ZJAA 4E9WA 1MQ8A 3HE6A 3ILDA 1U8MB 3RVUD 1AG6A 1FAIL 5BVPL 3H3KA 4L4JA 1Z32X 2ICWB 1DDTA 3ZKMC 2Q2EB 2F8OA 2IAMC 2VGLM 4OF3A 1Q38A 2ZSVB 4B9YA 4ENZA 2OMUA 4A7TA 5I74C 2H2PD 1CS6A 4HIHB 3OKDB 4BFOA 4NO0D 1U8OA 4IOFD 4UBDC 1R9FA 1RUQH 2EH8L 3G5ZB 1CT8A 5IB2A 5JPMB 5IGXL 3BKMH 4TVPH 2DQTL 4DP2X 2WXNA 3QPXL 4Q97A 1QATA 3FRPB 3GNMH 4OVUA 4ZXBB 3UBXG 1JPTH 4PJEF 5C3LD 4ODTL 4WUUA 1AO7A 1M7IB 2WO4A 5JMOC 1NFDE 3FKUS 3T2LA 4H8PA 4UV4H 5C09B 1A7RL 4V2BA 1SF3A 1IC7H 1ETZA 2WNXA 2Z1KA 3OR6B 1H15A 1I8KA 1YEJL 4QTHB 5E5LA 4YK4C 3ZSTA 3FO0H 3HBPA 3QNZB 4ELKB 3FU8A 4JY5L 4PRID 1KOAA 3TN0B 5HHNA 4U6YA 2OJ1A 2A38A 2B1OA 3D69B 4OD3H 2FDBP 3FCUB 2H26A 4ONGL 3UG3A 2ICEC 5IBTL 3HA0A 3EYQC 3WEXA 1BJ8A 5GGRB 2O5YH 2VR8A 3G6JF 4PGJA 4KTYA 5EOCJ 5FLUA 4N6QA 1R5VA 1KN4H 2DIEA 2BHYA 2OAAA 4KDVA 4QO1B 1DSFL 2FBRA 1NBZB 2FWUA 1TVHA 1J5DA 5DO8A 2B5IB 5GZOA 3EO1A 1KN2H 5EZIL 3AXHA 4AYID 4EDXB 3GSNL 4OD2B 4JLRA 4G9DA 1T1XB 2CUMA 4PMFA 3MROB 4M1DH 1BQHA 3FQ4A 1DJGA 1BZDA 4HC1H 4HCRL 2IDCA 2NSXA 4BFNA 4JFXB 1GGUA 2WTOA 5I1DA 5E99H 2VAAA 4PGCA 3F6IA 3ISWA 1E8WA 4IMKA 1XGQB 5FYKU 3EF4A 3CDGB 1NQBA 1LEIB 4DCQB 3MFFA 3REWA 5DK2B 4F3FA 4CBZA 2CKBH 2ZONA 3V5KB 4U1HA 4HGMA 1HDMB 5I8OL 4TF4A 2NOYA 3N50A 3ZBMA 4FXGC 5FUOL 3U7AA 3W5MA 2AMUA 3QDGA 5KSAA 5FGBA 4M8VA 3VSTA 3SKOB 3WLWD 2DYPA 3U9WA 1FAIH 3T6ZA 5BVPH 2OMUB 3K2IA 3TVMC 4TLUA 4WWNA 2QLVB 4Z7QF 2TRHA 1MLCA 1VGEL 4FXKC 1QABA 4MNGA 1U8OB 4O9HL 4V2CB 3NJFA 4ZFQA 3TYGL 3ZO9A 1IAII 4WDIA 1CT8B 5IB2B 4WFGD 5L6YL 4E5XA 4MJJA 5AG8A 4Z0BL 5I8CA 7TAAA 2EH8H 1NC4B 1QWHA 5IGXH 4CVXB 3UYPB 5AW8B 4WUUB 2DQTH 1AO7B 3QPXH 4PJBA 4A7UA 1MFNA 2OJEA 3DGCR 4ODTH 2R0KL 3UTQA 2AERT 5F3BA 5GGTL 4Z7WE 3H7BA 1E3XA 4LCWE 1A7RH 1ICTA 2FQFA 4XP1L 1ETZB 3Q43A 3LZFL 1H15B 2VN3A 2DEXX 2NY1D 4YSPA 2VN7A 4N8PA 3BZDA 4NKQB 3FBKA 5ID0A 2EVFA 4WVRA 5HP5A 1YEJH 3FB5A 3FQUA 4BH8A 2XV2A 4WWID 4HAFA 3SOTA 4JY5H 4MHHG 1DJYA 2W0LA 1LJMA 1QLFA 3EH4B 4KDWA 4ONGH 4P46A 2VN4A 4K15A 4ZZKA 3WEXB 4J7RA 4DH2A 3FONA 5IBTH 5C0AD 4K0OA 4UOW0 2X3CA 3VGHA 3WUWA 5L2KD 4UQDA 4JDZB 1R5VB 5IQMA 1KXTA 1OGAD 4BFBD 1AR1C 3ULUE 3H6AA 1FZJB 5ACZB 1DSFH 5JMRA 1LMKA 3K2MC 4P04A 5GISL 5J1SC 3HR5A 1TITA 3EGXA 3HHRB 1K5NA 4LP8A 2MHAA 4JLRB 5EZIH 4G9DB 2DDQL 2VXQL 1X5MA 1P4IL 3GSNH 2ADIA 4PHZA 1S5HA 3FQTA 4L3AA 2KYIA 5L4IA 3NOIA 3EH1A 1SHXA 3D06A 4UAOC 5I1DB 4G7YL 4PGCB 2EO7A 4GSQA 4HCRH 3KPRA 3VFPA 5D1QA 3D07A 4UQAA 3HVNA 3L4XA 5DO2C 4DZBA 5J11B 4H8UA 5D1ZI 1ZLUK 1UATA 3MFFB 4PYHA 4QF1A 4KPHL 4BZ2L 4OFYA 3U7WL 1O9WA 5E03A 3GUFA 2ARWA 4U1HB 3H9SA 2CWRA 5D7LE 4C4BA 4FG6D 4PJEA 2V8LA 2WY3B 4U3XA 2WXIA 1IM3A 2L0DA 3KBFA 3SO3B 3QDGB 1EAQA 5I8OH 5KSAB 4WSGA 2WSPA 4ZS7L 5FUOH 4YNYA 2DYPB 1MAML 4J3BA 2A7BA 5CJBA 3DJTA 3PWLB 4EKXA 2V7NA 1WPCA 3BAKA 4AEEA 4U1GB 3B43A 3A4DA 3HG3A 4MNGB 3CIAA 4R2GC 1AD9A 1HQ4B 1VFBA 1VGEH 4O9HH 4QY8A 4E5XB 3TYGH 2UVEA 4WI9A 5L6YH 1KXQE 3PJLA 4Z0BH 4PJBB 4OR1A 4TRPL 5F8RC 2EYRB 1LO5A 3VH8A 4CC1A 3G6JA 5BOZG 2FYVA 3UTQB 5F3BB 1LDSA 3H7BB 2BPBA 4R4FL 1FYTD 2OMBA 4I18C 2FEDD 2R0KH 2WXFA 3KYNA 5GXBB 4LIQL 5GGTH 1QAWA 5ID0B 5E8EA 1LWRA 4F24A 1ITBB 4P07A 4O02L 4XP1H 3LZFH 3FB5B 4MMZA 3SPHA 3A47A 4PU2A 4QD2E 3DETC 4YHZL 4AY0A 5JOFA 1QLFB 2QGEA 4P46B 2SEBA 3CBRA 1YEFL 4Q6YA 3ZDZE 3FONB 4DUWA 3T8VA 3GMLA 1A4BA 3LH8A 3O3UN 4KK9C 3WUWB 2P48B 4HZ1A 2J4WL 3DYPA 3AITA 4DKEL 1WBZB 1KXTB 1MCSA 1XGZA 5IEHB 4DK3A 3CPLA 4P2OC 3IJSA 1RQ5A 3PNWA 4DN4L 2E7CA 1Z9LA 1HESA 4I4WA 3BWZA 3ARZA 3MBED 1OIOA 2FE0A 5FO8A 3ARFC 2ZNWA 2WGNB 3DHUA 3HR5B 2EIMB 4A2DA 3EGXB 4H8VA 5JHMA 1YEDB 1K5NB 5J6GA 2MHAB 3GDCA 5GISH 2G2PA 2RD0A 5ENWA 2YRPA 4WK0B 1R3KA 3HE7A 1PNCA 2GCYA 2ADIB 3L4WA 4PJ5E 3EOAA 1GCFA 1D5BA 1OSPL 2IWKA 2DDQH 2VXQH 2MOQA 2YXFA 1BOYA 1P4IH 3OWRA 5E9DA 2R0ZL 2Q3AA 1E4XL 2HT4C 1TQCC 1SNRA 3K1DA 3KPRB 2FO8A 1DVYA 4X5RA 4G7YH 4DZBB 3BLBA 3ZDWA 4JKWA 1Z5LA 3QWNA 1JMXA 2H45A 4YQXL 2BSEA 3ZE1E 4R7NA 4KPHH 4BZ2H 3U7WH 2CO1A 4PJEB 4HUCA 5MP6L 2ITCA 4GIOA 3L3HA 1S3KL 4FQQA 2N56A 2YLKA 2FJSA 2E9GA 1WS8A 3QRGL 4YNYB 4RAVB 1IE4A 3TTYA 3LNHA 1DJHA 1XTLA 4ZS7H 2B14A 1I1AC 5J12C 1A9EA 1MAMH 3T0EE 2BLFA 1HINL 3K3QA 4R0LC 4QY8B 1BFTA 1RIUL 3ZTDC 2I60L 2NXZC 4ENEC 1U41A 3ARXA 4QNPF 3SE6A 5DEJA 1TJMA 3I3EA 3UTSA 4R97C 1NFIA 1LO5B 1KNOA 1PKQE 1I85A 2B0SL 3G6JB 1BYPA 3VH8B 5L4MA 4XNZB 1S7RB 2IAMA 2YPLA 4TRPH 4UDTA 3ZUCA 1FORL 2YN3A 1CIUA 3UCRA 1ILSA 5DHEA 1SRDA 4R4FH 1S3RA 1MSPA 5E8EB 4OF5A 2HLAA 4LIQH 2RACA 4HX1A 4MMZB 5KWYC 4AL8C 4O02H 4GRWH 3SZKC 4OGZA 1BA9A 5JOFB 1UD4A 3IJEA 2SEBB 1XHHA 4I5BA 4JDEA 2WCSA 4JX0A 5ISZE 4AM0Q 4YHZH 3L3GB 2OCFD 1YEFH 2ZKMX 2VO8A 3NT0A 1SJEA 2ZWSA 2J4WH 2WBJB 3QYMA 2Y5EA 3IJSB 3PNWB 4K4KA 2R4RL 4DKEH 3OHXC 3KH3A 1O6VA 3BT2L 4I4WB 5HVGB 1RI8A 2FECI 1ET5A 5FO8B 4DN4H 4N1EA 3GGWA 1QG3A 4PCYA 5DD3L 2AK4D 3ROLA 3HE7B 2E7BA 3K4AA 1A6AB 2GY7B 3EOAB 3L3OC 1D5BB 1TZHA 1V3MA 2UXGA 2EDDA 3FFDA 4JG1L 4HHAA 4FLHA 3T1FB 5E9DB 1DTUA 1B90A 3RVUC 3HB3B 1OSPH 4M7LT 4NFCA 5EU7E 4Y4KB 4Z7QB 3O4LD 3TBVA 2R0ZH 2VLJB 3KL0A 1E4XH 1HHHA 3SOBL 1Z5LB 2FJGA 3Q8EA 2RQ8A 5DHVA 2K7PA 2F53E 4IOFC 5EIIA 1GYCA 4R7NB 4FLOA 4FYTA 1XQ4A 4JO4L 4YQXH 4JL2A 2DWTA 3ZHFA 3L3HB 4A38A 3DGDA 4FL4C 4FQQB 5K39A 5KW9L 2XQYG 3BSZA 3FSAA 4C54A 5MP6H 3NFPA 1S3KH 3QRGH 1USZA 2P8LA 1A9EB 5H8DA 3VMOA 1I53A 5FKPA 3BCFA 3ZOAA 1HINH 4P23C 1EK3A 4M7LL 4EO5A 5K1VA 5JHLA 3UTSB 1RIUH 2C7UA 2GQHA 2I60H 2L7QA 4M4PA 2R29L 3VWJD 3TU6A 3UEQA 2B77A 9PCYA 2XKSA 3RRQA 2IAMB 3MRHA 4UDTB 3OKOB 3UBXI 1UKTA 2B0SH 4Z7IA 5I74B 2FGZA 2JVUA 1AZNA 3HC3L 3M88A 5IBLD 1FORH 1B4LA 1KZYA 2HLAB 4MDIA 1YMMA 3KH4A 4ONFL 4HX1B 2ZXAA 4JPKL 1ZLWH 5LXVA 1PD0A 2FT7A 3GXTA 5B1BB 1VF5C 1WA1X 3AROA 4ONOA 3C8DA 4DQAA 3IJEB 4LEXL 4Y5XC 4I5BB 2BCMA 4JDEB 4RMRA 4XN9A 4ELDA 1VERA 2WZ6A 5IKCA 1JI1A 4NBZB 3AWFA 3VU2A 1N8OE 5HPMA 3CVHL 3KVQA 5CJXC 2BRRL 1WEJL 2UZIL 3OJ2C 1D5XA 4AM0B 3V4PA 2QVIA 2DEYX 1N26A 5CHNB 2BW5A 5FWQA 2R4RH 3GMOA 2ICEB 4H8WC 1KB3A 3MRLB 1QSFA 2E6PA 3BT2H 2DB8A 3VB9A 3B7TA 4FC3E 1CYXA 5C08B 2Y9RT 4E9QA 3IDMA 2W5PA 3ROLB 4PRPE 3L95B 4BSVA 2DI9A 3TURA 1KIRB 3F84A 5DD3H 1TZHB 3FFDB 2G5BA 4HHAB 4AYMC 3EFOA 5F3HB 2JKTM 4JG1H 3WLWC 4HBCL 3NK3A 3HZMA 1P84K 1HHHB 4ZOBA 5DHVB 1E2WA 4P5KA 1VRSA 1WZLA 2DY2A 4ZQTA 5EIIB 3L1OL 3SOBH 4Z1PA 2BSBA 1CQYA 3TCLA 3RFRA 3P4NA 3QG6A 5E2TL 1T1WA 2NYZA 3FS9A 5K39B 2P5ED 4JO4H 2AQ3A 1AKJD 2MQ3A 4AK1A 1WAAF 3NFPB 2X2HA 1JDCA 2Q5BA 5KW9H 2P8LB 5FKPB 2UUDH 3D6GA 4MAUL 1HXYA 5F0LB 1WWBX 4FQPA 5T1KA 4G8FA 5C07D 1F4HA 4G59C 5KBKA 3V95A 3U46A 4XPTL 4Y8DC 1TETL 2YUZA 4AQ1C 4JRYE 4M7LH 4PBVC 4TNVK 1F8TL 2YJQA 2X1WL 3BVXA 2R29H 2W60A 3MRHB 3ARED 1CL7I 5DD0L 2FEJA 5BO1L 4FXKB 3TBTA 3JT2A 3QZWG 4B9JA 4D7PA 1NCAL 4MDIB 1YMMB 3HC3H 3EJSA 4Y1AA 3RY6C 3V6FA 2Z4TA 2WTRA 2X9WA 1PJ9A 4YBHA 1NCHA 2BIQA 4JPKH 4ONFH 3IDNA 1H6UA 3FU7A 2NT0A 1BGXL 1XL6A 5I71C 1N68A 1YJDC 1EBAA 2G3MA 3L5WA 5JZ7D 2F19L 1RJZA 5CSGA 2WYIA 4LEXH 2YZ1A 4TXVB 5SWSE 4X7TA 4YSEA 5IKCB 5C86A 5HPMB 3US1A 1B9ZA 4MHHI 1KPUB 3UC2A 1MFAL 3RQ3A 2ZUYA 1H9DA 3CSTA 3CVHH 3CLWA 4WV1C 3V4PB 2BRRH 1WEJH 4K94C 2UZIH 2YEQA 5C0CE 5BCAA 3ZRFC 3M8OL 3LPPA 1UCBL 3RNQA 2BINA 1XEUA 4UOQA 5GS0L 3GMOB 3E9UA 1RL1A 1QSFB 3VGEA 4DGYL 3MSPA 2JCWA 1NIDA 1MELA 3L1FA 4EN3C 3F8UB 1WCBA 3IDMB 4LOVA 3U6XA 3TV8A 3O6ML 4BSVB 2DBJA 3AT0A 5J4MA 4LGSB 3PWPA 2ROYA 1FPTL 3BN3B 3C87A 4UTAA 3SBQA 3TBYB 3UJIL 5SWQB 2ERJC 4B9KC 3EFOB 3BVTA 4P2OA 1AR1B 3QFGA 4P0DA 3AY2A 4OI7A 5GRXG 2BNQA 4QRQA 4HBCH 3WELA 1LQSR 1QEXA 4YHPA 3TCLB 3P4NB 3QG6B 3OKNB 3L1OH 2XJLA 2Z65C 3OKEA 1K4DA 4C56A 2YD2A 4PJDF 1IC0A 5E2TH 3KYAA 3SYAA 5CZVL 4UAOB 3LIUA 3ECVA 3A24A 3GK8L 3UEZA 3HG4A 2NCMA 5DMJB 4LCCA 5AEAA 4LVOC 4WNSA 2VDKL 2OK0L 3CZFA 1HXYB 4XVSL 5EC2A 1ZLVK 3CV5A 1TVBA 3MGTA 4LHJB 4MAUH 5T1KB 4G8FB 3ZSSA 1CURA 2FUTA 3U46B 2X40A 4RRPA 1H3PL 1PCSA 3HG1E 4PJ9C 4ORZC 3IJYA 5B1CA 2CHZA 4XPTH 2W60B 1TETH 3FQYA 3FXIC 3RVXD 2BVYA 4FHJA 2Z8RA 1F8TH 3WGUB 2FT8A 5CP3H 3EGDA 3VQ2C 3TBTB 1AHMA 1MRCL 1HEHC 5A6LA 2BVTA 5DD0H 5HY9A 2BOLA 4KXDA 4Y1AB 5DJYB 3V6FB 3IWVA 5BO1H 1JYWA 2WTRB 1AGDA 1JCVA 3NABL 4ZW7A 3G08A 1NCAH 4NQVB 1PW3A 3NPSC 2MQ0A 5DJZA 3FU7B 4J39A 1XDTT 4UNIA 4MZ3A 3MBEC 3L5WB 1T0OA 2HTKC 1M4KA 1RJZB 2FWOA 1BGXH 4LCYA 4X7TB 1FG9C 2F19H 4HZAA 1FSKC 5A3ID 1QI3A 3KPOA 3LD8C 3B8SA 4F9LC 2EDWA 1P5VA 3FT1A 2CPCA 3S34L 3ARPA 4FJ6A 1I4FA 1QFOA 4KMTL 3RWHA 1JD7A 1F42A 1MFAH 3RNQB 2Z8VC 2F1EA 2AS5M 2ARJA 5E24E 2ICCA 1M1SA 1LMIA 2FUQA 3M8OH 4PRBA 1UCBH 5GS0H 4LHQB 4TLKA 2IMMA 1F5WA 4ZPVA 2AV1A 3B1TA 1V3KA 1WCBB 4DGYH 3RIFF 3ABMB 3IU4L 3CFQA 4PJIF 3PWPB 3KJ6L 2VZ1A 1SUJA 3O6MH 2QDWA 1F6FB 5JIKA 1NDMA 4ZS6D 4P2OB 1FPTH 3UJIH 4DO6A 4F93B 2JKSA 2BNQB 3N06B 5DQJA 4P2QD 5FYKD 3VTAA 1Q9WA 2CKBA 3ARFB 3QB7C 1U8LA 2FZ3B 2CUIA 3EYOA 3JWOL 4JCMA 4I3SL 1G7LA 4RGMB 4H0IA 4M7ZC 3L3OA 4XO3A 2GYSA 3FRUA 3U0PA 2P7TA 2ZCZA 4H5SB 4C56B 5J0BA 5L0QC 3GRWA 4QGYA 1PYWA 2IWFA 3C60C 5CZVH 4NBYB 4LCCB 5CF3A 4ZW8A 1YAIA 3GK8H 2E59A 2XG5A 2I5YL 1HCYA 4L3CA 3CZFB 4NO0A 4EZJA 4HWBL 5EC2B 4HIXL 1TVBB 2GTQA 1SDDA 2VDKH 2Y7OA 3MGTB 4TTGA 2OK0H 2RJMA 1A21A 4XVSH 1SXBA 2PYED 2Y22A 4OV6F 4UQ9A 2XIIA 3BUTA 1P84J 3IJYB 3HBGA 2E3VA 1H3PH 3BFQG 5J12B 1I1AB 3EGDB 1D2OA 5I2IA 4G3YL 4C55A 1EXUA 5HY9B 1WT5C 4UT6L 1EUUA 1MRCH 4ODVL 3G08B 2NXZB 2FHBA 4PRIA 1DQQB 3RUGF 3A3YB 5DJZB 3NABH 3NCXA 3NZHL 3HI1A 1G94A 1KCSL 1LDPL 3A4FA 3D08A 4M43L 5EOQL 2FWOB 3V2AR 4LCYB 2VMEA 4XVTL 1TJHL 2WXHA 1E3ZA 3KPOB 1P5VB 3KGTA 1I8LC 1A47A 3ASWA 3CX5K 1EX0A 3EZ8A 1I4FB 4OFKA 3ZDXE 4DAGL 2OSXA 1Q0XL 3S34H 4ZNEE 1JOIA 3AJ7A 3ZZ1A 3WTUA 4KMTH 3ORJA 5T5NF 3L9YA 3DGGA 4PRBB 2GIYA 3BH9A 5IIEA 3ARYA 4YR6A 5I73B 1FL6A 4ZPVB 1EJOL 3NSFA 3U4EA 3B9DA 2JLPA 1YVLA 5B3SB 5T3ZL 1CYWA 4PJDA 5F7WC 5CJXA 3IU4H 1NDMB 1LM8V 3KJ6H 5DQJB 3MMEB 3F7KA 3BPLB 4ZUUA 1Q9WB 5AUMA 2BFVL 4HWZB 2OS7A 2J72A 1U8LB 4LAQL 1YZZA 1OM9A 2XWXA 3EYOB 1ZE3C 1G7LB 2ZKYA 3K6IA 3DLQR 3L3OB 1HILA 3FRUB 3JWOH 2P7TB 5I82A 2XA3A 3SKUD 4DP7X 2ZX6A 4I3SH 1JXKA 3QEQD 2DKMA 2F0CA 2H32H 4U3HA 3VWJC 8CGTA 1CD1A 1PYWB 2TRYA 4EMZA 2D0HA 3T6WA 3LS5L 2I07A 3FRPG 3F7PC 5GGVL 5T33L 3FQRA 3LXCA 4OCMC 5LO7A 2XG5B 3ESNA 4L3CB 5IBLC 5CCJA 1L9OA 4KV5F 4NO0B 1XB8A 3B2XA 2BVEA 2KH2B 4KZCA 4A7VA 1G1YA 2I5YH 1SDDB 5C70A 3IBEA 1QHPA 4LCIL 4HWBH 4HIXH 1KJVA 3RKDD 1XH2A 4FL4B 3U82B 2VB5A 1CGSL 3F01A 5FGSA 1JRHI 1J8KA 1XO8A 4QAWA 5IHWA 4LSRL 5FPIA 1QO3A 5KAQF 2PPAA 1EXUB 5LNEA 2CD0A 3UPAA 2D7QA 4KXZI 3S37X 1Z9PA 3VUAA 4G3YH 4PRIB 3TO4A 1TZOA 3IN0A 4UT6H 3HI1B 1B2YA 1WVZA 2DQEL 2VYRE 4L8DA 4ODVH 4H1LA 5I0XA 2BP0B 4QHKI 1Z9OA 3FUHA 3LPGA 2Y36L 3NZHH 1KCSH 2CKNA 1LDPH 4PJIA 3CCHA 4M43H 5EOQH 3OV6A 4FFWD 5C0AA 1NIAA 2Q3ZA 4GEJA 4R4NC 1Y1DA 2Z3FA 1TJHH 4IBSA 4XVTH 1OGAA 3NACL 2DWSA 3D39E 3EYVA 1I1RA 4DAGH 3DX2A 1AH1A 1L9NA 1Q0XH 5KSUA 5IJVB 3DGGB 4L8SC 3L4ZA 4Y5XB 3BH9B 5IIEB 4HKBA 3EBHA 3F7RA 3JZYA 4NXSA 3GSWA 1P7HL 1INQA 1M6UA 3U4EB 4WF7A 1GY2A 4MXQD 4ZX3A 1YUHA 1IEAB 3LEXA 5E94A 3GPSA 3BUDA 2MPAL 1EJOH 4PVBA 4PJDB 5EUOE 2YBRB 1MKFA 1KYDA 4ORGA 3QE5A 4TSAL 4WY7L 4Y4HA 5T3ZH 3EJUA 2WV3A 5CZXD 3HC0B 2YR3A 1PL3A 4M93B 4ZUUB 5AUMB 2IDTA 3LKPA 1YAZA 3VSVA 3STLA 2I7SA 1JIBA 3WCYA 2BFVH 4TS6A 1NTDA 4LAQH 4Y2DC 1HILB 5FS5A 3KVDD 1MHPL 2R27A 4GW4A 1U95A 4ADJA 5H35A 1A7NL 3K6FA 3SBWC 1CD1B 3GEFA 4DPAX 2CK0L 2I07B 5DMYA 2VDQB 5AB1A 1MFDH 2EC8A 3AREC 4BE6A 3FQRB 3LS5H 4HFWA 3UL4A 1SFHA 4RX4A 3WHE1 5GGVH 5T33H 1MFBL 2HA1A 3FZUD 4YPJA 1ROCA 4NC1E 3X1EA 3VAEA 3TFKD 5ESVA 1KJVB 4MXVE 4JFEE 4LCWD 1KCWA 3PAZA 2ADJA 4LCIH 1CXLA 3GIZL 3ZT6A 4JO5A 4A2EA 2VR5A 3QQ3B 3GM8A 1JPEA 2WOYA 3Q2CA 1OOAA 1CGSH 4HUWA 2CHXA 1QO3B 1FYTA 1GR7A 2ADFL 3GMPB 4GUCA 4LSRH 3VFMA 2NY1B 4G8EA 3Q6GL 4G7SB 4D9RE 1O0VA 1RZFL 3HNSL 4YSQA 1ZVSA 4L8DB 4H1LB 1E6OL 5DMIL 2H0PA 2P26A 3BH4A 2DQEH 4PJIB 1EAPA 3CCHB 5CSZB 2XY2A 2ZWZA 1HJCA 5C0AB 3ULUD 2Y36H 4IRZL 2KZBA 2CO6A 2ATKA 5H37H 1OTSD 5L2KB 3NA9L 4YVUA 1OGAB 5DA4A 3VXPA 2X9YA 4CA4A 3EYVB 4KKRA 2JJSC 2ZOKA 2JB5L 5KSUB 3NACH 1ZHKA 4J6RL 4P9ML 1UXLA 2N01B 3MBEA 4HKBB 4WFHE 3V0IA 5I71B 3GSWB 2E27L 1INQB 4CAGA 1NBYA 4BCZA 1YUHB 3LEXB 2GSMB 2BZCA 5E94B 1MLBA 2FLRT 2QR0A 1NAKL 4Y4HB 4F9LA 3BDBA 5HDBF 5JA8B 1MDAA 3EDKA 4G7VL 2MPAH 3UJJL 2PW1B 3O3AB 2ZPKL 4WY7H 5BZZA 4TSAH 2ALAA 1S2EA 4ZMXA 3E3QE 4JHWL 1JWUB 4G8AC 5FYLL 4G8GE 4XPHL 4E41E 3KLQA 3OPZL 3LKPB 1DN2A 2D7PA 5IB1A 3STLB 3N42F 3CHRA 1Z7JA 1F6AA 1M71A 3OAWA 3CX5J 1WWAX 2YJLA 3WNNA 2DJ4A 3V4LA 5KS9E 3Q6FA 1H6FA 3KWTA 4GW4B 1H3VA 2ERJB 1U95B 5D4JA 1O75A 1O7DE 5H35B 4B27A 4MQTB 4ES8A 4M4RA 1MHPH 2W9LA 1Y6KR 4NUGL 1CYGA 2XWEA 1A7NH 3RVXC 4XB8A 1V3LA 4HFWB 2CK0H 4IK6A 5BRQA 2WVSA 4BUQA 4HOWA 2GTWA 3X1BA 4FS0A 1M6OB 1D6EA 2X2IA 4AC4A 4AZ8B 4A6YA 1L0QA 2WMPA 5DEGA 3BWUC 3BUPA 3BVDB 1MFBH 4PLJC 1KCVL 2ADJB 1ZHNA 2B4CL 2BS9A 2DM4A 2QSVA 3GIZH 5EO9A 4HUWB 3H7LA 4FJYA 1FYTB 4LVOB 5A3IC 2ZUUA 3VFMB 3Q8FA 1CFTA 2GJPA 3QQDA 1AS7A 3QS3A 1SLVA 4G8EB 2ADFH 2CCLA 4OUOA 3S36X 1UH3A 2OV0A 3JWNH 4UNTA 4KTEL 3DA0A 4OCNC 1ZVSB 1NICA 3Q6GH 3T2QA 3ECUA 1XCTB 3FH8A 3HNSH 1RZFH 5ALCL 1EAPB 4CU7A 4OTXL 1LE5B 1E6OH 4CSSA 1T0PB 5AVVB 2ATKB 2AHIA 2Q8BL 1KULA 2QKSA 2V9QA 3CZUB 4L1HA 3ESOA 2NNFA 3GSRA 4S2SA 3WJLA 2W07A 2JI3A 4IRZH 5DZJA 1WT5A 1L3NA 4GRLA 2LQRA 3NA9H 4KROB 4ZS6C 2VE6A 3VXPB 1AS6A 3BDXA 2ZOKB 3EF7A 5BS0E 2NLJA 1WGOA 4GKLA 1ZHKB 1I75A 3MBEB 3K81A 4PJ5D 3EXLA 4N86A 2FHFA 2JB5H 2YD9A 5LBSA 4YSUA 1NBYB 2EXYD 4J6RH 4P9MH 4F8QA 1UG9A 4L48A 1S9KC 1MLBB 2IALA 2F18A 5AZEL 2E27H 2QR0B 1FSKB 5DJAB 4FOMA 3PWVA 3LD8B 2ALWA 2WQ8A 4WI7A 1M53A 4K8RC 5LDSA 1N0LA 3RZWA 3HUJF 1EMTL 1NAKH 5EH1A 3ZE2F 3K6SA 4JO2L 4WHCA 1QLEB 4G7VH 1FL3A 2PLTA 2LOEA 2XQYK 1BW8A 2DMCA 3UJJH 2ZPKH 1KBBA 4DP8X 1OVZA 1I3VA 1RU9L 3AG4B 3BAWA 3O4LA 4JHWH 2BSDA 5IB1B 3U48A 2RFXA 4M9OA 5FYLH 4XPHH 3UGXA 1I1FB 3K4DA 1LTXA 3OPZH 2VDLB 2NY5L 1S7SA 1F6AB 3IDGA 3BISA 1WCQA 3AABA 5J6HA 2FWLB 4WENB 4MMYA 4CJ1A 1F1DA 3Q6FB 1DLFL 5LN4A 3VI3E 1TQWA 1BXUA 3T0ED 3WNKA 1HKFA 3KM1A 1QTYT 4M4RB 2WWOA 3BGAA 5JHAA 1U58A 5IB4A 5DSCA 2Z34A 4NUGH 4OI9A 2DI7A 2PTTA 2GTWB 3QDJE 3VH8G 4BV1A 3PQYE 5CIPH 4C47A 3II3A 4MQSB 1KJ3H 4RDQG 3UIZA 4A6YB 1DFXA 5B8CA 1Q94A 2WMPB 2Z7YA 4M7ZB 3PJSB 4HISA 4LOEA 5L0QB 2K6YA 5JIQA 1ZHNB 1A6TB 3CC1A 1ZLSL 1T7ZA 3UGEA 1YO4A 5C0RL 3VWJA 1KCVH 1JE6A 2B4CH 4HWNA 5CJOL 3MCKB 1PMYA 4ZAKD 5EO9B 3WI9A 4YFEA 4PJXF 1URZA 1ZS8A 1RZGA 1EHKB 1BEXA 3F5WA 4XC1L 3QQDB 1CFTB 3MJ6A 4XN4A 2XWTA 4LSQL 2J6EL 3CXFA 4Z7UF 5T1JA 2N4IA 3F7YA 2BWIA 5B1AB 5ISZD 3DIFA 4BE5A 5C6PB 1IGYB 2ZKHL 2ED9A 3UZVA 5B21A 3FH5A 4KTEH 2ZWNA 3IKCA 1Z0NA 1FGVL 4Z7NE 1KBPA 4L5FE 2BM3A 4U1JA 4CDHA 1TZIA 2OYMA 3CN4A 3QUGA 5EMYA 2EABA 3WNJA 5ALCH 4OTXH 4GLRH 1IVLA 1H0DA 3PUCA 4OT1L 3AM8A 2VR7A 2DLGA 2W07B 4NX0A 4S2SB 4NC2B 1BFSA 2EICA 2Q8BH 8FABA 2DQJL 5E08L 4HDIA 3FT0A 2VE6B 4KI5C 5INDA 1G4RA 1KB9K 2NLJB 4F7EA 3W37A 1MCWW 1U4FA 3DSFL 3FAWA 2Y25A 4JVUA 3BWUF 1SPDA 3U4BL 4KY1L 4Q7DA 4WTQA 2R69A 1LEKA 4JFUA 1KB5A 1DO5A 3U2IA 3VXOA 2X2UA 2IALB 5E6SB 2VSCA 3PWVB 4DHLA 5AZEH 1N0LB 3W0WE 3HN3A 1LD9A 2D2CC 4DSYA 3K6SB 2F53D 5D7IF 1FL3B 1CTMA 1EMTH 4MA1C 2H1XA 4RBPH 5EZJB 5I1AA 4JO2H 5BZXA 1UD3A 3AT9A 4XMZA 3O4LB 2LU5A 5E00A 3SPIA 4L8SA 3ZL1A 4Y9FA 2RFXB 1RU9H 1SM3L 3HKFA 3FN0L 1S7SB 3IDGB 4AQOA 5F6IB 3WL9B 4MMYB 2NY5H 4XX5A 4EUPG 1MUJA 1RHHA 1EO7A 5I5IA 3M46A 1GPOL 4LE8A 2P5EA 3FT4A 1AKJA 1T2QL 1IGCL 1MJUL 1DLFH 2ZXGA 3ZMEA 4BK4A 2M2DA 1I3RA 5IB4B 1E9PA 1PKOA 2LT9A 2PP7A 2NY4D 5CINL 3LXUX 5DSCB 2RMNA 3BESR 1II4E 3DX6A 2PTTB 1UB5A 3GZKA 4PY8I 3RAJL 4AJ0A 5FM4A 5B8CB 3GJFA 1Q94B 1KF9B 4Y5YA 3VTTA 3HI5L 1C5BL 4HIEA 4XMWA 4DNLA 5KBDA 3Q2LA 3VWJB 3QDME 3SBWA 2KDGA 3I9IA 1ZLSH 1JMZA 4LASL 1NMCC 5C0RH 3AREA 2O30A 1ZS8B 1RZGB 5CJOH 5AL8A 3F5WB 1MCFA 5F7YC 4FI7A 4LDLB 3F7YB 4XC1H 1TLKA 2GB2A 3DIFB 3VXMA 4LSQH 5EORL 1IAOB 1PAZA 3V0WL 2BCKA 1JP5A 1TYEB 3UZVB 5IR1A 3IKCB 1U8JA 3PHOB 1XXDC 4KKBD 4PV9A 4HUNB 4Y9BA 4JR9L 4U1JB 2ZKHH 1FFPA 1IBDA 4MXQC 3ZTCC 5GRWA 2VXVL 5HDBB 3HUJA 8FABB 1J5CA 5TDNA 4HDIB 2OI9C 4I1RA 4OT1H 1LO3L 1T7VA 5EBMA 4MB1A 5FWRA 4K7PL 1CMOA 5CZXC 4NPYA 2DQJH 4F7EB 5E08H 2ZUWA 5DS1A 5I1LA 4PRPD 1MHCA 4ZMTA 3N42B 4N20A 4WNQA 5I5RA 3DSFH 4ZMOA 3U4BH 4X4ZA 4KY1H 1J7VR 1AS8A 1DFBL 1E50A 3KEHA 3FTWA 4ZJ9A 1A3LL 1QNZL 2YO3A 1GC1C 1LD9B 3OSVA 4XO9A 1ZPUA 2UWEF 1ZK5A 2K1MA 4QTFA 5GRUL 1ZGLA 5EOTA 4DGVL 3S6CA 2JJSA 5I1AB 3GF8A 4OZFH 5E00B 4XP6L 3PGCA 4L8SB 5EC1A 5AWNL 3T71A 5F8QC 1JK9A 4BRJA 1UXWA 2FR4A 3WYRA 2V2TA 1T4KA 3L3KA 1MWAA 4WKXA 1SM3H 1HL5A 3FZUC 3FN0H 1YQVL 1MUJB 1RHHB 1NKGA 4G6AD 5DQ9A 2Z6FA 1D7CA 2DM2A 5KYXB 2P5EB 3FT4B 1AKJB 4Q6IA 3MTRA 1GPOH 4NPKA 1I3RB 4DP5X 1E9PB 1T2QH 1IGCH 1MJUH 2ZSWB 3DX6B 4P48A 4KK8D 2RAMA 1IC1A 1UB5B 5CINH 3SDYL 3W82A 4Z7UA 2FL5A 3KVPA 3NZ8A 4JRYD 5FFLA 1A6WH 3GJFB 4MDJA 1AR2A 3RAJH 1RIVL 1N5YL 1UD8A 4Y5YB 4K3DL