2VCVA

Glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
219
structure length
219
Chain Sequence
KPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE A3
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcvA01
2LUSA 1PD21 1ZMAA 2H6ZA 3LYPA 2DJ1A 3MWHA 4EVMA 3ME7A 4L0WA 20GSA 4O92A 3EVIA 2R2JA 4JE1A 3ZRDA 4GSNA 4HZ4A 6GSVA 3W8SA 2LJRA 5HFIA 4POMA 5J4UA 2H72A 3ERGA 2YP6A 3DKSA 3FR9A 2EIOA 6GSTA 3IC4A 1K0DA 1XVQA 2OA7A 1H4OA 1YJ6A 1O6JA 4MJEA 1PGTA 2LRTA 4HQSA 1PQNA 4PQIA 5FWGA 2YWIA 3K8NA 4LMVA 2X8CA 3UJ1A 2V6KA 4MF6A 1C72A 7GSSA 3EMPA 6GSWA 1U6TA 2V2GA 2FY6A 3IK7A 4NHZA 1U87A 2M72A 4CW9A 1J08A 1R5PA 2O7KA 2WULA 3GTUA 3ZIJA 3TKPA 4E8EA 2IJYA 2AB6A 4XRDA 3L78A 4K7NA 2PWJA 3CXGA 5DAKA 1S3CA 2O87A 3ZTLA 3A5WA 1B4PA 1QFNA 3WYWA 1VF3A 4IW9A 4EC0A 1NM3A 2MMAA 5J41A 3Q74A 5A4WA 3LEFA 3EC3A 2B3SA 4OWYA 3C71A 3HVVA 4DVCA 1GLPA 1BYEA 2G2QA 3U5RE 2LEGA 3GSSA 2TRCP 5JWOB 2CAQA 1GNWA 2WRTA 1EEMA 1ACVA 3KCMA 1K0CA 4ECBA 3UVHA 2DLXA 3F8UA 5JCUA 5ECMB 1Y25A 2REMA 5DCHA 3HJMA 5GAND 4Z7XA 2H74A 3HKRA 2HI7A 2YJHA 4PXOA 1BG5A 2LS5A 1NW2A 4RQRA 2WJUA 5HR3A 3HYPA 4X43A 1KNGA 5EL8A 2CA8A 3F6FA 6GSUA 3BJ5A 5IM9A 2LQOA 2YV9A 3GUSA 2B7JA 3GV1A 1IYIA 4NHWA 3RDWA 3M3MA 13GSA 1FOVA 2ON7A 3G9BA 1FB6A 3G7YA 3VI7A 3D5JA 1EGRA 3GL3A 3ERFA 2L59A 2YWOA 5G1LA 3D0ZA 2B5YA 2H6XA 5GAPD 4IHUA 1O7UA 4MJAA 3TKRA 4GQCA 11GSA 2L5OA 1W4VA 1AUCA 2JACA 1YEXA 2EIRA 5KN0A 1ERWA 1TI1A 4FH8A 3QFBC 1SK0A 5ECIB 4I97A 1TK5B 3M0FA 1OE7A 3C1SA 2FWFA 2GZZA 3KIJA 4ZIJA 1J9BA 2YANA 2VCXA 2B5EA 2VCQA 2KOKA 1AIUA 3JCML 2I81A 5IOXA 1G0TA 2I9HA 3NIVA 4MPFA 4DEJA 3MDKA 3DIEA 2DMLA 3F4TA 4G2EA 4ZBDA 2H76A 2RIIA 1GUHA 2D2ZA 2JL4A 17GSA 2AUVA 1XW6A 4BL7B 3F3QA 1XXUA 2R3XA 3F63A 2VD0A 14GSA 2FNOA 5HQPA 4WF5A 3R2QA 4XRAA 1U3IA 1M2DA 5DVBA 1F37A 2VLVA 4HDEA 5IPHA 4LA1A 3TRPA 1SU9A 1GSQA 2BMXA 1SK1A 5CP1A 1XVWA 3APOA 4HOJA 3F6DA 2FD3A 2GGTA 1A8YA 5C04A 4L5OA 1GLQA 3A2VA 3PINA 1V58A 2VIMA 5A4VA 3S9FA 1A0RP 1S3AA 3CTGA 5ECKB 4Q5FA 3L9VA 2I1UA 2RUFA 1X5CA 4MABA 5IO0A 3IPZA 4PNFA 2E2GA 4F03A 2C0GA 3TJBA 2H0HA 5INYA 3VURA 4HJ2A 2OADA 1SK2A 3P8WA 4MH3A 2HNLA 1V9WA 4EUYA 3WGEA 4NMUA 3IRAA 3UOMA 1AC1A 3HVXA 3UARA 1MD3A 2LJAA 4TXOA 2GLRA 1DBYA 2CVDA 1PN9A 4V1Ap 2AJQB 3KH7A 4L5LA 5D73A 1BJXA 1G6WA 4GF0A 5G31A 3PH9A 3BBYA 3WGXA 4JEDA 4ECCA 2WS2A 1XZOA 3RAZA 1SL1B 2DJJA 4IVFA 4ID0A 3LXZA 1HNBA 3TJGA 3P7XA 4YH2A 4JU5A 1K3LA 3IR4A 1SL2B 4G19A 2O85A 1K0AA 3KH9A 4I8BA 1K0OA 2K8VA 2PPTA 1N8JA 4ZXGA 2IMDA 2XC2A 2MYGA 5D93A 3DEXA 5F8BA 4BPYA 2RLIA 10GSA 2NPBA 1USBA 1A24A 1FO5A 2RM5A 4GXZA 1YZXA 4MP4A 5HFKA 2GSRA 2HZEB 2ZNMA 1UC7A 2YJ7A 5D9TA 1R7HA 2C3TA 2JZRA 2MMOA 3VWXA 2OKAA 5FT3A 4ISDA 1ST9A 4MZCA 1E2YA 1GUMA 2LNSA 3EURA 3Q19A 3KEBA 5HR0A 4LL4B 4NAXA 3LORA 5LNKe 3M9KA 1O85A 4DSSB 5IOWA 1X5DA 3L0HA 4IELA 1ZGNA 5IIZA 1GUKA 1OKTA 1RQMA 4MH2A 3IXRA 2MZCA 4IP1A 3V1WA 2GQKA 3E9JB 4G9HA 4WETA 2HE3A 2VL2C 4YQVA 2X8HA 3KMOA 1ZL9A 3UBLA 2GQLA 4K0NA 4BVXA 3CBUA 4FYUA 3TOTA 2J9HA 4H86A 5ECHB 3MAKA 2VD1A 3KTLA 2KUCA 3H93A 4MZBA 2H30A 3C7MA 5IMVA 5J5NA 1HNCA 3L9SA 4NV2A 4BWQA 1PX7A 5HR1A 4RI7A 1LJRA 3ZVJA 4PGTA 4JR6A 5ECQB 4Q5NA 1Z7RA 5ECRB 1GULA 3TCOA 1TXXA 1EV9A 4MCUA 3FZ9A 3W8JA 1EZKA 2DIYA 5D96A 1F6MC 2L4QA 5L71A 3DYRA 2YPMA 1T7PB 2LRCA 1FHEA 3RBTA 4KSOA 3KP9A 3ZLPA 2GSTA 1KTEA 2GZYA 2VUPA 1AQXA 4N10A 1M2AA 3GMFA 5A4UA 4MK3A 1ZYQB 4XIHA 5AN1A 3IBHA 4KUNA 4QL9A 2HYXA 1TRVA 4XTSA 3IC8A 2H1DA 4BA7A 4MF7A 2WFCA 4PUFC 5CO3A 2VLTA 4PX1A 1YF0A 2IMKA 5B6MA 2YOIA 3W6GA 4GSTA 3ZREA 1X5EA 3UL3A 4ZBAA 1JLWA 5DCGA 1XBSA 3IHQA 1THOA 8GSSA 2HSYA 4O32A 3H8QA 3WD6A 1T3BA 2HXKA 1PL1A 2IMEA 3GTUB 2IFQA 2C0FA 2XBQA 1X9MB 4GLTA 5GZZB 1Z5YE 2HSHA 1MTCA 5DALA 1TU8A 4Q5RA 2UZ8A 1QXHA 1AQVA 4ZL8A 1OYJA 1Z6MA 1AW9A 4KAEA 5F0GA 1OE8A 2K18A 3C8EA 1M9AA 5A5KA 3BOAA 4JR4A 2V6OA 2HRAA 2H66A 2HZFA 3QAWA 5AISA 4K7IA 3N9JA 1EOGA 3HA9A 4TRXA 1R26A 4J56E 3GL5A 2LNTA 4MA9A 4G0IA 3HD5A 2BTOT 4GSSA 2AV4A 1N2AA 4OCEA 5AIVA 2HT9A 4KCAA 2NDOA 2NVLA 3FZ5A 2C0EA 1F3BA 4MMMA 4PQHA 2NBSA 5IMAA 4OO5A 4ML6A 2ES7A 4OMVA 3FRCA 1KEBA 1CQGA 1OKDA 4MLYA 5EVOA 4EDZA 1Z3EA 1G7EA 2LQQA 1O8XA 3KZQA 1CQHA 2QSIA 3GKMA 4FQUA 1R5AA 3FZAA 2GVPA 3EWLA 2RUEA 2IN3A 4V2LA 2GQMA 5ABRA 2LV3A 3H79A 1HQOA 2FA8A 3LWAA 3ED3A 1TDIA 3I69A 2ZCTA 4HU9A 2B6MA 1A2MA 3VLNA 2YWMA 2E2MA 3KM6A 4ZILA 3M8NA 4PQ1A 3GH6A 4TR1B 2YV7A 1VF2A 3O6TA 5HFGA 1J0FA 1B8XA 4IP6A 2C4JA 1AAZA 3TJKA 1B9XC 4NV5A 2H01A 2YNXA 1UN2A 4KB3A 2CV4A 2LSTA 4ULXA 3L4NA 3ZFBA 2EIQA 5CREA 3LSZA 2GSSA 2OJLA 5GSTA 4G10A 4XS1A 4D73B 1WJKA 2C0DA 1WPIA 3BCIA 1MDIA 2Z9SA 3FR6A 2ON5A 2FWGA 3LG6A 2KP1A 3H4KA 1GSFA 1ZYEA 1T4YA 4LL1B 3GA4A 18GSA 3BCKA 1TU7A 2H8LA 4L8EA 3EMXA 1OC3A 2F8AA 1PX6A 2PGTA 1ON4A 2IMFA 5FHIA 5IQYA 4GWRA 4KX4A 2B1LA 1TK8B 1MEKA 4ML1A 4F82A 1EP8A 2DBCA 1ZCPA 2DMMA 2FWHA 3FYGA 3GSTA 4KGIA 3ZMLA 1SKWB 1XIYA 4MZWA 2AAWA 2GTUA 2JZSA 1WIKA 5DDLA 1QQ2A 4KCEA 5ECPB 1RK4A 5KN3A 3M1GA 2V41A 2DJ2A 4KF9A 2F51A 1DE2A 4IN0A 4BVYA 4ACSA 1GTIA 1UA5A 3TKSC 4Q5QA 4EDYA 1BAYA 2WGRA 1PKWA 1M7TA 6GSXA 3DXBA 3RHCA 1SYXA 1SD8A 1F9MA 2C3QA 4OFMA 3ERWA 4IGJA 3H1NA 3HZ4A 2N5AA 2MMNA 3KTBA 1TJDA 5B6NA 2H73A 2OE3A 3R3EA 2IIYA 2C8UA 3SBCA 1AQWA 3PGTA 3EU4A 2H70A 3QMXA 2JADA 3LXTA 5DJMA 2FA4A 3F4SA 5COHA 1OVNA 2HRKA 4LLRA 3VWUA 4XS4B 3GURA 2H71A 3M9JA 3P2AA 2MBTA 3F9UA 5KN1A 2CVBA 4EXJA 3TB2A 4V1Ag 2PVQA 3IK9A 5JWRB 2M80A 1K0MA 4RQXA 1XFLA 4X0XA 2B7KA 4EKZA 6GSSA 3D21A 3FY7A 2H6YA 1R4WA 2I4AA 4WEYA 3Q6OA 4AJ6A 4PURA 2A2SA 1M99A 1DE1A 5KN2A 4OFNA 3J7Yk 3A3TA 2H19A 5H5RA 4TR0A 5JCGA 3RPNA 3EU3A 2A2RA 2R4VA 2YZHA 3ZL5A 2LRNA 3ZITA 1F2EA 3CRTA 1TRUA 4V2NA 4RI6A 1JHBA 5DQYA 2HSMB 2E0QA 2PVOC 3TJJA 3HJPA 1OAZA 2K8SA 1THXA 2C1YA 3EYTA 3G7IA 1HD2A 1Q98A 3DVXA 4MJCA 1O81A 3GKNA 4YAVA 4WR5A 3CSHA 4MDCA 4N0ZA 1SJZA 2L6CA 3FEUA 1WE0A 5ELAA 2N5BA 5G2ZA 2CX4A 3TGZA 1Z6NA 5G30A 2DJKA 2HRFA 1FB0A 5ECOB 3VPTA 3FR3A 4WBRD 1JLVA 1OC9A 3PR8A 5CYYA 2R6KA 1U88A 4E8HA 2HQTA 1A2LA 4K6XA 3CSJA 3QR6A 5IMCA 5F06A 5AGYA 4WF4A 4TXVA 1EWXA 1DSBA 2F3MA 3VWWA 1YY7A 1JZWA 4AGSA 3QAVA 2QKEA 4ILFA 2HLSA 5G1KA 3APQA 3UIWA 1A0FA 4NPBA 1IYHA 3TUEA 3IA1A 1PKZA 3BD2A 4FYBA 4KA0A 5CAXA 1PRXA 3O3TA 5DJLA 2PBJA 1SKRB 1U3AA 2B1KA 2GT6A 1XWKA 1T00A 4IBPA 1PMTA 1BQ7A 1ZOFA 2M46A 4MPGA 1V2AA 4OD7A 1WP0A 3IAM2 1FW1A 1VF4A 2CT6A 5B7CA 3HHVA 1M0UA 4YQUA 1ABAA 4TR3A 4GCIA 5CRHA 3NZNA 5CRGA 3GN3A 2KLXA 4KH7A 1PL2A 1T4ZA 5D8IA 5F07A 3QPMA 4ZL7A 4K1FA 1ERTA 2FLSA 2HZEA 4K0GA 3WGDA 3UBKA 5H5QA 4DSQA 1XW5A 2VCVA 4N0VA 2OBIA 2YZUA 3DGQA 4JBBA 1Q4JA 4HEA2 2HFDA 1FG4A 4POKA 2I3YA 4DSSA 3G7JA 4P3YB 2P31A 3GX8A 3GH9A 2PU9C 3TKSE 1RW1A 4IQ1A 3I43A 2FCHA 5ELGA 3IV4A 3TOUA 1F3AA 1E6BA 2GDRA 1Y6EA 2K6VA 4N30A 1EV4A 4BWSA 4ECJA 1PA3A 4AJ7A 2IFQB 4POBA 3MSZA 1SL0B 3TRQA 3KXOA 1JFUA 2YN1A 5DALB 2F8FA 2H75A 1HYUA 1GH2A 1T8EB 2R5GA 4TVEA 5D9VA 3F0IA 1W89A 1NSWA 2XPEA 4RUVA 3TJFA 1WMJA 3LGCA 2XHFA 4IKHA 5ID2A 4FYCA 1V40A 2X8GA 1GTUA 4O5RA 4MF5A 2PUKC 2XPDA 5CRWA 3GYKA 2R37A 4WBJA 1V98A 1EGOA 2DJ0A 1XCCA 2ZUPA 3VPQA 1YEPA 2VM2A 3AY8A 2JSZA 2K9FA 3HZ8A 4CDOA 5LCZA 3DWVA 4ECIA 3D4MA 2FGXA 1A2JA 5DAKB 3ZZXA 2AYTA 5DBQA 3CYNA 3VWVA 4DSRA 5EY6A 5IMFA 4F2IA 3TDGA 4L0UA 2WCIA 1TOFA 4QL7A 1QMVA 2N5FA 4G0LA 5KEJA 12GSA 3MNGA 3UAPA 1NHYA 1JZDA 1TRWA 4HZ2A 1EOHA 3CSIA 16GSA 4TN8A 3QOUA 4WXTA 3ME8A 1EEJA 1GL8A 4IQAA 1WWJA 4HUAA 3I9V2 3US3A 1WOUA 3QFAC 4KW6A 3E3EA 2DIZA 3GIXA 1XOAA 3EINA 2WDUA 4IJ3A 4POLA 5IPGA 3SWLA 1QK8A 1QUWA 3TRXA 1GTBA 1XPVA 3GNJA 5IMDA 5AIXA 4YAPA 4OCFA 1YKCA 2A4VA 2FUG2 1SD9A 4EE0A 2PN8A 1WRYA 4XS6A 4EF0A 4J57E 4V2MA 4QQ7A 1OC8A 2FHEA 3GRXA 1JZRA 1FAAA 2O8VB 3FK8A 3TKSA 2P5RA 1QGVA 3QAGA 3CRUA 19GSA 1G7OA 2CX3A 3D4TA 3NOFA 2DSAA 5CNWA 1ZZYA 2FWEA 1XWAA 4JRRA 5DQSA 2E7PA 4K2DA 3J7Yb 2H1AA 5GSSA 2NTOA 2QC7A 3L9UA 1X0RA 4I6XA 4I2TA 1I5GA 4K9ZA 4BVYB 2HSNB 4ZB8A 4TR1A 4KDXA 4WKWA 5C00A 4F0BA 5F05A 1H75A 3LQ7A 1TI3A 2OE0A 2H0IA 2F9SA 1V57A 1VRSD 1HNAA 2TIRA 4FO5A 1X9WB 2J23A 5H5SA 3KD0A 2CQ9A 4CHSA 5LD0A 3IDVA 2LKUA 1GNEA 4N11A 4OO4A 1FVKA 1NHOA 3FKFA 3ZVJD 1JZOA 1S3DA 4KNDA 3P90A 2BJXA 3TKQA 4D73A 2HRKB 2VCZA 1K3YA 1GP1A 2LTKA 4ZL9A 5ENUA 3UVTA 1TRSA 1I9DA 1MD4A 2JZTA 3I6AA 3GKKA 2WZ9A 2L5LA 3A2XA 1B9YC 4HQZA 4JZQA 4GQFA 3ZFLA 3DD3A 5BMUA 4ZB6A 4ZB9A 3KJYA 4TKYA 1UVZA 3VFIA 3GHAA 1SKSB 1SJIA 2B5XA 2OACA 2IL3A 3ZIVA 5EPFA 1TTZA 3C73A 4F0CA 4I5QA 2O89A 3C1RA 2V1MA 3OR5A 4GTUA 4J2FA 3HVSA 3HCZA 2OBKA 4K8MA 1YQ1A 1LU4A 1SJ6A 3U6VA 4IJIA 2P0GA 1ERVA 3VI5A 4EO3A 1B4QA 4NWYA 2PERA 4PTSA 2GZPA 4F9ZA 5ECLB 2YCDA 3CTFA 4TXOB 2CZ3A 4WR4A 3QDNA 3HJOA 1X9SB 1K3OA 2VAFA 3DRNA 3FW2A 2KHPA 1GSUA 2L57A 3QD9A 4BL7A 2AHEA 1URMA 2DC5A 4KDYA 2MBSA 3FHKA 1MDKA 1BEDA 3UEMA 1XOBA 1AXDA 4PUAA 5B8BA 3RHBA 4XS4A 3WT1A 2L6DA 2GS3A 2IWTA 1M9BA 1ERUA 3VK9A 1GSSA 2VL3A 3A2WA 4KE3A 3RPPA 1OC9B 2XBIA 3D6IA 5JWQB 6GSYA 1O8WA 2X99A 1YDKA 5G5EA 3KGKA 1XWCA 4IS0A 4XCSA 2X64A 1XW9A 1G6YA 3QCPA 2EC4A 1GSYA 1ILOA 2H1GA 3LFLA 4TW5A 2VL2A 3LJRA 2PMTA 2G0FA 3KP8A 5J9CA 2C3NA 3IOSA 4MJBA 2LJKA 4AJ8A 2HSMA 1M2BA 1XWBA 3GFKA 3HDCA 1K0BA 2CAIA 1Z9HA 4HS1A 2KP2A 2CVKA 1TP9A 1TW9A 5D9WA 1VGLA 2H1BA 2VO4A 4TR4A 2JSYA 4I2UA 4EL1A 4ZBBA 1GWCA 1ML6A 22GSA 4BVXB 4XHMA 1K0NA 3F4RA 2YWNA 1TK0B 1EP7A 3FZ4A 5IMZA 1YKAA 3APSA 2TRXA 5E59A 2OE1A 1A23A 5ECNB 1LBKA 3IAS2 2GT5A 1A8LA 3EE2A 3LYKA 4LMWA 2GSQA 4NXIA 2RM6A 3IE3A 2IPAA 3HY2A 2DJ3A 3N5OA 2HRNA 5G5FA 1GRXA 1T1VA 1BX9A 2VCTA 2C80A 3PPUA 3D22A 2VL9A 5IO2A 9GSSA 1FVJA 2VOCA 5J3RA 2JU5A 3DVWA 2QGVA 1O73A 2H0GA 4FIWA 3ZMKA 1MDJA 2P5QA 4YQMA 3CMIA 4PNGA 5ECSA 3O76A 3DMLA 1TKDB 4HJMA 2VLUA 2VM1A 4USSA 5JCWA 1GSEA 3UMAA 1Z7PA 5CRDA 1GTAA 2WB9A 1SENA 2ALBA 4K7OA 4X1UA 4HU7A 5ID2B 1XWGA 4GRFA 3Q18A 5J9BA 1SYRA 2L4CA 2CZ2A 3KMNA 3ISOA 1PSQA 1KBNA 5D9XA 2V32A 1YF1A 2VCWA 4AF2A 4HI7A 3F3RA 5B8AA 4KSMA 2MMZA 1B48A 2IMIA 4OFTA 3WT2A 3ZYWA 4KDUA 1DUGA 4G0KA 4O7HA 3E0UA 3GX0A 5E4WA 5HR2A 3HXSA 4TOPA 1GSDA 1VF1A 3GKXA
chains in the Genus database with same CATH superfamily
2LUSA 1PD21 1ZMAA 2H6ZA 3LYPA 2DJ1A 3MWHA 4EVMA 3ME7A 4L0WA 20GSA 4O92A 3EVIA 2R2JA 4JE1A 3ZRDA 4GSNA 4HZ4A 2EFCA 6GSVA 3W8SA 2LJRA 5HFIA 4POMA 5J4UA 2H72A 3MIXA 3ERGA 2YP6A 3DKSA 3FR9A 2EIOA 6GSTA 3IC4A 1K0DA 1XVQA 2OA7A 5A5HB 1H4OA 1YJ6A 5KOWA 1O6JA 4MJEA 1PGTA 2LRTA 4HQSA 1PQNA 4PQIA 5FWGA 2YWIA 3K8NA 4LMVA 2X8CA 3UJ1A 2V6KA 4MF6A 1C72A 4G01A 7GSSA 3EMPA 6GSWA 1U6TA 2V2GA 2FY6A 3IK7A 4NHZA 1U87A 2M72A 4CW9A 1J08A 1N25A 1R5PA 2O7KA 2WULA 3GTUA 3ZIJA 3TKPA 4E8EA 2IJYA 2AB6A 4XRDA 3L78A 4K7NA 2PWJA 3CXGA 5DAKA 5A34B 1S3CA 2O87A 3ZTLA 3A5WA 1B4PA 4HSCX 1QFNA 3WYWA 1VF3A 2WW0A 4IW9A 4EC0A 1NM3A 2MMAA 5J41A 3Q74A 5A4WA 3LEFA 3EC3A 2B3SA 4OWYA 3C71A 3HVVA 4DVCA 1GLPA 1BYEA 2VKZG 2QA2A 2G2QA 3U5RE 2LEGA 3GSSA 2TRCP 2O36A 4ICYA 5JWOB 2CAQA 1GNWA 2WRTA 1EEMA 1ACVA 3KCMA 1K0CA 4ECBA 3UVHA 2DLXA 3F8UA 5JCUA 4CY8A 5ECMB 1Y25A 2REMA 5DCHA 3HJMA 5GAND 4Z7XA 2H74A 3HKRA 2HI7A 2YJHA 4PXOA 1BG5A 2LS5A 4AKHA 1NW2A 4RQRA 2WJUA 5HR3A 3HYPA 4X43A 1KNGA 5EL8A 2CA8A 3F6FA 6GSUA 3BJ5A 5IM9A 2LQOA 2YV9A 3GUSA 2B7JA 3GV1A 1IYIA 4NHWA 3RDWA 3M3MA 13GSA 1FOVA 2ON7A 3G9BA 1FB6A 3G7YA 3VI7A 3D5JA 1EGRA 3GL3A 3ERFA 2L59A 2YWOA 5G1LA 3D0ZA 1Y1UA 2B5YA 2H6XA 5GAPD 2DKIA 4IHUA 1O7UA 2R0CA 4MJAA 3TKRA 4GQCA 11GSA 2L5OA 1W4VA 1AUCA 2JACA 3RGBC 1I1IP 1YEXA 2EIRA 5KN0A 1ERWA 1TI1A 4FH8A 3QFBC 1SK0A 5ECIB 4I97A 1TK5B 3M0FA 1OE7A 3C1SA 2FWFA 2GZZA 3KIJA 4ZIJA 1J9BA 2YANA 2VCXA 2B5EA 2VCQA 2KOKA 1AIUA 3JCML 2I81A 5IOXA 1G0TA 2I9HA 3NIVA 4MPFA 2WW2A 4DEJA 1YEWC 3MDKA 3DIEA 2DMLA 3F4TA 4G2EA 4ZBDA 2H76A 2RIIA 1GUHA 2D2ZA 2JL4A 17GSA 2AUVA 1XW6A 4BL7B 3F3QA 1XXUA 2R3XA 3F63A 2VD0A 4K2XA 14GSA 2FNOA 5HQPA 4WF5A 3R2QA 4XRAA 1U3IA 1M2DA 5DVBA 1F37A 2VLVA 4HDEA 5IPHA 4LA1A 3TRPA 1SU9A 1GSQA 2BMXA 1SK1A 5CP1A 2WVXA 1XVWA 3APOA 4HOJA 3F6DA 2FD3A 2GGTA 1A8YA 5C04A 4L5OA 1GLQA 3A2VA 3PINA 1V58A 2VIMA 5A4VA 2X4AA 3S9FA 1PFOA 4AKGA 1A0RP 1S3AA 3CTGA 5ECKB 4Q5FA 3L9VA 2I1UA 2RUFA 1X5CA 4MABA 5IO0A 3IPZA 4PNFA 2E2GA 4F03A 2C0GA 1M3JA 3TJBA 3CHXC 2H0HA 5INYA 3VURA 4HJ2A 2OADA 1SK2A 3P8WA 4MH3A 2HNLA 1V9WA 4EUYA 3WGEA 4NMUA 3IRAA 3UOMA 1AC1A 3HVXA 3UARA 1MD3A 2LJAA 4TXOA 2DKHA 2GLRA 1DBYA 2CVDA 1PN9A 4V1Ap 2AJQB 3KH7A 4L5LA 5D73A 1BJXA 1G6WA 4GF0A 5G31A 3PH9A 3BBYA 3WGXA 4JEDA 4ECCA 2WS2A 1XZOA 3RAZA 1SL1B 2DJJA 4IVFA 4ID0A 3LXZA 1HNBA 3TJGA 2WW3A 3P7XA 4YH2A 4JU5A 1K3LA 3IR4A 1SL2B 4G19A 2O85A 1K0AA 3KH9A 4I8BA 1K0OA 2K8VA 4AKXB 2PPTA 1N8JA 4ZXGA 2IMDA 2XC2A 2MYGA 5D93A 3DEXA 5F8BA 4BPYA 2RLIA 10GSA 2NPBA 1USBA 1A24A 1FO5A 2RM5A 1YZXA 4GXZA 4MP4A 5HFKA 2GSRA 2HZEB 2ZNMA 1UC7A 2YJ7A 5D9TA 1R7HA 2C3TA 2JZRA 2MMOA 3VWXA 2OKAA 5FT3A 4ISDA 1ST9A 4MZCA 1E2YA 1GUMA 2LNSA 3EURA 3Q19A 3KEBA 5HR0A 4LL4B 4NAXA 3LORA 5LNKe 3M9KA 1O85A 1BF5A 4DSSB 5IOWA 1X5DA 3L0HA 4IELA 1ZGNA 5IIZA 1GUKA 1OKTA 1RQMA 4MH2A 3IXRA 2MZCA 4IP1A 2WVZA 3V1WA 2GQKA 3E9JB 4G9HA 4WETA 2HE3A 2VL2C 4YQVA 2X8HA 3KMOA 1ZL9A 3UBLA 2GQLA 4K0NA 4BVXA 3CBUA 4FYUA 3TOTA 2J9HA 4H86A 5ECHB 3MAKA 2VD1A 3KTLA 5A1NA 2KUCA 3H93A 4MZBA 2H30A 3C7MA 5IMVA 5J5NA 1HNCA 3L9SA 4NV2A 4BWQA 4MNNA 1PX7A 5HR1A 4RI7A 1LJRA 3EPTA 3ZVJA 4PGTA 4JR6A 5ECQB 4Q5NA 1Z7RA 4EIPA 5ECRB 1GULA 3TCOA 1TXXA 1EV9A 4MCUA 3FZ9A 3W8JA 4X4JA 1EZKA 2DIYA 5D96A 1F6MC 2L4QA 5L71A 3DYRA 2YPMA 1T7PB 2LRCA 1FHEA 3RBTA 4KSOA 3KP9A 3ZLPA 2GSTA 1KTEA 2GZYA 2VUPA 1AQXA 4N10A 1M2AA 1SVOA 4YKGA 3GMFA 5A4UA 4MK3A 1ZYQB 4XIHA 5AN1A 1BG1A 3IBHA 4KUNA 4QL9A 2HYXA 1TRVA 4XTSA 3IC8A 2H1DA 4BA7A 4MF7A 2WFCA 4PUFC 5CO3A 2VLTA 4PX1A 1YF0A 2WZSA 2IMKA 5B6MA 2YOIA 3W6GA 4GSTA 3ZREA 1X5EA 3UL3A 4ZBAA 1JLWA 5DCGA 1XBSA 3IHQA 1THOA 8GSSA 2HSYA 4O32A 3H8QA 3WD6A 1T3BA 2HXKA 1PL1A 2IMEA 3GTUB 2IFQA 2C0FA 2XBQA 1X9MB 4GLTA 4K5RA 5GZZB 1Z5YE 2HSHA 1MTCA 5DALA 1TU8A 4Q5RA 2UZ8A 1QXHA 1AQVA 4ZL8A 1OYJA 1Z6MA 1AW9A 4KAEA 5F0GA 1OE8A 2K18A 3C8EA 1M9AA 5A5KA 3BOAA 4JR4A 2V6OA 2HRAA 2H66A 2HZFA 3QAWA 5AISA 4K7IA 3N9JA 1EOGA 3HA9A 4TRXA 1R26A 4J56E 3GL5A 2LNTA 4MA9A 4G0IA 3HD5A 2BTOT 4GSSA 2AV4A 1N2AA 4OCEA 5AIVA 2HT9A 4KCAA 2NDOA 2NVLA 3FZ5A 2C0EA 1F3BA 4MMMA 4PQHA 2NBSA 5IMAA 4OO5A 4ML6A 2ES7A 4OMVA 3FRCA 1KEBA 1CQGA 1OKDA 5A5HA 4MLYA 5EVOA 4EDZA 1Z3EA 1G7EA 2LQQA 1O8XA 3KZQA 1CQHA 2R0PA 2QSIA 3GKMA 4FQUA 1R5AA 3FZAA 2GVPA 3EWLA 2RUEA 2IN3A 4V2LA 2GQMA 5ABRA 2LV3A 3H79A 1HQOA 2FA8A 3LWAA 3ED3A 2X49A 1TDIA 3I69A 2ZCTA 4HU9A 2B6MA 1A2MA 3VLNA 2YWMA 2E2MA 3KM6A 4ZILA 3M8NA 4PQ1A 3GH6A 4TR1B 2YV7A 1VF2A 3O6TA 5HFGA 1J0FA 1B8XA 4IP6A 2C4JA 1AAZA 3TJKA 1B9XC 4NV5A 2H01A 2YNXA 5A34A 1UN2A 4KB3A 2CV4A 2LSTA 4ULXA 3L4NA 2H1LA 3ZFBA 2EIQA 5CREA 3LSZA 2GSSA 2OJLA 5GSTA 4G10A 4XS1A 4D73B 1WJKA 2C0DA 1WPIA 3BCIA 1MDIA 2Z9SA 3FR6A 2ON5A 1SVMA 2FWGA 3LG6A 2KP1A 3H4KA 1GSFA 1ZYEA 1T4YA 4LL1B 3GA4A 18GSA 3BCKA 1TU7A 2H8LA 4L8EA 3EMXA 1OC3A 2F8AA 1PX6A 2PGTA 1ON4A 2IMFA 5FHIA 5IQYA 4GWRA 5BMUB 3CWGA 4KX4A 2B1LA 1TK8B 1MEKA 4ML1A 4F82A 1EP8A 2DBCA 1ZCPA 2EFHA 2DMMA 2FWHA 3FYGA 3GSTA 4KGIA 3ZMLA 1SKWB 5KOXA 1XIYA 4MZWA 2AAWA 2GTUA 2JZSA 1WIKA 5DDLA 1QQ2A 4KCEA 5ECPB 4AI6A 1RK4A 2QA1A 5KN3A 3M1GA 2A4HA 2DJ2A 2V41A 4KF9A 2F51A 1DE2A 4IN0A 4BVYA 4ACSA 2HSNA 1GTIA 2WVYA 1UA5A 3TKSC 4Q5QA 4EDYA 1BAYA 2WGRA 1PKWA 1M7TA 2WVXB 6GSXA 3DXBA 3RHCA 1SYXA 1SD8A 1F9MA 2C3QA 4OFMA 3ERWA 3HZ4A 3H1NA 4IGJA 2N5AA 2MMNA 3KTBA 1TJDA 5B6NA 2H73A 2OE3A 3R3EA 4GDFA 2C8UA 2IIYA 3SBCA 1AQWA 2R0GA 3PGTA 3EU4A 2H70A 2EFEA 3QMXA 2JADA 3LXTA 5DJMA 2FA4A 3F4SA 5COHA 1OVNA 2HRKA 4LLRA 3VWUA 3FMWA 4XS4B 3GURA 2H71A 4K5SA 3M9JA 3P2AA 2MBTA 3F9UA 5KN1A 2CVBA 4EXJA 3TB2A 4V1Ag 2PVQA 3IK9A 5JWRB 2M80A 1K0MA 4RQXA 1XFLA 4X0XA 2B7KA 4EKZA 6GSSA 3D21A 3FY7A 2H6YA 1R4WA 2I4AA 4WEYA 3Q6OA 4AJ6A 4PURA 2A2SA 1M99A 1DE1A 5KN2A 4OFNA 3J7Yk 3A3TA 2H19A 5H5RA 4TR0A 5JCGA 3RPNA 3EU3A 4O5UA 2A2RA 2R4VA 2YZHA 3ZL5A 2LRNA 3ZITA 1F2EA 3CRTA 1TRUA 4V2NA 4RI6A 1JHBA 5DQYA 2HSMB 2E0QA 2PVOC 3TJJA 3HJPA 1OAZA 2K8SA 1THXA 2C1YA 3EYTA 3G7IA 1HD2A 1Q98A 3DVXA 4MJCA 1O81A 3GKNA 1ZYNA 4YAVA 4WR5A 3CSHA 4MDCA 4N0ZA 1SJZA 3CQFA 2L6CA 2O5VA 1WE0A 3FEUA 4PI2C 5ELAA 2N5BA 5G2ZA 2CX4A 1SVLA 3TGZA 4ZB7A 1Z6NA 5G30A 2DJKA 2HRFA 1FB0A 5ECOB 3VPTA 3FR3A 4WBRD 1JLVA 1OC9A 3PR8A 3MYDA 5CYYA 2R6KA 1U88A 4E8HA 2HQTA 1A2LA 4K6XA 3CSJA 3QR6A 5IMCA 5F06A 5AGYA 4WF4A 3HVNA 4TXVA 1EWXA 1DSBA 2F3MA 3IHGA 3VWWA 1YY7A 1JZWA 4AGSA 3QAVA 2QKEA 2HLSA 4ILFA 5G1KA 3APQA 3UIWA 1A0FA 4NPBA 1IYHA 3TUEA 3IA1A 1PKZA 3BD2A 4FYBA 4KA0A 5CAXA 1PRXA 3O3TA 5DJLA 2PBJA 1SKRB 1U3AA 2B1KA 2GT6A 1XWKA 1T00A 4IBPA 1PMTA 1BQ7A 1ZOFA 2M46A 4MPGA 1V2AA 4OD7A 1WP0A 3IAM2 1FW1A 1VF4A 2CT6A 5B7CA 3HHVA 1M0UA 4YQUA 1ABAA 4TR3A 4GCIA 5CRHA 3NZNA 5CRGA 3GN3A 2KLXA 4KH7A 1PL2A 1T4ZA 5D8IA 5F07A 3QPMA 4ZL7A 4K1FA 1ERTA 2FLSA 2HZEA 4K0GA 3WGDA 3UBKA 5H5QA 4DSQA 1XW5A 2VCVA 4N0VA 2OBIA 2YZUA 3HMJG 3TU3B 3DGQA 4JBBA 1Q4JA 4HEA2 2HFDA 1FG4A 4POKA 2I3YA 4DSSA 3G7JA 4P3YB 2P31A 3GX8A 3GH9A 2PU9C 3TKSE 1RW1A 4IQ1A 3I43A 2FCHA 5ELGA 3IV4A 3TOUA 1F3AA 1E6BA 2GDRA 1Y6EA 2K6VA 4N30A 1EV4A 4BWSA 4ECJA 1PA3A 4AJ7A 2IFQB 4POBA 2WW1A 3MSZA 1SL0B 3TRQA 3KXOA 1JFUA 2YN1A 5DALB 2F8FA 2H75A 1HYUA 4FXYP 1GH2A 2A2PA 1T8EB 2R5GA 4TVEA 5D9VA 3F0IA 1W89A 1NSWA 2XPEA 4RUVA 3TJFA 1WMJA 3LGCA 2XHFA 4IKHA 5ID2A 4FYCA 1V40A 2X8GA 1GTUA 4O5RA 4MF5A 3RFRC 2PUKC 2XPDA 5CRWA 3GYKA 2R37A 4WBJA 1V98A 1EGOA 2DJ0A 1XCCA 2ZUPA 3VPQA 1YEPA 2VM2A 3AY8A 2JSZA 2K9FA 3HZ8A 4CDOA 5LCZA 3DWVA 4ECIA 3D4MA 2FGXA 1A2JA 5DAKB 3ZZXA 2AYTA 5DBQA 3CYNA 3VWVA 4DSRA 5EY6A 4E68A 4Z2UA 5IMFA 4F2IA 3TDGA 4L0UA 2WCIA 1TOFA 4QL7A 1QMVA 2N5FA 4G0LA 5KEJA 12GSA 3MNGA 3UAPA 1NHYA 1JZDA 1TRWA 4HZ2A 1EOHA 3CSIA 16GSA 4TN8A 3QOUA 4WXTA 3ME8A 1EEJA 1GL8A 4IQAA 1WWJA 4HUAA 3I9V2 3US3A 1WOUA 3QFAC 4KW6A 3E3EA 2DIZA 3GIXA 1XOAA 3EINA 2WDUA 4IJ3A 4POLA 5IPGA 3SWLA 4A5PA 1QK8A 1QUWA 3TRXA 1GTBA 1XPVA 3GNJA 5IMDA 5AIXA 4YAPA 4OCFA 1YKCA 2A4VA 2FUG2 1SD9A 4EE0A 2PN8A 1WRYA 4XS6A 4EF0A 4J57E 4V2MA 4QQ7A 1OC8A 2FHEA 4EIQA 3GRXA 1JZRA 1FAAA 2O8VB 1YVLA 4N3ZA 3FK8A 1PN0A 3TKSA 2P5RA 1QGVA 3QAGA 3CRUA 19GSA 1G7OA 2CX3A 3D4TA 3NOFA 2DSAA 5CNWA 1ZZYA 2FWEA 1XWAA 4JRRA 5DQSA 2E7PA 4K2DA 3J7Yb 2H1AA 5GSSA 2NTOA 2QC7A 3L9UA 1X0RA 4I6XA 4I2TA 1I5GA 5J4VA 4K9ZA 4BVYB 2HSNB 4ZB8A 4TR1A 4KDXA 4WKWA 5C00A 4F0BA 5F05A 1H75A 3LQ7A 1TI3A 2OE0A 2H0IA 5J47A 2F9SA 1V57A 1VRSD 5BRTA 1HNAA 2TIRA 4FO5A 1X9WB 2J23A 5H5SA 3KD0A 2CQ9A 4CHSA 5LD0A 3IDVA 2LKUA 1GNEA 4N11A 4OO4A 1FVKA 1NHOA 4PI0C 3FKFA 3ZVJD 1JZOA 1S3DA 4KNDA 3P90A 2BJXA 3TKQA 4D73A 2HRKB 4BIKA 2VCZA 1K3YA 1GP1A 2LTKA 4ZL9A 5ENUA 3UVTA 1TRSA 1I9DA 4PHZC 1MD4A 2JZTA 3I6AA 3GKKA 2WZ9A 2L5LA 3A2XA 1B9YC 4HQZA 4JZQA 4GQFA 3ZFLA 3DD3A 5BMUA 4ZB6A 4ZB9A 3KJYA 4TKYA 1UVZA 3VFIA 3GHAA 1SKSB 1SJIA 2B5XA 2OACA 2IL3A 3ZIVA 5EPFA 1TTZA 3C73A 4F0CA 4I5QA 2O89A 3C1RA 2V1MA 3OR5A 4GTUA 4J2FA 3HVSA 3HCZA 2OBKA 4K8MA 1YQ1A 1LU4A 1SJ6A 3U6VA 4IJIA 2P0GA 1ERVA 3VI5A 4EO3A 1B4QA 3A5IA 4NWYA 2PERA 4PTSA 2GZPA 4F9ZA 5ECLB 2YCDA 3CTFA 4TXOB 2CZ3A 4WR4A 3QDNA 3HJOA 1X9SB 1K3OA 2VAFA 3DRNA 4W66A 5J40A 3FW2A 2KHPA 1GSUA 2L57A 3QD9A 4BL7A 3LW9A 2AHEA 1URMA 2DC5A 4KDYA 2MBSA 3FHKA 5J4YA 1BEDA 1MDKA 3UEMA 4YKFA 1XOBA 4Z2RA 1AXDA 4PUAA 5B8BA 3RHBA 4XS4A 3WT1A 2L6DA 1S4BP 2GS3A 2IWTA 1M9BA 1ERUA 3VK9A 1GSSA 2VL3A 3A2WA 4KE3A 4CY6A 3RPPA 1OC9B 2XBIA 3D6IA 5JWQB 6GSYA 1O8WA 2X99A 1YDKA 5G5EA 2UV8G 3KGKA 1XWCA 4IS0A 4XCSA 2X64A 1XW9A 1G6YA 3QCPA 2EC4A 1GSYA 1ILOA 2H1GA 3LFLA 4TW5A 2VL2A 3LJRA 2PMTA 2G0FA 3KP8A 5J9CA 2C3NA 4AKIA 3IOSA 4MJBA 2LJKA 4AJ8A 2HSMA 1M2BA 1XWBA 3GFKA 3HDCA 1K0BA 1ZYPA 2CAIA 1M3IA 1Z9HA 4HS1A 2KP2A 2CVKA 1TP9A 1TW9A 5D9WA 1VGLA 2H1BA 2VO4A 4TR4A 2JSYA 1TXUA 4I2UA 4EL1A 4ZBBA 1GWCA 1ML6A 22GSA 4BVXB 4XHMA 1K0NA 3F4RA 2YWNA 1TK0B 1EP7A 3FZ4A 1FOHA 5IMZA 1YKAA 3APSA 2TRXA 5A1NB 5E59A 2OE1A 1A23A 5ECNB 1LBKA 3IAS2 2GT5A 1A8LA 3EE2A 3LYKA 4LMWA 2GSQA 4NXIA 2RM6A 3IE3A 2IPAA 3HY2A 2DJ3A 3N5OA 2HRNA 5G5FA 1GRXA 1T1VA 1BX9A 2VCTA 2C80A 3PPUA 3D22A 2VL9A 5IO2A 9GSSA 1FVJA 2VOCA 5J3RA 2JU5A 3DVWA 2QGVA 1O73A 4QMKA 2H0GA 4FIWA 3ZMKA 1MDJA 2P5QA 1XG8A 4YQMA 3CMIA 4PNGA 5ECSA 3O76A 2OT3A 3DMLA 1TKDB 4HJMA 2VLUA 2VM1A 4Z2TA 2O3EA 4USSA 5JCWA 1GSEA 3UMAA 1Z7PA 4O5QA 5CRDA 1GTAA 2WB9A 1SENA 2ALBA 4K7OA 4X1UA 4HU7A 5ID2B 1XWGA 4GRFA 3Q18A 5J9BA 1SYRA 2L4CA 2CZ2A 3KMNA 3ISOA 1PSQA 1KBNA 5D9XA 2V32A 1YF1A 1S3RA 2VCWA 4AF2A 4HI7A 3F3RA 5B8AA 4KSMA 2MMZA 2EFDA 1B48A 2IMIA 4OFTA 3WT2A 3ZYWA 4KDUA 1DUGA 4G0KA 4O7HA 3E0UA 3GX0A 5E4WA 5HR2A 3HXSA 4TOPA 1GSDA 1VF1A 3GKXA
chains in the Genus database with same CATH topology
2LUSA 1PD21 1ZMAA 2H6ZA 3LYPA 2DJ1A 3MWHA 4EVMA 3ME7A 4L0WA 20GSA 4O92A 3EVIA 2R2JA 4JE1A 3ZRDA 4GSNA 4HZ4A 2EFCA 6GSVA 3W8SA 2LJRA 5HFIA 4POMA 5J4UA 2H72A 3MIXA 3ERGA 2YP6A 3DKSA 3FR9A 2EIOA 6GSTA 3IC4A 1K0DA 1XVQA 2OA7A 5A5HB 1H4OA 1YJ6A 5KOWA 1O6JA 4MJEA 1PGTA 2LRTA 4HQSA 1PQNA 4PQIA 5FWGA 2YWIA 3K8NA 4LMVA 2X8CA 3UJ1A 2V6KA 4MF6A 1C72A 4G01A 7GSSA 3EMPA 6GSWA 1U6TA 2V2GA 2FY6A 3IK7A 4NHZA 1U87A 2M72A 4CW9A 1J08A 1N25A 1R5PA 2O7KA 2WULA 3GTUA 3ZIJA 3TKPA 4E8EA 2IJYA 2AB6A 4XRDA 3L78A 4K7NA 2PWJA 3CXGA 5DAKA 5A34B 1S3CA 2O87A 3ZTLA 3A5WA 1B4PA 1QFNA 3WYWA 1VF3A 4IW9A 4EC0A 1NM3A 2MMAA 5J41A 3Q74A 5A4WA 3LEFA 3EC3A 2B3SA 4OWYA 3C71A 3HVVA 4DVCA 1GLPA 1BYEA 2VKZG 2QA2A 2G2QA 3U5RE 2LEGA 3GSSA 2TRCP 4ICYA 5JWOB 2CAQA 1GNWA 2WRTA 1EEMA 1ACVA 3KCMA 1K0CA 4ECBA 3UVHA 2DLXA 3F8UA 5JCUA 4CY8A 5ECMB 1Y25A 2REMA 5DCHA 3HJMA 5GAND 4Z7XA 2H74A 3HKRA 2HI7A 2YJHA 4PXOA 1BG5A 2LS5A 4AKHA 1NW2A 4RQRA 2WJUA 5HR3A 3HYPA 4X43A 1KNGA 5EL8A 2CA8A 3F6FA 6GSUA 3BJ5A 5IM9A 2LQOA 2YV9A 3GUSA 2B7JA 3GV1A 1IYIA 4NHWA 3RDWA 3M3MA 13GSA 1FOVA 2ON7A 3G9BA 1FB6A 3G7YA 3VI7A 3D5JA 1EGRA 3GL3A 3ERFA 2L59A 2YWOA 5G1LA 3D0ZA 1Y1UA 2B5YA 2H6XA 5GAPD 2DKIA 4IHUA 1O7UA 2R0CA 4MJAA 3TKRA 4GQCA 11GSA 2L5OA 1W4VA 1AUCA 2JACA 1YEXA 2EIRA 5KN0A 1ERWA 1TI1A 4FH8A 3QFBC 1SK0A 5ECIB 4I97A 1TK5B 3M0FA 1OE7A 3C1SA 2FWFA 2GZZA 3KIJA 4ZIJA 1J9BA 2YANA 2VCXA 2B5EA 2VCQA 2KOKA 1AIUA 3JCML 2I81A 5IOXA 1G0TA 2I9HA 3NIVA 4MPFA 4DEJA 3MDKA 3DIEA 2DMLA 3F4TA 4G2EA 4ZBDA 2H76A 2RIIA 1GUHA 2D2ZA 2JL4A 17GSA 2AUVA 1XW6A 4BL7B 3F3QA 1XXUA 2R3XA 3F63A 2VD0A 4K2XA 14GSA 2FNOA 5HQPA 4WF5A 3R2QA 4XRAA 1U3IA 1M2DA 5DVBA 1F37A 2VLVA 4HDEA 5IPHA 4LA1A 3TRPA 1SU9A 1GSQA 2BMXA 1SK1A 5CP1A 1XVWA 3APOA 4HOJA 3F6DA 2FD3A 2GGTA 1A8YA 5C04A 4L5OA 1GLQA 3A2VA 3PINA 1V58A 2VIMA 5A4VA 2X4AA 3S9FA 4AKGA 1A0RP 1S3AA 3CTGA 5ECKB 4Q5FA 3L9VA 2I1UA 2RUFA 1X5CA 4MABA 5IO0A 3IPZA 4PNFA 2E2GA 4F03A 2C0GA 3TJBA 2H0HA 5INYA 3VURA 4HJ2A 2OADA 1SK2A 3P8WA 4MH3A 2HNLA 1V9WA 4EUYA 3WGEA 4NMUA 3IRAA 3UOMA 1AC1A 3HVXA 3UARA 1MD3A 2LJAA 4TXOA 2DKHA 2GLRA 1DBYA 2CVDA 1PN9A 4V1Ap 2AJQB 3KH7A 4L5LA 5D73A 1BJXA 1G6WA 4GF0A 5G31A 3PH9A 3BBYA 3WGXA 4JEDA 4ECCA 2WS2A 1XZOA 3RAZA 1SL1B 2DJJA 4IVFA 4ID0A 3LXZA 1HNBA 3TJGA 3P7XA 4YH2A 4JU5A 1K3LA 3IR4A 1SL2B 4G19A 2O85A 1K0AA 3KH9A 4I8BA 1K0OA 2K8VA 4AKXB 2PPTA 1N8JA 4ZXGA 2IMDA 2XC2A 2MYGA 5D93A 3DEXA 5F8BA 4BPYA 2RLIA 10GSA 2NPBA 1USBA 1A24A 1FO5A 2RM5A 1YZXA 4GXZA 4MP4A 5HFKA 2GSRA 2HZEB 2ZNMA 1UC7A 2YJ7A 5D9TA 1R7HA 2C3TA 2JZRA 2MMOA 3VWXA 2OKAA 5FT3A 4ISDA 1ST9A 4MZCA 1E2YA 1GUMA 2LNSA 3EURA 3Q19A 3KEBA 5HR0A 4LL4B 4NAXA 3LORA 5LNKe 3M9KA 1O85A 1BF5A 4DSSB 5IOWA 1X5DA 3L0HA 4IELA 1ZGNA 5IIZA 1GUKA 1OKTA 1RQMA 4MH2A 3IXRA 2MZCA 4IP1A 3V1WA 2GQKA 3E9JB 4G9HA 4WETA 2HE3A 2VL2C 4YQVA 2X8HA 3KMOA 1ZL9A 3UBLA 2GQLA 4K0NA 4BVXA 3CBUA 4FYUA 3TOTA 2J9HA 4H86A 5ECHB 3MAKA 2VD1A 3KTLA 5A1NA 2KUCA 3H93A 4MZBA 2H30A 3C7MA 5IMVA 5J5NA 1HNCA 3L9SA 4NV2A 4BWQA 4MNNA 1PX7A 5HR1A 4RI7A 1LJRA 3EPTA 3ZVJA 4PGTA 4JR6A 5ECQB 4Q5NA 1Z7RA 4EIPA 5ECRB 1GULA 3TCOA 1TXXA 1EV9A 4MCUA 3FZ9A 3W8JA 4X4JA 1EZKA 2DIYA 5D96A 1F6MC 2L4QA 5L71A 3DYRA 2YPMA 1T7PB 2LRCA 1FHEA 3RBTA 4KSOA 3KP9A 3ZLPA 2GSTA 1KTEA 2GZYA 2VUPA 1AQXA 4N10A 1M2AA 1SVOA 4YKGA 3GMFA 5A4UA 4MK3A 1ZYQB 4XIHA 5AN1A 1BG1A 3IBHA 4KUNA 4QL9A 2HYXA 1TRVA 4XTSA 3IC8A 2H1DA 4BA7A 4MF7A 2WFCA 4PUFC 5CO3A 2VLTA 4PX1A 1YF0A 2IMKA 5B6MA 2YOIA 3W6GA 4GSTA 3ZREA 1X5EA 3UL3A 4ZBAA 1JLWA 5DCGA 1XBSA 3IHQA 1THOA 8GSSA 2HSYA 4O32A 3H8QA 3WD6A 1T3BA 2HXKA 1PL1A 2IMEA 3GTUB 2IFQA 2C0FA 2XBQA 1X9MB 4GLTA 4K5RA 5GZZB 1Z5YE 2HSHA 1MTCA 5DALA 1TU8A 4Q5RA 2UZ8A 1QXHA 1AQVA 4ZL8A 1OYJA 1Z6MA 1AW9A 4KAEA 5F0GA 1OE8A 2K18A 3C8EA 1M9AA 5A5KA 3BOAA 4JR4A 2V6OA 2HRAA 2H66A 2HZFA 3QAWA 5AISA 4K7IA 3N9JA 1EOGA 3HA9A 4TRXA 1R26A 4J56E 3GL5A 2LNTA 4MA9A 4G0IA 3HD5A 2BTOT 4GSSA 2AV4A 1N2AA 4OCEA 5AIVA 2HT9A 4KCAA 2NDOA 2NVLA 3FZ5A 2C0EA 1F3BA 4MMMA 4PQHA 2NBSA 5IMAA 4OO5A 4ML6A 2ES7A 4OMVA 3FRCA 1KEBA 1CQGA 1OKDA 5A5HA 4MLYA 5EVOA 4EDZA 1Z3EA 1G7EA 2LQQA 1O8XA 3KZQA 1CQHA 2R0PA 2QSIA 3GKMA 4FQUA 1R5AA 3FZAA 2GVPA 3EWLA 2RUEA 2IN3A 4V2LA 2GQMA 5ABRA 2LV3A 3H79A 1HQOA 2FA8A 3LWAA 3ED3A 2X49A 1TDIA 3I69A 2ZCTA 4HU9A 2B6MA 1A2MA 3VLNA 2YWMA 2E2MA 3KM6A 4ZILA 3M8NA 4PQ1A 3GH6A 4TR1B 2YV7A 1VF2A 3O6TA 5HFGA 1J0FA 1B8XA 4IP6A 2C4JA 1AAZA 3TJKA 1B9XC 4NV5A 2H01A 2YNXA 5A34A 1UN2A 4KB3A 2CV4A 2LSTA 4ULXA 3L4NA 2H1LA 3ZFBA 2EIQA 5CREA 3LSZA 2GSSA 2OJLA 5GSTA 4G10A 4XS1A 4D73B 1WJKA 2C0DA 1WPIA 3BCIA 1MDIA 2Z9SA 3FR6A 2ON5A 1SVMA 2FWGA 3LG6A 2KP1A 3H4KA 1GSFA 1ZYEA 1T4YA 4LL1B 3GA4A 18GSA 3BCKA 1TU7A 2H8LA 4L8EA 3EMXA 1OC3A 2F8AA 1PX6A 2PGTA 1ON4A 2IMFA 5FHIA 5IQYA 4GWRA 5BMUB 3CWGA 4KX4A 2B1LA 1TK8B 1MEKA 4ML1A 4F82A 1EP8A 2DBCA 1ZCPA 2EFHA 2DMMA 2FWHA 3FYGA 3GSTA 4KGIA 3ZMLA 1SKWB 5KOXA 1XIYA 4MZWA 2AAWA 2GTUA 2JZSA 1WIKA 5DDLA 1QQ2A 4KCEA 5ECPB 4AI6A 1RK4A 2QA1A 5KN3A 3M1GA 2A4HA 2DJ2A 2V41A 4KF9A 2F51A 1DE2A 4IN0A 4BVYA 4ACSA 2HSNA 1GTIA 1UA5A 3TKSC 4Q5QA 4EDYA 1BAYA 2WGRA 1PKWA 1M7TA 6GSXA 3DXBA 3RHCA 1SYXA 1SD8A 1F9MA 2C3QA 4OFMA 3ERWA 4IGJA 3H1NA 3HZ4A 2N5AA 2MMNA 3KTBA 1TJDA 5B6NA 2H73A 2OE3A 3R3EA 4GDFA 2C8UA 2IIYA 3SBCA 1AQWA 2R0GA 3PGTA 3EU4A 2H70A 2EFEA 3QMXA 2JADA 3LXTA 5DJMA 2FA4A 3F4SA 5COHA 1OVNA 2HRKA 4LLRA 3VWUA 3FMWA 4XS4B 3GURA 2H71A 4K5SA 3M9JA 3P2AA 2MBTA 3F9UA 5KN1A 2CVBA 4EXJA 3TB2A 4V1Ag 2PVQA 3IK9A 5JWRB 2M80A 1K0MA 4RQXA 1XFLA 4X0XA 2B7KA 4EKZA 6GSSA 3D21A 3FY7A 2H6YA 1R4WA 2I4AA 4WEYA 3Q6OA 4AJ6A 4PURA 2A2SA 1M99A 1DE1A 5KN2A 4OFNA 3J7Yk 3A3TA 2H19A 5H5RA 4TR0A 5JCGA 3RPNA 3EU3A 4O5UA 2A2RA 2R4VA 2YZHA 3ZL5A 2LRNA 3ZITA 1F2EA 3CRTA 1TRUA 4V2NA 4RI6A 1JHBA 5DQYA 2HSMB 2E0QA 2PVOC 3TJJA 3HJPA 1OAZA 2K8SA 1THXA 2C1YA 3EYTA 3G7IA 1HD2A 1Q98A 3DVXA 4MJCA 1O81A 3GKNA 1ZYNA 4YAVA 4WR5A 3CSHA 4MDCA 4N0ZA 1SJZA 2L6CA 2O5VA 1WE0A 3FEUA 5ELAA 2N5BA 5G2ZA 2CX4A 1SVLA 3TGZA 4ZB7A 1Z6NA 5G30A 2DJKA 2HRFA 1FB0A 5ECOB 3VPTA 3FR3A 4WBRD 1JLVA 1OC9A 3PR8A 3MYDA 5CYYA 2R6KA 1U88A 4E8HA 2HQTA 1A2LA 4K6XA 3CSJA 3QR6A 5IMCA 5F06A 5AGYA 4WF4A 4TXVA 1EWXA 1DSBA 2F3MA 3IHGA 3VWWA 1YY7A 1JZWA 4AGSA 3QAVA 2QKEA 2HLSA 4ILFA 5G1KA 3APQA 3UIWA 1A0FA 4NPBA 1IYHA 3TUEA 3IA1A 1PKZA 3BD2A 4FYBA 4KA0A 5CAXA 1PRXA 3O3TA 5DJLA 2PBJA 1SKRB 1U3AA 2B1KA 2GT6A 1XWKA 1T00A 4IBPA 1PMTA 1BQ7A 1ZOFA 2M46A 4MPGA 1V2AA 4OD7A 1WP0A 3IAM2 1FW1A 1VF4A 2CT6A 5B7CA 3HHVA 1M0UA 4YQUA 1ABAA 4TR3A 4GCIA 5CRHA 3NZNA 5CRGA 3GN3A 2KLXA 4KH7A 1PL2A 1T4ZA 5D8IA 5F07A 3QPMA 4ZL7A 4K1FA 1ERTA 2FLSA 2HZEA 4K0GA 3WGDA 3UBKA 5H5QA 4DSQA 1XW5A 2VCVA 4N0VA 2OBIA 2YZUA 3HMJG 3TU3B 3DGQA 4JBBA 1Q4JA 4HEA2 2HFDA 1FG4A 4POKA 2I3YA 4DSSA 3G7JA 4P3YB 2P31A 3GX8A 3GH9A 2PU9C 3TKSE 1RW1A 4IQ1A 3I43A 2FCHA 5ELGA 3IV4A 3TOUA 1F3AA 1E6BA 2GDRA 1Y6EA 2K6VA 4N30A 1EV4A 4BWSA 4ECJA 1PA3A 4AJ7A 2IFQB 4POBA 3MSZA 1SL0B 3TRQA 3KXOA 1JFUA 2YN1A 5DALB 2F8FA 2H75A 1HYUA 1GH2A 2A2PA 1T8EB 2R5GA 4TVEA 5D9VA 3F0IA 1W89A 1NSWA 2XPEA 4RUVA 3TJFA 1WMJA 3LGCA 2XHFA 4IKHA 5ID2A 4FYCA 1V40A 2X8GA 1GTUA 4O5RA 4MF5A 2PUKC 2XPDA 5CRWA 3GYKA 2R37A 4WBJA 1V98A 1EGOA 2DJ0A 1XCCA 2ZUPA 3VPQA 1YEPA 2VM2A 3AY8A 2JSZA 2K9FA 3HZ8A 4CDOA 5LCZA 3DWVA 4ECIA 3D4MA 2FGXA 1A2JA 5DAKB 3ZZXA 2AYTA 5DBQA 3CYNA 3VWVA 4DSRA 5EY6A 4E68A 4Z2UA 5IMFA 4F2IA 3TDGA 4L0UA 2WCIA 1TOFA 4QL7A 1QMVA 2N5FA 4G0LA 5KEJA 12GSA 3MNGA 3UAPA 1NHYA 1JZDA 1TRWA 4HZ2A 1EOHA 3CSIA 16GSA 4TN8A 3QOUA 4WXTA 3ME8A 1EEJA 1GL8A 4IQAA 1WWJA 4HUAA 3I9V2 3US3A 1WOUA 3QFAC 4KW6A 3E3EA 2DIZA 3GIXA 1XOAA 3EINA 2WDUA 4IJ3A 4POLA 5IPGA 3SWLA 4A5PA 1QK8A 1QUWA 3TRXA 1GTBA 1XPVA 3GNJA 5IMDA 5AIXA 4YAPA 4OCFA 1YKCA 2A4VA 2FUG2 1SD9A 4EE0A 2PN8A 1WRYA 4XS6A 4EF0A 4J57E 4V2MA 4QQ7A 1OC8A 2FHEA 4EIQA 3GRXA 1JZRA 1FAAA 2O8VB 1YVLA 4N3ZA 3FK8A 1PN0A 3TKSA 2P5RA 1QGVA 3QAGA 3CRUA 19GSA 1G7OA 2CX3A 3D4TA 3NOFA 2DSAA 5CNWA 1ZZYA 2FWEA 1XWAA 4JRRA 5DQSA 2E7PA 4K2DA 3J7Yb 2H1AA 5GSSA 2NTOA 2QC7A 3L9UA 1X0RA 4I6XA 4I2TA 1I5GA 5J4VA 4K9ZA 4BVYB 2HSNB 4ZB8A 4TR1A 4KDXA 4WKWA 5C00A 4F0BA 5F05A 1H75A 3LQ7A 1TI3A 2OE0A 2H0IA 5J47A 2F9SA 1V57A 1VRSD 5BRTA 1HNAA 2TIRA 4FO5A 1X9WB 2J23A 5H5SA 3KD0A 2CQ9A 4CHSA 5LD0A 3IDVA 2LKUA 1GNEA 4N11A 4OO4A 1FVKA 1NHOA 3FKFA 3ZVJD 1JZOA 1S3DA 4KNDA 3P90A 2BJXA 3TKQA 4D73A 2HRKB 2VCZA 1K3YA 1GP1A 2LTKA 4ZL9A 5ENUA 3UVTA 1TRSA 1I9DA 1MD4A 2JZTA 3I6AA 3GKKA 2WZ9A 2L5LA 3A2XA 1B9YC 4HQZA 4JZQA 4GQFA 3ZFLA 3DD3A 5BMUA 4ZB6A 4ZB9A 3KJYA 4TKYA 1UVZA 3VFIA 3GHAA 1SKSB 1SJIA 2B5XA 2OACA 2IL3A 3ZIVA 5EPFA 1TTZA 3C73A 4F0CA 4I5QA 2O89A 3C1RA 2V1MA 3OR5A 4GTUA 4J2FA 3HVSA 3HCZA 2OBKA 4K8MA 1YQ1A 1LU4A 1SJ6A 3U6VA 4IJIA 2P0GA 1ERVA 3VI5A 4EO3A 1B4QA 3A5IA 4NWYA 2PERA 4PTSA 2GZPA 4F9ZA 5ECLB 2YCDA 3CTFA 4TXOB 2CZ3A 4WR4A 3QDNA 3HJOA 1X9SB 1K3OA 2VAFA 3DRNA 4W66A 5J40A 3FW2A 2KHPA 1GSUA 2L57A 3QD9A 4BL7A 3LW9A 2AHEA 1URMA 2DC5A 4KDYA 2MBSA 3FHKA 5J4YA 1BEDA 1MDKA 3UEMA 4YKFA 1XOBA 4Z2RA 1AXDA 4PUAA 5B8BA 3RHBA 4XS4A 3WT1A 2L6DA 2GS3A 2IWTA 1M9BA 1ERUA 3VK9A 1GSSA 2VL3A 3A2WA 4KE3A 4CY6A 3RPPA 1OC9B 2XBIA 3D6IA 5JWQB 6GSYA 1O8WA 2X99A 1YDKA 5G5EA 2UV8G 3KGKA 1XWCA 4IS0A 4XCSA 2X64A 1XW9A 1G6YA 3QCPA 2EC4A 1GSYA 1ILOA 2H1GA 3LFLA 4TW5A 2VL2A 3LJRA 2PMTA 2G0FA 3KP8A 5J9CA 2C3NA 4AKIA 3IOSA 4MJBA 2LJKA 4AJ8A 2HSMA 1M2BA 1XWBA 3GFKA 3HDCA 1K0BA 1ZYPA 2CAIA 1Z9HA 4HS1A 2KP2A 2CVKA 1TP9A 1TW9A 5D9WA 1VGLA 2H1BA 2VO4A 4TR4A 2JSYA 1TXUA 4I2UA 4EL1A 4ZBBA 1GWCA 1ML6A 22GSA 4BVXB 4XHMA 1K0NA 3F4RA 2YWNA 1TK0B 1EP7A 3FZ4A 1FOHA 5IMZA 1YKAA 3APSA 2TRXA 5A1NB 5E59A 2OE1A 1A23A 5ECNB 1LBKA 3IAS2 2GT5A 1A8LA 3EE2A 3LYKA 4LMWA 2GSQA 4NXIA 2RM6A 3IE3A 2IPAA 3HY2A 2DJ3A 3N5OA 2HRNA 5G5FA 1GRXA 1T1VA 1BX9A 2VCTA 2C80A 3PPUA 3D22A 2VL9A 5IO2A 9GSSA 1FVJA 2VOCA 5J3RA 2JU5A 3DVWA 2QGVA 1O73A 4QMKA 2H0GA 4FIWA 3ZMKA 1MDJA 2P5QA 4YQMA 3CMIA 4PNGA 5ECSA 3O76A 2OT3A 3DMLA 1TKDB 4HJMA 2VLUA 2VM1A 4Z2TA 4USSA 5JCWA 1GSEA 3UMAA 1Z7PA 4O5QA 5CRDA 1GTAA 2WB9A 1SENA 2ALBA 4K7OA 4X1UA 4HU7A 5ID2B 1XWGA 4GRFA 3Q18A 5J9BA 1SYRA 2L4CA 2CZ2A 3KMNA 3ISOA 1PSQA 1KBNA 5D9XA 2V32A 1YF1A 2VCWA 4AF2A 4HI7A 3F3RA 5B8AA 4KSMA 2MMZA 2EFDA 1B48A 2IMIA 4OFTA 3WT2A 3ZYWA 4KDUA 1DUGA 4G0KA 4O7HA 3E0UA 3GX0A 5E4WA 5HR2A 3HXSA 4TOPA 1GSDA 1VF1A 3GKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUS A;  1PD2 1;  1ZMA A;  2H6Z A;  3LYP A;  2DJ1 A;  3MWH A;  4EVM A;  3ME7 A;  4L0W A;  20GS A;  4O92 A;  3EVI A;  2R2J A;  4JE1 A;  3ZRD A;  4GSN A;  4HZ4 A;  6GSV A;  3W8S A;  2LJR A;  5HFI A;  4POM A;  5J4U A;  2H72 A;  3ERG A;  2YP6 A;  3DKS A;  3FR9 A;  2EIO A;  6GST A;  3IC4 A;  1K0D A;  1XVQ A;  2OA7 A;  1H4O A;  1YJ6 A;  1O6J A;  4MJE A;  1PGT A;  2LRT A;  4HQS A;  1PQN A;  4PQI A;  5FWG A;  2YWI A;  3K8N A;  4LMV A;  2X8C A;  3UJ1 A;  2V6K A;  4MF6 A;  1C72 A;  7GSS A;  3EMP A;  6GSW A;  1U6T A;  2V2G A;  2FY6 A;  3IK7 A;  4NHZ A;  1U87 A;  2M72 A;  4CW9 A;  1J08 A;  1R5P A;  2O7K A;  2WUL A;  3GTU A;  3ZIJ A;  3TKP A;  4E8E A;  2IJY A;  2AB6 A;  4XRD A;  3L78 A;  4K7N A;  2PWJ A;  3CXG A;  5DAK A;  1S3C A;  2O87 A;  3ZTL A;  3A5W A;  1B4P A;  1QFN A;  3WYW A;  1VF3 A;  4IW9 A;  4EC0 A;  1NM3 A;  2MMA A;  5J41 A;  3Q74 A;  5A4W A;  3LEF A;  3EC3 A;  2B3S A;  4OWY A;  3C71 A;  3HVV A;  4DVC A;  1GLP A;  1BYE A;  2G2Q A;  3U5R E;  2LEG A;  3GSS A;  2TRC P;  5JWO B;  2CAQ A;  1GNW A;  2WRT A;  1EEM A;  1ACV A;  3KCM A;  1K0C A;  4ECB A;  3UVH A;  2DLX A;  3F8U A;  5JCU A;  5ECM B;  1Y25 A;  2REM A;  5DCH A;  3HJM A;  5GAN D;  4Z7X A;  2H74 A;  3HKR A;  2HI7 A;  2YJH A;  4PXO A;  1BG5 A;  2LS5 A;  1NW2 A;  4RQR A;  2WJU A;  5HR3 A;  3HYP A;  4X43 A;  1KNG A;  5EL8 A;  2CA8 A;  3F6F A;  6GSU A;  3BJ5 A;  5IM9 A;  2LQO A;  2YV9 A;  3GUS A;  2B7J A;  3GV1 A;  1IYI A;  4NHW A;  3RDW A;  3M3M A;  13GS A;  1FOV A;  2ON7 A;  3G9B A;  1FB6 A;  3G7Y A;  3VI7 A;  3D5J A;  1EGR A;  3GL3 A;  3ERF A;  2L59 A;  2YWO A;  5G1L A;  3D0Z A;  2B5Y A;  2H6X A;  5GAP D;  4IHU A;  1O7U A;  4MJA A;  3TKR A;  4GQC A;  11GS A;  2L5O A;  1W4V A;  1AUC A;  2JAC A;  1YEX A;  2EIR A;  5KN0 A;  1ERW A;  1TI1 A;  4FH8 A;  3QFB C;  1SK0 A;  5ECI B;  4I97 A;  1TK5 B;  3M0F A;  1OE7 A;  3C1S A;  2FWF A;  2GZZ A;  3KIJ A;  4ZIJ A;  1J9B A;  2YAN A;  2VCX A;  2B5E A;  2VCQ A;  2KOK A;  1AIU A;  3JCM L;  2I81 A;  5IOX A;  1G0T A;  2I9H A;  3NIV A;  4MPF A;  4DEJ A;  3MDK A;  3DIE A;  2DML A;  3F4T A;  4G2E A;  4ZBD A;  2H76 A;  2RII A;  1GUH A;  2D2Z A;  2JL4 A;  17GS A;  2AUV A;  1XW6 A;  4BL7 B;  3F3Q A;  1XXU A;  2R3X A;  3F63 A;  2VD0 A;  14GS A;  2FNO A;  5HQP A;  4WF5 A;  3R2Q A;  4XRA A;  1U3I A;  1M2D A;  5DVB A;  1F37 A;  2VLV A;  4HDE A;  5IPH A;  4LA1 A;  3TRP A;  1SU9 A;  1GSQ A;  2BMX A;  1SK1 A;  5CP1 A;  1XVW A;  3APO A;  4HOJ A;  3F6D A;  2FD3 A;  2GGT A;  1A8Y A;  5C04 A;  4L5O A;  1GLQ A;  3A2V A;  3PIN A;  1V58 A;  2VIM A;  5A4V A;  3S9F A;  1A0R P;  1S3A A;  3CTG A;  5ECK B;  4Q5F A;  3L9V A;  2I1U A;  2RUF A;  1X5C A;  4MAB A;  5IO0 A;  3IPZ A;  4PNF A;  2E2G A;  4F03 A;  2C0G A;  3TJB A;  2H0H A;  5INY A;  3VUR A;  4HJ2 A;  2OAD A;  1SK2 A;  3P8W A;  4MH3 A;  2HNL A;  1V9W A;  4EUY A;  3WGE A;  4NMU A;  3IRA A;  3UOM A;  1AC1 A;  3HVX A;  3UAR A;  1MD3 A;  2LJA A;  4TXO A;  2GLR A;  1DBY A;  2CVD A;  1PN9 A;  4V1A p;  2AJQ B;  3KH7 A;  4L5L A;  5D73 A;  1BJX A;  1G6W A;  4GF0 A;  5G31 A;  3PH9 A;  3BBY A;  3WGX A;  4JED A;  4ECC A;  2WS2 A;  1XZO A;  3RAZ A;  1SL1 B;  2DJJ A;  4IVF A;  4ID0 A;  3LXZ A;  1HNB A;  3TJG A;  3P7X A;  4YH2 A;  4JU5 A;  1K3L A;  3IR4 A;  1SL2 B;  4G19 A;  2O85 A;  1K0A A;  3KH9 A;  4I8B A;  1K0O A;  2K8V A;  2PPT A;  1N8J A;  4ZXG A;  2IMD A;  2XC2 A;  2MYG A;  5D93 A;  3DEX A;  5F8B A;  4BPY A;  2RLI A;  10GS A;  2NPB A;  1USB A;  1A24 A;  1FO5 A;  2RM5 A;  4GXZ A;  1YZX A;  4MP4 A;  5HFK A;  2GSR A;  2HZE B;  2ZNM A;  1UC7 A;  2YJ7 A;  5D9T A;  1R7H A;  2C3T A;  2JZR A;  2MMO A;  3VWX A;  2OKA A;  5FT3 A;  4ISD A;  1ST9 A;  4MZC A;  1E2Y A;  1GUM A;  2LNS A;  3EUR A;  3Q19 A;  3KEB A;  5HR0 A;  4LL4 B;  4NAX A;  3LOR A;  5LNK e;  3M9K A;  1O85 A;  4DSS B;  5IOW A;  1X5D A;  3L0H A;  4IEL A;  1ZGN A;  5IIZ A;  1GUK A;  1OKT A;  1RQM A;  4MH2 A;  3IXR A;  2MZC A;  4IP1 A;  3V1W A;  2GQK A;  3E9J B;  4G9H A;  4WET A;  2HE3 A;  2VL2 C;  4YQV A;  2X8H A;  3KMO A;  1ZL9 A;  3UBL A;  2GQL A;  4K0N A;  4BVX A;  3CBU A;  4FYU A;  3TOT A;  2J9H A;  4H86 A;  5ECH B;  3MAK A;  2VD1 A;  3KTL A;  2KUC A;  3H93 A;  4MZB A;  2H30 A;  3C7M A;  5IMV A;  5J5N A;  1HNC A;  3L9S A;  4NV2 A;  4BWQ A;  1PX7 A;  5HR1 A;  4RI7 A;  1LJR A;  3ZVJ A;  4PGT A;  4JR6 A;  5ECQ B;  4Q5N A;  1Z7R A;  5ECR B;  1GUL A;  3TCO A;  1TXX A;  1EV9 A;  4MCU A;  3FZ9 A;  3W8J A;  1EZK A;  2DIY A;  5D96 A;  1F6M C;  2L4Q A;  5L71 A;  3DYR A;  2YPM A;  1T7P B;  2LRC A;  1FHE A;  3RBT A;  4KSO A;  3KP9 A;  3ZLP A;  2GST A;  1KTE A;  2GZY A;  2VUP A;  1AQX A;  4N10 A;  1M2A A;  3GMF A;  5A4U A;  4MK3 A;  1ZYQ B;  4XIH A;  5AN1 A;  3IBH A;  4KUN A;  4QL9 A;  2HYX A;  1TRV A;  4XTS A;  3IC8 A;  2H1D A;  4BA7 A;  4MF7 A;  2WFC A;  4PUF C;  5CO3 A;  2VLT A;  4PX1 A;  1YF0 A;  2IMK A;  5B6M A;  2YOI A;  3W6G A;  4GST A;  3ZRE A;  1X5E A;  3UL3 A;  4ZBA A;  1JLW A;  5DCG A;  1XBS A;  3IHQ A;  1THO A;  8GSS A;  2HSY A;  4O32 A;  3H8Q A;  3WD6 A;  1T3B A;  2HXK A;  1PL1 A;  2IME A;  3GTU B;  2IFQ A;  2C0F A;  2XBQ A;  1X9M B;  4GLT A;  5GZZ B;  1Z5Y E;  2HSH A;  1MTC A;  5DAL A;  1TU8 A;  4Q5R A;  2UZ8 A;  1QXH A;  1AQV A;  4ZL8 A;  1OYJ A;  1Z6M A;  1AW9 A;  4KAE A;  5F0G A;  1OE8 A;  2K18 A;  3C8E A;  1M9A A;  5A5K A;  3BOA A;  4JR4 A;  2V6O A;  2HRA A;  2H66 A;  2HZF A;  3QAW A;  5AIS A;  4K7I A;  3N9J A;  1EOG A;  3HA9 A;  4TRX A;  1R26 A;  4J56 E;  3GL5 A;  2LNT A;  4MA9 A;  4G0I A;  3HD5 A;  2BTO T;  4GSS A;  2AV4 A;  1N2A A;  4OCE A;  5AIV A;  2HT9 A;  4KCA A;  2NDO A;  2NVL A;  3FZ5 A;  2C0E A;  1F3B A;  4MMM A;  4PQH A;  2NBS A;  5IMA A;  4OO5 A;  4ML6 A;  2ES7 A;  4OMV A;  3FRC A;  1KEB A;  1CQG A;  1OKD A;  4MLY A;  5EVO A;  4EDZ A;  1Z3E A;  1G7E A;  2LQQ A;  1O8X A;  3KZQ A;  1CQH A;  2QSI A;  3GKM A;  4FQU A;  1R5A A;  3FZA A;  2GVP A;  3EWL A;  2RUE A;  2IN3 A;  4V2L A;  2GQM A;  5ABR A;  2LV3 A;  3H79 A;  1HQO A;  2FA8 A;  3LWA A;  3ED3 A;  1TDI A;  3I69 A;  2ZCT A;  4HU9 A;  2B6M A;  1A2M A;  3VLN A;  2YWM A;  2E2M A;  3KM6 A;  4ZIL A;  3M8N A;  4PQ1 A;  3GH6 A;  4TR1 B;  2YV7 A;  1VF2 A;  3O6T A;  5HFG A;  1J0F A;  1B8X A;  4IP6 A;  2C4J A;  1AAZ A;  3TJK A;  1B9X C;  4NV5 A;  2H01 A;  2YNX A;  1UN2 A;  4KB3 A;  2CV4 A;  2LST A;  4ULX A;  3L4N A;  3ZFB A;  2EIQ A;  5CRE A;  3LSZ A;  2GSS A;  2OJL A;  5GST A;  4G10 A;  4XS1 A;  4D73 B;  1WJK A;  2C0D A;  1WPI A;  3BCI A;  1MDI A;  2Z9S A;  3FR6 A;  2ON5 A;  2FWG A;  3LG6 A;  2KP1 A;  3H4K A;  1GSF A;  1ZYE A;  1T4Y A;  4LL1 B;  3GA4 A;  18GS A;  3BCK A;  1TU7 A;  2H8L A;  4L8E A;  3EMX A;  1OC3 A;  2F8A A;  1PX6 A;  2PGT A;  1ON4 A;  2IMF A;  5FHI A;  5IQY A;  4GWR A;  4KX4 A;  2B1L A;  1TK8 B;  1MEK A;  4ML1 A;  4F82 A;  1EP8 A;  2DBC A;  1ZCP A;  2DMM A;  2FWH A;  3FYG A;  3GST A;  4KGI A;  3ZML A;  1SKW B;  1XIY A;  4MZW A;  2AAW A;  2GTU A;  2JZS A;  1WIK A;  5DDL A;  1QQ2 A;  4KCE A;  5ECP B;  1RK4 A;  5KN3 A;  3M1G A;  2V41 A;  2DJ2 A;  4KF9 A;  2F51 A;  1DE2 A;  4IN0 A;  4BVY A;  4ACS A;  1GTI A;  1UA5 A;  3TKS C;  4Q5Q A;  4EDY A;  1BAY A;  2WGR A;  1PKW A;  1M7T A;  6GSX A;  3DXB A;  3RHC A;  1SYX A;  1SD8 A;  1F9M A;  2C3Q A;  4OFM A;  3ERW A;  4IGJ A;  3H1N A;  3HZ4 A;  2N5A A;  2MMN A;  3KTB A;  1TJD A;  5B6N A;  2H73 A;  2OE3 A;  3R3E A;  2IIY A;  2C8U A;  3SBC A;  1AQW A;  3PGT A;  3EU4 A;  2H70 A;  3QMX A;  2JAD A;  3LXT A;  5DJM A;  2FA4 A;  3F4S A;  5COH A;  1OVN A;  2HRK A;  4LLR A;  3VWU A;  4XS4 B;  3GUR A;  2H71 A;  3M9J A;  3P2A A;  2MBT A;  3F9U A;  5KN1 A;  2CVB A;  4EXJ A;  3TB2 A;  4V1A g;  2PVQ A;  3IK9 A;  5JWR B;  2M80 A;  1K0M A;  4RQX A;  1XFL A;  4X0X A;  2B7K A;  4EKZ A;  6GSS A;  3D21 A;  3FY7 A;  2H6Y A;  1R4W A;  2I4A A;  4WEY A;  3Q6O A;  4AJ6 A;  4PUR A;  2A2S A;  1M99 A;  1DE1 A;  5KN2 A;  4OFN A;  3J7Y k;  3A3T A;  2H19 A;  5H5R A;  4TR0 A;  5JCG A;  3RPN A;  3EU3 A;  2A2R A;  2R4V A;  2YZH A;  3ZL5 A;  2LRN A;  3ZIT A;  1F2E A;  3CRT A;  1TRU A;  4V2N A;  4RI6 A;  1JHB A;  5DQY A;  2HSM B;  2E0Q A;  2PVO C;  3TJJ A;  3HJP A;  1OAZ A;  2K8S A;  1THX A;  2C1Y A;  3EYT A;  3G7I A;  1HD2 A;  1Q98 A;  3DVX A;  4MJC A;  1O81 A;  3GKN A;  4YAV A;  4WR5 A;  3CSH A;  4MDC A;  4N0Z A;  1SJZ A;  2L6C A;  3FEU A;  1WE0 A;  5ELA A;  2N5B A;  5G2Z A;  2CX4 A;  3TGZ A;  1Z6N A;  5G30 A;  2DJK A;  2HRF A;  1FB0 A;  5ECO B;  3VPT A;  3FR3 A;  4WBR D;  1JLV A;  1OC9 A;  3PR8 A;  5CYY A;  2R6K A;  1U88 A;  4E8H A;  2HQT A;  1A2L A;  4K6X A;  3CSJ A;  3QR6 A;  5IMC A;  5F06 A;  5AGY A;  4WF4 A;  4TXV A;  1EWX A;  1DSB A;  2F3M A;  3VWW A;  1YY7 A;  1JZW A;  4AGS A;  3QAV A;  2QKE A;  4ILF A;  2HLS A;  5G1K A;  3APQ A;  3UIW A;  1A0F A;  4NPB A;  1IYH A;  3TUE A;  3IA1 A;  1PKZ A;  3BD2 A;  4FYB A;  4KA0 A;  5CAX A;  1PRX A;  3O3T A;  5DJL A;  2PBJ A;  1SKR B;  1U3A A;  2B1K A;  2GT6 A;  1XWK A;  1T00 A;  4IBP A;  1PMT A;  1BQ7 A;  1ZOF A;  2M46 A;  4MPG A;  1V2A A;  4OD7 A;  1WP0 A;  3IAM 2;  1FW1 A;  1VF4 A;  2CT6 A;  5B7C A;  3HHV A;  1M0U A;  4YQU A;  1ABA A;  4TR3 A;  4GCI A;  5CRH A;  3NZN A;  5CRG A;  3GN3 A;  2KLX A;  4KH7 A;  1PL2 A;  1T4Z A;  5D8I A;  5F07 A;  3QPM A;  4ZL7 A;  4K1F A;  1ERT A;  2FLS A;  2HZE A;  4K0G A;  3WGD A;  3UBK A;  5H5Q A;  4DSQ A;  1XW5 A;  2VCV A;  4N0V A;  2OBI A;  2YZU A;  3DGQ A;  4JBB A;  1Q4J A;  4HEA 2;  2HFD A;  1FG4 A;  4POK A;  2I3Y A;  4DSS A;  3G7J A;  4P3Y B;  2P31 A;  3GX8 A;  3GH9 A;  2PU9 C;  3TKS E;  1RW1 A;  4IQ1 A;  3I43 A;  2FCH A;  5ELG A;  3IV4 A;  3TOU A;  1F3A A;  1E6B A;  2GDR A;  1Y6E A;  2K6V A;  4N30 A;  1EV4 A;  4BWS A;  4ECJ A;  1PA3 A;  4AJ7 A;  2IFQ B;  4POB A;  3MSZ A;  1SL0 B;  3TRQ A;  3KXO A;  1JFU A;  2YN1 A;  5DAL B;  2F8F A;  2H75 A;  1HYU A;  1GH2 A;  1T8E B;  2R5G A;  4TVE A;  5D9V A;  3F0I A;  1W89 A;  1NSW A;  2XPE A;  4RUV A;  3TJF A;  1WMJ A;  3LGC A;  2XHF A;  4IKH A;  5ID2 A;  4FYC A;  1V40 A;  2X8G A;  1GTU A;  4O5R A;  4MF5 A;  2PUK C;  2XPD A;  5CRW A;  3GYK A;  2R37 A;  4WBJ A;  1V98 A;  1EGO A;  2DJ0 A;  1XCC A;  2ZUP A;  3VPQ A;  1YEP A;  2VM2 A;  3AY8 A;  2JSZ A;  2K9F A;  3HZ8 A;  4CDO A;  5LCZ A;  3DWV A;  4ECI A;  3D4M A;  2FGX A;  1A2J A;  5DAK B;  3ZZX A;  2AYT A;  5DBQ A;  3CYN A;  3VWV A;  4DSR A;  5EY6 A;  5IMF A;  4F2I A;  3TDG A;  4L0U A;  2WCI A;  1TOF A;  4QL7 A;  1QMV A;  2N5F A;  4G0L A;  5KEJ A;  12GS A;  3MNG A;  3UAP A;  1NHY A;  1JZD A;  1TRW A;  4HZ2 A;  1EOH A;  3CSI A;  16GS A;  4TN8 A;  3QOU A;  4WXT A;  3ME8 A;  1EEJ A;  1GL8 A;  4IQA A;  1WWJ A;  4HUA A;  3I9V 2;  3US3 A;  1WOU A;  3QFA C;  4KW6 A;  3E3E A;  2DIZ A;  3GIX A;  1XOA A;  3EIN A;  2WDU A;  4IJ3 A;  4POL A;  5IPG A;  3SWL A;  1QK8 A;  1QUW A;  3TRX A;  1GTB A;  1XPV A;  3GNJ A;  5IMD A;  5AIX A;  4YAP A;  4OCF A;  1YKC A;  2A4V A;  2FUG 2;  1SD9 A;  4EE0 A;  2PN8 A;  1WRY A;  4XS6 A;  4EF0 A;  4J57 E;  4V2M A;  4QQ7 A;  1OC8 A;  2FHE A;  3GRX A;  1JZR A;  1FAA A;  2O8V B;  3FK8 A;  3TKS A;  2P5R A;  1QGV A;  3QAG A;  3CRU A;  19GS A;  1G7O A;  2CX3 A;  3D4T A;  3NOF A;  2DSA A;  5CNW A;  1ZZY A;  2FWE A;  1XWA A;  4JRR A;  5DQS A;  2E7P A;  4K2D A;  3J7Y b;  2H1A A;  5GSS A;  2NTO A;  2QC7 A;  3L9U A;  1X0R A;  4I6X A;  4I2T A;  1I5G A;  4K9Z A;  4BVY B;  2HSN B;  4ZB8 A;  4TR1 A;  4KDX A;  4WKW A;  5C00 A;  4F0B A;  5F05 A;  1H75 A;  3LQ7 A;  1TI3 A;  2OE0 A;  2H0I A;  2F9S A;  1V57 A;  1VRS D;  1HNA A;  2TIR A;  4FO5 A;  1X9W B;  2J23 A;  5H5S A;  3KD0 A;  2CQ9 A;  4CHS A;  5LD0 A;  3IDV A;  2LKU A;  1GNE A;  4N11 A;  4OO4 A;  1FVK A;  1NHO A;  3FKF A;  3ZVJ D;  1JZO A;  1S3D A;  4KND A;  3P90 A;  2BJX A;  3TKQ A;  4D73 A;  2HRK B;  2VCZ A;  1K3Y A;  1GP1 A;  2LTK A;  4ZL9 A;  5ENU A;  3UVT A;  1TRS A;  1I9D A;  1MD4 A;  2JZT A;  3I6A A;  3GKK A;  2WZ9 A;  2L5L A;  3A2X A;  1B9Y C;  4HQZ A;  4JZQ A;  4GQF A;  3ZFL A;  3DD3 A;  5BMU A;  4ZB6 A;  4ZB9 A;  3KJY A;  4TKY A;  1UVZ A;  3VFI A;  3GHA A;  1SKS B;  1SJI A;  2B5X A;  2OAC A;  2IL3 A;  3ZIV A;  5EPF A;  1TTZ A;  3C73 A;  4F0C A;  4I5Q A;  2O89 A;  3C1R A;  2V1M A;  3OR5 A;  4GTU A;  4J2F A;  3HVS A;  3HCZ A;  2OBK A;  4K8M A;  1YQ1 A;  1LU4 A;  1SJ6 A;  3U6V A;  4IJI A;  2P0G A;  1ERV A;  3VI5 A;  4EO3 A;  1B4Q A;  4NWY A;  2PER A;  4PTS A;  2GZP A;  4F9Z A;  5ECL B;  2YCD A;  3CTF A;  4TXO B;  2CZ3 A;  4WR4 A;  3QDN A;  3HJO A;  1X9S B;  1K3O A;  2VAF A;  3DRN A;  3FW2 A;  2KHP A;  1GSU A;  2L57 A;  3QD9 A;  4BL7 A;  2AHE A;  1URM A;  2DC5 A;  4KDY A;  2MBS A;  3FHK A;  1MDK A;  1BED A;  3UEM A;  1XOB A;  1AXD A;  4PUA A;  5B8B A;  3RHB A;  4XS4 A;  3WT1 A;  2L6D A;  2GS3 A;  2IWT A;  1M9B A;  1ERU A;  3VK9 A;  1GSS A;  2VL3 A;  3A2W A;  4KE3 A;  3RPP A;  1OC9 B;  2XBI A;  3D6I A;  5JWQ B;  6GSY A;  1O8W A;  2X99 A;  1YDK A;  5G5E A;  3KGK A;  1XWC A;  4IS0 A;  4XCS A;  2X64 A;  1XW9 A;  1G6Y A;  3QCP A;  2EC4 A;  1GSY A;  1ILO A;  2H1G A;  3LFL A;  4TW5 A;  2VL2 A;  3LJR A;  2PMT A;  2G0F A;  3KP8 A;  5J9C A;  2C3N A;  3IOS A;  4MJB A;  2LJK A;  4AJ8 A;  2HSM A;  1M2B A;  1XWB A;  3GFK A;  3HDC A;  1K0B A;  2CAI A;  1Z9H A;  4HS1 A;  2KP2 A;  2CVK A;  1TP9 A;  1TW9 A;  5D9W A;  1VGL A;  2H1B A;  2VO4 A;  4TR4 A;  2JSY A;  4I2U A;  4EL1 A;  4ZBB A;  1GWC A;  1ML6 A;  22GS A;  4BVX B;  4XHM A;  1K0N A;  3F4R A;  2YWN A;  1TK0 B;  1EP7 A;  3FZ4 A;  5IMZ A;  1YKA A;  3APS A;  2TRX A;  5E59 A;  2OE1 A;  1A23 A;  5ECN B;  1LBK A;  3IAS 2;  2GT5 A;  1A8L A;  3EE2 A;  3LYK A;  4LMW A;  2GSQ A;  4NXI A;  2RM6 A;  3IE3 A;  2IPA A;  3HY2 A;  2DJ3 A;  3N5O A;  2HRN A;  5G5F A;  1GRX A;  1T1V A;  1BX9 A;  2VCT A;  2C80 A;  3PPU A;  3D22 A;  2VL9 A;  5IO2 A;  9GSS A;  1FVJ A;  2VOC A;  5J3R A;  2JU5 A;  3DVW A;  2QGV A;  1O73 A;  2H0G A;  4FIW A;  3ZMK A;  1MDJ A;  2P5Q A;  4YQM A;  3CMI A;  4PNG A;  5ECS A;  3O76 A;  3DML A;  1TKD B;  4HJM A;  2VLU A;  2VM1 A;  4USS A;  5JCW A;  1GSE A;  3UMA A;  1Z7P A;  5CRD A;  1GTA A;  2WB9 A;  1SEN A;  2ALB A;  4K7O A;  4X1U A;  4HU7 A;  5ID2 B;  1XWG A;  4GRF A;  3Q18 A;  5J9B A;  1SYR A;  2L4C A;  2CZ2 A;  3KMN A;  3ISO A;  1PSQ A;  1KBN A;  5D9X A;  2V32 A;  1YF1 A;  2VCW A;  4AF2 A;  4HI7 A;  3F3R A;  5B8A A;  4KSM A;  2MMZ A;  1B48 A;  2IMI A;  4OFT A;  3WT2 A;  3ZYW A;  4KDU A;  1DUG A;  4G0K A;  4O7H A;  3E0U A;  3GX0 A;  5E4W A;  5HR2 A;  3HXS A;  4TOP A;  1GSD A;  1VF1 A;  3GKX A; 
#chains in the Genus database with same CATH topology
 2LUS A;  1PD2 1;  1ZMA A;  2H6Z A;  3LYP A;  2DJ1 A;  3MWH A;  4EVM A;  3ME7 A;  4L0W A;  20GS A;  4O92 A;  3EVI A;  2R2J A;  4JE1 A;  3ZRD A;  4GSN A;  4HZ4 A;  2EFC A;  6GSV A;  3W8S A;  2LJR A;  5HFI A;  4POM A;  5J4U A;  2H72 A;  3MIX A;  3ERG A;  2YP6 A;  3DKS A;  3FR9 A;  2EIO A;  6GST A;  3IC4 A;  1K0D A;  1XVQ A;  2OA7 A;  5A5H B;  1H4O A;  1YJ6 A;  5KOW A;  1O6J A;  4MJE A;  1PGT A;  2LRT A;  4HQS A;  1PQN A;  4PQI A;  5FWG A;  2YWI A;  3K8N A;  4LMV A;  2X8C A;  3UJ1 A;  2V6K A;  4MF6 A;  1C72 A;  4G01 A;  7GSS A;  3EMP A;  6GSW A;  1U6T A;  2V2G A;  2FY6 A;  3IK7 A;  4NHZ A;  1U87 A;  2M72 A;  4CW9 A;  1J08 A;  1N25 A;  1R5P A;  2O7K A;  2WUL A;  3GTU A;  3ZIJ A;  3TKP A;  4E8E A;  2IJY A;  2AB6 A;  4XRD A;  3L78 A;  4K7N A;  2PWJ A;  3CXG A;  5DAK A;  5A34 B;  1S3C A;  2O87 A;  3ZTL A;  3A5W A;  1B4P A;  4HSC X;  1QFN A;  3WYW A;  1VF3 A;  2WW0 A;  4IW9 A;  4EC0 A;  1NM3 A;  2MMA A;  5J41 A;  3Q74 A;  5A4W A;  3LEF A;  3EC3 A;  2B3S A;  4OWY A;  3C71 A;  3HVV A;  4DVC A;  1GLP A;  1BYE A;  2VKZ G;  2QA2 A;  2G2Q A;  3U5R E;  2LEG A;  3GSS A;  2TRC P;  2O36 A;  4ICY A;  5JWO B;  2CAQ A;  1GNW A;  2WRT A;  1EEM A;  1ACV A;  3KCM A;  1K0C A;  4ECB A;  3UVH A;  2DLX A;  3F8U A;  5JCU A;  4CY8 A;  5ECM B;  1Y25 A;  2REM A;  5DCH A;  3HJM A;  5GAN D;  4Z7X A;  2H74 A;  3HKR A;  2HI7 A;  2YJH A;  4PXO A;  1BG5 A;  2LS5 A;  4AKH A;  1NW2 A;  4RQR A;  2WJU A;  5HR3 A;  3HYP A;  4X43 A;  1KNG A;  5EL8 A;  2CA8 A;  3F6F A;  6GSU A;  3BJ5 A;  5IM9 A;  2LQO A;  2YV9 A;  3GUS A;  2B7J A;  3GV1 A;  1IYI A;  4NHW A;  3RDW A;  3M3M A;  13GS A;  1FOV A;  2ON7 A;  3G9B A;  1FB6 A;  3G7Y A;  3VI7 A;  3D5J A;  1EGR A;  3GL3 A;  3ERF A;  2L59 A;  2YWO A;  5G1L A;  3D0Z A;  1Y1U A;  2B5Y A;  2H6X A;  5GAP D;  2DKI A;  4IHU A;  1O7U A;  2R0C A;  4MJA A;  3TKR A;  4GQC A;  11GS A;  2L5O A;  1W4V A;  1AUC A;  2JAC A;  3RGB C;  1I1I P;  1YEX A;  2EIR A;  5KN0 A;  1ERW A;  1TI1 A;  4FH8 A;  3QFB C;  1SK0 A;  5ECI B;  4I97 A;  1TK5 B;  3M0F A;  1OE7 A;  3C1S A;  2FWF A;  2GZZ A;  3KIJ A;  4ZIJ A;  1J9B A;  2YAN A;  2VCX A;  2B5E A;  2VCQ A;  2KOK A;  1AIU A;  3JCM L;  2I81 A;  5IOX A;  1G0T A;  2I9H A;  3NIV A;  4MPF A;  2WW2 A;  4DEJ A;  1YEW C;  3MDK A;  3DIE A;  2DML A;  3F4T A;  4G2E A;  4ZBD A;  2H76 A;  2RII A;  1GUH A;  2D2Z A;  2JL4 A;  17GS A;  2AUV A;  1XW6 A;  4BL7 B;  3F3Q A;  1XXU A;  2R3X A;  3F63 A;  2VD0 A;  4K2X A;  14GS A;  2FNO A;  5HQP A;  4WF5 A;  3R2Q A;  4XRA A;  1U3I A;  1M2D A;  5DVB A;  1F37 A;  2VLV A;  4HDE A;  5IPH A;  4LA1 A;  3TRP A;  1SU9 A;  1GSQ A;  2BMX A;  1SK1 A;  5CP1 A;  2WVX A;  1XVW A;  3APO A;  4HOJ A;  3F6D A;  2FD3 A;  2GGT A;  1A8Y A;  5C04 A;  4L5O A;  1GLQ A;  3A2V A;  3PIN A;  1V58 A;  2VIM A;  5A4V A;  2X4A A;  3S9F A;  1PFO A;  4AKG A;  1A0R P;  1S3A A;  3CTG A;  5ECK B;  4Q5F A;  3L9V A;  2I1U A;  2RUF A;  1X5C A;  4MAB A;  5IO0 A;  3IPZ A;  4PNF A;  2E2G A;  4F03 A;  2C0G A;  1M3J A;  3TJB A;  3CHX C;  2H0H A;  5INY A;  3VUR A;  4HJ2 A;  2OAD A;  1SK2 A;  3P8W A;  4MH3 A;  2HNL A;  1V9W A;  4EUY A;  3WGE A;  4NMU A;  3IRA A;  3UOM A;  1AC1 A;  3HVX A;  3UAR A;  1MD3 A;  2LJA A;  4TXO A;  2DKH A;  2GLR A;  1DBY A;  2CVD A;  1PN9 A;  4V1A p;  2AJQ B;  3KH7 A;  4L5L A;  5D73 A;  1BJX A;  1G6W A;  4GF0 A;  5G31 A;  3PH9 A;  3BBY A;  3WGX A;  4JED A;  4ECC A;  2WS2 A;  1XZO A;  3RAZ A;  1SL1 B;  2DJJ A;  4IVF A;  4ID0 A;  3LXZ A;  1HNB A;  3TJG A;  2WW3 A;  3P7X A;  4YH2 A;  4JU5 A;  1K3L A;  3IR4 A;  1SL2 B;  4G19 A;  2O85 A;  1K0A A;  3KH9 A;  4I8B A;  1K0O A;  2K8V A;  4AKX B;  2PPT A;  1N8J A;  4ZXG A;  2IMD A;  2XC2 A;  2MYG A;  5D93 A;  3DEX A;  5F8B A;  4BPY A;  2RLI A;  10GS A;  2NPB A;  1USB A;  1A24 A;  1FO5 A;  2RM5 A;  1YZX A;  4GXZ A;  4MP4 A;  5HFK A;  2GSR A;  2HZE B;  2ZNM A;  1UC7 A;  2YJ7 A;  5D9T A;  1R7H A;  2C3T A;  2JZR A;  2MMO A;  3VWX A;  2OKA A;  5FT3 A;  4ISD A;  1ST9 A;  4MZC A;  1E2Y A;  1GUM A;  2LNS A;  3EUR A;  3Q19 A;  3KEB A;  5HR0 A;  4LL4 B;  4NAX A;  3LOR A;  5LNK e;  3M9K A;  1O85 A;  1BF5 A;  4DSS B;  5IOW A;  1X5D A;  3L0H A;  4IEL A;  1ZGN A;  5IIZ A;  1GUK A;  1OKT A;  1RQM A;  4MH2 A;  3IXR A;  2MZC A;  4IP1 A;  2WVZ A;  3V1W A;  2GQK A;  3E9J B;  4G9H A;  4WET A;  2HE3 A;  2VL2 C;  4YQV A;  2X8H A;  3KMO A;  1ZL9 A;  3UBL A;  2GQL A;  4K0N A;  4BVX A;  3CBU A;  4FYU A;  3TOT A;  2J9H A;  4H86 A;  5ECH B;  3MAK A;  2VD1 A;  3KTL A;  5A1N A;  2KUC A;  3H93 A;  4MZB A;  2H30 A;  3C7M A;  5IMV A;  5J5N A;  1HNC A;  3L9S A;  4NV2 A;  4BWQ A;  4MNN A;  1PX7 A;  5HR1 A;  4RI7 A;  1LJR A;  3EPT A;  3ZVJ A;  4PGT A;  4JR6 A;  5ECQ B;  4Q5N A;  1Z7R A;  4EIP A;  5ECR B;  1GUL A;  3TCO A;  1TXX A;  1EV9 A;  4MCU A;  3FZ9 A;  3W8J A;  4X4J A;  1EZK A;  2DIY A;  5D96 A;  1F6M C;  2L4Q A;  5L71 A;  3DYR A;  2YPM A;  1T7P B;  2LRC A;  1FHE A;  3RBT A;  4KSO A;  3KP9 A;  3ZLP A;  2GST A;  1KTE A;  2GZY A;  2VUP A;  1AQX A;  4N10 A;  1M2A A;  1SVO A;  4YKG A;  3GMF A;  5A4U A;  4MK3 A;  1ZYQ B;  4XIH A;  5AN1 A;  1BG1 A;  3IBH A;  4KUN A;  4QL9 A;  2HYX A;  1TRV A;  4XTS A;  3IC8 A;  2H1D A;  4BA7 A;  4MF7 A;  2WFC A;  4PUF C;  5CO3 A;  2VLT A;  4PX1 A;  1YF0 A;  2WZS A;  2IMK A;  5B6M A;  2YOI A;  3W6G A;  4GST A;  3ZRE A;  1X5E A;  3UL3 A;  4ZBA A;  1JLW A;  5DCG A;  1XBS A;  3IHQ A;  1THO A;  8GSS A;  2HSY A;  4O32 A;  3H8Q A;  3WD6 A;  1T3B A;  2HXK A;  1PL1 A;  2IME A;  3GTU B;  2IFQ A;  2C0F A;  2XBQ A;  1X9M B;  4GLT A;  4K5R A;  5GZZ B;  1Z5Y E;  2HSH A;  1MTC A;  5DAL A;  1TU8 A;  4Q5R A;  2UZ8 A;  1QXH A;  1AQV A;  4ZL8 A;  1OYJ A;  1Z6M A;  1AW9 A;  4KAE A;  5F0G A;  1OE8 A;  2K18 A;  3C8E A;  1M9A A;  5A5K A;  3BOA A;  4JR4 A;  2V6O A;  2HRA A;  2H66 A;  2HZF A;  3QAW A;  5AIS A;  4K7I A;  3N9J A;  1EOG A;  3HA9 A;  4TRX A;  1R26 A;  4J56 E;  3GL5 A;  2LNT A;  4MA9 A;  4G0I A;  3HD5 A;  2BTO T;  4GSS A;  2AV4 A;  1N2A A;  4OCE A;  5AIV A;  2HT9 A;  4KCA A;  2NDO A;  2NVL A;  3FZ5 A;  2C0E A;  1F3B A;  4MMM A;  4PQH A;  2NBS A;  5IMA A;  4OO5 A;  4ML6 A;  2ES7 A;  4OMV A;  3FRC A;  1KEB A;  1CQG A;  1OKD A;  5A5H A;  4MLY A;  5EVO A;  4EDZ A;  1Z3E A;  1G7E A;  2LQQ A;  1O8X A;  3KZQ A;  1CQH A;  2R0P A;  2QSI A;  3GKM A;  4FQU A;  1R5A A;  3FZA A;  2GVP A;  3EWL A;  2RUE A;  2IN3 A;  4V2L A;  2GQM A;  5ABR A;  2LV3 A;  3H79 A;  1HQO A;  2FA8 A;  3LWA A;  3ED3 A;  2X49 A;  1TDI A;  3I69 A;  2ZCT A;  4HU9 A;  2B6M A;  1A2M A;  3VLN A;  2YWM A;  2E2M A;  3KM6 A;  4ZIL A;  3M8N A;  4PQ1 A;  3GH6 A;  4TR1 B;  2YV7 A;  1VF2 A;  3O6T A;  5HFG A;  1J0F A;  1B8X A;  4IP6 A;  2C4J A;  1AAZ A;  3TJK A;  1B9X C;  4NV5 A;  2H01 A;  2YNX A;  5A34 A;  1UN2 A;  4KB3 A;  2CV4 A;  2LST A;  4ULX A;  3L4N A;  2H1L A;  3ZFB A;  2EIQ A;  5CRE A;  3LSZ A;  2GSS A;  2OJL A;  5GST A;  4G10 A;  4XS1 A;  4D73 B;  1WJK A;  2C0D A;  1WPI A;  3BCI A;  1MDI A;  2Z9S A;  3FR6 A;  2ON5 A;  1SVM A;  2FWG A;  3LG6 A;  2KP1 A;  3H4K A;  1GSF A;  1ZYE A;  1T4Y A;  4LL1 B;  3GA4 A;  18GS A;  3BCK A;  1TU7 A;  2H8L A;  4L8E A;  3EMX A;  1OC3 A;  2F8A A;  1PX6 A;  2PGT A;  1ON4 A;  2IMF A;  5FHI A;  5IQY A;  4GWR A;  5BMU B;  3CWG A;  4KX4 A;  2B1L A;  1TK8 B;  1MEK A;  4ML1 A;  4F82 A;  1EP8 A;  2DBC A;  1ZCP A;  2EFH A;  2DMM A;  2FWH A;  3FYG A;  3GST A;  4KGI A;  3ZML A;  1SKW B;  5KOX A;  1XIY A;  4MZW A;  2AAW A;  2GTU A;  2JZS A;  1WIK A;  5DDL A;  1QQ2 A;  4KCE A;  5ECP B;  4AI6 A;  1RK4 A;  2QA1 A;  5KN3 A;  3M1G A;  2A4H A;  2DJ2 A;  2V41 A;  4KF9 A;  2F51 A;  1DE2 A;  4IN0 A;  4BVY A;  4ACS A;  2HSN A;  1GTI A;  2WVY A;  1UA5 A;  3TKS C;  4Q5Q A;  4EDY A;  1BAY A;  2WGR A;  1PKW A;  1M7T A;  2WVX B;  6GSX A;  3DXB A;  3RHC A;  1SYX A;  1SD8 A;  1F9M A;  2C3Q A;  4OFM A;  3ERW A;  3HZ4 A;  3H1N A;  4IGJ A;  2N5A A;  2MMN A;  3KTB A;  1TJD A;  5B6N A;  2H73 A;  2OE3 A;  3R3E A;  4GDF A;  2C8U A;  2IIY A;  3SBC A;  1AQW A;  2R0G A;  3PGT A;  3EU4 A;  2H70 A;  2EFE A;  3QMX A;  2JAD A;  3LXT A;  5DJM A;  2FA4 A;  3F4S A;  5COH A;  1OVN A;  2HRK A;  4LLR A;  3VWU A;  3FMW A;  4XS4 B;  3GUR A;  2H71 A;  4K5S A;  3M9J A;  3P2A A;  2MBT A;  3F9U A;  5KN1 A;  2CVB A;  4EXJ A;  3TB2 A;  4V1A g;  2PVQ A;  3IK9 A;  5JWR B;  2M80 A;  1K0M A;  4RQX A;  1XFL A;  4X0X A;  2B7K A;  4EKZ A;  6GSS A;  3D21 A;  3FY7 A;  2H6Y A;  1R4W A;  2I4A A;  4WEY A;  3Q6O A;  4AJ6 A;  4PUR A;  2A2S A;  1M99 A;  1DE1 A;  5KN2 A;  4OFN A;  3J7Y k;  3A3T A;  2H19 A;  5H5R A;  4TR0 A;  5JCG A;  3RPN A;  3EU3 A;  4O5U A;  2A2R A;  2R4V A;  2YZH A;  3ZL5 A;  2LRN A;  3ZIT A;  1F2E A;  3CRT A;  1TRU A;  4V2N A;  4RI6 A;  1JHB A;  5DQY A;  2HSM B;  2E0Q A;  2PVO C;  3TJJ A;  3HJP A;  1OAZ A;  2K8S A;  1THX A;  2C1Y A;  3EYT A;  3G7I A;  1HD2 A;  1Q98 A;  3DVX A;  4MJC A;  1O81 A;  3GKN A;  1ZYN A;  4YAV A;  4WR5 A;  3CSH A;  4MDC A;  4N0Z A;  1SJZ A;  3CQF A;  2L6C A;  2O5V A;  1WE0 A;  3FEU A;  4PI2 C;  5ELA A;  2N5B A;  5G2Z A;  2CX4 A;  1SVL A;  3TGZ A;  4ZB7 A;  1Z6N A;  5G30 A;  2DJK A;  2HRF A;  1FB0 A;  5ECO B;  3VPT A;  3FR3 A;  4WBR D;  1JLV A;  1OC9 A;  3PR8 A;  3MYD A;  5CYY A;  2R6K A;  1U88 A;  4E8H A;  2HQT A;  1A2L A;  4K6X A;  3CSJ A;  3QR6 A;  5IMC A;  5F06 A;  5AGY A;  4WF4 A;  3HVN A;  4TXV A;  1EWX A;  1DSB A;  2F3M A;  3IHG A;  3VWW A;  1YY7 A;  1JZW A;  4AGS A;  3QAV A;  2QKE A;  2HLS A;  4ILF A;  5G1K A;  3APQ A;  3UIW A;  1A0F A;  4NPB A;  1IYH A;  3TUE A;  3IA1 A;  1PKZ A;  3BD2 A;  4FYB A;  4KA0 A;  5CAX A;  1PRX A;  3O3T A;  5DJL A;  2PBJ A;  1SKR B;  1U3A A;  2B1K A;  2GT6 A;  1XWK A;  1T00 A;  4IBP A;  1PMT A;  1BQ7 A;  1ZOF A;  2M46 A;  4MPG A;  1V2A A;  4OD7 A;  1WP0 A;  3IAM 2;  1FW1 A;  1VF4 A;  2CT6 A;  5B7C A;  3HHV A;  1M0U A;  4YQU A;  1ABA A;  4TR3 A;  4GCI A;  5CRH A;  3NZN A;  5CRG A;  3GN3 A;  2KLX A;  4KH7 A;  1PL2 A;  1T4Z A;  5D8I A;  5F07 A;  3QPM A;  4ZL7 A;  4K1F A;  1ERT A;  2FLS A;  2HZE A;  4K0G A;  3WGD A;  3UBK A;  5H5Q A;  4DSQ A;  1XW5 A;  2VCV A;  4N0V A;  2OBI A;  2YZU A;  3HMJ G;  3TU3 B;  3DGQ A;  4JBB A;  1Q4J A;  4HEA 2;  2HFD A;  1FG4 A;  4POK A;  2I3Y A;  4DSS A;  3G7J A;  4P3Y B;  2P31 A;  3GX8 A;  3GH9 A;  2PU9 C;  3TKS E;  1RW1 A;  4IQ1 A;  3I43 A;  2FCH A;  5ELG A;  3IV4 A;  3TOU A;  1F3A A;  1E6B A;  2GDR A;  1Y6E A;  2K6V A;  4N30 A;  1EV4 A;  4BWS A;  4ECJ A;  1PA3 A;  4AJ7 A;  2IFQ B;  4POB A;  2WW1 A;  3MSZ A;  1SL0 B;  3TRQ A;  3KXO A;  1JFU A;  2YN1 A;  5DAL B;  2F8F A;  2H75 A;  1HYU A;  4FXY P;  1GH2 A;  2A2P A;  1T8E B;  2R5G A;  4TVE A;  5D9V A;  3F0I A;  1W89 A;  1NSW A;  2XPE A;  4RUV A;  3TJF A;  1WMJ A;  3LGC A;  2XHF A;  4IKH A;  5ID2 A;  4FYC A;  1V40 A;  2X8G A;  1GTU A;  4O5R A;  4MF5 A;  3RFR C;  2PUK C;  2XPD A;  5CRW A;  3GYK A;  2R37 A;  4WBJ A;  1V98 A;  1EGO A;  2DJ0 A;  1XCC A;  2ZUP A;  3VPQ A;  1YEP A;  2VM2 A;  3AY8 A;  2JSZ A;  2K9F A;  3HZ8 A;  4CDO A;  5LCZ A;  3DWV A;  4ECI A;  3D4M A;  2FGX A;  1A2J A;  5DAK B;  3ZZX A;  2AYT A;  5DBQ A;  3CYN A;  3VWV A;  4DSR A;  5EY6 A;  4E68 A;  4Z2U A;  5IMF A;  4F2I A;  3TDG A;  4L0U A;  2WCI A;  1TOF A;  4QL7 A;  1QMV A;  2N5F A;  4G0L A;  5KEJ A;  12GS A;  3MNG A;  3UAP A;  1NHY A;  1JZD A;  1TRW A;  4HZ2 A;  1EOH A;  3CSI A;  16GS A;  4TN8 A;  3QOU A;  4WXT A;  3ME8 A;  1EEJ A;  1GL8 A;  4IQA A;  1WWJ A;  4HUA A;  3I9V 2;  3US3 A;  1WOU A;  3QFA C;  4KW6 A;  3E3E A;  2DIZ A;  3GIX A;  1XOA A;  3EIN A;  2WDU A;  4IJ3 A;  4POL A;  5IPG A;  3SWL A;  4A5P A;  1QK8 A;  1QUW A;  3TRX A;  1GTB A;  1XPV A;  3GNJ A;  5IMD A;  5AIX A;  4YAP A;  4OCF A;  1YKC A;  2A4V A;  2FUG 2;  1SD9 A;  4EE0 A;  2PN8 A;  1WRY A;  4XS6 A;  4EF0 A;  4J57 E;  4V2M A;  4QQ7 A;  1OC8 A;  2FHE A;  4EIQ A;  3GRX A;  1JZR A;  1FAA A;  2O8V B;  1YVL A;  4N3Z A;  3FK8 A;  1PN0 A;  3TKS A;  2P5R A;  1QGV A;  3QAG A;  3CRU A;  19GS A;  1G7O A;  2CX3 A;  3D4T A;  3NOF A;  2DSA A;  5CNW A;  1ZZY A;  2FWE A;  1XWA A;  4JRR A;  5DQS A;  2E7P A;  4K2D A;  3J7Y b;  2H1A A;  5GSS A;  2NTO A;  2QC7 A;  3L9U A;  1X0R A;  4I6X A;  4I2T A;  1I5G A;  5J4V A;  4K9Z A;  4BVY B;  2HSN B;  4ZB8 A;  4TR1 A;  4KDX A;  4WKW A;  5C00 A;  4F0B A;  5F05 A;  1H75 A;  3LQ7 A;  1TI3 A;  2OE0 A;  2H0I A;  5J47 A;  2F9S A;  1V57 A;  1VRS D;  5BRT A;  1HNA A;  2TIR A;  4FO5 A;  1X9W B;  2J23 A;  5H5S A;  3KD0 A;  2CQ9 A;  4CHS A;  5LD0 A;  3IDV A;  2LKU A;  1GNE A;  4N11 A;  4OO4 A;  1FVK A;  1NHO A;  4PI0 C;  3FKF A;  3ZVJ D;  1JZO A;  1S3D A;  4KND A;  3P90 A;  2BJX A;  3TKQ A;  4D73 A;  2HRK B;  4BIK A;  2VCZ A;  1K3Y A;  1GP1 A;  2LTK A;  4ZL9 A;  5ENU A;  3UVT A;  1TRS A;  1I9D A;  4PHZ C;  1MD4 A;  2JZT A;  3I6A A;  3GKK A;  2WZ9 A;  2L5L A;  3A2X A;  1B9Y C;  4HQZ A;  4JZQ A;  4GQF A;  3ZFL A;  3DD3 A;  5BMU A;  4ZB6 A;  4ZB9 A;  3KJY A;  4TKY A;  1UVZ A;  3VFI A;  3GHA A;  1SKS B;  1SJI A;  2B5X A;  2OAC A;  2IL3 A;  3ZIV A;  5EPF A;  1TTZ A;  3C73 A;  4F0C A;  4I5Q A;  2O89 A;  3C1R A;  2V1M A;  3OR5 A;  4GTU A;  4J2F A;  3HVS A;  3HCZ A;  2OBK A;  4K8M A;  1YQ1 A;  1LU4 A;  1SJ6 A;  3U6V A;  4IJI A;  2P0G A;  1ERV A;  3VI5 A;  4EO3 A;  1B4Q A;  3A5I A;  4NWY A;  2PER A;  4PTS A;  2GZP A;  4F9Z A;  5ECL B;  2YCD A;  3CTF A;  4TXO B;  2CZ3 A;  4WR4 A;  3QDN A;  3HJO A;  1X9S B;  1K3O A;  2VAF A;  3DRN A;  4W66 A;  5J40 A;  3FW2 A;  2KHP A;  1GSU A;  2L57 A;  3QD9 A;  4BL7 A;  3LW9 A;  2AHE A;  1URM A;  2DC5 A;  4KDY A;  2MBS A;  3FHK A;  5J4Y A;  1BED A;  1MDK A;  3UEM A;  4YKF A;  1XOB A;  4Z2R A;  1AXD A;  4PUA A;  5B8B A;  3RHB A;  4XS4 A;  3WT1 A;  2L6D A;  1S4B P;  2GS3 A;  2IWT A;  1M9B A;  1ERU A;  3VK9 A;  1GSS A;  2VL3 A;  3A2W A;  4KE3 A;  4CY6 A;  3RPP A;  1OC9 B;  2XBI A;  3D6I A;  5JWQ B;  6GSY A;  1O8W A;  2X99 A;  1YDK A;  5G5E A;  2UV8 G;  3KGK A;  1XWC A;  4IS0 A;  4XCS A;  2X64 A;  1XW9 A;  1G6Y A;  3QCP A;  2EC4 A;  1GSY A;  1ILO A;  2H1G A;  3LFL A;  4TW5 A;  2VL2 A;  3LJR A;  2PMT A;  2G0F A;  3KP8 A;  5J9C A;  2C3N A;  4AKI A;  3IOS A;  4MJB A;  2LJK A;  4AJ8 A;  2HSM A;  1M2B A;  1XWB A;  3GFK A;  3HDC A;  1K0B A;  1ZYP A;  2CAI A;  1M3I A;  1Z9H A;  4HS1 A;  2KP2 A;  2CVK A;  1TP9 A;  1TW9 A;  5D9W A;  1VGL A;  2H1B A;  2VO4 A;  4TR4 A;  2JSY A;  1TXU A;  4I2U A;  4EL1 A;  4ZBB A;  1GWC A;  1ML6 A;  22GS A;  4BVX B;  4XHM A;  1K0N A;  3F4R A;  2YWN A;  1TK0 B;  1EP7 A;  3FZ4 A;  1FOH A;  5IMZ A;  1YKA A;  3APS A;  2TRX A;  5A1N B;  5E59 A;  2OE1 A;  1A23 A;  5ECN B;  1LBK A;  3IAS 2;  2GT5 A;  1A8L A;  3EE2 A;  3LYK A;  4LMW A;  2GSQ A;  4NXI A;  2RM6 A;  3IE3 A;  2IPA A;  3HY2 A;  2DJ3 A;  3N5O A;  2HRN A;  5G5F A;  1GRX A;  1T1V A;  1BX9 A;  2VCT A;  2C80 A;  3PPU A;  3D22 A;  2VL9 A;  5IO2 A;  9GSS A;  1FVJ A;  2VOC A;  5J3R A;  2JU5 A;  3DVW A;  2QGV A;  1O73 A;  4QMK A;  2H0G A;  4FIW A;  3ZMK A;  1MDJ A;  2P5Q A;  1XG8 A;  4YQM A;  3CMI A;  4PNG A;  5ECS A;  3O76 A;  2OT3 A;  3DML A;  1TKD B;  4HJM A;  2VLU A;  2VM1 A;  4Z2T A;  2O3E A;  4USS A;  5JCW A;  1GSE A;  3UMA A;  1Z7P A;  4O5Q A;  5CRD A;  1GTA A;  2WB9 A;  1SEN A;  2ALB A;  4K7O A;  4X1U A;  4HU7 A;  5ID2 B;  1XWG A;  4GRF A;  3Q18 A;  5J9B A;  1SYR A;  2L4C A;  2CZ2 A;  3KMN A;  3ISO A;  1PSQ A;  1KBN A;  5D9X A;  2V32 A;  1YF1 A;  1S3R A;  2VCW A;  4AF2 A;  4HI7 A;  3F3R A;  5B8A A;  4KSM A;  2MMZ A;  2EFD A;  1B48 A;  2IMI A;  4OFT A;  3WT2 A;  3ZYW A;  4KDU A;  1DUG A;  4G0K A;  4O7H A;  3E0U A;  3GX0 A;  5E4W A;  5HR2 A;  3HXS A;  4TOP A;  1GSD A;  1VF1 A;  3GKX A; 
#chains in the Genus database with same CATH homology
 2LUS A;  1PD2 1;  1ZMA A;  2H6Z A;  3LYP A;  2DJ1 A;  3MWH A;  4EVM A;  3ME7 A;  4L0W A;  20GS A;  4O92 A;  3EVI A;  2R2J A;  4JE1 A;  3ZRD A;  4GSN A;  4HZ4 A;  2EFC A;  6GSV A;  3W8S A;  2LJR A;  5HFI A;  4POM A;  5J4U A;  2H72 A;  3MIX A;  3ERG A;  2YP6 A;  3DKS A;  3FR9 A;  2EIO A;  6GST A;  3IC4 A;  1K0D A;  1XVQ A;  2OA7 A;  5A5H B;  1H4O A;  1YJ6 A;  5KOW A;  1O6J A;  4MJE A;  1PGT A;  2LRT A;  4HQS A;  1PQN A;  4PQI A;  5FWG A;  2YWI A;  3K8N A;  4LMV A;  2X8C A;  3UJ1 A;  2V6K A;  4MF6 A;  1C72 A;  4G01 A;  7GSS A;  3EMP A;  6GSW A;  1U6T A;  2V2G A;  2FY6 A;  3IK7 A;  4NHZ A;  1U87 A;  2M72 A;  4CW9 A;  1J08 A;  1N25 A;  1R5P A;  2O7K A;  2WUL A;  3GTU A;  3ZIJ A;  3TKP A;  4E8E A;  2IJY A;  2AB6 A;  4XRD A;  3L78 A;  4K7N A;  2PWJ A;  3CXG A;  5DAK A;  5A34 B;  1S3C A;  2O87 A;  3ZTL A;  3A5W A;  1B4P A;  1QFN A;  3WYW A;  1VF3 A;  4IW9 A;  4EC0 A;  1NM3 A;  2MMA A;  5J41 A;  3Q74 A;  5A4W A;  3LEF A;  3EC3 A;  2B3S A;  4OWY A;  3C71 A;  3HVV A;  4DVC A;  1GLP A;  1BYE A;  2VKZ G;  2QA2 A;  2G2Q A;  3U5R E;  2LEG A;  3GSS A;  2TRC P;  4ICY A;  5JWO B;  2CAQ A;  1GNW A;  2WRT A;  1EEM A;  1ACV A;  3KCM A;  1K0C A;  4ECB A;  3UVH A;  2DLX A;  3F8U A;  5JCU A;  4CY8 A;  5ECM B;  1Y25 A;  2REM A;  5DCH A;  3HJM A;  5GAN D;  4Z7X A;  2H74 A;  3HKR A;  2HI7 A;  2YJH A;  4PXO A;  1BG5 A;  2LS5 A;  4AKH A;  1NW2 A;  4RQR A;  2WJU A;  5HR3 A;  3HYP A;  4X43 A;  1KNG A;  5EL8 A;  2CA8 A;  3F6F A;  6GSU A;  3BJ5 A;  5IM9 A;  2LQO A;  2YV9 A;  3GUS A;  2B7J A;  3GV1 A;  1IYI A;  4NHW A;  3RDW A;  3M3M A;  13GS A;  1FOV A;  2ON7 A;  3G9B A;  1FB6 A;  3G7Y A;  3VI7 A;  3D5J A;  1EGR A;  3GL3 A;  3ERF A;  2L59 A;  2YWO A;  5G1L A;  3D0Z A;  1Y1U A;  2B5Y A;  2H6X A;  5GAP D;  2DKI A;  4IHU A;  1O7U A;  2R0C A;  4MJA A;  3TKR A;  4GQC A;  11GS A;  2L5O A;  1W4V A;  1AUC A;  2JAC A;  1YEX A;  2EIR A;  5KN0 A;  1ERW A;  1TI1 A;  4FH8 A;  3QFB C;  1SK0 A;  5ECI B;  4I97 A;  1TK5 B;  3M0F A;  1OE7 A;  3C1S A;  2FWF A;  2GZZ A;  3KIJ A;  4ZIJ A;  1J9B A;  2YAN A;  2VCX A;  2B5E A;  2VCQ A;  2KOK A;  1AIU A;  3JCM L;  2I81 A;  5IOX A;  1G0T A;  2I9H A;  3NIV A;  4MPF A;  4DEJ A;  3MDK A;  3DIE A;  2DML A;  3F4T A;  4G2E A;  4ZBD A;  2H76 A;  2RII A;  1GUH A;  2D2Z A;  2JL4 A;  17GS A;  2AUV A;  1XW6 A;  4BL7 B;  3F3Q A;  1XXU A;  2R3X A;  3F63 A;  2VD0 A;  4K2X A;  14GS A;  2FNO A;  5HQP A;  4WF5 A;  3R2Q A;  4XRA A;  1U3I A;  1M2D A;  5DVB A;  1F37 A;  2VLV A;  4HDE A;  5IPH A;  4LA1 A;  3TRP A;  1SU9 A;  1GSQ A;  2BMX A;  1SK1 A;  5CP1 A;  1XVW A;  3APO A;  4HOJ A;  3F6D A;  2FD3 A;  2GGT A;  1A8Y A;  5C04 A;  4L5O A;  1GLQ A;  3A2V A;  3PIN A;  1V58 A;  2VIM A;  5A4V A;  2X4A A;  3S9F A;  4AKG A;  1A0R P;  1S3A A;  3CTG A;  5ECK B;  4Q5F A;  3L9V A;  2I1U A;  2RUF A;  1X5C A;  4MAB A;  5IO0 A;  3IPZ A;  4PNF A;  2E2G A;  4F03 A;  2C0G A;  3TJB A;  2H0H A;  5INY A;  3VUR A;  4HJ2 A;  2OAD A;  1SK2 A;  3P8W A;  4MH3 A;  2HNL A;  1V9W A;  4EUY A;  3WGE A;  4NMU A;  3IRA A;  3UOM A;  1AC1 A;  3HVX A;  3UAR A;  1MD3 A;  2LJA A;  4TXO A;  2DKH A;  2GLR A;  1DBY A;  2CVD A;  1PN9 A;  4V1A p;  2AJQ B;  3KH7 A;  4L5L A;  5D73 A;  1BJX A;  1G6W A;  4GF0 A;  5G31 A;  3PH9 A;  3BBY A;  3WGX A;  4JED A;  4ECC A;  2WS2 A;  1XZO A;  3RAZ A;  1SL1 B;  2DJJ A;  4IVF A;  4ID0 A;  3LXZ A;  1HNB A;  3TJG A;  3P7X A;  4YH2 A;  4JU5 A;  1K3L A;  3IR4 A;  1SL2 B;  4G19 A;  2O85 A;  1K0A A;  3KH9 A;  4I8B A;  1K0O A;  2K8V A;  4AKX B;  2PPT A;  1N8J A;  4ZXG A;  2IMD A;  2XC2 A;  2MYG A;  5D93 A;  3DEX A;  5F8B A;  4BPY A;  2RLI A;  10GS A;  2NPB A;  1USB A;  1A24 A;  1FO5 A;  2RM5 A;  1YZX A;  4GXZ A;  4MP4 A;  5HFK A;  2GSR A;  2HZE B;  2ZNM A;  1UC7 A;  2YJ7 A;  5D9T A;  1R7H A;  2C3T A;  2JZR A;  2MMO A;  3VWX A;  2OKA A;  5FT3 A;  4ISD A;  1ST9 A;  4MZC A;  1E2Y A;  1GUM A;  2LNS A;  3EUR A;  3Q19 A;  3KEB A;  5HR0 A;  4LL4 B;  4NAX A;  3LOR A;  5LNK e;  3M9K A;  1O85 A;  1BF5 A;  4DSS B;  5IOW A;  1X5D A;  3L0H A;  4IEL A;  1ZGN A;  5IIZ A;  1GUK A;  1OKT A;  1RQM A;  4MH2 A;  3IXR A;  2MZC A;  4IP1 A;  3V1W A;  2GQK A;  3E9J B;  4G9H A;  4WET A;  2HE3 A;  2VL2 C;  4YQV A;  2X8H A;  3KMO A;  1ZL9 A;  3UBL A;  2GQL A;  4K0N A;  4BVX A;  3CBU A;  4FYU A;  3TOT A;  2J9H A;  4H86 A;  5ECH B;  3MAK A;  2VD1 A;  3KTL A;  5A1N A;  2KUC A;  3H93 A;  4MZB A;  2H30 A;  3C7M A;  5IMV A;  5J5N A;  1HNC A;  3L9S A;  4NV2 A;  4BWQ A;  4MNN A;  1PX7 A;  5HR1 A;  4RI7 A;  1LJR A;  3EPT A;  3ZVJ A;  4PGT A;  4JR6 A;  5ECQ B;  4Q5N A;  1Z7R A;  4EIP A;  5ECR B;  1GUL A;  3TCO A;  1TXX A;  1EV9 A;  4MCU A;  3FZ9 A;  3W8J A;  4X4J A;  1EZK A;  2DIY A;  5D96 A;  1F6M C;  2L4Q A;  5L71 A;  3DYR A;  2YPM A;  1T7P B;  2LRC A;  1FHE A;  3RBT A;  4KSO A;  3KP9 A;  3ZLP A;  2GST A;  1KTE A;  2GZY A;  2VUP A;  1AQX A;  4N10 A;  1M2A A;  1SVO A;  4YKG A;  3GMF A;  5A4U A;  4MK3 A;  1ZYQ B;  4XIH A;  5AN1 A;  1BG1 A;  3IBH A;  4KUN A;  4QL9 A;  2HYX A;  1TRV A;  4XTS A;  3IC8 A;  2H1D A;  4BA7 A;  4MF7 A;  2WFC A;  4PUF C;  5CO3 A;  2VLT A;  4PX1 A;  1YF0 A;  2IMK A;  5B6M A;  2YOI A;  3W6G A;  4GST A;  3ZRE A;  1X5E A;  3UL3 A;  4ZBA A;  1JLW A;  5DCG A;  1XBS A;  3IHQ A;  1THO A;  8GSS A;  2HSY A;  4O32 A;  3H8Q A;  3WD6 A;  1T3B A;  2HXK A;  1PL1 A;  2IME A;  3GTU B;  2IFQ A;  2C0F A;  2XBQ A;  1X9M B;  4GLT A;  4K5R A;  5GZZ B;  1Z5Y E;  2HSH A;  1MTC A;  5DAL A;  1TU8 A;  4Q5R A;  2UZ8 A;  1QXH A;  1AQV A;  4ZL8 A;  1OYJ A;  1Z6M A;  1AW9 A;  4KAE A;  5F0G A;  1OE8 A;  2K18 A;  3C8E A;  1M9A A;  5A5K A;  3BOA A;  4JR4 A;  2V6O A;  2HRA A;  2H66 A;  2HZF A;  3QAW A;  5AIS A;  4K7I A;  3N9J A;  1EOG A;  3HA9 A;  4TRX A;  1R26 A;  4J56 E;  3GL5 A;  2LNT A;  4MA9 A;  4G0I A;  3HD5 A;  2BTO T;  4GSS A;  2AV4 A;  1N2A A;  4OCE A;  5AIV A;  2HT9 A;  4KCA A;  2NDO A;  2NVL A;  3FZ5 A;  2C0E A;  1F3B A;  4MMM A;  4PQH A;  2NBS A;  5IMA A;  4OO5 A;  4ML6 A;  2ES7 A;  4OMV A;  3FRC A;  1KEB A;  1CQG A;  1OKD A;  5A5H A;  4MLY A;  5EVO A;  4EDZ A;  1Z3E A;  1G7E A;  2LQQ A;  1O8X A;  3KZQ A;  1CQH A;  2R0P A;  2QSI A;  3GKM A;  4FQU A;  1R5A A;  3FZA A;  2GVP A;  3EWL A;  2RUE A;  2IN3 A;  4V2L A;  2GQM A;  5ABR A;  2LV3 A;  3H79 A;  1HQO A;  2FA8 A;  3LWA A;  3ED3 A;  2X49 A;  1TDI A;  3I69 A;  2ZCT A;  4HU9 A;  2B6M A;  1A2M A;  3VLN A;  2YWM A;  2E2M A;  3KM6 A;  4ZIL A;  3M8N A;  4PQ1 A;  3GH6 A;  4TR1 B;  2YV7 A;  1VF2 A;  3O6T A;  5HFG A;  1J0F A;  1B8X A;  4IP6 A;  2C4J A;  1AAZ A;  3TJK A;  1B9X C;  4NV5 A;  2H01 A;  2YNX A;  5A34 A;  1UN2 A;  4KB3 A;  2CV4 A;  2LST A;  4ULX A;  3L4N A;  2H1L A;  3ZFB A;  2EIQ A;  5CRE A;  3LSZ A;  2GSS A;  2OJL A;  5GST A;  4G10 A;  4XS1 A;  4D73 B;  1WJK A;  2C0D A;  1WPI A;  3BCI A;  1MDI A;  2Z9S A;  3FR6 A;  2ON5 A;  1SVM A;  2FWG A;  3LG6 A;  2KP1 A;  3H4K A;  1GSF A;  1ZYE A;  1T4Y A;  4LL1 B;  3GA4 A;  18GS A;  3BCK A;  1TU7 A;  2H8L A;  4L8E A;  3EMX A;  1OC3 A;  2F8A A;  1PX6 A;  2PGT A;  1ON4 A;  2IMF A;  5FHI A;  5IQY A;  4GWR A;  5BMU B;  3CWG A;  4KX4 A;  2B1L A;  1TK8 B;  1MEK A;  4ML1 A;  4F82 A;  1EP8 A;  2DBC A;  1ZCP A;  2EFH A;  2DMM A;  2FWH A;  3FYG A;  3GST A;  4KGI A;  3ZML A;  1SKW B;  5KOX A;  1XIY A;  4MZW A;  2AAW A;  2GTU A;  2JZS A;  1WIK A;  5DDL A;  1QQ2 A;  4KCE A;  5ECP B;  4AI6 A;  1RK4 A;  2QA1 A;  5KN3 A;  3M1G A;  2A4H A;  2DJ2 A;  2V41 A;  4KF9 A;  2F51 A;  1DE2 A;  4IN0 A;  4BVY A;  4ACS A;  2HSN A;  1GTI A;  1UA5 A;  3TKS C;  4Q5Q A;  4EDY A;  1BAY A;  2WGR A;  1PKW A;  1M7T A;  6GSX A;  3DXB A;  3RHC A;  1SYX A;  1SD8 A;  1F9M A;  2C3Q A;  4OFM A;  3ERW A;  4IGJ A;  3H1N A;  3HZ4 A;  2N5A A;  2MMN A;  3KTB A;  1TJD A;  5B6N A;  2H73 A;  2OE3 A;  3R3E A;  4GDF A;  2C8U A;  2IIY A;  3SBC A;  1AQW A;  2R0G A;  3PGT A;  3EU4 A;  2H70 A;  2EFE A;  3QMX A;  2JAD A;  3LXT A;  5DJM A;  2FA4 A;  3F4S A;  5COH A;  1OVN A;  2HRK A;  4LLR A;  3VWU A;  3FMW A;  4XS4 B;  3GUR A;  2H71 A;  4K5S A;  3M9J A;  3P2A A;  2MBT A;  3F9U A;  5KN1 A;  2CVB A;  4EXJ A;  3TB2 A;  4V1A g;  2PVQ A;  3IK9 A;  5JWR B;  2M80 A;  1K0M A;  4RQX A;  1XFL A;  4X0X A;  2B7K A;  4EKZ A;  6GSS A;  3D21 A;  3FY7 A;  2H6Y A;  1R4W A;  2I4A A;  4WEY A;  3Q6O A;  4AJ6 A;  4PUR A;  2A2S A;  1M99 A;  1DE1 A;  5KN2 A;  4OFN A;  3J7Y k;  3A3T A;  2H19 A;  5H5R A;  4TR0 A;  5JCG A;  3RPN A;  3EU3 A;  4O5U A;  2A2R A;  2R4V A;  2YZH A;  3ZL5 A;  2LRN A;  3ZIT A;  1F2E A;  3CRT A;  1TRU A;  4V2N A;  4RI6 A;  1JHB A;  5DQY A;  2HSM B;  2E0Q A;  2PVO C;  3TJJ A;  3HJP A;  1OAZ A;  2K8S A;  1THX A;  2C1Y A;  3EYT A;  3G7I A;  1HD2 A;  1Q98 A;  3DVX A;  4MJC A;  1O81 A;  3GKN A;  1ZYN A;  4YAV A;  4WR5 A;  3CSH A;  4MDC A;  4N0Z A;  1SJZ A;  2L6C A;  2O5V A;  1WE0 A;  3FEU A;  5ELA A;  2N5B A;  5G2Z A;  2CX4 A;  1SVL A;  3TGZ A;  4ZB7 A;  1Z6N A;  5G30 A;  2DJK A;  2HRF A;  1FB0 A;  5ECO B;  3VPT A;  3FR3 A;  4WBR D;  1JLV A;  1OC9 A;  3PR8 A;  3MYD A;  5CYY A;  2R6K A;  1U88 A;  4E8H A;  2HQT A;  1A2L A;  4K6X A;  3CSJ A;  3QR6 A;  5IMC A;  5F06 A;  5AGY A;  4WF4 A;  4TXV A;  1EWX A;  1DSB A;  2F3M A;  3IHG A;  3VWW A;  1YY7 A;  1JZW A;  4AGS A;  3QAV A;  2QKE A;  2HLS A;  4ILF A;  5G1K A;  3APQ A;  3UIW A;  1A0F A;  4NPB A;  1IYH A;  3TUE A;  3IA1 A;  1PKZ A;  3BD2 A;  4FYB A;  4KA0 A;  5CAX A;  1PRX A;  3O3T A;  5DJL A;  2PBJ A;  1SKR B;  1U3A A;  2B1K A;  2GT6 A;  1XWK A;  1T00 A;  4IBP A;  1PMT A;  1BQ7 A;  1ZOF A;  2M46 A;  4MPG A;  1V2A A;  4OD7 A;  1WP0 A;  3IAM 2;  1FW1 A;  1VF4 A;  2CT6 A;  5B7C A;  3HHV A;  1M0U A;  4YQU A;  1ABA A;  4TR3 A;  4GCI A;  5CRH A;  3NZN A;  5CRG A;  3GN3 A;  2KLX A;  4KH7 A;  1PL2 A;  1T4Z A;  5D8I A;  5F07 A;  3QPM A;  4ZL7 A;  4K1F A;  1ERT A;  2FLS A;  2HZE A;  4K0G A;  3WGD A;  3UBK A;  5H5Q A;  4DSQ A;  1XW5 A;  2VCV A;  4N0V A;  2OBI A;  2YZU A;  3HMJ G;  3TU3 B;  3DGQ A;  4JBB A;  1Q4J A;  4HEA 2;  2HFD A;  1FG4 A;  4POK A;  2I3Y A;  4DSS A;  3G7J A;  4P3Y B;  2P31 A;  3GX8 A;  3GH9 A;  2PU9 C;  3TKS E;  1RW1 A;  4IQ1 A;  3I43 A;  2FCH A;  5ELG A;  3IV4 A;  3TOU A;  1F3A A;  1E6B A;  2GDR A;  1Y6E A;  2K6V A;  4N30 A;  1EV4 A;  4BWS A;  4ECJ A;  1PA3 A;  4AJ7 A;  2IFQ B;  4POB A;  3MSZ A;  1SL0 B;  3TRQ A;  3KXO A;  1JFU A;  2YN1 A;  5DAL B;  2F8F A;  2H75 A;  1HYU A;  1GH2 A;  2A2P A;  1T8E B;  2R5G A;  4TVE A;  5D9V A;  3F0I A;  1W89 A;  1NSW A;  2XPE A;  4RUV A;  3TJF A;  1WMJ A;  3LGC A;  2XHF A;  4IKH A;  5ID2 A;  4FYC A;  1V40 A;  2X8G A;  1GTU A;  4O5R A;  4MF5 A;  2PUK C;  2XPD A;  5CRW A;  3GYK A;  2R37 A;  4WBJ A;  1V98 A;  1EGO A;  2DJ0 A;  1XCC A;  2ZUP A;  3VPQ A;  1YEP A;  2VM2 A;  3AY8 A;  2JSZ A;  2K9F A;  3HZ8 A;  4CDO A;  5LCZ A;  3DWV A;  4ECI A;  3D4M A;  2FGX A;  1A2J A;  5DAK B;  3ZZX A;  2AYT A;  5DBQ A;  3CYN A;  3VWV A;  4DSR A;  5EY6 A;  4E68 A;  4Z2U A;  5IMF A;  4F2I A;  3TDG A;  4L0U A;  2WCI A;  1TOF A;  4QL7 A;  1QMV A;  2N5F A;  4G0L A;  5KEJ A;  12GS A;  3MNG A;  3UAP A;  1NHY A;  1JZD A;  1TRW A;  4HZ2 A;  1EOH A;  3CSI A;  16GS A;  4TN8 A;  3QOU A;  4WXT A;  3ME8 A;  1EEJ A;  1GL8 A;  4IQA A;  1WWJ A;  4HUA A;  3I9V 2;  3US3 A;  1WOU A;  3QFA C;  4KW6 A;  3E3E A;  2DIZ A;  3GIX A;  1XOA A;  3EIN A;  2WDU A;  4IJ3 A;  4POL A;  5IPG A;  3SWL A;  4A5P A;  1QK8 A;  1QUW A;  3TRX A;  1GTB A;  1XPV A;  3GNJ A;  5IMD A;  5AIX A;  4YAP A;  4OCF A;  1YKC A;  2A4V A;  2FUG 2;  1SD9 A;  4EE0 A;  2PN8 A;  1WRY A;  4XS6 A;  4EF0 A;  4J57 E;  4V2M A;  4QQ7 A;  1OC8 A;  2FHE A;  4EIQ A;  3GRX A;  1JZR A;  1FAA A;  2O8V B;  1YVL A;  4N3Z A;  3FK8 A;  1PN0 A;  3TKS A;  2P5R A;  1QGV A;  3QAG A;  3CRU A;  19GS A;  1G7O A;  2CX3 A;  3D4T A;  3NOF A;  2DSA A;  5CNW A;  1ZZY A;  2FWE A;  1XWA A;  4JRR A;  5DQS A;  2E7P A;  4K2D A;  3J7Y b;  2H1A A;  5GSS A;  2NTO A;  2QC7 A;  3L9U A;  1X0R A;  4I6X A;  4I2T A;  1I5G A;  5J4V A;  4K9Z A;  4BVY B;  2HSN B;  4ZB8 A;  4TR1 A;  4KDX A;  4WKW A;  5C00 A;  4F0B A;  5F05 A;  1H75 A;  3LQ7 A;  1TI3 A;  2OE0 A;  2H0I A;  5J47 A;  2F9S A;  1V57 A;  1VRS D;  5BRT A;  1HNA A;  2TIR A;  4FO5 A;  1X9W B;  2J23 A;  5H5S A;  3KD0 A;  2CQ9 A;  4CHS A;  5LD0 A;  3IDV A;  2LKU A;  1GNE A;  4N11 A;  4OO4 A;  1FVK A;  1NHO A;  3FKF A;  3ZVJ D;  1JZO A;  1S3D A;  4KND A;  3P90 A;  2BJX A;  3TKQ A;  4D73 A;  2HRK B;  2VCZ A;  1K3Y A;  1GP1 A;  2LTK A;  4ZL9 A;  5ENU A;  3UVT A;  1TRS A;  1I9D A;  1MD4 A;  2JZT A;  3I6A A;  3GKK A;  2WZ9 A;  2L5L A;  3A2X A;  1B9Y C;  4HQZ A;  4JZQ A;  4GQF A;  3ZFL A;  3DD3 A;  5BMU A;  4ZB6 A;  4ZB9 A;  3KJY A;  4TKY A;  1UVZ A;  3VFI A;  3GHA A;  1SKS B;  1SJI A;  2B5X A;  2OAC A;  2IL3 A;  3ZIV A;  5EPF A;  1TTZ A;  3C73 A;  4F0C A;  4I5Q A;  2O89 A;  3C1R A;  2V1M A;  3OR5 A;  4GTU A;  4J2F A;  3HVS A;  3HCZ A;  2OBK A;  4K8M A;  1YQ1 A;  1LU4 A;  1SJ6 A;  3U6V A;  4IJI A;  2P0G A;  1ERV A;  3VI5 A;  4EO3 A;  1B4Q A;  3A5I A;  4NWY A;  2PER A;  4PTS A;  2GZP A;  4F9Z A;  5ECL B;  2YCD A;  3CTF A;  4TXO B;  2CZ3 A;  4WR4 A;  3QDN A;  3HJO A;  1X9S B;  1K3O A;  2VAF A;  3DRN A;  4W66 A;  5J40 A;  3FW2 A;  2KHP A;  1GSU A;  2L57 A;  3QD9 A;  4BL7 A;  3LW9 A;  2AHE A;  1URM A;  2DC5 A;  4KDY A;  2MBS A;  3FHK A;  5J4Y A;  1BED A;  1MDK A;  3UEM A;  4YKF A;  1XOB A;  4Z2R A;  1AXD A;  4PUA A;  5B8B A;  3RHB A;  4XS4 A;  3WT1 A;  2L6D A;  2GS3 A;  2IWT A;  1M9B A;  1ERU A;  3VK9 A;  1GSS A;  2VL3 A;  3A2W A;  4KE3 A;  4CY6 A;  3RPP A;  1OC9 B;  2XBI A;  3D6I A;  5JWQ B;  6GSY A;  1O8W A;  2X99 A;  1YDK A;  5G5E A;  2UV8 G;  3KGK A;  1XWC A;  4IS0 A;  4XCS A;  2X64 A;  1XW9 A;  1G6Y A;  3QCP A;  2EC4 A;  1GSY A;  1ILO A;  2H1G A;  3LFL A;  4TW5 A;  2VL2 A;  3LJR A;  2PMT A;  2G0F A;  3KP8 A;  5J9C A;  2C3N A;  4AKI A;  3IOS A;  4MJB A;  2LJK A;  4AJ8 A;  2HSM A;  1M2B A;  1XWB A;  3GFK A;  3HDC A;  1K0B A;  1ZYP A;  2CAI A;  1Z9H A;  4HS1 A;  2KP2 A;  2CVK A;  1TP9 A;  1TW9 A;  5D9W A;  1VGL A;  2H1B A;  2VO4 A;  4TR4 A;  2JSY A;  1TXU A;  4I2U A;  4EL1 A;  4ZBB A;  1GWC A;  1ML6 A;  22GS A;  4BVX B;  4XHM A;  1K0N A;  3F4R A;  2YWN A;  1TK0 B;  1EP7 A;  3FZ4 A;  1FOH A;  5IMZ A;  1YKA A;  3APS A;  2TRX A;  5A1N B;  5E59 A;  2OE1 A;  1A23 A;  5ECN B;  1LBK A;  3IAS 2;  2GT5 A;  1A8L A;  3EE2 A;  3LYK A;  4LMW A;  2GSQ A;  4NXI A;  2RM6 A;  3IE3 A;  2IPA A;  3HY2 A;  2DJ3 A;  3N5O A;  2HRN A;  5G5F A;  1GRX A;  1T1V A;  1BX9 A;  2VCT A;  2C80 A;  3PPU A;  3D22 A;  2VL9 A;  5IO2 A;  9GSS A;  1FVJ A;  2VOC A;  5J3R A;  2JU5 A;  3DVW A;  2QGV A;  1O73 A;  4QMK A;  2H0G A;  4FIW A;  3ZMK A;  1MDJ A;  2P5Q A;  4YQM A;  3CMI A;  4PNG A;  5ECS A;  3O76 A;  2OT3 A;  3DML A;  1TKD B;  4HJM A;  2VLU A;  2VM1 A;  4Z2T A;  4USS A;  5JCW A;  1GSE A;  3UMA A;  1Z7P A;  4O5Q A;  5CRD A;  1GTA A;  2WB9 A;  1SEN A;  2ALB A;  4K7O A;  4X1U A;  4HU7 A;  5ID2 B;  1XWG A;  4GRF A;  3Q18 A;  5J9B A;  1SYR A;  2L4C A;  2CZ2 A;  3KMN A;  3ISO A;  1PSQ A;  1KBN A;  5D9X A;  2V32 A;  1YF1 A;  2VCW A;  4AF2 A;  4HI7 A;  3F3R A;  5B8A A;  4KSM A;  2MMZ A;  2EFD A;  1B48 A;  2IMI A;  4OFT A;  3WT2 A;  3ZYW A;  4KDU A;  1DUG A;  4G0K A;  4O7H A;  3E0U A;  3GX0 A;  5E4W A;  5HR2 A;  3HXS A;  4TOP A;  1GSD A;  1VF1 A;  3GKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...