2VCYA

Crystal structure of 2-enoyl thioester reductase of human fas ii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
332
structure length
332
Chain Sequence
RVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANS-2-ENOYL-COA REDUCTASE
publication title Structural Enzymological Studies of 2-Enoyl Thioester Reductase of the Human Mitochondrial Fas II Pathway: New Insights Into its Substrate Recognition Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.3.1.104: Enoyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vcyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vcyA01
2GR9A 4HFJA 3DZIA 1J5PA 5K6AA 1FK8A 3EMKA 5C37A 3BMQB 4BNKA 1ONNA 4BB6A 4CLOB 1KVUA 4DBZA 1AGNA 4YJGB 2DAPA 3AY3A 1OOEA 5CPFA 1KVTA 1YOVA 3OSUA 3DBLA 1H5QA 5LC1A 4CQLB 4BV9A 3WJ7A 1EDOA 1DAPA 4AICA 2D2IA 1N8KA 4H7PA 4ALJA 2AQIA 2RIRA 4OIMA 5J23A 4ND1A 4CV3A 1DLJA 3AJRA 4PLYA 1NYTA 4I8XA 5CEFA 2FY8A 3TZKA 1X7DA 1L7EA 1QP8A 3F1LA 4FC7A 3E48A 4Q3NA 4YWJA 1HSZA 4KZPA 4GLLA 3MJTA 3DXFA 3FF4A 4CMKA 4DUPA 4PZCA 3TJRA 1KEPA 5DDIP 1C1XA 1I3NA 4R01A 3GGPA 3JQ7B 1JVSA 1H6CA 4CLXA 4CMEA 3BMNA 4L75A 2EF1A 2W8ZA 3FNFA 3IKVA 3T4XA 4IZIA 4BHTA 2JJYA 1LDGA 2IEBA 2PLAA 3SJUA 2C07A 1P1IA 5ILGA 3LYLA 4IMPA 2O3RA 2PZMA 3H9QA 3MJSA 1GDHA 2PZJA 1VRWA 1W73A 3DZGA 4QUKA 3EGOA 5T64A 4GVXA 3S2IA 1X0XA 1Q7CA 3HDJA 3NT2A 2IDZA 3ULKA 1R16A 1ADGA 3H2ZA 1KBZA 3UXYA 4OOEA 3DOCA 1NPTO 2WE8A 3KYCA 4H16A 5L45A 1FF9A 4BNVA 1ADCA 5CHEA 5TSDA 1TB4A 4GPD1 2YHIA 3I9KA 1UZLA 4A2CA 3HG7A 1E7WA 5CAEA 2EJWA 3AK4A 1QORA 2AEMA 3NJ4A 3U4DA 5B4VA 3WQQA 2C2YA 4K6CA 4RVUA 3AM4A 3SLKA 4DTIA 3BMOA 4O0LA 3U09A 4E30A 5DP1A 4IDEA 5DCYA 2HMVA 3EW7A 2PZLA 1HDZA 1QR6A 1U4SA 3ZV3A 1P44A 4LMPA 2NU6A 2O4UX 3DWFA 4BO9A 4CQMB 2J5RA 3K5PA 5KTKA 4NPCA 1BMDA 1RJWA 2GSDA 2AA3A 4JJFA 2UV8A 4BO7A 3FI9A 4JBIA 3C1TA 2J8ZA 3PFFA 1Y9AA 3OA2A 5JFOA 2X8LA 3WGIA 1NBOA 2I3AA 5KJ1A 2OL4A 2PD6A 4HP8A 1JU9A 4OHUA 4Q3DA 4BGUA 4BS9A 4RF4A 1R0KA 4EITA 5L53A 3MEQA 3T7CA 3NTRA 3G49A 4JCOA 3VC7A 2YFQA 2C7VA 3PHIA 5I8WA 3RBVA 1QLJA 3ANNA 4DQXA 3ZW8A 3JQGB 1CIVA 4NZ9A 1LDNA 1RYEA 2EWMA 1AUPA 4Z9XA 3U9LA 4CM5A 1OMOA 1GYPA 1NQ5A 4IQ0A 4WLOA 1NR7A 2Y1DA 5IDXA 4HWKA 4XB1A 1XU7A 4IJVA 4FGSA 2V7PA 3F9IA 3ZNNA 4L74A 3EVNA 4Y98A 3F46A 3ROMA 3UN1A 3PYMA 1QG6A 1ZIDA 2Q46A 3QW2A 3LT1A 1VL8A 1LC3A 2OFPA 1E5QA 4URFA 4GMFA 4E12A 4B3JA 5H82A 1DRUA 5KCZA 1U2DA 3V1YA 4XRGA 4E2ZA 1HE2A 4FFNA 4MP3A 1JVBA 2PKQO 3EZYA 1JWAB 2PTGA 3U5TA 1K6JA 1I8TA 3ICCA 4QSMA 1YJQA 4YQYA 5G0VA 4KOAA 1I01A 4R41A 3RWBA 1RYDA 3LDHA 2Z95A 4DYVA 1M2WA 1YDWA 3A06A 1YRLA 3OIDA 4GX2A 4CM7A 4IBOA 4XGIA 4W6ZA 3WS7A 4XJTA 5FI5A 1D1SA 3VZRA 2Y68A 4NHEA 4YAIA 2BRUA 1IHXA 3GEGA 3GPDG 5H83A 1ONOA 3ZCXA 2BHLA 4BNXA 1H94A 3FD8A 4GQAA 2FPPA 2I65A 4K1LA 4L4XA 1O8CA 1JKIA 4I9HA 1PQPA 2HU2A 3T4EA 2PK3A 2Z5LA 4AJ4A 1NPYA 5KWEA 5A5FA 4Q3CA 1GYQA 1BDMA 1HE4A 2VRCA 2ZKLA 3BYZA 3GA0A 3KUXA 4D45A 2Y1OA 4IDAA 2CFCA 3KEQA 2CMDA 4Z9FA 3G3EA 1ZK2A 3G79A 3BMCA 3WGQA 1HYGA 1CRWG 3DZHA 3V8BA 1WLYA 4BB5A 4XYLA 4E5YA 4IIUA 2G17A 3INGA 3I9NA 5IXSA 1T2CA 1EFKA 3NGLA 1ZUD1 2O3TA 3PIDA 2CVQA 4BNNA 3O4RA 3WB9A 3IS3A 2P9CA 1GQ2A 1OBFO 5JE8A 1Y8QB 1KOLA 1KC1A 1JW9B 3SEFA 4CM3A 1TVEA 3KETA 1UP6A 2J6IA 4EUHA 2X9GA 4OKIA 4MVJH 1T2EA 3BZUA 2OBYA 2E48A 3PGJA 1M67A 1ISFA 2A4KA 3ZV5A 1PTJA 3WDSA 2PFGA 3VPFA 4ALKA 4YT2A 1NWHA 5CG1A 1JN0A 3KBOA 1KYQA 3JQFA 1E7QA 1B8VA 1EQUA 4LISA 2D4AA 3TL3A 3QJ5A 4PLGA 4R3NA 1KVSA 3CZMA 3F6YA 5IN4A 2JFGA 3C7AA 1OAAA 2J3KA 1PJ4A 2AE2A 4CM8A 2V6MA 3W8EA 1U5AA 4RF5A 3W8DA 1C1DB 3I6QA 4FDAA 4B4OA 3GN2A 3SXPA 4IDGA 1T1RA 3CKYA 4XA8A 1P3DA 3JD1A 2OZPA 4NFYA 3DZBA 1A9YA 3DDNA 2WYVA 1KY4A 1SMKA 3S1LA 5JDIA 1ZVMA 3STHA 5KKCA 4DVJA 4AJNA 1YGYA 1MFZA 3CZRA 3OIGA 3KLMX 3DBRA 3CTMA 4CMBA 1NHGA 1PJCA 1WNTA 4GKVA 4PLFA 3IP3A 3JYOA 2FPIA 1JKJA 5A3JA 3RUAA 5HBRA 1GAEO 4OQYA 4ZQEA 4KTVE 5F1OA 4QTZA 4KUGA 4E5MA 4Z6KA 1CJCA 1XSEA 5T5QA 4ZICA 2H9IA 4N7RA 2Q1UA 2WWRA 3OHSX 2WMDA 2Y0CA 4INAA 3VTFA 3WGTA 1U7HA 4YACA 2OOSA 4EJ6A 5IXYA 1R4MA 1JDJA 1YQGA 3O8QB 1JA9A 5LDHA 5KIAA 3PJGA 3DFUA 3OJEA 1G1AA 3WXBA 5AXCA 3ZU4A 3VVBA 3ENKA 1SPXA 1JQBA 1Q7BA 1V8BA 1EK5A 1U3UA 4G81A 5G4KB 5HS4A 1XU9A 4ND3A 4BO2A 3EDMA 3O26A 3GHYA 3JQBC 1HDYA 1YQDA 1O95A 3LK7A 5I7SA 4CUKA 1X7HA 5C3MA 2BELA 3GN1A 3AUUA 1I33A 3TNLA 3GG9A 3NDJA 1U3WA 4H3VA 1UUFA 2G82A 2VWPA 1E6EA 3CXRA 1VL0A 4R54A 1Y9EA 4JLWA 3F5SA 1ZSVA 2QG4A 3K30A 2X0NA 4U7WA 4AJOA 3ITKA 4PLTA 3CPSA 5F1PA 3ADPA 1N9GA 4DPKA 4TZKA 1EFLA 2VUSA 3IDSA 4J16A 3W6UA 4IJUA 1N1EA 5IF3A 3HNPA 3Q2IA 4G2NA 4CMHA 2X23A 3PP8A 3HJAA 4CUJA 3LF1A 4NBRA 3CUKA 1T24A 3HN7A 4CMIA 4RVGA 4ALLA 1DPGA 3NJ8A 2JCXA 4D3DA 1YE3A 4F6LA 4U6QA 4RZHA 3K31A 2QYTA 4L76A 4CR6A 3MZ0A 1ULUA 2P4HX 4E5NA 1BXZA 1UJMA 1ARZA 4FSHA 4MKZA 2C82A 5L4NA 1E7RA 2QIOA 3GG2A 3KTDA 4HKTA 3OQBA 3OECA 3DONA 3OEYA 5G0TA 4NK5A 3VPHA 1LX6A 4GSKA 5DOZA 1V6AA 1XELA 4MO2A 1IZ0A 1SOWA 3RFTA 3ROQA 4RJTA 3I23A 4ZN6A 1TLTA 2NWQA 2W98A 3PVZA 5G0SA 3PLRA 3UOGA 1TEHA 1NXQA 4PLPA 1Y1PA 1XWFA 5TLSA 1YVEI 4W82A 5AXDA 3SVTA 1PL8A 4B3HA 4IDFA 3H3JA 4RPLA 2UAGA 3GVCA 2R6JA 2FR8A 4HNGA 1R0LA 3GNSA 3GPIA 2O50A 4NDNE 3GDOA 5DBFA 3H2SA 5ILOA 1H9BA 3KB6A 3AFNA 2HO5A 4PCVA 4RORA 1QYVA 2G1UA 2GASA 1XA0A 1YB1A 2OO5A 3WR5A 4ALMA 5IAAA 1MP0A 3C1AA 1QV7A 5JYEA 3AM3A 3RASA 1E7YA 4BO3A 2YV3A 4XEHA 4E4YA 1P31A 5EPOA 5KVSA 4WNIA 2J3IA 4RL6A 1NNUA 2FMUA 5I8ZA 4WEOA 4MVJA 1I0ZA 1NQOA 4YJFB 1EVIA 3I9OA 5H81A 5IDYA 2X86A 4DRYA 1VJ1A 3Q2KA 4BNGA 3JSAA 9LDTA 4XQCA 1I24A 1KVRA 3P2OA 3JYQA 1U4OA 2AHRA 1E1NA 1JTVA 2NM0A 4BIIA 1U3VA 4FQ8A 3JQ8A 4XQEA 4AG3A 3NDRA 3VH4A 2HJRA 1NAHA 1F06A 4D3SA 3KYDA 4A27A 5COQA 4XWYA 3CH6A 2FR1A 2E82A 3E5RA 1GUFA 1AXGA 2YQ5A 1M66A 3NUGA 4E6PA 4ILKA 3DAPA 4PLZA 5AQ1A 1H2BA 4J49A 5ES3A 2P4QA 5TS3A 3HDYA 1PGOA 4KUHA 2QQ5A 1WP4A 3MJ4A 2CY0A 4OOFA 4CV2A 4AJ2A 2GD1O 4XIJA 1PEDA 2C7GA 4WLFA 3PI7A 5JYDA 2VNSA 4L4SA 3E9NA 1NVMB 1CERA 2EW8A 4E2XA 3GK3A 2X5JO 1PSDA 3EC7A 8LDHA 4FGWA 2DBQA 4OXNA 4QX6A 4EUFA 4NBVA 4QO7A 1YONA 3FCOA 2PR2A 3TZ6A 2O7QA 3U0BA 3HE3A 4W4TA 1YXMA 2VZ8A 1ID1A 1SOVA 3VH2A 3OQ1A 1B8PA 1K89A 1WVGA 1TT5B 1NAIA 3WGYA 2OGUA 2P68A 4CMCA 4M89A 4PZDA 3SBOA 4MDHA 3ZWOA 1H6BA 1HLDA 4E3ZA 3WMWA 1Q2XA 3VH3A 4WCDA 3IMFA 3K8ZA 4BNZA 1X0VA 5G0UA 2VWHA 2LDXA 4AJKA 1GV1A 5B12A 2Q1SA 1U1IA 4I9UA 4UEOA 1WZIA 3K96A 3O38A 4BGVA 4YJGA 3JQFC 4JK3A 4ND2A 2YZ7A 4R1UA 2NVUB 4TRRA 1A7KA 4CQLA 5A9SB 5BNIA 4OKNA 5BT9A 2SCUA 3GVHA 2CUKA 2VRBA 2VZ0A 2IYOA 4XYGA 2I3GA 4BQRA 4XGKA 1PJ2A 1PIWA 2Y0EA 1VKOA 4JQCA 3OF2A 1VSVA 3Q9NA 3DB2A 2D1YA 2GN8A 3BIOA 5DP2A 4WLVA 1V35A 3ROKA 4Y67A 1ZXLA 2YFHA 3AY6A 3ZWXA 2J3JA 3WBFA 3JQ7A 1ZO8A 3OJOA 3WSWA 4O63O 4DQVA 3PYXA 3ZWYA 3Q3CA 1HSOA 2NU9A 4MVJI 2HMUA 1ZEJA 4BO5A 5BNTA 1LXCA 1PS8A 4ZRMA 5ADHA 4XZ3A 1S7CA 3NRCA 2WD8A 5KOIA 3DTYA 4ID9A 2BI8A 1DC5A 1JKFA 1KETA 2E4AA 4ZJUA 1NHWA 1GCOA 2VUTA 2O48X 3A28A 4MVJG 3EHEA 2W2LD 4JXKA 1ZW1A 1OI7A 3R6DA 5F5NA 2Y1FA 4TSKA 4J7CA 3ASUA 3QVTA 3DBVO 2UDPA 4AFNA 2DLDA 2Y1CA 3BAZA 4KDFA 1LU9A 1E77A 4F45A 4CJXA 1G0NA 1BXGA 5F3RA 3JQAD 3UCXA 1IZ9A 3I9LA 1GY8A 1HLPA 1DIRA 1OFGA 2ZYDA 1Y8RA 1CETA 3VPXA 2QRLA 1MXFA 5BNFA 1CWUA 4J0FA 5CDSA 1VJ0A 2EJVA 1T1SA 4DPLA 4LSWA 2FZEA 4Y6SA 4BNUA 3LC2O 4DMLA 4M55A 2ZB8A 2A92A 1LDMA 1QYDA 1H93A 1PX0A 4DA9A 4Z3KA 3GFBA 3LF2A 5FF9A 3WYBA 2AG5A 3QY9A 3JTMA 2GF2A 5HS6A 3N7UA 2B37A 1IPFA 1JWBB 1KEUA 4NR0A 4C4OA 3PGXA 4CQMA 5IDQA 2Q4BA 4Q9NA 3QLJA 4MOWA 3LT2A 2PV7A 4AJJA 4CMJA 4DGSA 3DO5A 1DHRA 3I3OA 3QRWA 4J7UA 1VSUA 2YHUA 1I32A 4R1TA 1PGPA 1M76A 1UP4A 2BGMA 2B5WA 4EDFA 4KDEA 4BMVA 4FJ1A 3PWZA 1QLHA 3L4BA 4HUJA 1U7TA 3Q0EA 4TVOA 1KS9A 4L4RA 4HV4A 2ZCUA 2FRDA 2O7SA 1P33A 2Q1TA 3JQGA 1MUUA 5TNXA 3JQBA 3VVCA 1EQ2A 3TZCA 3N74A 1AHIA 3PDJA 3RBXA 1LDYA 1ISIA 4XKJA 2BMAA 3VKVA 2IXBA 2O23A 3DC2A 1EUDA 4NK4A 3FR7A 5L3ZA 2YDYA 3WTBA 4MKXA 2O3QA 4OYRA 3D4OA 3QVXA 1RM3A 4E33A 4ZA2A 3AUTA 2QYSA 1HRDA 2VYVA 1ZJYA 5IDWA 5JW6A 3JQ9C 1NP3A 2GYYA 1ORRA 4FB5A 5L9AA 4J1SA 3E03A 5DULA 3TZQA 3C24A 3OM9A 4I5GA 4J2HA 2XAAA 3DZJA 3V2GA 3JD4A 5JAZA 5EJ2A 1DIGA 2PH5A 4OQZA 1LLUA 4Y6PA 5ITWA 4GWGA 1E92A 3BTSA 2H5LA 2Q3EA 3I9MA 1N1GA 3D3WB 4CL8A 1I2ZA 4W7HA 1BRMA 2HMWA 5LCXA 1D4FA 3H65A 3UGKA 1LA2A 5L7WA 1YBVA 5KJCA 2YV1A 3G1TA 2FOIA 2B69A 1K0UA 4TKLA 3PXXA 2IRWA 4NH4A 3RUIA 1YWGO 4EZBA 2X58A 4YR9A 1MGOA 3C1OA 1GPDG 3ORFA 2JD0A 1B7GO 1HWYA 2PD3A 3TN7A 2PKQP 1DFGA 3JYPA 1PGJA 4BO0A 3AFMA 2DQ4A 4J2OA 2BFMA 4CM4B 2I76A 1E5LA 5KVQA 3MTGA 4R9SA 4AJIA 1KIFA 1PQUA 2WD7A 2G76A 1Q0LA 2I66A 1W6UA 1B26A 1M75A 3V5NA 2B5VA 2UVDA 2Y93A 5T8KC 2J5KA 3Q11A 4EI2A 3GVPA 4A7PA 3OETA 4DBVO 3G17A 3NKLA 5DCUA 1N2SA 4UUMA 3ZV4A 1Q0HA 1Y8QA 4JIGA 1ZXBA 1J0XO 7MDHA 4KMSA 5JAQA 2NVWA 4O6VA 5TRTA 4F6CA 2HRZA 1H0KA 1E3WB 4J6FA 1NTOA 6ADHA 1K2WA 3DEYX 1OZAA 4DIFA 4DREA 3PWKA 4HFRA 2RHRA 1C1XB 2VQ3A 5I7FA 4XYBA 4W99A 2UYYA 1YH3A 4RLSA 7ADHA 3UW3A 3H9GA 4OXYA 5DNAA 2JHFA 4J43A 4R51A 4ZVVA 1FDWA 4WCFC 3K2EA 4PG4A 4HX5A 1C1DA 1QV6A 1I5RA 2P5UA 3PJEA 2F1KA 1UZMA 3QIVA 2RH8A 2BF7A 4YVFA 2O3JA 1LBEA 2EHDA 2NTJA 4II3A 3WGOA 4JROA 2IZZA 4II2A 2ZK7A 1O5IA 3CMMA 2P9EA 3K92A 3NDIA 1QYWA 4YJHA 5JDCC 3RUHA 3ZDFA 4YT4A 3SX2A 2BD0A 3KO8A 1PQWA 1XDWA 3NGXA 4U6SA 1BG6A 1EE2A 3SC4A 4P22A 3KYCB 2OP0A 1I2BA 1LLQA 3LLVA 3G1UA 4NJMB 2IZ0A 2YHIB 1IHYA 1XYGA 4UVEA 2Q99A 1LQTA 5TF4A 3D5QA 2CF6A 1HDRA 3DMTC 4P38A 2E6UX 2I99A 1HDGO 1XGKA 4ZRNA 5A04A 1F8GA 1PJLA 4MVJE 4OMUA 1LSOA 2AQKA 3WJAA 3WGGA 3EZLA 3F5QA 1IB6A 4L8VA 3RC9A 4CM9A 4RPKA 4K6FA 3BHIA 3S2FA 5EQFA 1NFRA 2GZ1A 3AU8A 3KEOA 4LVCA 4UVIA 4AJEA 1MG5A 3BTOA 1X14A 4HFNA 2BFOA 3TDKA 3D64A 4BL5A 5CG2A 1WXDA 3BTUA 4YAKA 3O8QA 4QT0A 1XKQA 2Q4EA 2A35A 3GFGA 4PG7A 1IL0A 3UF0A 2VT2A 5IZCC 1BTOA 1ZK3A 3EY4A 3GUCA 4WK6A 2YJZA 4YT8A 4PVDA 4RZIA 3ONEA 4GH5A 1ISMA 3BHMA 1WAMA 5G4KA 2BGLA 2G0TA 4B4WA 4MVJD 1YKFA 1Z45A 3TOZA 3PRJA 3VPSA 3GGOA 4TRJA 2X9NA 1FDUA 4CR7A 4DC0A 4XRRA 3A9WA 2PZKA 1B14A 1O9BA 1DXYA 1C0IA 1YL6A 4QFCA 3WSVA 2EP7A 3NT5A 2X0IA 2H63A 3NTQA 4EEXA 3U49A 3DOOA 1MFPA 2JD2A 1FJHA 4GI2A 4WLNA 3W4IA 1GCUA 3ZH2A 2ZJ1A 4Y8VA 1E1MA 4UUPA 4BNFA 3JQ6A 5AXAA 4I08A 3W8FA 1MV8A 1WDLA 1C14A 2GDZA 3E18A 3E82A 3GUYA 2XXJA 1DEHA 1LUAA 1LLDA 1KEWA 3CMCO 3D1LA 3D7LA 3F3SA 3QWIA 3TFQA 1P77A 3GNQA 3M2TA 1U8XX 4LRTB 4NBUA 4N18A 3OH8A 2AQHA 2W2KB 4DIBA 4XQ9A 3WLEA 1B2LA 1WWKA 4TRMA 3C85A 3FPLA 4YAGA 4S1VA 2DBZA 1SEPA 4KQXA 1T2FA 3T7EA 4ALIA 5A5EA 2H6EA 2JAHA 2PH3A 5HTOA 1FDVA 2BFAA 2O2YA 4IS3A 3AWDA 4ZQBA 1LSUA 4XDZA 3EVTA 5JLAA 5I7VA 4YXFA 1GD1O 4Z3DA 5B1YA 1VPDA 1OC4A 2WTBA 2HLPA 3NEPX 4G65A 2UUPA 3ZI0A 2DUWA 3B1JA 3WGHA 4N5LA 4MKRA 2NACA 3INRA 3QVSA 2AW5A 4ONEA 3B70A 2Q2QA 2NVBA 2JKVA 5JNLA 4NJOA 2Q45A 3M6IA 2FZWA 4KWIA 4QQRA 4XQGA 3L6OO 4JBGA 3TFOA 5F1KA 5JBIA 3WFIA 5DZSA 3L4BC 4Z9YA 4PGFA 3HFGA 5KJEA 5CDGA 2B0JA 1D8AA 3VZPA 4U0KA 3JQAB 4LK3A 4LMRA 4ZHSA 1AE1A 4E5PA 1LJ8A 3FR8A 1ZEMA 1ONPA 4FFLA 1TA4A 3UCFA 5C7OO 2R00C 2J3HA 3KOUA 3QE3A 5KJFA 4BKQA 4LRSB 4CODB 2I67A 5JAIA 1GEEA 1RPNA 1VI2A 2Q2VA 1DRWA 4TKMA 3VTZA 5JS6A 5JXWA 3UCEA 2C5AA 3ZWCA 2PY6A 4GLOA 5JO0A 3O03A 4HBGA 3KSDO 1T4BA 1P0FA 3RUFA 3PFWO 1LRKA 1JAXA 2VHYA 2G5CA 2YYYA 3PTZA 2P91A 4WGGA 2AE1A 3QHAA 1ZK1A 4NG5A 3MOGA 3I4FA 4YJFA 2C2XA 4AJLA 1YBMA 5T57A 1GYRA 2AQ8A 3GLQA 4JJIA 2DVMA 4KTTE 3JD2A 1DIBA 3HWRA 1GFSA 1R37A 3VZSA 4MJLA 1AXEA 1ZMOA 4Y9DA 3UICA 1NFFA 4B8ZA 3GHHA 5I9NA 3IIEA 4MINA 3ZNOA 2RHCA 4OO3A 1N7GA 4BNYA 5CEJA 1WW8A 1EVJA 2NLOA 2QX7A 2O4CA 3DZKA 1W0CA 3H5NA 2VYND 4GMGA 4J1TA 2EERA 1DC4A 3FN4A 3ZNPA 3HSKA 3A4VA 3OJLA 3QQPA 1AN9A 4MPDA 3SC6A 1KEVA 1B15A 1GR0A 4A73A 3JQ9A 3H9EO 1VM6A 4TROA 4PLWA 2DTDA 1A9ZA 5K9ZA 4UULA 1ML3A 1BDBA 1BW9B 2B83A 3DZFA 2WYUA 3WYCA 1A5ZA 2GCGA 3AM5A 3AUSA 4FOSA 4BKUA 3DBHB 3UFXA 1NM5A 1B16A 4CQMD 3IUSA 4D46A 4XD2A 1E3SA 1JLLA 3GR6A 1NFQA 3OIFA 4IQ8A 1HE5A 3FPCA 1TT5A 2QW8A 3UHAA 3I4CA 4HY3A 5AYVA 1EEHA 2ZTMA 3RFXA 1QKIA 1UP7A 1SBYA 4FOOA 4RVDA 4QXMA 1R4MB 1UXJA 5A05A 3PPIA 2HK8A 5KJ6A 3AI1A 1LQUA 3RKUA 2ZYAA 4I5FA 1UR5A 2TMDA 4MIYA 4XJSA 4R4JA 1R4NB 3GZNA 5FEUA 3HQ4O 3QA9A 4XB2A 1GEGA 1NASA 1HZZA 4TMFA 3P7MA 3OP4A 5L95A 1YJ8A 1O94A 5A9SA 3KLPX 1V3TA 4FJ0A 4J1QA 3I52A 1YL5A 4D43A 2PGDA 4C7KA 3GGGA 3TSCA 5B4TA 4WOJA 2HSDA 3H6KA 4YAJA 1EBUA 1HYHA 4BO8A 1X15A 4FJ2A 4BVAA 1I3LA 3A1NA 3M2PA 1PR9A 1PZHA 4WNCA 3GOHA 3S2GA 3UKOA 1BHSA 5T8KA 1PL6A 4KP7A 3S2EA 3TL2A 3CIFA 2VYVD 1HDXA 3R3SA 3K9QO 3RROA 4PFJA 3BA1A 3U4HA 2NTNA 4IXWA 3ZWPA 2EEZA 2A94A 1H6AA 4YQZA 2WE7A 4BKOA 1GL3A 3ZZNA 3NX4A 1E3LA 4GX0A 3K73O 5ICMA 4UVDA 4XYMA 2YV2A 1X7GA 1P0CA 5IN5A 1B0AA 1S6YA 4WUVA 3WWZA 3EAGA 5THKA 4Q39A 4BO6A 1YB5A 2IE0A 3NT4A 4IM7A 3EK2A 4CMIB 4BNLA 1DSSG 3E9MA 5A06A 3B20A 5TIIA 3H9UA 4P4GA 1BSVA 1M6HA 4A10A 1MC4A 1FXSA 3C8MA 3RBZA 3TZHA 3S55A 3BHJA 1JAYA 2Y99A 4GGPA 4WCFA 3VPGA 3H9JA 3F4LA 3R0IA 2NADA 3UUWA 2CF5A 2DKNA 1P1RA 1MX3A 4XGNA 5TX7A 1PWXA 1UXGA 1K6IA 4M8SA 3LT4A 4UUOA 4DQUA 2C5EA 3RC7A 1F8FA 4LW8A 2ZJ0A 5JDCA 4QEDA 4BNMA 2BH9A 5KVVA 1BGVA 5U4QA 3RU9A 5CEEA 1U3TA 1XCBA 3OJFA 1HE3A 4TQGA 4I1IA 4OH1A 2PWZA 3ONFA 4AJPA 3BMQA 4R1NA 2V6GA 1BXKA 3IUPA 3M1LA 4CLOA 3V1TC 1IE3A 2X0JA 4B4VA 2ZB3A 1H6DA 2XXBA 3DMTA 4LVUA 1BWSA 5JY1A 3AI2A 4J4BA 3GY0A 5BR7A 4NBTA 3DQPA 4UVHA 1A7AA 4DIOA 4DLBA 4WPGA 1R12A 1N92A 3ABIA 3BXXA 2ZCVA 2ZYGA 4CL3A 1UAGA 3LVFO 1MC5A 2GPTA 3L77A 4JGBA 1PGQA 2EG9A 4PRLA 3PJDA 5IZCA 3JQEA 4UUNA 2JCVA 4E13A 4YAEA 2FR0A 3ETDA 1OC2A 1QYCA 4OSPA 4M49A 1DOHA 3PYLA 2DTEA 5TJHA 3GZ4A 4NFHA 2QHXA 4A03A 4FC6A 3E9QA 3E8XA 1FDTA 3U4CA 1DDOA 3K6JA 1SC6A 4ZQGA 3MJVA 4RPHA 3S8MA 2GN9A 1U9JA 2FP4A 3MCVA 2OBNA 1QMGA 1DC6A 2ET6A 2JAPA 2I6TA 4RLHA 1ZZEA 1DJQA 3ZHYA 3QSGA 3FNGA 1ZKMA 1PS9A 4ND4A 4MP8A 2D3TA 3M1AA 3V2UA 3KYDB 3E5MA 1O6ZA 1C0PA 1F14A 5BSFA 3ZWBA 1YB4A 2OUIA 5K1SA 4YT5A 3LC1O 1EUZA 1ISJA 3F47A 1BVRA 2VRCD 2VOJA 3IC5A 4DC1A 4YRDA 4IPTA 4PG6A 2NV6A 5JY6A 2GERA 5CDUA 3VZQA 2RBEA 2EXXA 5L7YA 2CVZA 4IS2A 4IMRA 4GVLA 3TPCA 5TJ9A 1E0DA 2CDCA 1ZK0A 3D3WA 4CV1A 1PGNA 2DBVO 1PJ3A 4UEKA 3NTOA 1ADBA 2UUOA 3I9JA 3F4BA 4ND5A 4ROSA 1NVTA 4RF3A 5T67A 3HDHA 4HNHA 3GEDA 4TVBA 4RO0A 4UVGA 1UDAA 3GAFA 3GRPA 4IXTA 2NQ8A 4WJZA 5F21A 3ZWWA 3OEWA 2P2SA 4J9VA 4RQTA 1P1FA 3U4IA 4ZD6A 3U62A 2D5CA 1BVUA 2PNFA 3QVOA 4ZQHA 3GNTA 2EW2A 3IOYA 1ENZA 4J9UE 3OBBA 1Y81A 4CM4A 4RDHA 4J4TA 2GZ3A 3W4KA 5L7TA 5JMWA 4BMSA 3LLSA 3MJCA 1NQAO 4CLRB 3ZWAA 3ONDA 2YQ4A 3B1FA 5CP8A 1R66A 1QXSA 3DFZA 4M87A 4NI5A 4NU6A 2W4QA 5ENVA 1EMDA 1T26A 4X54A 3H5RA 3JD3A 1C0LA 1GU7A 3CSDA 4GSLA 4RVSA 1Q1NA 4PZEA 3JCZA 4D42A 5JPIA 4BGIA 2R2GA 2FWMX 1MA0A 2HK7A 5GZ6A 5L40A 3WG9A 3KHUA 5AXBA 4BUCA 4G5HA 3WBBA 4IGFA 1V9LA 1CYDA 1NVGA 2R00A 3FNEA 3ITDA 4XR4A 1V3VA 2VN8A 3WYEA 5B4UA 3ZV6A 1E3WA 2VCYA 3KXDA 4IDCA 1U28A 5JCJA 1VLLA 3OA0A 3DMYA 4LCEA 4MVJM 1PJBA 2EGHA 2EIHA 3RD5A 2DT5A 3C7CB 4PVCA 2V65A 1RM0A 4IJKA 2X7HA 3R3JA 5JCXA 1K6XA 5KKAA 2D5AA 1F12A 3V1UA 2DFDA 5C5IA 2VHWA 3DR3A 3E1KA 4CMGA 4FPXA 5IG2A 3NV9A 1VJTA 3VHRA 1ZSYA 3WQSB 4GGOA 2JCYA 1T25A 1PR3A 2EP5A 3KYBA 5IZ4A 5L4SA 2JL1A 3ON5A 5ER9A 1PU2A 1ULSA 3B1KA 2TMGA 3ZU3A 3D4PA 3I5MA 1HDOA 2V6BA 2VTEA 2WM3A 3V2HA 1CEQA 1VC2A 4YB8A 4B7CA 3HB5X 4NJMA 2P5YA 1BXGB 4HXYA 4IDDA 4N54A 1LLCA 4XIYA 3KVOA 1MLDA 5JMPA 1PL7A 2FPGA 3HUDA 3PWSA 1C0KA 1EVZA 2WDZA 1Y8RB 1WMBA 2HUNA 4FBGA 3ETGA 1I2CA 1A4UA 2QRKA 1PS0A 3QP9A 3CINA 1IOLA 5DBIA 4GAEA 5A4DA 5BSGA 1SEVA 1TI7A 3TF5A 1J4AA 3IJRA 3D3EA 4U5QA 4XDYA 3RI3A 1UAYA 2V6FA 1YOVB 3ANMA 3DBLB 4Q3AA 4DXHA 3DTTA 4E0BA 3IL2A 4ZGWA 1E3JA 2VHVA 1DFIA 1M6WA 2X5OA 3QWBA 2GN4A 5AOVA 4EJMA 1MB4A 4Z0HO 3W6ZA 1D1TA 1E1KA 2JFHA 4PLHA 4MVJF 1UXKA 1B3RA 1DRVA 4P4NA 3JV7A 2DBRA 1G0OA 1Y6JA 1DC3A 1KVQA 3KSUA 3QWAA 2CD9A 3I1JA 1PZGA 2ZQZA 4F46A 2Y67A 2VTDA 3RUCA 1YL7A 5L4LA 2WJPA 4YRBA 4J90A 1Q0QA 4KUEA 2EV9A 2IODA 2ZB7A 3H4VA 2X5KO 3LT0A 3GH3A 4JN6B 1HDCA 4NNJA 3TOXA 4YYZA 1A4IA 1U5CA 3JYNA 4E31A 2ZTLA 1MG0A 5AVOA 2ZTVA 2DM6A 1Y7TA 3GT0A 3BMNB 4UREA 2NUAA 3LC7O 4L0QA 3OICA 4I5DA 3ROPA 3LSYA 2CDBA 1GZ3A 9LDBA 1DO8A 4JBHA 1K5HA 4PG8A 1HT0A 2VHXA 2WEKA 1V0JA 2VT3A 1Q7GA 2CDAA 4B4UA 2GRAA 4GWKA 4YJDA 1W8DA 4FN4A 3G0OA 2YW9A 3HZZA 5HWSA 3AOEC 3ETEA 3PQDA 5EMHA 2FSSA 3E6AA 2XF8A 2W2KA 4DMMA 2ZB4A 3QV1A 2RH4A 3ZWMA 2GO1A 2YY7A 3QWFA 4FIZA 1ZSNA 2X22A 3WMXA 1Y5RA 1B3BA 1T4DA 2ZTUA 3P19A 4W9NC 2HJSA 1LRLA 1XR3A 2Q49A 3CEAA 3L6EA 4L73A 2GN6A 2HAEA 3GQVA 5GZ1A 1P1HA 4H15A 2BKAA 4J7XA 2I5PO 1P45A 2HDHA 4JJGA 5TT1A 1ZBQA 1FMCA 4S3MA 1CF2O 5KNLA 2PGLA 1KC3A 1XLTA 4J4HA 4FFPA 5ENDA 4O59O 2GLXA 2W2LA 5T6BA 3VKUA 4BNIA 5C7LO 3BMOB 2DC1A 3DOJA 3GDGA 1DBVO 3MWDB 5G4LA 5DF1A 4M1QA 2YDXA 3COSA 2POQX 3L6DA 4JNKA 1I36A 4YDRA 4BKRA 4FFMA 3AI3A 2Q2WA 3D5TA 2VWGA 1SB9A 3AOGA 3F1KA 5FYDA 4IQGA 3ZWNA 3ZN2A 4RQUA 5ER6A 2BI7A 4IJWA 1A71A 2B35A 2OP1A 3L0DA 4B3IA 3JQAA 5EESA 1W4ZA 4O1MA 3RJ9A 3HADA 1X1EA 1LNQA 5BSHA 5COAA 2HRBA 4MP6A 2WD7B 2Z1MA 5LDGA 4GX1A 1P1JA 4LGVA 5MDHA 4D44A 3GMSA 4GBJA 3C3XA 1F17A 2IEDA 3HHPA 3KV3O 4GL4A 2VWQA 4CV0A 4F3YA 4IZHA 3ZU2A 1Z82A 4TZTA 4ZQFA 4BQPA 2PA3A 1NWCA 1TT7A 1YO6A 4E21A 2NU8A 3VDRA 2C29D 1XQ6A 4C7JA 4D79A 5CFZA 4OGWA 3PEFA 2NTVA 1C3VA 3WTCA 4NFSA 1N5DA 3AW9A 4R5MA 1XG5A 3FBGA 4NIMA 3RKRA 2EGGA 1QSGA 4IDBA 1UDCA 5JC8A 1PJSA 4YTEA 3DHNA 1WZEA 3PZBA 1ZJZA 1PWZA 3FWZA 4OSOA 1L7DA 1Z7BA 2O2SA 4QECA 4RV9A 1ISGA 4Q3EA 2RCYA 4PLCA 4DL9A 1P1KA 4R69A 4PN3A 5ITVA 5HRUA 1WPQA 1IPEA 1H9AA 3ENNA 1LI4A 1SB8A 4LN1A 4OL9A 3WQRA 3RUDA 4XYEA 1QYXA 5EINA 3FRJA 3Q1LA 3PDUA 1O89A 3DL2A 1EE9A 1LEHA 4LCJA 4OAQA 2GNAA 2X9VA 2P9GA 1E3IA 3MTJA 4EYEA 3PLNA 1GQQA 3DHYA 3WWYA 1GQYA 1GZ6A 1HZJA 4O5OA 3D0OA 4YJHB 2Y1GA 4EGFA 4WLUA 1B8UA 1F0YA 1UZNA 3WIEA 3VDQA 4I5EA 1P74A 1XQ1A 5K6AC 4BNJA 1VL6A 4GKBA 1SO8A 4I9NA 4ALNA 4WASA 4D7AA 1SNYA 4U8GA 4A0SA 3VAZA 1HETA 3W4JA 3ST7A 2BGKA 4CLHA 1EDZA 4E5KA 3WNVA 4M86A 2X0RA 1BW9A 1R15A 5A9TA 2FHSA 2I9PA 1E1LA 1DFHA 4MIOA 3O9ZA 5A3VA 3BTVA 3WLFA 3DBHA 1GZ4A 1HYEA 4J0EA 3WOHA 1HEUA 1VKNA 3DAFA 3BMCB 3DHEA 5EIOA 1Y5MA 3R1IA 3FBTA 3UAGA 2VZ9A 1V3UA 2X6TA 4FS3A 3K2BA 4WOKA 1AHHA 3I6IA 2LDBA 4OXKA 2HCTA 4RF2A 1SCUA 4U0JA 1O0SA 4QFDA 5JO9A 1UXHA 4YCAA 4XCVA 4RPGA 1ZNQO 1R4NA 3L07A 4R3WA 4ESOA 3EUWA 4IGEA 4TWRA 3JD0A 2VUUA 2NSDA 4YA6A 2CSUA 1NX6A 4CMEC 1I10A 4BOYA 3ZU5A 5ICSA 2H1SA 2XPCA 1YDEA 5F5LA 3LU1A 2WSBA 4N5MA 5B37A 4WEQA 3VH1A 3B6ZA 2Y0DA 2WYWA 1E6WA 4OJNA 4W7IA 2HKIA 4PLVA 2CNBA 4ZU3A 3RVDA 1N7HA 3ZHBA 1YQXA 3FTPA 4BO1A 4Z0TA 4RCVA 1LDBA 4DLAA 5THQA 2W90A 1DJNA 3L9XA 3P5SA 4CM8B 8ADHA 4AL4A 3TQHA 2OMEA 2DPGA 1MXHA 2A9FA 3N58A 5MGBA 4NMHA 1ZCJA 3ANLA 3RC1A 3D4NA 4NU5A 5JAMA 4FFRA 3PQFA 3OQ6A 1KY5A 1DLIA 5BQFA 2NNLD 3MOIA 4FW8A 4P4LA 1PJQA 5EN4A 1UDBA 2ZQYA 1ENPA 3C7DB 4NQZA 4D0RA 1HTBA 2C20A 2Y1EA 3DBRB 1U2GA 3RJ5A 4B7UA 1ENYA 2IZ1A 1RKXA 1PJTA 2EKQA 5TQVA 3RAJA 1A72A 4RGBA 4BO4A 3PZRA 2NU7A 6LDHA 4KQWA 4CMAA 5TGDA 4AVYA 1EK6A 1IUKA 2AMFA 2EKLA 2JHGA 5CPBA 5EERA 4E2WA 2AEJA 1SZJG 5TT0A 4R5HA 1HL3A 1UXIA 1Z75A 1PZEA 4B7XA 2C0CA 1ZH8A 4EJ0A 3ASVA 1RM4A 1I3KA 4YBZA 1I30A 1RM5A 2C54A 4HFMA 3QWHA 4P8RA 1L1FA 4J3FA 1GPJA 1LC0A 1LDEA 3X2FA 3H7AA 1J49A 2DU8A 4MVJP 3RU7A 4R1SA 4JP3A 4EEZA 2D59A 1ZMTA 1LSSA 3IQDB 3H3FA 3IP1A 1D3AA 4K9DA 4NBWA 2AG8A 5G2OA 4DYDA 4Q3BA 1WDMA 3TRIA 3TWOA 1Z74A 4EUEA 1KERA 2NVUA 3WNQA 4D0SA 3WICA 3ZNQA 2D8AA 2B4RO 3GMDA 1Z73A 3NYWA 1IY8A 1PZFA 1SAYA 1LRJA 1CQJA 2B4QA 1ADFA 1GTMA 2PKRA 3IKTA 3FHLA 4WECA 3HN2A 4AJ1A 3DAGA 4UAGA 5A02A 4Y6RA 1XIVA 2QZZA 4BGEA 1U8FO 1ZK4A 4IIVA 4JX8A 2PD4A 4PRKA 4WE3A 4FD3A 5JCJD 4JP2A 4RDIA 3L9WA 4R16A 5FWNA 4K26A 2HMTA 3GDFA 2GGSA 4N5NA 4D3FA 1E6UA 2FSVA 1IYZA 3PJFA 1IULA 1Z7EA 3QVWA 1HXHA 5COBA 4B8WA 4CLDA 5TC4A 2HK9A 2DTXA 5I9LA 3KRTA 2GUGA 3WIDA 1T2DA 2FN7A 1J6UA 1NR1A 1N9GB 5IJZA 1LSJA 3GVXA 4OM8A 5JSFA 2B4TO 4M54A 3FTNA 5IFLA 2ZATA 2CZCA 2Q1WA 4PG5A 3AU9A 4BKPA 2Y66A 5I9MA 3RSHA 1H2HA 3OJ0A 2HMSA 3H8VA 4RVFA 5I7EA 2OORA 4XX0A 1TXGA 1DAOA 1DB3A 5HM8A 1X13A 5DOVA 2AEFA 1E7SA 2Y05A 3EYWA 3GAZA 4YRAA 3Q9UA 3HDQA 2GZ2A 2Z1NA 4TRNA 4R68A 3ZW9A 3VOSA 2ILTA 5K0ZA 1VE9A 5DBGA 5GY7A 4BV8A 1P9LA 5EQDA 4YPOA 3ADOA 2E49A 4CR8A 4FR5A 4J91A 3INTA 3MJEA 3CE6A 1XEAA 2F00A 3PHJA 3AOEA 2D0IA 5A1TA 1I3MA 3U3XA 2QRJA 5L51A 1EZ4A 3NAQA 4WKGA 3LZ6A 2Q50A 4DLLA 2J5QA 4W9NA 3KM0A 1EUCA 2ZIZA 3UH1A 2C59A 3PK0A 5CDYA 3LQFA 1YS4A 3P2YA 2YUTA 3GC6A 1G6KA 3PQEA 5U9CA 3FSRA 3OMLA 5CDTA 4RPJA 1GUYA 4UEJA 3H5AA 1GV0A 2IYPA 4KWHA 4RVHA 4GX5A 1WDKA 2VHZA 3MWEB 1EBFA 1HF3A 1NQTA 3FWNA 4E32A 4XR9A 4EBFA 3AUAA 4E2YA 1WMAA 3UVEA 3PHHA 1CDOA 4BNHA 2E37A 2NQTA 3GZNB 3JQCA 3Q6IA 3PHLA 4CLRA 4K28A 3ZHZA 5JC1A 3WGZA 2O3UA 4IINA 4YEDA 5DT9A 2QZ9A 3PHGA 5KVCA 1E7MA 5EL0A 1HKUA 1LTHR 3W1VA 3A14A 1RWBA 1DIHA 4A5OA 1E3EA 4BNTA 1UH5A 3HFSA 3GRKA 2HQ1A 3HB4X 4AJHA 2OXIA 4IY1A 3FNHA 3ZGYA 5DN9A 1D7OA 3RCBA 2DUUA 5U1PA 2OHXA 5JDIC 1R6DA 4MIEA 3ZHXA 2X1HA 3JQ8B 1EVYA 1X1TA 2XOXA 3GF4A 3I83A 1T2AA 5FI3A 2JD1A 2X4GA 4QO8A 3RQSA 4LSMA 1K3TA 3GEMA 4FFOA 4L9RA 2PGJA 2EKPA 1DIAA 4BNWA 2VNAA 1ENOA 1ZFNA 2IXAA 4FCCA 3X2EA 1CQIA 3AY7A 4PIVA 4B79A 5G0WA 1QRRA 5A03A 5BSEA 4WLEA 4A26A 4CUZA 3WX0A 4DWVA 4HADA 2BFPA 4CM9D 5FFFA 4D41A 4CM1A 3RIHA 2O3SA 1DHTA 1GADO 3ICPA 4J1NA 3JYLA 1XHLA 5GZ3A 3OFSA 4IUYA 3RC2A 3SJ7A 4CM6A 3IAHA 4ITUA 3L4SO 3GVIA 4WCFB 3ZWVA 1FDSA 1R0SA 2CVOA 3JQDA 2VOEA 1Z6ZA 4Z0PA 1NPDA 2BLLA 5HA5A 2B36A 5GMOA 5C7IO 3KZVA 5A9RA 2AXQA 3RFVA 3IJPA 4CPDA 4CLEA 2VYNA 2RAFA 4BMNA 1ISHA 3RUEA 3PIIA 3SLGA 2DFVA 2JFFA 4R9RA 4EW6A 3KSZO 1YBAA 2DPHA 5DCWA 4DPMA 3WFJA 1GUZA 1A27A
chains in the Genus database with same CATH superfamily
4U5XA 4BTEA 4HFJA 3HN6A 3WLAA 1KDOA 2J3EA 3EMKA 3BMQB 3BSFA 4BB6A 2CYCA 4NWIA 1S1MA 3OM1A 4DR5B 4CLOB 4H3SA 5MFZA 1DNPA 4YJGB 3CO5A 5CPFA 1OOEA 3Q88A 4ZXPA 5LBUA 1H5QA 5LC1A 2IP1A 4RJ2A 2WG0A 3AHCA 4KC0A 1BJTA 1IJBA 2FSFA 3FPJA 1WS6A 5J23A 3AHDA 4CV3A 1HFWA 3GARA 2QM3A 1DBSA 5CEFA 4J16C 1N2JA 4KPEC 1ZX1A 4OSEA 4HVAA 2VPQA 1X7DA 4HMPA 1GIAA 3KS9A 3PE6A 4K7JA 2RKOA 5KTNA 3VZCA 2J6BA 4D99A 2ISCA 4Q3NA 2F8MA 4WD3A 1HSZA 5K6TA 1N57A 3V3KA 2L82A 3D6TB 1AS3A 1H8HD 2V5VA 3MJTA 1R27A 3TJRA 1L5OA 1CUHA 1QHHB 5KOJA 1OREA 1B23P 1C1XA 4R01A 3I58A 4M0EA 5I9SA 3SG0A 2WJZB 4OP1A 4CG3A 5T41A 1UKCA 1G3QA 1ML4A 1OCEA 2DQZA 2F4NA 5A7FA 2XQFA 4WT7A 3GUZA 1UXOA 2W8ZA 3IKVA 1FFGA 1T8SA 3T4XA 2WYIA 1XNHA 4IZIA 2V4MA 3E0QA 4P08A 1LDGA 4RMJA 2IEBA 2QUJA 5IVDA 2QX9A 1JG1A 1M33A 1P1IA 4PGMA 3LYLA 4IMPA 3H9QA 1QAQA 5JNSA 2Q7DA 4TV9B 4PAOA 2D6FA 2OG2A 2QENA 3CR7A 4AKHA 3DZGA 3EGOA 3CH4B 3HL4A 3S2IA 3PDWA 4S1PA 2YIVX 3AEZA 4QVGA 3HDJA 2J0VA 3QPCA 3NT2A 3QM1A 1QU2A 1ADGA 4FYIA 2AUMA 3DVRX 1UJCA 3FUWA 3H2ZA 1KBZA 1VLVA 4ZDIA 1OFHA 2P5SA 2WE8A 2XUZA 3CLRD 3DOCA 3KD2A 4H16A 4RKQA 4IV8A 4I81A 3WO0A 4XSGA 1H5NA 5ALNA 2X8JB 5CHEA 4INOA 2GNPA 2L0XA 1RTKA 4MJ3A 1WD5A 2V9CA 4GPD1 4O4LB 3GT7A 5I6DA 4RIGA 1VHQA 3SZ3A 1I7NA 4MVYA 3LQQA 3WLIA 5CAEA 4DB4A 4G24A 4ZO4A 1DAKA 1QORA 3DGEC 1C8VB 4TWJA 5F2KA 1Z0SA 1HGXA 3H04A 5F12A 3WQQA 1F2DA 2C2YA 2F3RA 4K6CA 5DHUA 3R40A 5FJIA 3H0CA 2QAGC 3EEBA 4ND8A 3PXCX 4IVPA 3T12A 4GP6A 1K7CA 3OOEA 4E30A 3U09A 2QR5A 3KAKA 1DXOA 5DP1A 1K5GA 2VJQA 2X4IA 2ZETA 3EW7A 2IV3A 5K2MA 4QGHA 3EZ6A 3RYFA 2I78A 1QR6A 3ZV3A 1J70A 5IM4A 1P7WA 3N6VA 4BVEA 2VC2B 3M4YA 2O4UX 1YKGA 5GTDA 2XGGA 4CQNA 2A14A 2AA3A 3W8NA 2R6R1 4QXQA 4RLQA 2BEKA 5EEGA 2Y9PB 2UV8A 1NVVR 1KY2A 3NS7A 3ERCA 4TLBA 4BO7A 3Q2OA 3A3OA 3RRFA 2YZNA 4AMGA 3PFFA 5CM8B 1Y9AA 5HFNA 3QU9A 3ROTA 2X8LA 3GAMA 1AQLA 3WMEA 2EBHX 4H4CA 2I3AA 2JLYA 1O96A 2WIAA 3DOHA 5KJ1A 3NWPA 1GGEA 3HA5A 7YASA 2RCNA 4P35A 4BGUA 3IAFA 4BYGA 4OK6A 4BS9A 2VQSA 4RF4A 3DD1A 2C61A 1R0KA 2P90A 3WGNA 2X7XA 5L53A 1C4OA 3MEQA 1F9AA 4JCOA 4UHJA 3SR4A 3K3PA 3NQ41 2YFQA 3EZFA 3KFVA 5JTUA 1MV5A 2HEGA 1HKHA 2AG1A 3RBVA 1JLHA 4HDKA 4F1WA 1RAFA 3ANNA 3C5CA 3FYHA 1ATIA 2OHJA 3ZW8A 1USKA 4X6XA 3IT2A 1CF4A 5ITZB 5A6SB 2IHVA 2JLXA 3LQYA 1OMOA 4GI7A 5DXJA 3PR3A 1T1JA 2QPOA 2VDLB 3FVRA 4TSRA 4Z1MD 3ACDA 1SXHA 1Y1RA 3TDNA 4EB0A 2ZR7A 4LXGA 5IDXA 4LRQA 4XB1A 3WIBA 2JAQA 1B6GA 4KWCA 2A2ZA 4PXAA 2V7PA 3TG2A 2ZS9A 3KKMA 1S5PA 2GK4A 5J5AA 3F46A 4BUJA 4TT3D 2GRJA 3PYMA 2Q46A 1Q57A 4ZP1A 3DR5A 1UMCA 1NLZA 3V1LA 5AK5A 2ERCA 4E12A 3KKOA 4LOJA 4GRIA 1YVPA 4NMWA 1Z4OA 5AI4A 3HY4A 1DOZA 3KDSE 4PE5B 3P2EA 1R0YA 3VZDA 4LZPA 1RBYA 3ICCA 3ONNA 1I01A 2AI1A 3LDHA 2Y4OA 2Z95A 2PVCA 1BH2A 3A06A 1KO5A 3RK0A 2DQYA 3OIDA 3RANA 1RI4A 1I7LA 2PXXA 4JU8A 4QGSA 5JD5A 4W6ZA 3WS7A 1GZVA 2P69A 2C5LA 3D3NA 3MXOA 5FI5A 5L3RA 1JMKC 2VH2A 2NO6A 2X7JA 4NHEA 1IHXA 5H83A 4HB0A 1ONOA 1IVYA 2R87A 5DX8A 5HRAA 1GG9A 3K09C 4KX3A 4RM2A 4GQAA 2PRSA 3W9YA 4RHFA 3FOBA 2QJOA 4AJ4A 2Z5LA 1YDFA 1LPBB 1QKKA 2OCIA 1FNDA 3H05A 3IPLA 4LDAA 1Z4MA 5B1SA 1ANKA 5LYYA 2XUJA 3ZCSA 3H5OA 2LTAA 3EXHA 4LXTA 1UMKA 1KE2A 1ZMRA 1ZU4A 2ZKLA 3KUXA 3BYZA 4DCUA 1JDPA 4D45A 1WM1A 5CXUA 4Z9FA 4L7QA 1ZK2A 2V97A 1HYGA 5JO0A 5IDVA 3T5BA 4QXAA 1NW7A 1WTCA 4HJXA 4B6QA 4BB5A 1N0WA 4MR8A 4E5YA 4IIUA 2QVCA 1R5NA 2HV8A 1E2KA 3I9NA 2OV4A 5ANRB 1ULZA 5KC8A 5KMGB 1YHNA 4XUCA 3EFEA 1U2QA 2WMNB 3HDTA 3QPWA 3VYRB 6Q21A 1RXCA 1C30B 4LHXA 5K8TA 4AMBA 3PIDA 2RHOA 4ZPXA 5ILQA 1Q0PA 3AESB 5IARA 4XW2A 1RRVA 4X1KB 5JE8A 3ILVA 3WO1A 2X0FA 5PNTA 2WBLC 3X1KA 1JW9B 3DZCA 4Y2SA 3SEFA 4CM3A 1TVEA 4IHAA 5IJXA 3KETA 3NOVA 2X9GA 3GGCA 3AYXB 1MF7A 2WFMA 1WZNA 3C87A 3GJ4A 3BZUA 3EIHA 3G2JA 3NB0A 4JOCA 1QP4A 3N59A 3CURA 2FLWA 2XKAA 4J0DA 4EKGA 2A4KA 1VBMA 1J1IA 2WVGA 2PFGA 3VPFA 3BIFA 4WZBB 1D04A 3CRW1 5C8YF 1UFQA 1GTVA 4WSOA 3WHKA 1J2EA 1AQYA 1P2UA 2QXUA 5TPWA 2QUAA 1OX4A 3BICA 1B8VA 1EQUA 3PUHA 3U3MA 4DR2B 1OB2A 1G59A 2QYHA 4J0CA 2H4JA 4W7IA 3FUXA 4F3CA 3STVA 2OO7A 3DVAA 3QJ5A 4PLGA 3H5IA 4PHTA 1KVSA 1ZDMA 2LPMA 3F6YA 2JFGA 3C7AA 3KR0A 3MS7A 4JEHA 2J3KA 5CM9C 3WP1B 1JAZA 4P3NA 4UBIA 4RMNA 4RZSA 2PIDA 5JNRA 3PUVA 1DADA 1ZLYA 3W8EA 3PR2B 5KI6A 2JJ2D 3S2UA 1WBJB 3PCRB 1WXGA 2XMDA 5K20A 2UUCB 1L7AA 4LX0A 4YGXB 3RHTA 4NFYA 4YPFA 4EFNA 2GZMA 1E2IA 1EXMA 4RVOA 1HY3A 2WYVA 3SFVA 2QP3A 5H0IA 1RJ9B 4ZK2A 4MAMA 3AMVA 4RJLA 2Z4TA 2W00A 3OIGA 3CTMA 1P1CA 4HGZA 4MNTA 4CMBA 1MVOA 1V1RB 3PDHA 1IBCA 2GVNA 4RX1A 2H5JA 3DA8A 1JQEA 3Q3IA 3RUAA 3WYNA 5CB6A 1DXHA 3KT3A 1GAXA 4GBMA 2GJ4A 2J6HA 2YYZA 3QLUC 3ENQA 3CVYA 4QTZA 3Q3GE 1CRLA 2FDXA 1KPIA 3FVVA 3NV7A 4KUGA 1CJCA 3A9SA 1XSEA 4QEKA 3U4GA 1MB2A 1ORIA 3MQFA 2Z30A 3OIYA 4PPQA 4MX8A 4RXMA 3WHPA 821PA 3OLQA 2HEIA 2OZEA 4MR9A 3HKEA 3IP8A 2R2AA 3OHSX 3U1BA 5EE3A 3JAWB 2ZJBA 2QBYA 3NDBB 1H2RS 1SXJC 2Y0CA 4YACA 2OOSA 1QOZA 5D86A 1XAHA 3VR2A 1JA9A 1QUFA 3DKRA 2AOXA 1E94E 1XZHA 1G1AA 1WF3A 3WXBA 4AMUA 4DGQA 5AXCA 1XTIA 4OHCA 3VVLA 4J2TA 2B82A 4Q9AA 5TB5A 1Q7BA 1V6CA 4G81A 1WDTA 5HW0A 4C0HA 3E8SA 4DNFA 5AVVA 2WABA 4DR4B 2IXFA 4ND3A 4QPCA 1HQDA 2QIPA 3O26A 3OVMA 1TO1E 2HRRA 2D1TA 1U8AA 3F78A 3FYSA 4FR2A 4I50A 4IV5A 4P6VF 4S12A 5GQSA 5KWVA 1T3ZA 4DLPA 1X92A 4XVCA 1A3CA 2VPWA 1R10A 3IBGA 1QIKA 2QV7A 2RHBA 4XH9B 3I8SA 2I2AA 2BELA 3Q0IA 1PLJA 3AUUA 3GROA 5EFZA 3I09A 3KB2A 4QPJC 4LAFA 1Z68A 2FQXA 2OFOA 4AI6A 4RQAA 1LPMA 2YJ4A 2G82A 4NV3A 3RSOA 3OKAA 5IT9A 4HQKA 1G60A 1UBGA 1V7PC 1QC5A 3OWXA 4GHWA 1VL0A 2GHQA 3N8IA 1I13A 1Y9EA 2FLVA 4JLWA 4RH0A 3EN0A 1H4TA 1ZSVA 1TKAA 4IDPA 3ZYZA 4DCSA 3DCJA 3F9CA 5D2CA 4U7WA 2Z2JA 3RS9A 1E5TA 3B6JA 2ACKA 3A9UA 4R40A 5C35A 2IHKA 1EFLA 2PKEA 3IDSA 4B47A 2ZRGA 5FX2A 4B0OA 3TL6A 3WYDA 4G89A 2IH4A 5H02A 5EWJB 4Q02A 4IL5A 1NVVQ 2UXDB 5JXIA 1TO2E 3KJXA 3GLKA 3PP8A 3E3LA 4U8HA 1UBJS 2ID7A 2YFYA 2O6LA 1T24A 1XHFA 3CX3A 3HN7A 3L0CA 4BVLA 1V8OA 3B2NA 1QGED 2EOAA 2I4MA 4ALLA 4JP1A 2I8AA 1DPGA 3GT3A 2IS6A 3HS3A 1AQ6A 2J0EA 1FXWF 4E7OA 2G0NA 4D3DA 4BAUA 2BEWB 3UV3A 3H84A 1ORHA 2BKXA 2VP2A 1ULUA 2E3JA 1BWRA 2P4HX 2VP3A 3DMDA 3EPRA 4MPPA 2REQA 4FSHA 3T7JA 3LHIA 2F1JA 1TAHA 4EKNB 5SY9A 1TYZA 2J0UA 2JH3A 3N9IA 4QOJA 4YCCA 1E69A 1JQ3A 3B2EA 5HKOA 1C41A 3PFCA 1IHOA 1MABA 2GZHA 2ZP1A 3LP5A 4EPRA 2JIQA 4YRGA 3WRWA 5DLEA 3A25A 4YWHA 5C52B 4WERA 2FG5A 5BT8A 5DOZA 4MV1A 1XELA 2ZQ5A 4MO2A 2Y8EA 5TDHA 1XNQB 4MSUA 1IZ0A 1LV7A 3ROQA 2I4LA 5BN5A 3I23A 1JYSA 1HK7A 3RWOA 3PVZA 4ZN6A 5JT1A 1PO7A 1FUKA 3N8GA 1UDRA 2C04A 3AKCA 2C3YA 3GLIB 2CCGA 2UUAB 1PZMA 2H8GA 5TARA 1TEHA 1H3FA 1V96A 2EF0A 4F4DA 1Y1PA 3R0XA 3KHTA 2AR7A 5TLSA 3W5UA 5AXDA 3FFXA 3KQMA 1I5OA 2R86A 4H1VA 4RIEA 4HNGA 3UJDA 3GNSA 5H68A 1UKYA 4JBYA 4B81A 1TKBA 3HNOA 1JDBC 3PA6A 3R7BA 3GDOA 1P62B 1QWSA 5DBFA 4B2LA 1H9BA 3GLGA 1SCUB 1VGQA 2HO5A 2XDYA 3KK0A 2R6DA 4C76A 4DY6A 3QX8A 4BZXA 4RORA 4HXEB 2GILA 2I2CA 4JV5B 4TUYF 2GASA 2C7BA 2IE8A 3ZHSA 1Z0KA 3MGCA 4ALMA 1IBKB 1JSCA 3FPAA 2BTOA 3C1AA 2I2XB 1QV7A 3ESQA 1AKYA 2FXIA 3AM3A 5HKBA 5BR8B 2GEUA 3ECSA 4BO3A 2Z08A 3MCAA 1LK7A 4AX4A 4RIHA 4G8CA 1XJQA 4G67A 4JSRA 1G4UR 1P31A 2FUG6 5EPOA 2C03A 2J30A 4ME6A 4CWAA 3F90A 3LKBA 1H2EA 3K8YA 5G02A 1XZPA 1I0ZA 4K9PA 3O9MA 3QF4B 5DGCA 1EVIA 1W25A 2X0KA 3T9CA 4R71A 1B2RA 1O03A 2RGEA 2ZPTX 5HR5A 2YTZA 9LDTA 4X91A 4XQCA 1XCMA 2E87A 5EG5A 4ZVRA 3PX2A 5BWBA 1AG9A 2RHGB 1Y8ZA 2JZOA 2QTFA 4DCVA 1JTVA 4L51A 1GGVA 3QHQA 5T4HA 2ZULA 1RWWA 4IIJB 1ZGAA 3SC2B 3V4LA 4OV6B 1KHTA 4RABA 3M4JA 4NE9A 3ZJUA 3E84A 4AG3A 3D7SA 3L2OB 3Q40A 4M37A 5BURA 1A2OA 4WK0B 1BFDA 1F06A 1UMBB 1Z0JA 3RRJA 4XWYA 2CLMB 3K0AA 3AJ9A 4HJRA 4D6XA 5CYGA 5EJEA 3E5RA 2OD9A 3P0FA 1A9XB 2APJA 1AJEA 3SQOA 1KO4A 2CFIA 3C97A 3NDPA 4KREA 1K86A 3MHTA 5JSQA 3IA2A 1GNQA 4OCZA 4PLZA 5AQ1A 1BYIA 1EGQA 2ZYWX 4XDGA 5LXTF 4K5QA 4YV0A 4KUHA 2QQ5A 2PZAA 3ED5A 3WIVA 3MJ4A 3WOVA 4BBZA 2CY0A 4QYTA 3S81A 1JR6A 1U80A 2PO7A 4E94A 3A36A 2XH8A 2PL3A 2GD1O 3I05A 4P83A 4XIJA 4BX0A 1E79A 4WLFA 4K2HA 3FA2A 3AT1A 3KKEA 2XADA 4GUDA 3DTVD 3EXEA 1NVMB 1CW2B 2QPTA 3ET4A 1FNNA 2QVZX 3HXOA 4L8WB 4W5JA 1I2DA 4OHZA 4QUGA 2X5JO 2DBYA 1OAKA 3FZEA 4FEAA 4H60A 1V11B 3IDAA 2QLTA 4GPZA 1E64A 3ZHQA 5HJ7A 1H4SA 5ES4B 4OLAA 4BVGA 2WT4A 3SE0A 4W5OA 3U0BA 1F4VA 1E9RA 4MS3B 3VH2A 3OQ1A 1WVGA 1TT5B 1U04A 1RKQA 2OGUA 1TZBA 2OCKA 3ZX5A 1T15A 1Z13A 4H7FA 5J1SB 3BT7A 4H1HA 4XD7D 4OA8A 1KSHA 3DEHA 3DKPA 1UOPA 1L5WA 1AY0A 2G08A 3IMFA 5ECDA 2Q5OA 3PQ7A 3QXSA 4KYTA 2VWHA 2VP9A 5DTIA 4IJ6A 1PG2A 2GCIA 2HQOA 2Z0MA 5G0UA 1FNBA 5DM0A 5B12A 5K05A 4LXHA 4I9UA 2H16A 4EG5A 4YJGA 3JQFC 4EECA 4F1JA 2BSAA 2J08A 3DZDA 3TK1A 3RIEA 1IY0A 1OASA 1OPRA 2HLDA 2CNWD 2FKNA 2V3WA 4X71A 5A9SB 3LBNA 5BT9A 5F7JA 2ACWA 2PAFA 3GEIA 1EBBA 1K75A 4J7AA 4WINA 5CNIA 5EIHA 5A5GA 3AY0A 3LWNA 1ZONA 3TZLA 4XYGA 1XZQA 1KA9H 5NLLA 5JJIA 3DZ8A 2YWHA 3H2KA 2XT9A 1VIVA 4UPDA 1PJ2A 1K8RA 1PIWA 1K6EA 2Y0EA 5LUBA 4KGZA 3BGDA 3UWOA 2Q4TA 4X92A 1M8KA 4ZOAA 4BLSA 2Z9DA 2C92A 3DSRA 4LC1A 3DMFA 3B2QA 3OCJA 2XNJA 4GOLD 2BZGA 2GN8A 4AUEA 3BIOA 4JKYA 5DP2A 1VFPA 4UTRA 2PJUA 3CUSA 2I91A 4X61A 1V35A 3R0JA 3HCDA 3O73A 2WSMA 4PANA 1WX1A 1FRNA 4JS0A 3ZWXA 5J59A 3WBFA 2XAUA 1NUHA 3H2HA 1KU6A 3OJOA 4ODIA 3PYXA 3VTAA 4O4IB 1MT3A 3NFYA 1HSOA 3O3MB 3Q3CA 4MVJI 5KQLA 1M1XB 2WOOA 5ADHA 3KDPA 1NJ2A 1O08A 2DP4E 2W2NA 3ABSB 4GC5A 1UBEA 5KOIA 1M1YB 2QI9F 4PZZA 2BI8A 2P1DA 4TV9A 4DRZA 1LNZA 4M46A 4ZJUA 2XD9A 2W71A 2Z98A 2VUTA 2O48X 3BULA 2ZSDA 4MVJG 1H5UA 5CCBA 2JLWA 4GYKA 3RYIA 4B2IA 4RCYA 3R3ZA 1L2TA 1OI7A 3BGWA 3BHNA 3R6DA 3HI6A 4N0EA 4QU8A 1GTRA 3H5WA 3UK2A 2XB6A 4HGPA 3I39X 3KYJB 3P2MA 4O08A 3DBVO 2AMYA 3LUAA 3IMCA 2OGWA 3EQ6A 4FS8A 4Q03A 1J0DA 5DYYA 4CG0A 4BECA 3VUFA 4DJTA 1NXXA 4IH1A 2JKYA 3ND9A 1WB6A 2OCXA 3V4OA 5B53A 2X8JA 2G5PA 4BFZA 2OAP1 4O4LA 3JQAD 2H3EA 1IZ9A 3I9LA 2OFWA 4K6GA 1GY8A 4XPIB 5ERXA 1YCDA 3OZUA 1R3UA 4R8MA 5DJ5A 1Q1BA 2JI7A 4CDNA 3FYCA 2PUCA 3FTEA 2GEKA 1MXFA 1U8ZA 3PQ5A 3TW4A 1VJ0A 5CBPB 1TCVA 1VE7A 1ZJJA 4DPLA 5KZMB 3ZGXA 3WRYA 4WL0A 2ZRNA 3LC2O 3CUWA 5GVSA 2XRYA 4XWGA 5H3HA 4CFZA 3F3KA 1WCV1 5HF8A 1ODSA 1WLSA 3O9VA 4X8OA 2N75A 5CXQA 2YC2C 2LE0A 4NE2A 4PWZA 2AUNA 1MAAA 3I92A 13PKA 2WJWA 2GJKA 2WT9A 4TTAA 4B9AA 5K0GA 2GF2A 3HA7A 4JJAA 1JLRA 3UJAA 2AJBA 4UBKA 2E1RA 3KQLA 2GXAA 2C2MA 3PGXA 3NEJA 4XIGS 2BR4A 3QXCA 4RMGA 2OQ2A 2H29A 2ZSHA 2E7ZA 1E1CA 2H2WA 5DNCA 3ME5A 1WSWA 1GL6A 2QSUA 4MQUA 4CYMA 1RC8A 2C4VA 2LNDA 1GL9B 4ABYA 1YCGA 3N70A 2HH9A 4BJ1A 3RFUA 3QRWA 1DJMA 4AMZA 1I32A 3AETB 1CU1A 3OOHA 1M76A 4GOND 1ZAKA 1UP4A 4N0PA 5JWOA 4KLZA 4OJTA 1J22A 1J1ZA 4HAUA 1E1QA 1K5DA 5TE9A 4EHKA 3L6UA 4H7JA 4JI7B 1YUBA 3Q1KA 2FEMA 3VNAA 3LPCA 2Q0QA 2R7NA 2FW7A 3ML1A 2WJ3A 3FNQA 1KS9A 4FNOA 4QQKA 2FOLA 4ZQIA 1U1EA 4FILA 4JB3A 3HXPA 1J20A 4BZZA 2H65A 2O7SA 3RYCB 3GZTB 4PPFA 5DYTA 2P77A 3WJ1A 1L5ZA 3DOUA 4D8WA 5J1TB 1S3SA 3F97A 5ITZA 3RBXA 5A6SA 1LDYA 3MGAA 1HNZB 3IIMA 2BMAA 4NE7A 1W19A 2O23A 3BXPA 3DC2A 2QX6A 2Z3VA 3FR7A 5L3ZA 1M73E 2YDYA 3NC1C 2XCSB 3ZVRA 4AO8A 1A76A 1A9OA 1ZQ1A 1RM3A 1SKBA 2A0KA 4XCXA 4ZA2A 3MD0A 3T3OA 2FPLA 2QYSA 3H2YA 3EGVA 1ZGCA 2VYVA 1ZJYA 2ZE8A 2RAVA 4JR1A 4ZZ2A 4PSKA 2GYYA 3C16C 4EHFA 5JW6A 3A2KA 5BRNA 4ES6A 3UK6A 4CE6A 2B9EA 2JLSA 2MSCB 2O07A 5K3DA 3E5HA 1Y42X 3PQ6A 1P5FA 5LM3A 5E8JA 2I4NA 5IP5A 4JLNA 5AOAA 2CBGA 3QVGA 1Y5NA 1R6VA 4ZQCB 1U7PA 1MOSA 2WWIA 3NOQA 1NM5C 2VLIA 1RACA 1K7EB 2DJ5A 4E11A 1XWWA 3GJ5A 1A0OA 1SD5A 3A11A 3JD4A 4JCCA 5JAZA 5M7EA 1PWYE 1CC1S 3IP7A 3MAAC 4GWGA 3IHTA 2Y71A 2H5LA 2Q3EA 1QRAA 2P9HA 2OHIA 1CG6A 3D3WB 2OZVA 2XW6A 4TLDA 4CL8A 1YGPA 4HLQB 4JJ6A 2WJVA 2Z2KA 4EYEA 5KX5F 2DEUA 2YRXA 1FW8A 3B82A 3JPYA 1LA2A 3KLBA 5L7WA 1J0EA 1O54A 2ETVA 1SG9A 3MWDA 4ECEA 1K0UA 3GRAA 4TKLA 3PXXA 2WKSA 4WZAB 4DUGD 4EZBA 5EEHA 4JYMA 1MGOA 1M2VA 5FO0A 2MIIA 3NIBA 1GPDG 2JD0A 2ZRCA 4I1UA 4JT9A 1XNJA 4M1ZA 4WXRA 1ZUHA 3TN7A 1O94C 3EVAA 3UGTA 3V32A 2PKQP 4EYOA 3LHDA 4PCUA 3PUYA 5LZ2A 3SLRA 3VO8A 1NZFA 1YZNA 1ZINA 4BO0A 2NZ2A 2BFMA 3G7UA 1ZLXA 2I76A 1IOVA 2D0OB 3ABOB 3GLSA 1VB3A 3WAKA 5KVQA 2CE2X 4EFDA 5BW4A 5EZYF 3WLPA 1KEEB 1NY6A 2WD7A 4N0QA 2IT1A 4EF4A 3QEOA 4PONA 3HKBA 2VK1A 3BH0A 4G5GA 3V5NA 5IVHA 1VLJA 1IHUA 1DELA 1XB2A 2B5VA 4ZVLA 1O58A 1XDBA 2Y93A 4RYLA 2FE1A 4L1KA 5T8KC 4MRNA 5KMGA 5BV1A 2D00A 3EISA 3ELUA 4G6ZA 2AXNA 5JVDA 1C30A 2ODPA 3NM6B 3U19A 2QORA 2GXSA 3OETA 3T99A 4AURA 3G9QA 3G17A 3DQQA 1DINA 2FETA 3RUPA 2IUYA 1CZNA 1VCOA 3AESA 5LQAA 2PRYA 4M1KA 3UWKA 1UBOS 3RVPA 5FQNA 2DGDA 4LXUA 1ZXBA 2FRXA 3ZDEA 7MDHA 4B09A 2WM2A 2P9JA 2Q5QA 2Z2YA 3I2YX 4KMSA 4O6VA 4GXQA 5E6UA 1PL0A 5JAQA 4B73A 9ABPA 1NLYA 3EXIB 1L7OA 3HO6A 2O8EB 1L4GA 2IC5A 4PEVA 3RHSA 4RACA 1NTOA 5I5GA 4KCGA 1YZQA 1M8PA 1OTYA 4MLPA 4EPYA 1WY7A 4WZBA 3J7TA 2DR0A 2VQ3A 4H6XA 1CRZA 5CW1A 5HP4A 2ZUTA 1KAMA 5TS2A 1KI9A 4RLSA 1X38A 2BMFA 4FFSA 4FLEA 4LQDA 3GELA 3UW3A 3H9GA 4ZYUA 3PB3A 3X2SA 2R6HA 4MMZB 3K0HA 1E9DA 2JHFA 2B1GA 3L8CA 4ZVVA 2PUDA 1Q1QA 1OY1A 3GCWA 4MYCA 3K2EA 4JOBA 4MQFB 1Q5PA 4PG4A 1YB2A 1MJGA 3IPXA 1R6TA 4FE3A 1U0BB 2YOHA 4Q47A 5DYNA 1QB8A 3PJEA 3U0VA 4CEHB 4PSDA 2BF7A 1IWPB 2J9ZB 2YRFA 1BCSB 2NTJA 3E7DA 3RU2A 4C0AC 2XR1A 4HWTA 1QGYA 4DCCA 1YU9A 3CMMA 3K92A 4YJHA 1Q95A 4EGAA 1GHTA 1CR0A 1U0JA 4JUBA 1TF5A 4CCWA 3I2IA 3DEIA 2NT3A 2BD0A 1WMFA 1PQWA 3QJGA 5CLGA 1XKTA 1EE2A 5KYXB 1KK1A 2P3QA 3CB2A 4TKZA 3CH5A 3I5AA 3MS2A 4ZDKA 1NR5A 3H6HA 2FW6A 4KIFA 2NSHA 3LLVA 1SQFA 1YNSA 3G1UA 4B4DA 4RTLA 3HBLA 4PPYA 2FWIA 5DI3B 8GPBA 5J2TB 2YHIB 4LSZA 1XYGA 2XNDA 3IV6A 4UVEA 2O54A 4IYRA 4Y1EA 3D5QA 3HBMA 3HR4A 1VE1A 1HDGO 3T94A 3UJ7A 3G88A 3HJRA 1PJLA 3WY9A 3LPNA 1WJGA 3WJAA 2FSIA 3GLHB 2OV3A 1DDIA 1IB6A 3DLIA 2JJ8A 3O1HB 4L8VA 4MYSA 2C83A 3DDCA 4ZVUA 3VPAA 5CA1F 4M2LA 1MPXA 3M3HA 3TBKA 5B6IA 5JCZA 4B3MB 5TVGA 3COVA 3WWDA 3AU8A 3DL7A 2REOA 2GHIA 2HCRA 5JD3A 1VMKA 2P35A 3D64A 4EB6A 4G07A 5K3OA 3K5HA 1XTVA 4H0FA 1O6BA 1J90A 1TAUA 2VQDA 2A35A 2XMCA 2P2ZA 1IL0A 3SJCA 3UF0A 4EJFA 5IZCC 3D2CA 2I80A 3DMHA 3L4JA 2JFZA 2PZFA 5KNDH 4DMFA 2RGGA 4OP3A 1OH6A 5HUHA 3NC4A 1TD1A 3MA0A 3ONEA 3ZKAA 1ISMA 3SXUB 4HRAA 4RS4A 1WAMA 3D7RA 4UDOA 3LUKA 1UBMS 2G0TA 4MGIR 4JC8A 4Y3UA 5AI5A 5JROA 3TOZA 4HXGA 2ADFA 2JAOA 3NTVA 1B1AA 2X9NA 3NXSA 3PFGA 3J7AC 3KR2A 4DC0A 5TGTA 3WGUA 2VQEB 1DXYA 1C0IA 3HABA 3PICA 3QELB 3T3GA 1HYBA 4ZEOA 4TYYA 2EP7A 2WYOA 5JALA 3QUSA 3UO8B 2H63A 4U02A 3P9NA 5CT9A 1CUAA 1NMSA 4HAXA 3C6XA 1EWVA 1FJHA 2NUAB 4EHHA 1ZAYA 5I7WA 4EA6A 1T36A 3AV3A 3UV7A 1A77A 2ZAMA 2CJYA 4N65A 1GCUA 1XWIA 3W4IA 5EMNA 4I9FA 4Y8VA 4H7KA 5DGDA 4A6XA 3JQ6A 3LKZA 3ASZA 4I08A 5AXAA 4ZXFA 2OLJA 4OP2A 3L18A 2ZJZA 3ESAA 2DQKA 1PHPA 1G9TA 3HCFA 3E18A 2GDZA 1ZM2A 3GUYA 1E4OA 1Z17A 5NULA 2XXJA 1DEHA 1LUAA 5EE1A 5AVZA 4L5YA 3HZRA 3TLBA 2JIMA 4L08A 4N18A 4OI2A 4ZHQA 5LYJF 1L4NA 4P3KA 2F3PA 3OOJA 3L7IA 4IO0A 4HEQA 1CUBA 1FUEA 3BE4A 1RLMA 2XCIA 1WWKA 3GRYA 4ZOCA 3C85A 4YAGA 4MEAA 1VHWA 1ZYUA 3D43A 4S1VA 4YCSA 2XXAB 3KOWA 1T2FA 4BVKA 3R7LA 3T7EA 5ED4A 2H6EA 2JAHA 3D6VA 2P75A 3TSOA 1QZXA 2BFAA 3IBYA 1SVNA 4ZQBA 1LSUA 1VIDA 2P11A 5JLAA 1KS2A 2IS4A 4NG4A 2JDID 5IVPA 5JCOA 4Z3DA 5B1YA 3UV6A 1ZICA 1VE3A 3RC3A 1RHKA 2QPAA 2UUPA 3LO8A 1WVMA 5KSPA 3ZI0A 4Q7KA 2NTEA 2Q3MA 3ES9A 5EC8A 2NVBA 1D4ZA 1QU3A 3T3IA 1HE1C 4NATA 5A3SA 4NJOA 4C7BA 4MTLA 1GPWB 3M6IA 4M60A 2FPPB 2JLUA 5FI1B 1QK5A 4HVLA 3L6OO 4JBGA 3TFOA 1II8B 4I4LA 2OENG 3CF6R 3FCCA 4PGFA 3IPRA 1E1RD 5CDGA 4QBIA 1D8AA 1OR8A 2OA0A 3FHCB 4DLTA 3A4TA 4LI0A 4KLCA 4LK3A 2HB6A 1E5DA 1PLLA 5DVZA 3IQWA 3OP1A 2WIFA 4HTAA 2N42A 5AJHA 1GPAA 5LLTA 3UCFA 5C7OO 3FJYA 2MTBA 2R00C 3KOUA 3QE3A 1ZJ5A 4YGYA 1X9IA 1Q77A 4KR7A 4DR6B 3P0HA 3W04A 3AZOA 3F7TA 1PE0A 2F64A 2Q2VA 2ZVPX 4TKMA 5FIUA 3KNZA 3SKVA 3ZD8A 5H8WA 1KBQA 3UCEA 4RHEA 3TX2A 4F2HA 1EYZA 1ETHA 1RYHA 4D8YA 2BSXA 3QVJA 4DDWA 3UMGA 3VJLA 4KRYA 1D2NA 5ALVA 4DMHA 3PFWO 2VHCA 2YJ5A 4N39A 1U90A 4PHFA 4XIFA 3PTZA 3HXQA 1HPLA 1XP5A 1GKKA 1T1EA 2QN6A 4Q1CA 2H1HA 2C9DA 4ITRC 2FCAA 3VXKA 1PI3A 2FEKA 2YXBA 2X2FA 3ZDRA 4LWPA 3SOPA 4OI0A 1KRXA 1PEAA 1IN8A 2QP9X 3FI0A 3GJTA 5ADWA 2O2XA 2OK7A 3QKSB 4GM1A 1JHDA 5FOUA 1QRUA 1NIJA 1GTZA 5DHTA 5FBLB 1ULHA 1SELA 3NETA 3CR8A 2QMEA 4MUAA 2DVMA 5AUPB 2J7PA 5DK6A 1M2GA 5KTPA 1E58A 4ROTA 3ELDA 4IIJA 3SC2A 1YJXA 2CHQA 2PO5A 3GJ8A 4B8ZA 4QBHA 4ZCIA 2D5BA 3RRMA 5K3FA 5CIQA 2X8AA 1EP1B 4HSGA 4ZT5A 3IIEA 3DV2A 1W4LA 4G4SP 2R79A 4RA9A 4WY8A 4GXRA 2RHCA 2DJIA 2G70A 3V9PA 1G21E 1A9XA 1WW8A 3O0DA 4BPRA 3WMRA 4A8JB 5EHZA 3LG2A 4J1TA 2HUPA 3FN4A 3OT5A 3REGA 4TXLA 3CM0A 3HSYA 4BYMA 2HM7A 1BNCA 1SXJE 4B7ZA 1KEVA 5KSWB 1LK0A 4MW9A 2FF7A 1XL0A 2YCLA 2BF4A 2CV1A 5K0BA 4OU4A 4TROA 4AT1A 1DQRA 4PLWA 4W5RA 1KZ9A 4KXYA 3EULA 3CR3C 2PE5A 2GH1A 5HCIA 2ZUEA 1ML3A 4G36A 1BW9B 1V11A 4LYYA 5CVTA 1RIFA 2GCGA 3AM5A 3AUSA 5AP9A 3FMVA 3H1AA 3UFXA 2QM8A 2O05A 1B16A 5AI9A 2PEYA 3KPWA 1JXMA 3OOWA 4O2LA 2J6CA 2BW0A 1IY2A 2NG1A 1TT5A 3UG7A 5AYVA 3D8TA 3PIRA 1GGHA 1WOYA 2X5XA 3MWEA 3OT1B 3RFXA 5KWJA 2F3TA 3JR7A 1I9GA 4C29A 5BV7A 1UXJA 5KTYA 2HK8A 3OO0A 5HCNA 4LY9A 2BGWA 3KOXA 2ZROA 3MUNA 2WIJA 4R4JA 4E03A 2P1ZA 4EO4A 5KQPA 2JATA 1W94A 3HQ4O 3NH6A 4MHOA 4Q7JB 4YAWA 5JSZA 1SVUA 3TD6A 3ZEAA 1C7JA 4EA7A 4MXDA 1JWLA 3LOPA 3IKLA 1TYAE 5E9QA 3CZPA 3LNTA 5A9SA 1OJLA 1ZGGA 3O3OB 3GGGA 5B4TA 4I7EA 3PNLA 2AD5A 2OG1A 4MPJA 3EC2A 4M9ZA 4IHJB 2VRWA 2DZDA 2DY1A 4N3GA 1X15A 2DB3A 2DE0X 3GA7A 1Q3TA 2CXUA 4WNCA 3TLGA 3GOHA 2A9VA 3H5LA 1PNRA 2P6RA 3M4ZA 3S2GA 3UKOA 3EGCA 4J3NA 5JHHB 2H1VA 3KB1A 2ATEA 4KP7A 4LY0A 5EZ5A 4B3FX 4DV4B 1HDXA 3R3SA 3CYFA 1N78A 4G1MB 1JR4A 4W5QA 1E3QA 2ABWA 4KQ9A 4ABTA 5A3RA 1HT3A 3BORA 2NMVA 1VGVA 2I1WA 2EEZA 3TIIA 1H6AA 3DVSX 4YHBA 4Q16A 3C6ZA 4O4IA 3I53A 1NF3A 1H3EA 5F5XA 5GOTA 1GL3A 4F85A 5LB2A 3T7DA 1GXSB 2PQMA 1E3LA 1S2OA 3T5GA 3D4IA 3QVVA 2TS1A 1XTJA 1VCHA 3R5TA 5IN5A 3MT7A 2ZZNA 4NPHA 2YRWA 1M1YA 4PY2A 5CU7A 4WUVA 1KZHA 3KZXA 4BO6A 3ZDZB 2IE0A 3NT4A 3TQRA 1RAHA 3EK2A 3ZIUA 4BNLA 5BUSA 3E9MA 1C3EA 2DQSA 3IJ5A 1XLTC 4OD0A 3UK0A 1BSVA 1M6HA 1KJ8A 3NBAA 1IBMB 1DQSA 4ZVNA 1XYVA 3FMPB 1U7XA 3HTXA 5GONF 2NZXA 2DHRA 1YI0A 3FMOB 3LPLA 3VYWA 3IXMA 4IGAA 4YCMA 3S55A 2UVPB 2NQ2C 3A1UA 3GGJA 4EZEA 2ZBUA 2ZWOA 1HT2E 4Q0MA 5IAEA 3VOTA 3VPGA 5LZ9A 3H9JA 3R0IA 3NXKA 3ZE6A 1Y63A 3LX5A 1T2UA 2IYWA 4WBSA 1HLGA 2GA9A 4QAQA 4YN3A 3R75A 5AJZA 1PWXA 2A0UA 2AG0A 3AJAA 4GS5A 4NJEA 3ZGVA 2ZRFA 3GFRA 2NZUG 4AY4A 4D8TA 1RQGA 1X1RA 4UUOA 4XPIA 3ZQJA 4DQUA 3L82B 4OFWA 4ZPJA 2GEJA 4HWOA 4F12A 2JGMA 2JFBA 1V71A 3E35A 3N7TA 2BH9A 3V8QA 4D9CA 5CEEA 1UT5A 4OK5A 3TR5A 4D1YA 3TTVA 4OB6A 1TX4B 1NNEA 4I1IA 1AZWA 4A82A 4OH1A 1A2BA 1OTHA 4GPEA 1N2EA 3WGLA 4X65B 3I32A 2FHPA 3AB8A 5DM60 4XI9A 4B4VA 2MJLA 3Q5GA 2O5EA 2QD3A 1IJKA 2NXCA 4WN9B 1OWLA 5LWHA 4KHPB 3GXOA 2IELA 4LHWA 3JWPA 4Y0AA 3GY0A 3PPWA 5AOBA 5CXSA 4ZV9A 2LKDA 4TKVA 4HNRA 3QQ5A 4LOHA 1KU0A 5TMDA 3L1HA 2WSIA 1A7UA 3ILXA 2YXLA 3Q4GA 3KJHA 3FDFA 1XMVA 3MWGA 4M1SA 2GZAA 1E1DA 1G8JA 2YOGA 3FWYA 4UD2A 3ZXSA 5LNK6 4RK5A 2GPBA 5KSZA 1C9DB 3AETA 2IYYA 3M70A 3L77A 2YNMA 2I2FA 2RI6A 2GEBA 3G9XA 3QBTA 1YUNA 1FLDA 3A70A 3NHKA 5CT4A 3RSFA 2XVZA 3NR2A 1RAAA 3HCNA 1UQUA 4L57A 4UUBA 4DIDA 5JAIA 2BMEA 1OC2A 1QYCA 1SOMA 2HX1A 3ETDA 2R68A 2YW2A 3FMFA 4YO7A 4N3BA 4BQIA 1CRPA 4FK8A 3RREA 4C4TA 2J87A 1DTWA 2QDXA 4BWYA 1EDEA 1NJSA 2C1EA 3TPFA 3BQMB 4MCJA 5LQSA 1FDTA 3KPVA 1K8YB 2YOFA 1BHJA 3SYKA 4RM3A 4B7AA