2VCYA

Crystal structure of 2-enoyl thioester reductase of human fas ii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
332
structure length
332
Chain Sequence
RVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANS-2-ENOYL-COA REDUCTASE
publication title Structural Enzymological Studies of 2-Enoyl Thioester Reductase of the Human Mitochondrial Fas II Pathway: New Insights Into its Substrate Recognition Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.3.1.104: Enoyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vcyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vcyA01
3ZWCA 1L1FA 5DOVA 1BGVA 2EKPA 1MLDA 4YPOA 3AUAA 3CMMA 5IXYA 1ZK2A 1UR5A 5T8KA 1FF9A 1BW9B 1SOWA 1XDWA 1QYDA 3QY9A 3ROPA 2GNAA 3IAHA 2FSVA 4E5PA 1W0CA 1QR6A 1ISFA 3DQPA 4NBRA 4OQYA 1A4UA 2BD0A 3DOJA 3LC7O 2AG8A 3E9NA 1HE3A 3QA9A 3FNGA 3QRWA 1XKQA 4ND1A 4KTVE 1FDTA 2E4AA 4CLDA 2ZTVA 3WMWA 5F3RA 4BOYA 5TT0A 1HE5A 4ID9A 2GF2A 1LX6A 4M49A 4N54A 5GMOA 3WX0A 3H2SA 5K9ZA 5JMPA 1P77A 2SCUA 3AUSA 2EWMA 3OSUA 5ENDA 4E30A 2Q1TA 4QSMA 3U4IA 4Z9YA 3S2EA 1T2FA 3PQFA 5KJCA 1U4OA 4J2OA 3GHYA 1U2DA 1KEPA 4N5NA 3DBLB 5TS3A 4DMMA 4XWYA 3IQDB 4Y6PA 1LBEA 1Y8QB 1RM4A 4O0LA 1U9JA 4ZU3A 5IZ4A 2IYPA 3GDOA 4DVJA 3CZRA 2HKIA 1WDMA 4A7PA 1C1DB 4FQ8A 4JBIA 5JAMA 4Q9NA 4I5DA 3JQ8B 2YZ7A 2PKQP 2ZTLA 1OFGA 4J49A 1NPTO 3G1UA 2I76A 4YACA 3W8FA 4I8XA 1OC2A 1AGNA 3ZU3A 2W90A 1MC5A 2P68A 2WMDA 2FP4A 3H3JA 1E6UA 2DKNA 4GKBA 4FJ1A 3VZSA 4BIIA 1AUPA 3D7LA 3TF5A 4CMKA 3H3FA 1CWUA 4K1LA 4DRYA 1T26A 2C07A 3V8BA 4JBHA 1YBMA 1P1HA 3C8MA 4BNVA 3A1NA 1ZBQA 5HWSA 3VDQA 3RC1A 3GEMA 3VAZA 1YB4A 1UAGA 3AI3A 3RFVA 2HK8A 3I9MA 4CLOA 4JCOA 4IJUA 3K5PA 4E6PA 1YDEA 3WS7A 2Q99A 5IDXA 3GVCA 2VZ0A 1UH5A 1JKFA 2CY0A 3VPXA 3EC7A 3ZI0A 4CV0A 4GI2A 2H63A 2R00C 1Y5RA 1HE2A 2FWMX 3GK3A 5JE8A 4OJNA 5CEJA 3TZ6A 5G0WA 5C5IA 5CDTA 4ND3A 2P5YA 1R4MA 1YDWA 1GDHA 1MG0A 4R16A 3LC2O 1J4AA 3HADA 2YHIA 3GNTA 3MWDB 5DBGA 2P2SA 5F21A 4RCVA 3ZU5A 1BMDA 2H9IA 3P2YA 4MVJA 4YJDA 4B7XA 4C7KA 5KJEA 1Z73A 4DBVO 1LQUA 2R6JA 3RUIA 3RUCA 3ST7A 1NAHA 2E82A 2PGJA 1E7SA 5L51A 4NPCA 3NTQA 2ET6A 4A73A 5BSFA 3I9LA 4WCFB 3A4VA 1A7KA 2W8ZA 4WNIA 1XYGA 2D1YA 4L4XA 1JA9A 2JD2A 3CINA 5TNXA 1BTOA 1ZK0A 3JQ7A 2I65A 1ENPA 4H7PA 4D7AA 1IOLA 2Z5LA 3AUTA 3GNSA 2ZTUA 3S8MA 1EFKA 5JS6A 1KEUA 1PS8A 2IEBA 3A28A 3RJ9A 1PGQA 1ZK1A 1MA0A 2YY7A 5FI3A 1ZEJA 4TRNA 4WGGA 1IYZA 1PWXA 3IIEA 3U49A 4TRJA 1DB3A 3GEGA 3ZV4A 2ZTMA 3M1AA 4MP6A 1M6HA 1H6BA 3PFFA 4HX5A 2B5WA 1R16A 4RORA 5H81A 4E21A 4PG6A 3H7AA 3WNQA 3UGKA 1YQGA 1GPDG 2VWQA 1K2WA 3C85A 3NYWA 3PGJA 4DIFA 3ABIA 1XSEA 4A03A 1CEQA 3UCXA 1XA0A 2I9PA 3OECA 4GGPA 1QLJA 1T2DA 2IZZA 4OYRA 4IJKA 3RUHA 2BI8A 5A9SA 1PS9A 3HZZA 1PJ4A 2VRCA 2IE0A 2H1SA 3GAFA 4U7WA 4J16A 2B4RO 4CLRB 1LRKA 3QVTA 2FY8A 3UCEA 4GX2A 1V3VA 1D4FA 4IQ8A 5B37A 1JU9A 1RYEA 4FFLA 2PD3A 3EVTA 5ENVA 5G0SA 4KQXA 4UEKA 3TSCA 4OSPA 3I3OA 4GVLA 1VJ0A 4TMFA 1MV8A 2WTBA 3KSZO 3RI3A 4YWJA 2QZZA 1E1NA 1SBYA 2Y1FA 3NT5A 3DBHB 4BMNA 3BMQA 3BMOB 4WEQA 3WFJA 4BV8A 3ADOA 1I10A 4YAIA 1HE4A 2EP5A 4ZJUA 4HXYA 9LDTA 4OIMA 2GD1O 3O8QB 1M76A 4YT2A 5KVCA 2PKQO 4R1TA 3ZNQA 3KHUA 3UH1A 5JC8A 2CUKA 2X1HA 3DXFA 1E6WA 4JP3A 2NVWA 5CDYA 4U0KA 1KBZA 2V6MA 4CM4B 3LYLA 2BGLA 5G0VA 5JYDA 3OQ6A 4INAA 2FPIA 1ADFA 3DBVO 4HUJA 4Y8VA 2JFFA 2RBEA 2OUIA 4DQXA 3FF4A 4J7XA 3BAZA 1I30A 4FPXA 5CG1A 2FOIA 2J3HA 3RUDA 1HLDA 2GPTA 3WTCA 4GMGA 1Z45A 4Q3CA 4CM9D 1ADCA 4WK6A 1P0CA 2W2LD 2V6GA 3GZNB 2Q2VA 1HDZA 1YQXA 4DGSA 2C0CA 1TT5B 3D4NA 3LU1A 3AY3A 3UVEA 1SMKA 2WYWA 3ETDA 1E3IA 4MINA 3EZYA 3H5AA 4CQMA 1PGPA 1QKIA 4II2A 4EW6A 3Q11A 5JYEA 1B8VA 4IQGA 3B20A 3PZBA 3GGGA 5CEFA 1F8FA 4RPHA 4MJLA 1VKOA 5JY6A 4R01A 5KJ1A 3DHYA 2GN9A 4YT8A 5J23A 1G0OA 3BMNA 4BO1A 3UF0A 3IC5A 4IJVA 1ONOA 2IZ0A 4AICA 4DA9A 1CIVA 2AW5A 3WOHA 1PS0A 5ER6A 4YQYA 1GTMA 3MEQA 3GUYA 4RJTA 3GEDA 4MVJI 2VHZA 4R41A 5JPIA 3C3XA 3Q0EA 1GYRA 1DRUA 2JAPA 1GUYA 1GZ6A 5C7OO 1YQDA 2VQ3A 3RU7A 2AA3A 4BO5A 1DAPA 1JW9B 1YRLA 3DMTA 3NUGA 4MO2A 1LLDA 3HDHA 3VPGA 4B3HA 5CPBA 1O89A 2O50A 4IM7A 5THKA 3ON5A 4BGEA 5G2OA 4IBOA 3H65A 1TB4A 1N1GA 3OA0A 4WUVA 2Y0DA 1ZVMA 4WCDA 2GDZA 1N9GA 2WJPA 4ONEA 1DRVA 5TX7A 4BO6A 5TLSA 2IYOA 2PY6A 2EW8A 1Y8RB 2I67A 4PZCA 3H9GA 4ND2A 1HTBA 2X4GA 1ZJYA 2VWPA 3IDSA 4DPKA 4QFCA 4X54A 4WLFA 4XKJA 3NGLA 4QUKA 1AXGA 2HRZA 3PJEA 2ZYAA 2G1UA 4KUEA 1QP8A 4EYEA 3K6JA 4HFMA 4XX0A 5JW6A 3GRPA 1Z75A 4C4OA 2OBYA 4J1NA 3D0OA 1Y9AA 3F5QA 1QMGA 4NH4A 3F47A 4B4WA 1G1AA 1JVSA 1L7EA 2PV7A 2GN6A 5DF1A 5JMWA 1LSOA 3FTNA 1Q7BA 2GZ1A 4BMVA 1P44A 2F00A 5ILOA 3H8VA 4NK4A 3GN1A 4MVJE 2Q50A 5KJ6A 1U28A 3PDJA 2BFOA 2D59A 4NBVA 1YH3A 3GG9A 4RL6A 3GR6A 2JAHA 3DZJA 5EN4A 1YVEI 1DFHA 2NSDA 2QX7A 3QWHA 5EINA 1M67A 4TVBA 4QEDA 2B4TO 3I23A 4I08A 4K6FA 4XQCA 2JCVA 3EY4A 5DCUA 2HJRA 1F12A 3INRA 5L7WA 1HRDA 2G17A 1XR3A 1OC4A 4HY3A 2XPCA 2Q2WA 3I52A 3L77A 3OIDA 1BRMA 3D3WB 3O9ZA 4TVOA 1Y9EA 4YEDA 4ROSA 1NWHA 1U7TA 1UXKA 3H6KA 1ZKMA 1UP6A 2HRBA 2QZ9A 2CVOA 2A35A 3KB6A 2GN4A 2CDCA 2PKRA 4WOJA 5JAIA 3JQGA 4IGFA 3WGHA 4XGKA 4KDFA 3P19A 1EBUA 2Q4EA 3HDYA 1CDOA 4CMHA 1DIAA 4FCCA 2NU6A 2F1KA 2NTVA 3IOYA 1LLUA 3JQEA 2FN7A 4O1MA 4Z0TA 4NU6A 4E5MA 4DYDA 2VUUA 3UHAA 4IY1A 4XYGA 1CJCA 1DO8A 3PHJA 1XG5A 1XELA 3JQ6A 4EJ6A 2PD6A 3TL2A 4XYLA 4XA8A 3L6OO 3BTUA 1HF3A 2FR1A 2DPHA 1JQBA 1F8GA 1SEPA 1VL6A 2PD4A 3ZNPA 3C1OA 5B4TA 1XWFA 2VOEA 2Y1DA 4W6ZA 5DCYA 1HWYA 4ZQGA 3RC9A 3UUWA 4PLZA 4EITA 2I66A 3ASVA 4CLXA 1WZEA 3ZU2A 3LF2A 1PZHA 2NADA 5L4SA 4OMUA 1U8XX 3VPHA 1E7WA 3HE3A 2V6FA 4Z9XA 1BXGB 3WGOA 5ICMA 4JIGA 5I8ZA 4CMIB 3MTJA 1B15A 2VYVA 3PYXA 4NDNE 4QFDA 3UKOA 3ZU4A 1ADBA 1HETA 3RFXA 1OBFO 1ULSA 2ZQZA 3KSUA 1EMDA 3ICPA 4BB6A 3OIGA 1N92A 2PGDA 2QW8A 1ZJZA 4N5LA 5L7YA 1N8KA 2D8AA 2R00A 5G4KB 1HYEA 3ETEA 3W8DA 3VPFA 4DXHA 1RPNA 3F9IA 4IIVA 1ZUD1 1ZO8A 2OMEA 4HBGA 4NFYA 4XQGA 3WLEA 1NFRA 1R0SA 3GT0A 3INTA 4BNHA 1GQ2A 2BI7A 1Q0LA 2DFDA 1VSUA 3MJCA 2O3RA 1NM5A 4RGBA 5JCJA 4UEJA 3GN2A 1E0DA 3E1KA 2QQ5A 3GGOA 5IFLA 5CDSA 1DC4A 5IDQA 4LSWA 5H82A 3DWFA 3QWAA 1O0SA 2CNBA 3DONA 5FYDA 1LDGA 3UXYA 3OJ0A 1YXMA 1A7AA 1Q7CA 1S7CA 1GQYA 1ADGA 4O5OA 3U4DA 5EQFA 2YW9A 3DBRA 3TN7A 1H6CA 2HMVA 3QJ5A 1VRWA 2PZKA 2IZ1A 4H16A 4YQZA 1VJ1A 3C7CB 2B69A 4Q3AA 4GQAA 4J1TA 4CR7A 3UW3A 1WNTA 1P45A 4FW8A 4UVHA 3OIFA 1Q1NA 1LUAA 3AK4A 2DTXA 5ITWA 1EE9A 3HN2A 4CL8A 1PJ2A 2VTDA 4YAJA 4R68A 4I9NA 3IP1A 2DBZA 1KVRA 1FDSA 2JD0A 1MUUA 2NWQA 4J7CA 4OKIA 1GR0A 3WYEA 3V1UA 3WGQA 3JQAA 3E48A 1XLTA 1DFIA 4A2CA 1ONNA 3R3SA 4L74A 5TIIA 5I7EA 1SAYA 2W2KB 3F5SA 4A5OA 4FFOA 3TDKA 1IZ9A 2NVUB 4KQWA 1ISMA 1N1EA 5HRUA 3SVTA 1EK5A 4GLOA 3PI7A 3VVCA 4AJKA 4ZHSA 3RKRA 2J8ZA 4GX0A 4NI5A 4XJTA 1CF2O 1YO6A 2O3SA 4JJFA 1HL3A 3E5MA 3S1LA 1PZEA 5B4VA 5KWEA 2D2IA 4YJHB 3VPSA 1JKIA 2I6TA 2P9GA 4BGUA 5KTKA 2EEZA 1U3UA 4DUPA 4BNXA 3NJ4A 2XXJA 1LNQA 3O26A 3KVOA 1JVBA 4CMCA 5A3VA 2V6BA 2ZCVA 1NFQA 4MDHA 3ZHYA 3EMKA 3DMTC 4S3MA 3MTGA 4IPTA 3QWIA 1XIVA 3EYWA 1GPJA 2A9FA 4JP2A 4E12A 5HTOA 1DBVO 3NRCA 3B1KA 1A9ZA 3D4PA 3H5RA 1UXIA 2EF1A 1DSSG 4BO9A 5DOZA 2G5CA 1DAOA 1DC6A 3VTZA 4D3DA 2VYND 1H5QA 1B8PA 1Q7GA 4AL4A 2Y1GA 5FFFA 1HDRA 2C2XA 4W99A 1HDYA 5DNAA 3M6IA 2ZB8A 2RHRA 3DB2A 4NFHA 3GGPA 3RWBA 3LQFA 3CH6A 3STHA 4HNHA 4ZQFA 1V6AA 3VZRA 7ADHA 4U0JA 4UAGA 1ARZA 2CFCA 1QSGA 4UVEA 5TT1A 2AQ8A 5FF9A 1Z7BA 1E7YA 1LLQA 4J3FA 4D3SA 2VUSA 4LSMA 2UUOA 3GNQA 4BO3A 2Y05A 4YRDA 5TRTA 5CP8A 3AJRA 2GRAA 4W9NC 2Y68A 3NTOA 3I83A 1NVTA 3PZRA 4JK3A 3SLKA 5U4QA 3RAJA 2Z95A 5A9RA 3ZH2A 2YDYA 1WZIA 3AI2A 1R6DA 4KDEA 3WSVA 4PLGA 3WTBA 1J5PA 2IXAA 3F46A 4J2HA 4AJHA 4TROA 3DHEA 1DLJA 4CV1A 1U5AA 3ZW9A 4BNKA 4AVYA 1QRRA 1NAIA 4KZPA 5L4LA 1Z74A 2PLAA 3GF4A 3N74A 1XQ6A 2DBVO 4Q3NA 2DBQA 4RPJA 2RH4A 1FDUA 1X0VA 4CQLB 3WGYA 2A94A 1BXZA 4A10A 3LSYA 1PQWA 2OORA 2RAFA 4TRRA 5ICSA 1R37A 4OH1A 4BNMA 1XEAA 4WLEA 2UDPA 1BW9A 1YE3A 4D41A 2X22A 5HBRA 1EVYA 2G82A 3GVIA 5I9LA 1EDOA 1FDWA 2CDAA 2OGUA 1NFFA 1KY4A 4EEZA 2HMWA 4W4TA 4DIOA 4TRMA 5CHEA 2C20A 5JAZA 3ANMA 3QHAA 5LC1A 2HLPA 2NTNA 1PR3A 2BGMA 1T4BA 1LLCA 2AQIA 2O4CA 1LRLA 2GLXA 2ZK7A 3JYNA 4J6FA 4ZICA 2WYVA 4E5NA 1G0NA 2H6EA 4MKZA 1CRWG 3P5SA 4YCAA 3GFBA 4XR9A 2EG9A 4N5MA 2GGSA 4WECA 1EK6A 4YVFA 4M89A 1GAEO 3DOCA 1KETA 4BB5A 1Z82A 3L9WA 2P9CA 3SJUA 1TEHA 1QYVA 1U5CA 3IMFA 3DBLA 3JYQA 4I9UA 4DTIA 2UAGA 3DL2A 4OM8A 1VKNA 3KM0A 5EERA 1Y8QA 1PSDA 3U5TA 1UDAA 1KVQA 3QSGA 3HSKA 3NKLA 3VVBA 3LT1A 2Z1NA 4KUGA 4ND5A 3KV3O 5I9NA 3RASA 4P8RA 3JD1A 5IN4A 2JHFA 1UZMA 4EDFA 1C1DA 2AHRA 3HB5X 3IJPA 4W7HA 1E92A 4QQRA 1NQAO 4YT4A 2O4UX 3F1LA 4WKGA 1TI7A 1PZFA 3JQ8A 3SEFA 4F46A 4PN3A 4RPGA 1X7DA 3GMDA 4BKPA 2V65A 4DQUA 3RJ5A 3MJ4A 5BT9A 2CDBA 2AEMA 1EUZA 3KBOA 3DAPA 3TZHA 3QVSA 3VKVA 2CF6A 3I9KA 3U0BA 4CM8A 4YAGA 3AWDA 1ZMTA 3ENNA 4IIUA 8LDHA 4EBFA 1LC0A 1X0XA 2AEFA 2GR9A 4LCEA 3CUKA 4H15A 3FWZA 1A4IA 5AOVA 3H9QA 4UEOA 4QECA 4BNWA 2EKLA 3L9XA 4LVCA 3K9QO 1SNYA 1H93A 4QTZA 3OH8A 4EJ0A 2I3GA 3UOGA 4PG8A 3RC2A 1DPGA 3OP4A 4NK5A 2HMTA 2VN8A 4DIBA 3PYMA 1SOVA 2EJVA 1NASA 5HS4A 1I01A 3R1IA 4BV9A 3DTTA 2IDZA 4BNZA 4XCVA 3OEWA 1HZZA 3KO8A 2J6IA 3PDUA 1E1KA 2HMSA 3O38A 3LT4A 4OXNA 1DEHA 2X58A 5JAQA 1VL0A 2Y1OA 3ZWVA 3VHRA 3W4IA 3FR7A 5A04A 2NNLD 1EFLA 4A27A 1DDOA 4Z3KA 2Z1MA 3RBZA 5BR7A 2OXIA 2BHLA 2I3AA 1ISHA 3F4LA 4RQUA 2VRBA 3ONFA 4GLLA 5IJZA 3JV7A 1P1KA 4HADA 4YJGB 4C7JA 5A5EA 1C14A 5G0TA 2NU9A 4RF4A 5KJFA 4LMRA 4DBZA 1J0XO 5KOIA 3E82A 3NGXA 3L0DA 3DZBA 3LT2A 3ZHBA 1I2ZA 3MZ0A 4UVGA 1HYHA 1Y1PA 3FNEA 1PTJA 1EE2A 5AYVA 3VZQA 4IGEA 4N18A 5COAA 1T2AA 3KOUA 3WLFA 5JDCA 4E5YA 4E13A 5ER9A 1LI4A 4PG4A 2JL1A 5I9MA 2ILTA 1PL7A 3OF2A 4OXKA 1ZXBA 4JX8A 3IUSA 1O94A 2FZWA 3TJRA 3CPSA 2UUPA 3C1TA 4Q39A 2D5AA 4EUFA 1NQ5A 2VZ8A 2PGLA 3FPLA 1HDCA 3A9WA 4HNGA 1J49A 1HXHA 4PLYA 1P9LA 3WXBA 5TC4A 3DOOA 4XGNA 5JC1A 3B1FA 4JXKA 1RJWA 1V35A 3WGGA 2QRJA 4MIEA 3UAGA 3UCFA 1YJQA 4IXWA 2YV1A 3WBFA 2DFVA 5B12A 5C3MA 1LEHA 1FJHA 2CVQA 3HWRA 2A4KA 5T67A 3TZCA 5COBA 3L6EA 4HFNA 1ZFNA 3HB4X 3F1KA 3QVXA 3PJDA 2ZB4A 4TZKA 5CFZA 1GQQA 1Z7EA 2Q2QA 1X7HA 3QQPA 4NNJA 4Y67A 4XQEA 2IRWA 1MXHA 2AMFA 1CERA 3DAGA 3NV9A 1BSVA 3W4JA 1NPYA 3D5QA 5A06A 4D3FA 3EAGA 3MJEA 4B4VA 3H4VA 4F45A 3FN4A 4DQVA 5CEEA 1SCUA 4CUJA 3PWKA 3I9JA 3KYCB 4NR0A 3LVFO 1RYDA 4YJFB 3OICA 5CPFA 4DYVA 5JNLA 2C2YA 3I1JA 3K92A 2D5CA 3NT4A 3ZWNA 3ORFA 4WOKA 4CLRA 2EGGA 5LDHA 2Y0EA 4OO3A 2VTEA 1WDLA 3BMNB 1MXFA 3MJTA 4GVXA 3E03A 5TSDA 3WNVA 4D79A 7MDHA 2EIHA 1O9BA 3H9JA 1H9BA 2ZIZA 4D0RA 3BHIA 1YGYA 3JYPA 4KWIA 1M75A 2NU8A 1LDBA 4FOOA 3GFGA 3PEFA 3PJGA 3DBHA 2H5LA 4PFJA 4WE3A 3BMOA 3NJ8A 3WBBA 1E3WB 4IDGA 3O8QA 5I8WA 4QX6A 1D3AA 4A26A 3JQDA 1VSVA 3BMCB 3ZWYA 3ZW8A 1GADO 4BNYA 5BNTA 5KIAA 3GAZA 2CVZA 4L73A 1MFZA 3AOGA 3LLVA 3O03A 4U6QA 1WLYA 5A3JA 3ZWMA 2YQ4A 4BQRA 4BVAA 4TWRA 2AG5A 4R1SA 3WQRA 3V5NA 3CMCO 4GSKA 5AQ1A 9LDBA 2TMDA 1EUCA 1QG6A 4FJ2A 4RVSA 2X8LA 1H2BA 2NM0A 4L4RA 1D8AA 2CZCA 4OQZA 3D4OA 3LC1O 3RC7A 1V8BA 3IKVA 1RKXA 1TT5A 4PLTA 3NDIA 1I3LA 1BDBA 1DIRA 1GEEA 2Y99A 4RVUA 1B26A 4Y9DA 4EUEA 5GZ1A 3QP9A 2I5PO 4QT0A 4XR4A 1ENYA 2WD8A 3A14A 4AJLA 4UUPA 3GMSA 4BO2A 4HFRA 4ALKA 4CMJA 1B3RA 2YHUA 1R66A 1MX3A 2E49A 3U9LA 5TGDA 4FB5A 4GX5A 1H94A 3TZQA 1P1FA 1HDGO 1BHSA 1V3TA 3EDMA 1T1RA 1XGKA 4AJ4A 4DC0A 3VH2A 3PRJA 1P1RA 2IXBA 4NZ9A 3WWZA 1K6XA 3H9UA 1VL8A 2O7SA 1ZH8A 1M6WA 1A71A 3Q1LA 1NQOA 1Q0QA 3KZVA 4RDHA 3GUCA 4IDCA 4PVCA 2Y1EA 4JJIA 1PIWA 1T2EA 3ZWXA 3AM4A 1O8CA 3BTSA 3DDNA 4W9NA 3ZWAA 4OSOA 1OOEA 3GVPA 1XU9A 4BL5A 1NYTA 1A9YA 1QYXA 2PK3A 5K0ZA 1E5LA 2GCGA 2NV6A 3ASUA 2P4QA 4LRSB 2FMUA 2GYYA 2VNSA 3T7EA 1VC2A 1IUKA 4K26A 1EEHA 2HK7A 2JFGA 5TJHA 1OI7A 1SB8A 4JBGA 2I99A 3JQGB 3CZMA 4AJ1A 2NLOA 1FDVA 1Y8RA 2UVDA 2YFHA 3BZUA 1DFGA 1I24A 4ILKA 4DLLA 2B5VA 5TQVA 2FZEA 3NEPX 4ZVVA 4XRRA 4FFRA 5A4DA 1GL3A 5MDHA 3GDFA 4ESOA 1EVJA 3KEQA 4MVJF 1DC5A 2CMDA 1W8DA 2B4QA 4BNGA 5B1YA 3NX4A 3PQDA 2QIOA 1I2BA 5JDIC 1JAYA 3AW9A 1DRWA 4FC6A 3H5NA 4B8WA 1X7GA 1WXDA 1IZ0A 4AJIA 5EESA 3O4RA 4R1UA 5I7FA 3KSDO 2VHXA 1E3LA 3AM5A 1D7OA 4AFNA 1MB4A 2HAEA 4YAEA 3GA0A 2BH9A 1E7MA 4P4NA 3HQ4O 3LZ6A 4OAQA 4RDIA 1TLTA 1HDOA 2PTGA 4OOEA 1WP4A 3QVOA 3RIHA 5JO0A 3DAFA 3C7DB 1BXKA 4GGOA 2BFPA 5JDCC 3UICA 5L95A 1PEDA 3R0IA 1HLPA 4JQCA 4KOAA 1PJ3A 4GPD1 1P1IA 5IN5A 2P5UA 5K1SA 1M2WA 3DZIA 5TJ9A 4XRGA 1ENOA 3NTRA 4WLOA 1WWKA 4BO4A 4MVJD 4WCFC 1K5HA 3GVHA 4XIJA 1YL7A 1OMOA 1C0KA 4A0SA 1QORA 4J43A 3W1VA 4FGWA 4J1SA 3EZLA 3GHHA 1R0KA 3PPIA 4BNJA 1T24A 1F14A 3CKYA 2O2YA 3CIFA 4CR8A 1R4NB 5I7VA 4JLWA 1ID1A 3TZKA 2Q3EA 3M2PA 3FCOA 3G0OA 4R3WA 1MG5A 1ISJA 1YOVB 1JN0A 1NBOA 3WJ7A 2GUGA 1HSZA 1KY5A 4D46A 2HDHA 3DHNA 1H6DA 1AHIA 4KTTE 2CD9A 3FPCA 4LISA 1W73A 2WYUA 4ZD6A 1GEGA 4EZBA 1VLLA 2IEDA 3CE6A 5BSEA 4WASA 1C0PA 3MOGA 4ZRNA 3I9NA 3FNFA 1BDMA 4L9RA 3S2IA 1H9AA 2AQHA 3PK0A 1JDJA 4J4TA 1D1SA 5H83A 5KKCA 2DVMA 1HDXA 2NQ8A 4RZHA 5A03A 3K31A 2BELA 4G81A 1IHYA 1RM0A 3R3JA 4R4JA 5AXDA 3QWFA 1T2CA 2X7HA 4R5MA 1RWBA 3JSAA 3ZGYA 2EERA 2BFAA 2X23A 3HFSA 4CV3A 2WD7B 1BXGA 3FRJA 3QWBA 4J91A 4OOFA 1V3UA 2X9VA 4MVJM 2AXQA 2VNAA 2VOJA 3RCBA 3VC7A 2YYYA 3VDRA 4CMIA 3JQFA 1RM5A 4IS2A 1E5QA 1I33A 1QYWA 4OHUA 3ZZNA 3DZGA 2AEJA 4P38A 2AE2A 1SO8A 2OP1A 3I5MA 4XB1A 3G3EA 4U6SA 4M87A 3TNLA 3S2FA 4FC7A 2GZ2A 3ONDA 5G4KA 5GZ6A 3KYDA 3AFNA 3OEYA 3WSWA 3JQBC 5COQA 3L4BA 1U3TA 2J5RA 3DZFA 4EGFA 3OJLA 3JCZA 1C0IA 1ULUA 3E18A 3FWNA 3V1TC 4NJMB 2VRCD 2JCYA 3E5RA 1I0ZA 2PFGA 1PJQA 2X5OA 4JGBA 4B7CA 3VH3A 1ZSVA 4IXTA 5TF4A 3LT0A 4OL9A 4CMBA 3PQEA 2E37A 4LN1A 3G49A 3IUPA 3RROA 4E2YA 4ND4A 4J0EA 4FFPA 4CMGA 1DIHA 1KIFA 2GN8A 5T6BA 2HUNA 2W4QA 1UDCA 1WPQA 2VHYA 1C1XA 3OMLA 4FDAA 1CQJA 1XQ1A 3JD3A 4RLSA 3GPDG 1ZIDA 2YV2A 3KXDA 4IMRA 1PJLA 3QIVA 3VOSA 3ZWOA 6LDHA 1K3TA 2O2SA 4PZDA 2Q1SA 3ZHZA 1DHTA 3H2ZA 1K6JA 4IDEA 4RQTA 4JROA 1DJNA 1NR1A 4TKMA 3B70A 4W7IA 4BO7A 1O95A 1J6UA 3GY0A 3PXXA 3RD5A 2VCYA 3L4SO 4PRKA 5HM8A 1R15A 3ADPA 2EHDA 1EQ2A 3PTZA 5B4UA 1TA4A 1UXGA 2WEKA 5L40A 1KVSA 4PGFA 4CM9A 4W82A 5JLAA 2RHCA 3WMXA 2W2LA 2JD1A 4FJ0A 4WPGA 3EGOA 3PYLA 3W6UA 4KUHA 4BHTA 3ROKA 1P3DA 1VM6A 4CMEC 1ZW1A 2DPGA 4UREA 1E77A 1LSSA 3OQ1A 1U2GA 1CYDA 1XU7A 1I8TA 1XHLA 3D5TA 2NVUA 3PGXA 1ZCJA 1NPDA 5KKAA 1X15A 3SXPA 2VHWA 3RUFA 4B79A 4J9VA 4E2ZA 1ZK4A 4BNLA 4L8VA 5BNFA 3Q6IA 4TKLA 4HV4A 1N7GA 4CQMD 4YJHA 3DTYA 4GAEA 1QXSA 3BHMA 2NU7A 5L3ZA 5T64A 2JCXA 2G76A 1WW8A 1NHWA 3IS3A 4BKOA 3C24A 5CDUA 1IE3A 4B4OA 2ZQYA 2EW2A 4M8SA 2AE1A 3AU9A 4R1NA 1NHGA 1IULA 1HKUA 3PHLA 4LGVA 4MVJH 1HYGA 1B14A 3S55A 4ZQHA 2FPPA 1DLIA 3WYCA 3R6DA 4YAKA 2NTJA 4GKVA 2C29D 5L9AA 2B36A 4BO0A 3SC6A 5IZCA 4WNCA 2B35A 4IQ0A 3SBOA 1V0JA 3PHIA 1Z6ZA 2G0TA 3HG7A 2QRLA 2PWZA 4IDDA 4ALIA 8ADHA 4M54A 4NHEA 2C7GA 1UAYA 4J90A 1K0UA 1UUFA 4J0FA 5T57A 3WFIA 3B6ZA 3Q2IA 4AJJA 4DPMA 4YYZA 3WIEA 3ITDA 1SEVA 5THQA 3HDQA 3TFQA 2YFQA 3CSDA 1UXHA 4MP3A 1PJTA 5A5FA 2D0IA 1BVRA 2DTDA 4R51A 4AG3A 4E4YA 4FGSA 4D43A 2ZYGA 3GPIA 2PR2A 4YR9A 2EJWA 2O48X 3GC6A 4UVDA 4AJPA 5AXCA 2FHSA 2J3IA 1KVUA 3N58A 2RCYA 3IKTA 4R69A 1GV1A 4YXFA 4AJOA 1KVTA 2WSBA 2NQTA 3DZKA 2EV9A 3RSHA 5I7SA 1E3SA 5IAAA 1X1EA 3KEOA 4CPDA 2NUAA 4HKTA 4CLOB 4UUNA 5A02A 4WJZA 1GUFA 5G0UA 4CM5A 1Q0HA 2VHVA 4LCJA 3WWYA 2ZJ0A 2LDBA 2TMGA 3K8ZA 1H2HA 1LDYA 2PZJA 3GVXA 3E8XA 1I3NA 1HZJA 1WMBA 2X0JA 4E5KA 4BKUA 1E7RA 1IPEA 4YB8A 4R5HA 3OJFA 3OFSA 4CQLA 2X9NA 4L75A 1EDZA 2O23A 2OFPA 5EIOA 1YBAA 4PRLA 1ZSYA 4F6LA 1R4MB 5AXBA 3S2GA 5DDIP 5A05A 1H0KA 3MOIA 5F1OA 2HQ1A 4CM8B 4GSLA 5CG2A 3FD8A 1MC4A 2YHIB 1YJ8A 4R9SA 5C7LO 1I3KA 1YKFA 3VZPA 1NVMB 2P4HX 5BSGA 5U9CA 2P91A 1HSOA 1T4DA 3T4XA 4YBZA 1PX0A 1EZ4A 4RVGA 1A5ZA 4K6CA 4RPKA 4D0SA 2QG4A 2X0IA 3KUXA 1NNUA 2JKVA 2GERA 2B0JA 3HDJA 2BLLA 5HA5A 4I5EA 2EXXA 3ZV3A 4WLUA 5A1TA 4OGWA 1JWAB 3ICCA 4XEHA 5JBIA 3EVNA 3Q9NA 3F6YA 1YB1A 3H9EO 1LDNA 3JQ9C 3JQ7B 1U4SA 2PZMA 4CV2A 1E7QA 3X2FA 3CTMA 3NT2A 3WGTA 3P7MA 4OXYA 3RBVA 3D64A 3WG9A 5JFOA 4ZA2A 3AOEC 4E31A 3V2GA 1NX6A 2X9GA 4AJNA 3G79A 3ENKA 1SC6A 3D1LA 1U7HA 4ALJA 1I3MA 2C5EA 2VZ9A 3BTVA 3DO5A 4ZQEA 2B83A 4D42A 2EGHA 3JQFC 3GLQA 2J5QA 4Y98A 1IY8A 4ZGWA 1T25A 3TPCA 4DWVA 4Z9FA 4DLAA 1I5RA 1YL6A 1PZGA 1E1LA 5CAEA 3PIDA 3C7AA 4FS3A 5AVOA 5JDIA 2OO5A 3F3SA 2CF5A 3L4BC 1X14A 3TQHA 4RLHA 5L45A 3I9OA 1I36A 3PJFA 3I6IA 3TWOA 1HEUA 4R54A 1EVIA 5KVQA 2VYVD 2WWRA 4B8ZA 3K2BA 4MIOA 4URFA 4FIZA 3ANNA 5DT9A 1LTHR 5A9SB 3JD4A 3L6DA 3FHLA 2IODA 2VWGA 3FI9A 4NIMA 5ITVA 4MKRA 5F5NA 1LDEA 1GFSA 2Q1WA 3GOHA 3ZDFA 5FWNA 4J1QA 3DR3A 1UZNA 2C54A 2EKQA 4BNNA 1FK8A 2VUTA 4TQGA 5AXAA 1QYCA 1VPDA 3FNHA 4CM7A 2X5KO 3E6AA 4GX1A 3AI1A 1MGOA 4RF2A 3V2HA 4JJGA 5LDGA 4DPLA 3SX2A 1E3EA 1LU9A 3K73O 4IUYA 5DBIA 3KLPX 3WGZA 5IG2A 4I5GA 1S6YA 3BMQB 5JCJD 4HP8A 5DP2A 1BVUA 4WCFA 4DMLA 4FSHA 3NDJA 4MP8A 1Y5MA 4NBWA 2WE7A 4LRTB 4ALMA 3M2TA 4NG5A 1F06A 1PWZA 3D3EA 2D3TA 3EW7A 3AY7A 3KRTA 4J9UE 1U3VA 4PLCA 2DT5A 3G1TA 1DXYA 4K28A 1U8FO 4YJGA 5IXSA 3QE3A 4HWKA 4ZN6A 4Z0HO 1MP0A 1HT0A 2DU8A 1UP7A 1EBFA 3BA1A 4LW8A 4XYBA 4FN4A 2RH8A 5G4LA 1WVGA 4P4LA 1XCBA 1GZ4A 3QW2A 1Y81A 4WLNA 4YTEA 4LK3A 3VKUA 3HNPA 2ZYDA 3ZCXA 4CLHA 3ZWBA 1JLLA 2ZKLA 3K30A 4UUMA 3AY6A 2JHGA 3WGIA 1IHXA 1YWGO 3OHSX 3OBBA 4UVIA 1WMAA 5EL0A 4P22A 4AJEA 3SLGA 3AM3A 4RV9A 3JQAD 4Q3DA 1FMCA 2JFHA 3AU8A 3ZV5A 4PLPA 4L4SA 1LSJA 4CQMB 1PGNA 3N7UA 4BQPA 2AQKA 2QYTA 3PLNA 3TOZA 4CUZA 4NBUA 1DIBA 3PP8A 4RPLA 5JO9A 1GU7A 1CETA 4BNUA 2V7PA 2Q4BA 3DFUA 2X0NA 1KC3A 1ML3A 4F3YA 3COSA 4BNIA 5L7TA 1I2CA 4Q3BA 1NP3A 3KLMX 2YJZA 3MWEB 5T8KC 2Q49A 3OJOA 3ROQA 1YL5A 4XDYA 5KCZA 1KERA 4NQZA 2PZLA 1KEWA 1JTVA 2DAPA 2HK9A 3IL2A 5IZCC 5MGBA 3JQBA 4XIYA 2O3JA 3MJVA 4RF3A 1K89A 2J3KA 2FSSA 4JNKA 1UP4A 2OHXA 4IMPA 4G65A 3GQVA 4J7UA 2DLDA 3V2UA 3RVDA 4BNTA 2ZCUA 2VYNA 5ILGA 3VTFA 2WM3A 5DCWA 4B3IA 1VJTA 3U4CA 2W98A 3FTPA 2ZJ1A 2QHXA 4LMPA 3PVZA 2X0RA 3PWSA 4DREA 1PQUA 3A06A 5BSHA 4GH5A 1WAMA 5DBFA 3ZV6A 3WICA 3WQQA 5ES3A 4B3JA 5T5QA 4CM4A 3RKUA 2HU2A 4ZQBA 1PL8A 5LCXA 3W8EA 3M1LA 5K6AA 1KOLA 4PG7A 3KETA 1N9GB 1WDKA 4QXMA 1F17A 1JKJA 1W6UA 4F6CA 1DIGA 1GCOA 3OETA 2YV3A 3KYCA 4YJFA 4BNFA 3IP3A 4Z6KA 5JXWA 4YDRA 3W4KA 1R0LA 4FFNA 2PH5A 4FFMA 3GRKA 1Y6JA 1ZSNA 2XOXA 2QYSA 1GV0A 3GZNA 1DHRA 4I5FA 1PQPA 1ZMOA 2VT3A 1E3JA 4CUKA 1QV7A 2J3JA 3U4HA 3MJSA 1N7HA 2OOSA 4YT5A 4P4GA 3NAQA 2R2GA 4BGIA 4CODB 4M55A 3QLJA 3ZWWA 2ZATA 1OZAA 2C7VA 4CMEA 3KTDA 1LQTA 2CSUA 3U09A 1E3WA 3Q3CA 1JWBB 2LDXA 4BKQA 3B1JA 4XJSA 4O63O 5DN9A 4EI2A 4B7UA 4XZ3A 4XYMA 3HHPA 1I32A 1B3BA 3INGA 4D45A 3KYBA 3BMCA 4EEXA 4RZIA 5DP1A 3ZNOA 4ALNA 2X86A 1RM3A 2DBRA 4XGIA 4L76A 4OKNA 2VWHA 3LDHA 4TZTA 3FSRA 1YS4A 5KNLA 4E33A 1YONA 1ENZA 3K96A 4I1IA 1P31A 3BYZA 3ETGA 1P1JA 3TOXA 3ZN2A 4PIVA 4NU5A 1PJBA 1KS9A 4BGVA 1PGOA 3BTOA 3P2OA 3V1YA 1UZLA 1Q2XA 3QV1A 3GH3A 5EPOA 1PU2A 4E2WA 2DUUA 4XB2A 2PNFA 1P0FA 3JD0A 2PH3A 2HMUA 1AHHA 1D1TA 3MCVA 2Y1CA 1LXCA 1PJSA 2OBNA 2BF7A 4BO8A 2BMAA 2DC1A 2XAAA 1A27A 3PIIA 1U3WA 1X1TA 4BS9A 2X5JO 2YDXA 3LF1A 1M66A 1JAXA 2HCTA 2X6TA 5EMHA 4XYEA 2BKAA 4MPDA 1VE9A 2UYYA 1GYQA 4HFJA 4PZEA 4IDAA 3WQSB 4J4HA 1PR9A 5L53A 3SJ7A 4Y6RA 3HJAA 1NQTA 4KMSA 3NDRA 3ZNNA 3HN7A 4PCVA 3UFXA 4PG5A 3GG2A 1F0YA 3EUWA 1W4ZA 4FD3A 4DLBA 1O6ZA 1ISGA 1B7GO 5JSFA 1B8UA 3LLSA 3OA2A 1CQIA 2D4AA 3RUEA 1ORRA 4S1VA 4NJOA 5ADHA 2BRUA 2VT2A 3FR8A 3JQCA 4B4UA 3RFTA 4GWGA 4BMSA 1MFPA 3OM9A 2FRDA 3AFMA 1N2SA 2O3TA 3RU9A 4G5HA 1P74A 4BUCA 4E2XA 3U62A 1LJ8A 2NVBA 3WR5A 3IJRA 4MIYA 4RF5A 2DM6A 2HJSA 5U1PA 2GSDA 2A92A 5IF3A 1QLHA 2NACA 5HS6A 2Y66A 5F5LA 5FI5A 3DZHA 3WDSA 1NWCA 2C82A 3PLRA 1GYPA 1O5IA 2Q46A 4JN6B 2P9EA 3LK7A 3WB9A 4AJ2A 1H6AA 1UDBA 1SPXA 2GO1A 2HSDA 3X2EA 1X13A 1ISIA 3D3WA 4U5QA 3DC2A 3JTMA 5JY1A 4UUOA 4QO8A 1T1SA 4E32A 4WLVA 1LDMA 5GZ3A 1AXEA 4H3VA 3U3XA 4PLHA 1UJMA 3PFWO 3VH4A 5BNIA 3I4CA 1NXQA 4I9HA 4ITUA 1B16A 2JJYA 2FR8A 4FOSA 4CM1A 4CL3A 3QVWA 2XF8A 2RIRA 4NMHA 1NTOA 2BGKA 3I4FA 4QO7A 3RUAA 3ROMA 3DBRB 2Q45A 5A9TA 4O6VA 4UULA 4II3A 4CM3A 4D44A 3CXRA 2B37A 4PLWA 4Y6SA 3E9MA 1KEVA 4MVJG 1Y7TA 2C59A 4NFSA 4PLVA 4G2NA 1ZNQO 5IDYA 4XDZA 2OP0A 1ONPA 1SB9A 3JQ9A 4M86A 3E9QA 5C7IO 4WEOA 3KYDB 1IL0A 3DFZA 3DMYA 4Z0PA 4BKRA 2FPGA 1TT7A 5IDWA 1IPFA 3AOEA 4RVDA 1LC3A 4TSKA 4IS3A 4CM6A 2FR0A 1TXGA 4GBJA 4EUHA 4ZRMA 1ZXLA 2EP7A 3FBGA 3JQAB 1PJCA 4IDFA 4R9RA 1G6KA 3HUDA 1NR7A 3CEAA 2GZ3A 3G17A 4Q3EA 2YQ5A 3PHGA 4J4BA 2Y0CA 5CDGA 5L4NA 4GWKA 3VH1A 1EUDA 1R4NA 2C5AA 3EHEA 3RQSA 4CJXA 3AUUA 4E0BA 3TFOA 1EVZA 3Q2KA 4IZHA 4XD2A 4FR5A 5EQDA 4GMFA 4YRBA 2DUWA 2QRKA 2ZB3A 1YOVA 1C1XB 5EJ2A 2E48A 2GASA 4YRAA 2XXBA 3PHHA 3JD2A 1SZJG 2DTEA 1YBVA 3ITKA 1BG6A 4MOWA 3TRIA 1OAAA 2BFMA 2POQX 3GDGA 2YUTA 3L07A 4N7RA 1C3VA 1P33A 1GD1O 2O3UA 3OJEA 1R12A 4GL4A 1A72A 4IINA 1LA2A 4U8GA 1EQUA 1VI2A 3Q9UA 1DC3A 1AE1A 1C0LA 2DQ4A 1PL6A 2HO5A 4L0QA 4RO0A 5DZSA 3SC4A 3T7CA 4CMAA 5K6AC 1DOHA 4PVDA 4KWHA 1DJQA 2UV8A 2O3QA 3OQBA 4IZIA 4ALLA 1YB5A 1E1MA 1IB6A 1LRJA 2O7QA 1GUZA 2WD7A 3PWZA 1GY8A 3HFGA 3ZWPA 5JCXA 3I6QA 2E6UX 4M1QA 5BQFA 5KVSA 6ADHA 4K9DA 4MVJP 2Q1UA 1LSUA 3ONEA 1UXJA 4YA6A 1B2LA 1K6IA 3C1AA 4CLEA 1KC1A 4KP7A 1QV6A 4E3ZA 2PA3A 1L7DA 3BXXA 3DEYX 1ZEMA 5KVVA 2J5KA 1KYQA 5DULA 4CR6A 3W6ZA 5C37A 4NJMA 5F1PA 3ZHXA 4Z3DA 4IDBA 2ZB7A 1B0AA 3FBTA 3RBXA 2Y93A 4FBGA 5F1KA 2WE8A 2OL4A 1AN9A 3F4BA 4EJMA 2W2KA 1NVGA 3UN1A 3ANLA 3GZ4A 4IJWA 4O59O 4R3NA 4RVHA 3TL3A 2Y67A 3BHJA 1N5DA 3T4EA 4LVUA 3WIDA 3ULKA 3K2EA 5FEUA 1ZZEA 1BWSA 3JYOA 4DL9A 3WJAA 1GZ3A 1PGJA 1ZK3A 1GCUA 4XQ9A 1E6EA 5GY7A 1U1IA 3WYBA 4DC1A 3BIOA 3EK2A 4RVFA 2WDZA 4MKXA 1TVEA 1V9LA 3JYLA 1FXSA 2OZPA 4NBTA 4PLFA
chains in the Genus database with same CATH superfamily
3U7RA 5LFAA 3WL7A 3WK4A 4R31A 5BUQA 2C84A 3SICE 1G38A 2GB4A 1NU8A 2J9RA 1KP9A 2C1XA 1QHHB 1QFXA 1UR5A 3FFTA 1DAMA 1SOWA 4F3RA 3EMDA 5FWYB 3R5TA 1EXDA 2GNAA 4XDHA 4HNUA 4E5PA 3U13A 2JAQA 1TO2E 2BV3A 4EW1A 2J9ZB 1QR6A 1U04A 2QQGA 4WA7A 1AQYA 2QA5A 2RKOA 5JD4A 1OV4A 1DCTA 2ZIEA 3DOJA 4N3NA 1C3JA 4Q7MB 1NVKA 1T3LA 1HE3A 3L0PA 4E07A 2NZXA 1U0OC 3C4QA 2ES4A 1XCMA 2LCQA 3E3AA 2ZTVA 3EGXA 4FLFA 4MI3A 2RHTA 5F3RA 3WMWA 4OG2A 4GKAA 3WMEA 5L3VA 3EZNA 3H42B 2F43B 2QNRA 2RHDA 3MHPA 2CLLB 4B85A 2Z5VA 2HEGA 4X9XA 1HM5A 5K9ZA 5I47A 3OZRA 1R8SA 5IKPA 1KYWA 5KS2A 3H2IA 2FH5B 5ENDA 4E30A 3U2QA 1XN1A 2FLWA 4LFAB 2QGZA 4I99A 4CEHA 1U4OA 1NF3A 3MWLA 5BYKA 2QVZX 4XGQA 2AH5A 3GA7A 1CNEA 2E9SA 2JZCA 1KEPA 3KSAC 3OG9A 3SHOA 2H2IA 1J0CA 1L8OA 2F3UA 3GFRA 1YIAA 1N2OA 2N1BA 2Q5HA 2X6RA 4NBNA 4P53A 4XWYA 4ZCSA 4DMMA 2FRDC 1LBEA 4NONA 1RM4A 2X4LA 1RRVA 1BKYA 4R81A 5DHTA 4ZU3A 5A6SB 1RADA 2FZVA 3AHJA 3OSZA 4UATA 2WINI 3CZRA 3A0RB 4HDKA 4L0CA 3CO5A 4V03A 1MBZA 4G5XA 4NG4A 4Y2UA 3CVUA 5IUNC 4M22A 1TAGA 5CVDA 4EA7A 4Q9NA 2O2GA 2XCLA 4GP7A 2YZ7A 2ZIWB 4UBOA 3MMZA 4ML3A 2Q8PA 5D5QA 3B60A 3G1UA 4J49A 1M2VA 1FQKA 1E9FA 2DHDA 1SRRA 2HOQA 4OHKA 3W8FA 3EIXA 1IK6A 4I8XA 3U9TA 3UWDA 3ZU3A 1V3QE 4UTRA 2W90A 1MC5A 2WFAA 2A1TR 4TLMB 5KNCA 2UYGA 4X20B 3RTGA 4WXYB 3IIJA 2XGOA 3FAKA 4GUAA 5FHRA 3SM9A 3D7LA 4V3BA 3H3FA 1PG0A 3W3AH 1ICEA 1J9EA 4UM9D 5J2TA 2BIFA 3NASA 4GICA 3PNKA 4PAQA 4EB6A 2FR8C 1VXRA 5DKFA 4JBHA 3SF8A 1II0A 1P1HA 2MSNA 2WSSA 2RKWA 2ORED 1O03A 2YFYA 3IHLA 1LZLA 3M9LA 5GVSA 1EVEA 4L27A 1ZBQA 5HWSA 1ZMXA 2XVZA 1X9HA 2LPMA 1KI8A 4A23A 5LP1A 4AY3A 2P7IA 3LZDA 4JC4A 1Z4PX 3PXBA 2PCLA 3GEMA 3G5MA 3KR1A 3VAZA 4ZEOA 3AI3A 1XKLA 2GHQA 4G37A 4IX1A 5E95A 3SU8A 1KJ9A 2EFGA 1MO6A 2E4UA 3P0RA 4IJUA 4QVGA 1XDDA 1PLLA 2W0MA 4ZO6A 5DT2A 3ZG6A 1EJ0A 4KIFA 3U61B 2AV6A 3ZD6A 4C7BA 2Q99A 2B1GA 3GVCA 3OAAA 4D02A 1O96A 1HFWA 3MTAA 4EIWA 3EC7A 2FMXA 4G8BA 4GI2A 1UINA 1MIHA 4LZJA 4QICA 1JA0A 3BCSA 1XHFA 5HCNA 2J09A 5C1PA 2QAIA 2G6TA 1SVLA 4PANA 1ORVA 3NRJA 1E8MA 5K3FB 3TZ6A 5CEJA 5BN3A 1KQFA 3IPRA 1AA9A 1N2EA 2L19A 1AVTA 3BD6A 5C5IA 4EO9A 5AESA 3LT5A 3LC2O 1J4AA 3FMOB 4NZYA 2DRIA 3HADA 5K8JB 5KYYB 4OM7A 2I2BA 2HMAA 3ZU5A 3EJ6A 1AO3A 3FNRA 5CX1B 3GOQA 4YJ3A 4HG2A 2G0AA 5CFLA 1XYYA 4B7XA 5AJYA 1VHJA 4KI7A 2C4UA 1XQYA 4GNKA 5F7ZA 5H3LA 4OGKA 3SPXA 1RKVA 3JZIA 1X9IA 1NI4A 1ZX1A 3HKDB 3VYUB 4POOA 1FFDA 4CT4B 4EL0A 4C0LA 5I5EA 3LOPA 1UJNA 1NOJA 3M9XA 5ERXA 2ZIGA 3ZOZA 4KGXA 5K51A 2FWPA 4HUQA 4Y18A 3UMFA 1QAQA 4H1UA 2IIBA 3NTQA 3VNBA 5IYZA 2ET6A 3LY5A 4R2JA 2BGWA 1PEYA 5BSFA 3H99A 4A0GA 1QZXA 1TUBA 3HCAA 2XMSA 3EG5A 4DY6A 2X1LA 1A7KA 1NLZA 2FW1A 3IXLA 3BWEA 1WRBA 2C5BA 4EH1A 3OTGA 2JD2A 1SHLA 2FLKA 2AI3A 5TNXA 5KOJA 5F9FA 3AG6A 3REOA 1TDJA 1QF7A 2Z5LA 4M1KA 2WPDA 2ZTUA 3GNSA 4XFKA 5JNTA 2H92A 5KOHA 1AC5A 3QXGA 3H3XA 3A28A 2QAGB 3G0CA 4G67A 2KX7A 4PXAA 2HADA 1ZIYA 4TRNA 4C7VA 5ICFA 3G88A 3R5JA 1PWXA 3U49A 2Y1LA 2GAFA 4KGVA 4NESA 1DB3A 4MDFA 3AT1A 2YWHA 4UM8B 3D6MA 5HUJA 2O8BA 1G63A 2EBHX 2IPNA 3IR5A 5J3JA 5FUWA 1IOVA 3C3MA 1UKCA 4MP6A 1AK9A 3DAYA 3QE0A 4GHWA 5DGCA 4BN0A 5DLYA 5LMZA 1Q7EA 5H81A 4FM9A 4MKGA 5LQRA 2FF5A 3MCTA 4MAMA 2YYSA 1N9KA 3WNQA 3U3OA 1EFVB 1F2VA 3TAUA 4DG9A 1AN0A 3NIGB 2OAQ1 5D84A 1QP0A 3NYWA 3O31A 3SR0A 4G63A 4D0GA 5KVAA 1XSEA 4OI0A 1AQNA 1LVHA 3B1YA 4GMDA 2IW3A 2BFFB 1QGUA 1D2MA 1ORWA 1PNOA 3OECA 5HJ7A 3FSJX 3PPXA 1YQ9A 3L7IA 3FW1A 3IE1A 3QEMA 2FSGA 1KXJA 2H8KA 4QGGA 4UTZA 2EW1A 1F2UA 5CBKA 5A9SA 3COPA 4HNVA 2A9OA 2QLBA 1J06A 4KMOA 1ZONA 2GDJA 1PJ4A 1Z2PX 2VRCA 3D02A 1TK3A 4HVLA 4J16A 1LX7A 4WFJA 1U3CA 2B4RO 3F3MA 1PG5A 4ZOCA 2FY8A 1SFRA 1V4VA 3RFUA 1JAHA 2J9FA 3VI3B 1HT3A 5B37A 5EXSA 1JU9A 4Q6BA 4IGKA 5ALZA 3CB2A 1VB3A 1PFGA 1XF9A 1JE0A 2PVCA 1DWPA 2F7SA 1UFQA 2ZU0C 4NE9A 5JR3A 1E94E 2G4LA 1I2DA 4MAAA 1FDIA 2ZXEA 3CUUA 3DMPA 4FMCB 1VJ0A 4GR9A 2KSQA 3QELA 4XDGA 2D2VA 2ZWOA 4MUIA 2O2XA 3WVNA 4YWJA 4WBNB 1K5PA 4JI0B 1ZHOA 1P4RA 2NU8B 1E1NA 1W8IA 2Y1FA 3T3OA 3R9WA 3NT5A 4Y9UA 2O7NA 3NC4A 2YZKA 4QOGA 5EMKA 1QIFA 1YJBA 5C1IA 3VFDA 2OQ2A 4TS9A 2EP5A 1NIJA 1V1MB 3EZFA 3KJGA 4PV7A 5AM1A 3O8QB 3SDSA 4YT2A 3BJIC 3C7KA 4YRMA 2COKA 4QXOA 5JS8A 5KVCA 4R1TA 5J2UA 3TLXA 3S7ZA 5A3RA 1G291 1TA9A 2H2WA 3EMVA 1E6WA 3A6FA 4QGAA 4JP3A 3ANYB 5F52A 4DEYA 2JKZA 2HIAA 4HQLA 1WJGA 2OGZA 4U0KA 3IODA 3SOPA 4B7AA 1YVPA 1MC1A 2IT1A 2Q5LA 3KD2A 3SYLA 1AK1A 3NTUA 3D6AA 4LZWA 4YX9A 2Z4TA 5F98A 2FPIA 5KC9A 1WV1A 1YI0A 4UDYX 4BRZA 4PC6A 4DLSA 3RT1A 2ZEJA 2C96A 3EASA 3VMMA 1EUCB 3REGA 3RS4A 1I30A 2WF5A 4FN5A 2CXHA 2FOIA 4U2KA 1OXKB 1ZM3A 3DFKA 2GPTA 3GLFB 3WTCA 4JB3A 1BRTA 4Q3CA 3ZLVA 3HXOA 1DAFA 1I4LD 2WM2A 3G2OA 1ADCA 1UKAA 3FZGA 4HDMA 2W2LD 2V3WA 5J1SB 3KQVA 1F38A 3ASZA 1J42A 1WXEA 2G4VA 2Q2VA 3E8SA 2W48A 1TA0A 4JT9A 3UXEA 4BB9A 3VJKA 4RY9A 1Z12A 2J31A 3CF2A 5DM4A 3NW9A 3LU1A 1L7PA 3BE4A 2WWXA 3L1JA 2R8OA 2WK1A 4RHYA 5C53B 3ETDA 4AS1A 4MINA 1FSZA 2WJJA 3H5AA 4TOIA 4UZEA 4BMXA 4II2A 3NHRA 3V48A 3Q11A 4CKCA 4HJRA 5AFSA 4MLPA 5JYEA 3L0ZA 4IQGA 4KITB 1AQUA 1ISPA 1OA1A 4ETMA 3OPXA 4D1YA 3ACBA 2VEOA 3VV2A 3NV7A 2VDUE 2VDWA 1M5UA 4R01A 3DHYA 4HGYA 4C21A 3NVDA 1NA5A 1AIPA 1T9ZA 3DCJA 5J23A 1BXRA 3WL4A 3NOVA 1NDUA 3IAS6 4MV9A 4DRXA 5LXTA 3CUYA 3IC5A 4IJVA 2O7RA 4ESHA 1CIVA 2ENWA 4FFVA 3WOHA 4NS4A 2OBXA 1RLOA 3L18A 1OLXB 4UMDA 1Q95A 3JAWB 1RZ3A 5F64A 5FKJA 4RJTA 1RBMA 1YZFA 3HKCA 3QMVA 4EHBA 1XDSA 4MVJI 3DNFA 1RP1A 2VHZA 4HDOB 5DI3B 1CZLA 1NUQA 1XVIA 1YA8A 4V3CA 2JAPA 3E1SA 4C89A 3JALB 1YQDA 1HI9A 2VQ3A 4N40A 4N82A 5DCLA 3M5CA 3SF0A 1HA3A 1OBOA 2AA3A 2EBUA 2X7JA 3GCXA 1GQSA 2ZREA 1MNAA 4F96A 1FJXA 3DMTA 1KKUA 2A5LA 4MO2A 1NKSA 2R87A 1LLDA 5EHQA 4X0EA 1QH1A 2KQUA 3HA7A 1YCGA 2O2EA 5DTQA 1P2BA 2FUNB 3BILA 3Q41A 3KQMA 1GNTA 3NH6A 4IM7A 5DIFA 5G3ZA 4R2XA 2WD9A 3H65A 1IOZA 1TB4A 2CJXA 2D5IA 3R7LA 3EVBA 3OA0A 4WUVA 4N3GA 4MZXA 3LHDA 5TF4A 1GUDA 2Y0DA 1ZVMA 3B7PA 2GDZA 2WJPA 2WIKA 3FPSA 4CN8A 3THWB 1DRVA 4HS9A 4B3XA 5CDFA 1H42A 1D6SA 2IYOA 5TPZA 3ZGVA 4EFDA 2H2GA 1JG6A 1Y7IA 2ZPTX 5DIZA 2PY6A 3PUZA 4NYMQ 2YY6A 4BC1A 5FL3A 3T6KA 2X4GA 2XKBA 3ESBA 3R7WB 5T4BA 1K63A 1LI7A 2FPMA 3LO8A 4RV4A 2R96A 1RIIA 1FFAA 4OF4A 1TEZA 2CV2A 1G20B 3OFND 3RW9A 4QM7A 1P2GA 2FXIA 4CDRA 3PJEA 5E3HA 4NCHA 4UJ5A 2H4YA 2ZYAA 4J6EA 4RXMA 4ND7A 2SKEA 1X94A 4G6ZA 2FEWB 5FV4A 3K6JA 4HFMA 3CLUD 3TTTA 3GRPA 4WQMA 3Q8KA 3PD7A 2RK6A 4GU5A 4W8OA 3D0OA 5EWMA 3ZKWB 4D0NA 2P9BA 3F5QA 5HEKA 1ELOA 1LBQA 3S1AB 4CG0A 1M6YA 2I4IA 2R3SA 1NNI1 3Q87B 4OHOA 2Q8QA 4JLPA 3ZHRA 3HU2A 3KDAA 4RU1A 2J0SA 4M0PA 2Z08A 3QG1A 3TR6A 2IPLA 2F4NA 2ZWPA 4BQQA 5JMWA 4L0MA 5DF1A 3SJAA 4DAEA 2C94A 2GZ1A 4QUBA 1G17A 2X8WA 1S89A 4HXFB 1L9KA 2QN6A 4MRPA 3GBPA 4E7PA 4HOYA 4NK4A 2F48A 3E23A 3BL8A 1UDXA 3PDJA 3LIPA 1YH3A 3GG9A 1USUA 4RL6A 1T3HA 5J4LA 2BAGA 1G5HA 2QORA 5NULA 4TVBA 2OBLA 3OF5A 5F7JA 2QM8A 3A9RA 4O2BF 3IDQA 2JGEA 3GDWA 3NIDB 4MV3A 5DCUA 3NAZA 1SY7A 3KUCA 3AJEA 2CBZA 1D0VA 1XR3A 2XPCA 1J9ZA 1QG0A 3CLKA 3I2GA 2QYHA 3K35A 3L77A 4YCNA 4ER5A 3DQQA 4YAFA 5FD8A 3RANA 2CSXA 3OVMA 4HAYA 4TVOA 4YEDA 5HIKA 2LIVA 1CE8A 1NWHA 3DXZA 1WSWA 2ZYRA 1UP6A 4EOGA 4K86A 3PGLA 1ABBA 3DOIA 4KQFA 2OLJA 1G98A 2VDMB 2AK2A 4MUEA 1LF0A 1Q1ZA 4BMOB 5JAIA 1CY8A 2JGDB 4ZEVA 2YCLA 1CDOA 4MWDA 1DIAA 3IOYA 3JQEA 3HKEB 421PA 3K9FC 4H6XA 5FORA 4Z0TA 4NU6A 5IASA 5BRAA 2YXNA 2PEZA 3PHJA 4AC9A 4RGVA 1CHNA 3MS4A 1ZCAA 1PJRA 4JT8A 4NJEA 4URWR 1Z22A 1XG5A 1XELA 5T4EA 1P29A 3R9IA 1FW6A 2FEPA 2PD6A 2FMKA 3EEOA 2WM8A 2YNMC 4XYLA 4JHLA 5IW8A 1GSHA 3L6OO 4UHKA 3STWA 4DB2A 1CQWA 3BWYA 3S7TA 3RYCB 3WB1A 1DV2A 4ZXPA 1SEPA 4JAVC 2P77A 2F8MA 3U3MA 5FNVA 3G59A 1VYTA 4WXHA 2Y0PA 4ON9A 2VOEA 3CEJA 4U9IS 1G6Q1 4MW9A 2YMQA 1PNVA 1I4DD 4HVAA 3RC9A 1U94A 4EITA 3ASVA 4CLXA 2CNWA 3AIOA 4URZR 4MIKA 5LQSA 2OO7A 2FMFA 2NADA 2ZRKA 3VPHA 3CWCA 2X76A 4UBLA 2BHNA 2V6FA 4FP9A 4Z9XA 3ILSA 1C9JA 4EPVA 5ICMA 2HQSA 3CN7A 5AW5A 1RXWA 3MTJA 4C88A 1C9KA 2FMHA 4YCCA 1Z4QA 1TKRA 1GZHB 3P26A 4QFDA 2Q4OA 1RR6A 3F5DA 1C30A 2BGUA 1HETA 1T5OA 1ULSA 2ZVJA 1QYRA 1EMDA 3SR3A 4BB6A 2ZSIA 4GXQA 1N92A 4N5LA 1QH0A 2NX2A 4URXR 1WY7A 4YRFA 3FGZA 4ZCMA 1UT6A 5CVJA 3RV3A 3TLKA 3VPFA 3WK9A 1JHUA 5JYBA 2EYQA 3P9ZA 3RWMB 4M7OA 3WLEA 5AKKA 4BVEA 4Z4GA 1XNGA 1F3LA 4KLAA 4Y3UA 4I2VA 1QOPB 2DFDA 4WTOA 4BNHA 4NECA 4F3KA 3UJNA 3LP6A 3MJCA 1V9CA 3RF7A 1M1ZA 2DQSA 7AT1A 3M6XA 3DOHA 3X1ZA 2O8FA 3BJMA 5B1HA 2QUHA 3CONA 2WVHA 3IBSA 4RGBA 3FMIA 1KQOA 3COYA 3D2AA 2ZXFA 3KSBC 1L5HA 1JL3A 2QQ5A 5IFLA 5CDSA 1R6XA 1N3LA 5IDQA 3IILA 4LSWA 3DWFA 5EZ6B 1XMQB 3FDZB 1O0SA 2VBFA 2CNBA 3AGPA 2JAWA 3OJ0A 4Q7JB 2IPOA 3KJEA 1Q7CA 4LY6A 1MNQA 1L5WA 4RK0A 1S7CA 4KO8A 2N42A 1Z26A 1UJ2A 2ZU6A 1KP2A 2VDVE 4KW7A 4L8LA 5AUPB 4GOOD 2Z4RA 3O74A 1S01A 1VJ1A 2QT0A 3FDIA 4TMVA 1WHTA 1KU0A 2B69A 3HMKA 4GQAA 5SZKB 4HTFB 4J1TA 4OK6A 1JMVA 3IERA 3UW3A 2V0NA 4F4UA 1GRVA 1S2IA 2JAOA 2ZJFA 5GADl 1LUAA 3AK4A 1SVKA 3I1IA 3HN2A 4CL8A 3HV2A 1DTWA 3A25A 4LJ9A 2MCFA 4YAJA 2D2XA 2L69A 2PUBA 3IP1A 2DBZA 2LW7A 2R6R1 3CNEA 1B6SA 1FDSA 2WNSA 3RFCA 4N6OA 4YUWA 2BGRA 3SFZA 3UEOA 1JFLA 4OXIA 3U17A 4AY2A 3DC7A 4OKIA 3FOWA 2WJIA 4IVQA 3VR5A 3FYUA 4F97A 2G71A 4RPCA 1Z8DA 3OOYA 3R3YA 1XLTA 4ZC8A 1ONNA 4RMJA 3R3SA 4WZAA 5I7EA 1YJXA 3D6TB 2W2KB 4V0QA 5DYIA 1QRAA 4P7BA 5BSTA 1YTUA 3DUFA 2BZSA 4KQWA 4U3JB 1ISMA 2XNDA 3CRMA 2GN0A 4MGIR 5HRUA 2PRKA 4C4ZA 1FP1D 1G21A 2WMNB 4ZHSA 5AOAA 4U7DA 3HA2A 4F11A 1KAGA 3UUGA 3ZE7A 5ADWA 4TXJA 4G0XA 2O3SA 1TPYA 4KFSA 1PZEA 5KWEA 1R4AA 3Q1KA 2AX4A 3MTDA 2I6TA 3KWJA 1M1UA 1SHUX 3QU2A 4LWOA 4CCSA 5KTKA 2NU7B 5KHOC 1M1XB 1SK9A 1U9YA 2XXJA 4YDHB 2X4IA 2I2XB 2ZBRA 1WKBA 4PAGA 5TQ0A 1RAIA 1SHKA 4DA7A 3PCXA 4EGSA 1FXUA 3D6VA 1DDIA 2PRJA 3OPMA 3T61A 2XODA 3OT1A 2ZROA 3VU8A 4C0WA 2DPYA 4FX2A 1T8RA 3N8IA 3TDNA 3BC1A 4ZT5A 1PG2A 3FX2A 1D4ZA 3D59A 5SZIA 4D6PA 1A9ZA 3AB3A 1FVOA 1DSSG 2FPPB 1GL6A 4G0WA 3EH2A 2QSJA 1DC6A 1JHMA 3UB4A 1MEOA 4DJFC 4YMVA 1OPXA 1SA0A 1X1DA 2VYND 4RM2A 2VJKA 4D2IA 2OENG 4AL4A 4ZP1A 1I7LA 1QANA 2WA2A 3KE9A 3GBVA 4I8DA 4HRYA 5B3JA 1ZOIA 2VBCA 2Q3HA 2XHZA 1X7YB 2AUMA 3E8MA 2A14A 5EOVA 2XIQA 1NQVA 2QW0X 3STHA 1CF4A 3MSCA 4ZQFA 3WXMA 2C9DA 5GWXA 3VZRA 1CS4C 4AROA 5BUZA 3OTHA 2CMKA 4O4HA 4PQGA 4HT3B 3DV9A 3S0JA 1UK7A 2CFCA 4A2QA 3C5VA 1KKMA 1CUZA 2F9FA 2XVMA 2ZRFA 3AUXA 4G5GA 4EMSA 1CUVA 1XD9A 3KNZA 4D8VA 3A1SA 4QEKA 2Z6UA 2EX1A 1QGOA 1JI0A 3MFQA 4LSMA 2NXWA 3UT5A 4R1QA 3NDBB 1R50A 2HMYB 4UU0A 5LWQA 1BFKA 4LGMA 3UY4A 4W9NC 2GJKA 2GD6A 3V4LA 1NVTA 3BN3A 4MRSA 4NP6A 3MYYA 4DARA 5KINB 3QG5A 5U4QA 4FWTA 3ELBA 1ZM7A 3RAJA 3MT0A 4ZO8A 1WZIA 3AI2A 1QTRA 4ZTBA 1EXMA 1ZU4A 2W6NA 3M3DA 2NYRA 1W47A 2ZBPA 4V0LA 1T5IA 3IXMA 1RHKA 5DISB 3ZE1B 2AI1A 1N6PA 3AX6A 3DVRX 1CQZA 1J2TA 1WR8A 2QTRA 3C3JA 4BVFA 2NZ8A 2C8VA 1K8ZB 3ZW9A 2QD1A 1IFXA 1QRRA 4BXOA 4MS4B 2G0NA 3AJDA 4RTNA 1BMFD 5JPDA 1Z74A 2PLAA 1LGYA 3GF4A 4MVCA 4O4JA 4ZAWA 3QVUA 3VKFA 4PBTA 5L6MB 2BCGY 3NWEA 1C8VB 2NXJA 3H2YA 3FYSA 3MTEA 2HFJA 1FDUA 4AUNA 4EHFA 4YRQA 1JPJA 1JHRA 3U7EB 3ZJTA 1FSFA 2A94A 3WGYA 1EESA 4C08A 3R3HA 3LSYA 1PQWA 1RJGA 4A1OA 2RAFA 3AEQB 4IH4A 4O0MA 4A0HA 5ICSA 2FMTA 3K20A 2O2CA 2P2DA 4Q00A 1E2PA 2FEKA 5ERYA 2BSQA 1NFFA 4EEZA 1AMOA 1L6IA 1W48A 2ZUWA 1UJBA 1IWBB 2YJ6A 2QTGA 1XMPA 3B5JA 5AK3A 5JAZA 2QTLA 3U48A 3WKBA 4JGIA 5DE3A 5KC8A 1EZZA 2HLPA 4Q19A 5F35A 3KXIA 1L4LA 4EL5A 1PR3A 2BGMA 1KPHA 1T4BA 4UFNA 5TR9A 3B13B 2ZK7A 2R9VA 1UJ4A 2VDQB 3AETA 4EP1A 4R6WA 3ISVA 3W5AA 3TSZA 5HVNA 3I2IA 5E6UA 4UE2A 3THYA 4Y2GA 2A9JA 3V7WA 1O4VA 3HZRA 2I6GA 1YRAA 1MOSA 2E2WA 3ED5A 4ASUD 3F2VA 5L3QB 5REQA 4BP1A 4Z7NB 3K71B 3KKQA 3DLIA 5ALEA 5EVCA 3HDGA 1C7RA 3T9AA 2BZ0A 4WFKA 5FOUA 1RU3A 2GGSA 5HUHA 1PK8A 1MJNA 1EK6A 1FJGB 4M89A 4O2BB 3DOCA 1ZGZA 3BWVA 4UNIA 4BB5A 1Z82A 3L9WA 5G3YA 1WUHS 4YDSA 3WLNA 3QX7A 1E1QA 1PQ4A 3OJXA 1U5CA 1QRSA 3DBLA 3S99A 4X8HA 3TXYA 2XITA 3T35A 2G9ZA 3I01A 3O9MA 3MERA 3DL2A 1L4GA 3KM0A 1OB2A 1Y8QA 4R2MA 5CBPB 3BDAA 3IEIA 3HSKA 1WCIA 2Z1NA 3LYUA 4OU5A 1PJZA 4KUGA 2IP1A 1PD1A 2UZ3A 3FOBA 3KV3O 3QUQA 3T1YB 1IM5A 1YS9A 4RKRA 1H2AS 4RIEA 1I80A 3PFGA 2AHRA 5CB4F 3HB5X 1KZHA 1KZ9A 1WQ3A 8GPBA 3DS8A 1NQAO 3AP2A 2A7QA 3F1LA 2XUQA 4RPGA 5KYUB 2BFDB 4WDRA 4C1BA 1CY6A 3CF4A 4M1SA 3LK6A 4O2LA 5BT9A 1GCAA 2CDBA 4OP1A 2HW8A 4GR5A 2IHZA 3K4QA 1WMEA 4LOJA 1ZH2A 1I7PA 3QVSA 4YAGA 4KN5A 2BWJA 4HEA1 1GJRA 4MS3A 5MN5A 5FTWA 8LDHA 1LC0A 2AEFA 2PYDA 4LCEA 2PJRA 3CUKA 1ND6A 1A9PA 4IEIA 4L2IA 5M34A 1AQJA 4C2TA 3UO8B 3H9QA 4BNWA 3ECSA 1P4HA 2QUKA 4QECA 1SNYA 1X7WB 2PSSA 3OH8A 1KIMA 1IAVA 4XIGS 3OZTA 2YZ2A 3RC2A 1DPGA 3G1WA 3ZIUA 3PYMA 1FQWA 3RS8A 2UZ1B 3ZJUA 3G9QA 3SX4A 2ZUUA 4CT5A 5FLYA 1CUAA 2FSFA 1KHTA 2QL6A 4DNOA 4HPWA 2G83A 1AH2A 4EI9A 1CJUC 3ZIAD 4COKA 3AEKB 2WU0A 2G5PA 1GPWB 3KJFA 4JUCA 1XX6A 3A2NA 1P8JA 5IAEA 2HMSA 3ORSA 3C70A 4BJ3A 4QREA 5JIBA 1YR3A 2PSDA 1WTAA 1JG1A 1R3UA 2ZE6A 3I32A 2X58A 4OXNA 2OHIA 3FUWA 5JAQA 3GFPA 3OX2A 4UHDA 1C8BA 2UVPA 5A04A 4DCMA 2NNLD 4A27A 1VGQA 2ZSUA 1DDOA 3BKXA 3IALA 4Z3KA 1PV4A 4CGZA 4DT1B 3KUDA 1BVHA 2HCBA 2OXIA 4AAYA 5LQJA 3KIPA 5I9TA 3O3CA 4KN6A 2H4ZA 4TL7A 1J0BA 2UU9B 5AI0A 1VLQA 2VRBA 3ONFA 1N7JA 4HTAA 3DVAA 4B6FA 4TYQA 2PA0A 1H23A 1X7ZA 3HBLA 1UXOA 2J0EA 1SXQA 1VI6A 5G0TA 2NU9A 2L2QA 2GK7A 4RF4A 3N8KA 1R0YA 4DBZA 3URKA 3MWDA 2HGZA 3TLGB 5CJJA 3LT2A 3CTPA 5BMVB 3ZHBA 4AMGA 4CI0B 1RNLA 1I2ZA 1C2YA 1JIUA 1P9OA 1HYHA 1TL7C 1XLUA 3FGNA 1PTJA 2AX3A 4P7JA 4RDCA 5HE8A 4DMKA 4IGEA 5C2JB 4MHTA 3QYAA 3DHWC 1ANKA 4D26A 3HRHA 4E5YA 4B3SB 1JWLA 4Q05A 4PG4A 4GOXA 4X91A 2IELA 2ILTA 4F4HA 1JDNA 3OF2A 2OE2A 4YRLA 5JFGA 3TJRA 2AUTA 4S1OA 1IMJA 1DKMA 3MBKA 1ODKA 4Q39A 3SKYA 4RSMA 2BGJA 2W6PA 1P9NA 1XZCA 3RSCA 1QPZA 2JCBA 3DE4X 4EUFA 3B7WA 1RKBA 1CKEA 1O95C 3LUFA 4HNSA 5C1OA 4CIWA 2QEQA 3A4IA 4IDOA 5ALOA 4LF9B 4BIMA 4FBMA 3DOOA 5TC4A 1R5JA 3OM0A 3W3AA 4RMHA 4DQLA 2R7KA 1RJWA 1ULHA 4XUEA 1TMGE 2QENA 4FYVA 2E4WA 3NM5A 1J0DA 2QRJA 4L0DA 4MIEA 5EA2A 4YXWD 3UWKA 1H2EA 1VG0B 5DTRA 2R6AA 3WBFA 3B9BA 2AFIA 3NNSA 1CIPA 1UMCB 4UHJA 1TYBE 3TRHA 5IABA 4MW5A 3ETNA 2I3ZA 5M29A 1FJHA 2AD5A 2VC2B 2VNKA 3TVTA 4CYMA 2FDCA 2W43A 4PYMA 4ZOLA 1QQ6A 5GPBA 5T67A 1D5CA 4TQ9A 2WKWA 3W9SA 1SQSA 1ZFNA 3OQIA 2RSLA 3KEMA 2AFHB 2OK7A 2Q4DA 4TZKA 1A04A 1K7XB 5CFZA 2Q2QA 3T3MB 2F1JA 1MXHA 1T13A 3W5UA 1N78A 1BSVA 2MR5A 3KKMA 3KU4A 2GD0A 3WMRA 2FGKA 3MF4A 4G5FA 5B55A 3HYNA 2VBGA 4J0CA 5DEIA 3ND5A 2EFCB 5C5DA 3MJEA 4B4VA 2XUZA 3DA8A 1OXSC 2QU7A 2C3PA 3ND8A 4FZJA 4LDPA 5FT9A 4DQVA 1SCUA 3F5FA 4F45A 5KYTA 4JYCA 1O6FA 2PZGA 4KLRA 1V26A 2XMCA 4NR0A 4DYVA 5IJWA 2C2YA 3V32A 1FRVA 4QXRA 4MTCA 3PXDA 2D5CA 1JGTA 2Q5QA 2A1TS 4WXRA 3WSTA 1GGMA 4MPTA 5EC8A 3WWDA 1MXFA 4GVXA 5TMEA 3E03A 1N2JA 1ZCFA 4YP0A 2B8TA 5EE9A 1WE2A 3CW2A 4WL0A 3BHIA 1ESMA 3JYPA 3P71T 3PA8A 4ME6A 2AN3A 3DBHA 5K20A 2L42A 1F4VA 1C4XA 3BMOA 3T3GA 1EDEA 2J1LA 1CUHA 1QB7A 2XYRA 2APJA 2XUAA 3ZDQA 4CF7A 2MTBA 2O6HA 5EVJA 3FHTA 1TJPB 1JE1A 1LNZA 1R0BA 2Q3DA 4KH1A 1E3WB 3IO5A 3NHBA 4UXJA 1WCV1 1RCUA 3ZGZA 1JHPA 4DR1B 3L8CA 3SEQA 4Y6OA 2NZVG 3JWPA 3NIWA 2GOYA 3ZWYA 1GADO 4O3FA 3URMA 4EHAA 2V7QD 1IY2A 4L73A 4MROA 3TSYA 1MFZA 1E98A 1GKLA 4U6QA 1ZNXA 4MQFA 3LSTA 3I3SR 4QXPA 5JZMA 2QJWA 3W1EA 4QJ4A 5A3JA 3CCBA 4PAOA 4CKEA 4EABA 5HKAA 3L6BA 4R1SA 5FO1A 3RRFA 3WQRA 4AZ3A 2QRQA 5DX0A 5E4TA 3QUTA 4KVAA 1UPFA 3LQQA 5AQ1A 1DQPA 3BE5A 3CBGA 3K8OE 3O82A 2HPAA 5BUCA 2JJ1A 3BEOA 4E94A 1ZNWA 1HNNA 5F9HA 3B12A 2A57A 2PBLA 1V8OA 3Q85A 7REQA 3A4MA 1LI5A 4CNBA 3MIIA 3FIUA 3D4OA 2ZPUA 2P67A 4YECA 4LECA 4U2CA 5E6SB 3OTWA 4AG6A 1RD4A 1GSIA 3HO8A 3VPAA 1MPXA 3K9GA 3QFFA 5AI5A 4PLTA 1NSTA 2YRXA 2VSYA 1I3LA 1DIRA 2BHSA 2HA3A 4V0SA 2Y99A 4RVUA 1U8CB 1A2QA 2XB4A 3HEBA 3QP9A 4M46A 3HJNA 3QYFA 1OW3B 4QT0A 1ZUHA 5IT4A 1Q11A 3GMSA 4BO2A 1X19A 1B3RA 5ELXA 1AD2A 1R66A 3AYXB 2E49A 2JLXA 1AZLA 5TGDA 4FUTA 2GAOA 3WLRA 1NP6A 3TZQA 4BJHB 1P1FA 3OPYA 1DZIA 1HDGO 1OX4B 2QTHA 3MWJA 1FW8A 1HE1C 3LC0A 4RESA 3EDMA 4C4PA 4DCCA 4DC0A 2HPHA 2WWIA 4NZ9A 4WY2A 1JU3A 5CVUA 1DKNA 5JRJA 5MN4A 4MW7A 5JEEA 3GLRA 4NWIA 2O7SA 3TLAA 2IBTA 4QUAA 2AD1A 1NXVA 1R18A 3E7WA 3L8GA 4CIYA 1N5MA 4JC8A 5LYJF 4WJLA 3LX6A 1BFDA 2AF3C 2XXAA 4IDCA 1WPXA 2R5FA 3UB2A 2Y1EA 1PIWA 2CKDA 1XA4A 2KE5A 3DDNA 3ZBQA 4IIBA 4OSOA 3ZDAA 1DWQA 5FQOA 4FMBB 1OOEA 1REQB 3JTEA 2CXUA 4G0NA 4A8JC 3EXG1 2HM7A 1WY5A 4P33A 4EMTA 2IVZA 3BWMA 5JTUA 4HDRA 5CB4A 3AJ8A 4QODA 2HNKA 3BFXA 4TXMA 2PK3A 4UCXA 3AZQA 2JFVA 3EDYA 2O05A 2H2AA 3AEZA 3ITNA 4UFPA 1BCSB 3HNRA 4Z49A 2GZSA 4G1BA 2B5OA 2YOHA 1SOUA 2VNSA 3T7EA 3V9PA 1VC2A 1GNPA 2M6KA 2M1ZA 1BQEA 3VZCA 4WXMA 1NXTA 3DFMA 3LS2A 1TUGA 4MEJA 5FAKA 1INLA 2A9KA 2I99A 3JQGB 2IU0A 5CHYA 1MX9A 5DHUA 5FL7A 4AJ1A 3H11A 2WF9A 3LLCA 1EQAA 5GP1A 2QBYA 3U4GA 1TK2A 4HPJB 4OP2A 4F38A 1SCKA 3BZUA 4MWGA 5AM4A 5E9JA 5H4HA 1RCTE 4KVZA 3ENQA 4BMPB 2B5VA 1MABB 4P0TA 4WXEA 3SXUA 1QVZA 3SBEA 4IV8A 3EXHA 3NONA 3O93A 3KCNA 4XRRA 2JRCA 3EZ2A 3GDFA 1T9KA 2GRJA 4F8JA 5KTOA 3IUJA 1YJ5A 1EXNA 4BE4A 1X2EA 3V7FA 4PYQA 5B1YA 3NX4A 1CC1S 1R0ZA 2RGNA 3R0ZA 5F4BA 1SBQA 1C1YA 1DQZA 1YDMA 2Z3VA 3EIOA 3A10A 3RIGA 2DR3A 2JI7A 4I36A 2C58A 1P7VA 2YN2A 4C0BA 1NNEA 3UTDA 1UFKA 4PAWA 1ODIA 4FC6A 1L3BA 3O4FA 5AW0A 1X7GA 1WXDA 4AJIA 5JROA 2B2XA 4R1UA 4IZOA 4NENA 4H4DA 3KCQA 3ZVKA 2QMZA 2EGUA 2ZGVA 3GA0A 4EKDA 4NYMR 2IEGA 2WAXA 2C83A 3GFQA 2MSDB 5H3HA 1KEEA 3MC1A 2HIGA 3VV3A 5BR1A 1Z35A 1WU7A 1OF1A 4TTSA 2CT8A 1MCZA 3OZGA 4QBTA 6REQB 2OV4A 3MMSA 1DAKA 2BFPA 2EZ8A 5K0GA 2UUBB 5KNDH 2BFEB 4WOPA 3ZGOA 3CT6A 2CUTA 1D0IA 1JKMA 1WMFA 2DLCX 4UAJA 1PJ3A 2ZS7A 5REQB 3PDIA 2XB6A 5C3UA 5K1SA 5TJ9A 2GEBA 3TB6A 1ID8A 4WLOA 4F60A 1MF7A 1NUUA 3H1TA 1UWLA 2F67A 1PFQA 3GVHA 3PUVA 1OMOA 4KQCA 1C0KA 2OV3A 4L9WA 4A0SA 1DQSA 2YVQA 3W1VA 2WKQA 1XMOB 2PRYA 1R0KA 1G8JA 4D8WA 3TLMA 1FQOA 2X3UA 3Q6NA 2PL9A 3IJ5A 4IIJA 1GO2A 2JLQA 2W93A 1WL8A 4KXUA 4RPIA 3HYLA 4ECEA 2Z3WA 1NF9A 4QL3A 1CR6A 4BFCA 3IE2A 4OHBA 5F7XA 2GK3A 4FOLA 1WQ4A 1JEAA 2Q3EA 3TZKA 5KYXB 1EX6A 3FCOA 1Z0AA 4PNZA 1MG5A 3R9XB 1ISJA 3P2KA 1NBOA 4V39A 3DEIA 2GUGA 3IVAA 1HSZA 5TEVA 2O5CA 1KY5A 4PM4A 4AXXA 3L5OA 2V0GA 1JPNA 2AMLA 2JIOA 3SZRA 5AW4A 1W5AA 1OYWA 4NV3A 4JJKA 4ZD6A 1JT2A 3PQ4A 3HB7A 3SM3A 1VLLA 3DL7A 1L5NA 1G5FA 1GNQA 4J0IA 2CNDA 2HEIA 3QKWA 4MLCA 1F1JA 1KQGA 4DV4B 3QEAZ 2JAXA 5KDDA 1AS2A 1G3IA 3PK0A 2AQHA 4OQQA 4AQ7A 1JDJA 3AVTA 1DO2A 2DH5A 2NQ8A 4N1AA 1B00A 3B48A 4LI3X 4UM7A 5A03A 2HRRA 1LF5A 4FI3C 1BROA 4Z53A 3QBDA 1RM0A 4R4JA 4AY5A 4RKFA 2O20A 2DXIA 3ZGYA 4RDXA 5AQEA 4LOIA 1FYDA 1BXGA 3EG9B 4NKRA 1SIOA 2R68A 2Q8NA 2AMYA 4DLZA 3P0IA 2BMWA 1RWMA 1RM5A 4IS2A 3RODA 1E5QA 1I33A 1QYWA 2E5WA 3AH8A 2QR5A 1J5XA 3IVCA 4OHUA 1D2GA 4EYQA 2JFXA 5FUBA 1NE2A 2OP1A 1FNMA 1G2IA 3JASA 3R41A 3DPIA 4HLNA 4U6SA 5LIPA 2AWNA 1NUHA 2I34A 4RKQA 3S2FA 5LP6A 2ID9A 3ONDA 1ZOLA 4GYWA 4YALA 1FFYA 1QFZA 1U3TA 1ZH4A 1PW7A 4XUCA 4QUIA 1R3DA 2CWWA 1C0IA 1N6RA 3D4BA 2D00A 4R1PA 2D1FA 1PHPA 3NG1A 4NV0A 3VGJA 3WMGA 2P79A 3E5RA 4DLTA 3VO9A 2PL3A 1DXOA 2B7CA 5HR5A 3VH3A 4ENTA 4EPXA 4DM4A 1NRJB 3LT0A 3RYIB 2H31A 3PQEA 2A5GA 4LN1A 5JYDA 1QG2A 1QR2A 3VKGA 3H2BA 4M8LA 3IUPA 1SXJC 4ND4A 1NLYA 4CI9A 1JU4A 4I3FA 5IBCA 1JRLA 1R6BX 4BV3A 1L5RA 1UDCA 1WPQA 1C7JA 2VHYA 1ZLXA 1YRQA 2O8NA 3AQ4A 1AZSC 4JQOA 4MWSA 4O4LA 1ZHFA 1XP5A 1OXXK 5LLSA 2J7KA 3BS4A 1T6ZA 4RLSA 5IVPA 4CG2A 3JWIA 3ZC3A 2B6NA 3RJZA 1KMQA 4YCSA 1D4OA