2VCZA

Complex structure of prostaglandin d2 synthase at 1.95a.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vczA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vczA01
1ZMAA 2B3SA 2VL2A 1M0UA 5FWGA 1O85A 4MPGA 5H5QA 4DSRA 3EINA 2L5OA 4K0GA 3CSIA 5H5RA 4EL1A 1TRWA 4PQ1A 1GSQA 1BG5A 3QAVA 2H6XA 4ECCA 2D2ZA 5IOWA 3F4TA 2B1LA 4Z7XA 2VL9A 2KLXA 1QK8A 3TOTA 2P5RA 3FEUA 1XWAA 5F07A 3IXRA 1AXDA 2I9HA 1XWBA 4MK3A 1EV4A 2CAQA 5JCUA 4TXVA 4XCSA 1V58A 4ISDA 3PR8A 4KNDA 3WD6A 3SWLA 2HE3A 3UVHA 5IMZA 4TOPA 1ML6A 3LQ7A 4HOJA 3LYKA 2DJ0A 2LJAA 1O81A 4RUVA 1HYUA 3APOA 4DVCA 3M8NA 4K0NA 4FYBA 4ZL7A 5J4UA 3KMOA 2MMNA 5D9TA 3QFAC 2FNOA 3A2XA 5DAKA 2BTOT 3TKSC 4PNGA 3DMLA 1K0OA 1YDKA 2G2QA 5ECPB 2CT6A 2VCQA 4HU9A 1SENA 4O32A 5HR1A 1M2BA 3M3MA 1XWGA 4HU7A 3M1GA 3GX8A 1AQWA 3KTBA 4NV2A 3W8JA 3FK8A 4OD7A 2XBIA 3UARA 2IMDA 2MYGA 3GX0A 1XW6A 2V2GA 3L9SA 5G1KA 2A2RA 2YV9A 2H72A 2GT6A 1GSDA 3L4NA 2WJUA 4Q5FA 5D73A 1Z7PA 4G0KA 4MF5A 3HYPA 3IK7A 4NXIA 3F3QA 2X64A 4GSNA 1GL8A 4BVXA 2JZTA 2E7PA 1FAAA 5GZZB 3L0HA 4I5QA 1JZWA 4KDUA 3C7MA 1PQNA 2HRKB 3WT2A 2HI7A 2KP2A 2M72A 3TKRA 1GH2A 3ZMLA 3DXBA 3Q6OA 11GSA 4JRRA 3FYGA 1GLPA 4PNFA 1OC9B 1Y25A 2QC7A 1V57A 1JZRA 4X0XA 2C8UA 3IC8A 1MDKA 1NM3A 2H1GA 4GRFA 1PRXA 5J5NA 3TJFA 3TGZA 4GSTA 3LXTA 3IBHA 5F0GA 2H0GA 5JWQB 3GTUA 3J7Yk 3A2VA 4AJ7A 4IS0A 4ZBAA 2PGTA 3Q19A 1B4PA 1EWXA 2YWOA 5HFKA 4I6XA 5CRHA 1EGRA 3I69A 4LL4B 3F9UA 5JWRB 3FZ4A 3F4SA 5IOXA 3DEXA 1BAYA 3PH9A 1ZYEA 3GH9A 1TOFA 3ERFA 2B1KA 3MNGA 1FVKA 1VF4A 3GSTA 3CXGA 2VM1A 2CV4A 3H1NA 4HZ2A 3D4MA 2H74A 4Q5QA 3U6VA 3IC4A 2ON7A 4ILFA 1FHEA 5IIZA 2R6KA 4NAXA 1ABAA 1X9WB 3L9UA 1XWKA 2C3NA 1SJZA 1G7OA 1JHBA 4N0VA 1A2LA 4IP1A 1SD9A 3C73A 3TKPA 1YKAA 1DUGA 3W6GA 2EIOA 1OAZA 2L59A 5DALA 4J2FA 1XZOA 3RPNA 3VI5A 5IM9A 3HJMA 1TK0B 5JCWA 2VD0A 4ZBBA 2OBIA 3TJGA 1WOUA 18GSA 2WB9A 4K9ZA 1G0TA 4WKWA 1UN2A 4IN0A 4N30A 4LMVA 4RI6A 3US3A 1AW9A 3VWWA 2CA8A 2I4AA 4KDXA 4FYUA 1ZCPA 2IJYA 2DJ2A 3R3EA 1R7HA 2HYXA 2PUKC 4XS4B 1JFUA 4LLRA 4YQVA 1R5AA 3IOSA 1IYIA 2FWFA 5A4WA 3DIEA 3QAWA 4RQRA 1XPVA 4EO3A 3WT1A 2C3QA 1XXUA 1G6YA 3VWUA 1K0CA 4G2EA 4OCFA 2RM6A 2GZPA 4TR1B 3DYRA 2GQKA 2CZ3A 1VRSD 1Y6EA 1S3CA 2VL2C 1XBSA 5G5EA 3D4TA 2DC5A 4MJEA 3P90A 3PPUA 3SBCA 1A8LA 3GFKA 1FB6A 2GDRA 3RDWA 3VWXA 2CVKA 8GSSA 1BEDA 1DE1A 4ML6A 10GSA 4MJBA 4XS1A 3KM6A 1V2AA 2K9FA 2H66A 2IMIA 4JU5A 3NZNA 1V9WA 5HR3A 4KDYA 2TIRA 3LGCA 4MJAA 1PKZA 4MLYA 1PMTA 2V6OA 5IMVA 2H1AA 3LEFA 4HQZA 2HNLA 2KOKA 2GT5A 2HZEA 2HZFA 2LNTA 1Q4JA 1MDIA 2X8HA 1H4OA 3C1SA 4QQ7A 5IO2A 3KD0A 4HDEA 2H30A 2MMOA 2DIZA 2F9SA 3ZTLA 3A5WA 3ZFBA 4PUFC 2DJ3A 3GL5A 3R2QA 1AC1A 2HRNA 2IN3A 1X5DA 2RUEA 1T4ZA 5D9WA 2J9HA 2K6VA 4DSSB 4MZBA 1I9DA 1PA3A 3UOMA 1W4VA 3TRXA 2YANA 5A4UA 4TN8A 1EGOA 1SJIA 1TK5B 2H01A 3TKQA 1QFNA 1A8YA 1HNCA 2ON5A 3ERWA 3V1WA 1TRSA 1B4QA 2C0FA 4BL7B 5JWOB 5ECNB 2AUVA 1XOAA 3VPQA 3ZIJA 2M46A 3D22A 4KW6A 2VOCA 1NHYA 4I8BA 2C0DA 4EE0A 3IRAA 3W8SA 2X99A 1B48A 3NOFA 5D9VA 4MH3A 4N0ZA 1EP7A 14GSA 3EC3A 5FHIA 4JE1A 5F05A 1OYJA 5FT3A 1O6JA 2XPDA 2M80A 3C8EA 3WGDA 2G0FA 1WRYA 5GAPD 2JZSA 3IHQA 1HNAA 2FHEA 2PWJA 1EZKA 2LTKA 2H75A 3FZAA 1YEPA 4PQHA 1UA5A 2XBQA 4KUNA 2OA7A 3KTLA 5IPHA 4GF0A 3PINA 1PX6A 3TB2A 4PURA 2DJ1A 2GLRA 1Z9HA 1E2YA 3KIJA 1O8XA 5GSSA 1FB0A 3QR6A 2V32A 1QMVA 2YNXA 2C4JA 3ZLPA 2GZYA 4K2DA 2WRTA 2H71A 4TR4A 5C04A 4GCIA 5GAND 3K8NA 1LU4A 1TW9A 3A2WA 4BVYB 4TVEA 1IYHA 4MMMA 1GUMA 1F2EA 4IQAA 3CBUA 5KN0A 4G19A 1XOBA 1RQMA 3BD2A 1SKSB 3HVVA 2REMA 2IPAA 2VCTA 5KEJA 3LFLA 1EEMA 2IWTA 5JCGA 3I43A 3ZVJA 5A5KA 2PVOC 4XRDA 4PTSA 4XRAA 3TJBA 4XHMA 3P2AA 4ZIJA 1J9BA 2WDUA 3TKSE 2VLVA 1JLWA 1RW1A 3IDVA 1ERWA 2GSSA 2AYTA 5ECHB 2NVLA 4OFMA 2O87A 1X5EA 4KF9A 3F8UA 3EURA 5L71A 1USBA 1Z5YE 4CHSA 2WZ9A 5HFGA 3PGTA 2MMAA 3A3TA 4WETA 3HJPA 4MPFA 3QAGA 1T00A 3JCML 3UBLA 5D8IA 5CREA 1OC8A 2L4CA 2FD3A 1KNGA 1YF1A 2I3YA 2DIYA 2I81A 2IIYA 3FZ5A 2IMFA 1A0FA 1GTBA 2LJRA 3QCPA 4YAVA 3HZ8A 1AQXA 3GNJA 2R3XA 4K7NA 4J56E 1FVJA 1Z3EA 3TJJA 5EVOA 2YV7A 2FUG2 1YZXA 1F9MA 2NPBA 1ILOA 2IL3A 3HHVA 1T8EB 1Z6MA 1XW5A 3HVSA 3VWVA 4HQSA 3UJ1A 2JACA 4CW9A 1NHOA 1WP0A 4GQCA 4CDOA 5AIXA 1EOHA 4K7OA 4JR6A 4RQXA 1XIYA 4WBJA 4JR4A 5IQYA 1NW2A 3GYKA 2JL4A 2F8AA 4FO5A 2UZ8A 2V6KA 3O6TA 4V2MA 4AF2A 4F82A 3ZL5A 1I5GA 1ERTA 3UMAA 4IKHA 1T7PB 1GNWA 4ECIA 2CVBA 1GWCA 2HSMB 4RI7A 4KB3A 2K8VA 1AUCA 2OE3A 3EMPA 2PPTA 1ERVA 3H93A 2C3TA 5J41A 3QD9A 5IMAA 2K18A 3TUEA 3EU4A 4IJ3A 1K3YA 3IR4A 1GSUA 5ECIB 3E9JB 2DSAA 3GN3A 2O8VB 5F8BA 3M9JA 1SL1B 1EEJA 2VCXA 1N8JA 2LUSA 2L57A 1UC7A 1WWJA 5H5SA 1GSEA 3ME8A 5ID2B 1UVZA 3CSHA 4OWYA 5HR0A 1GNEA 1SK1A 1ZZYA 1QXHA 4HZ4A 3DVWA 2HRKA 4MF7A 3HXSA 1THOA 4MA9A 2FWGA 2VLTA 2YZHA 2IFQB 3I6AA 1LJRA 1W89A 5ECQB 5DJLA 2OACA 1GTAA 1OC9A 3ZZXA 1OE7A 3BBYA 1ST9A 4AJ6A 3KH7A 4FH8A 1KBNA 5HQPA 1TXXA 4V2NA 4ZB9A 1RK4A 4NHZA 3D21A 2MBSA 1G6WA 3F6FA 1XWCA 3GA4A 1OKDA 4L5OA 2EC4A 1WIKA 3HA9A 2O89A 1OE8A 1GSFA 4D73B 1XW9A 1ZYQB 4KAEA 5IMCA 3QMXA 2ES7A 1PL1A 5ABRA 4MZWA 4YH2A 1DSBA 3LJRA 1G7EA 3IE3A 1YF0A 1J0FA 1Q98A 3RHCA 4O5RA 5IMFA 1BJXA 2CVDA 1B8XA 4NMUA 4TW5A 4XIHA 1GUHA 4J57E 3ZRDA 4EC0A 2GVPA 4L8EA 4O7HA 1PD21 4MF6A 1JZOA 4IQ1A 2LRNA 2E2GA 5KN1A 4ZILA 2L6CA 2YP6A 5ID2A 3EMXA 1WMJA 4F03A 2VLUA 1SL2B 1PSQA 5CRGA 2HRFA 2PVQA 2V41A 2GZZA 5D93A 2JSZA 3BCKA 2KHPA 2CQ9A 3KH9A 2LS5A 2IFQA 2N5BA 2YWIA 1AAZA 1KEBA 4EKZA 4G0IA 2NBSA 4N10A 2YJ7A 3ZMKA 2HSHA 5ECKB 3F63A 1O73A 2TRCP 1GSSA 1JZDA 2DJJA 2B7KA 1A2MA 3F3RA 3DVXA 2C80A 1URMA 2P31A 1SD8A 3UBKA 3TRPA 2R37A 2RLIA 4MZCA 3GURA 1OVNA 2PMTA 2LNSA 1Z6NA 3O3TA 2WGRA 4L0WA 3L9VA 1K0MA 3FZ9A 4H86A 3GKMA 3UVTA 2C0GA 2R2JA 1GRXA 2N5AA 3APQA 4BA7A 3Q74A 4XS4A 2H1DA 3ZYWA 4P3YB 4IJIA 2H1BA 4G0LA 5DVBA 3QDNA 3KCMA 5ECMB 5CO3A 2H19A 3WGEA 3G7IA 3KEBA 2CAIA 4I97A 1QGVA 4POBA 1F37A 1DBYA 4ZL9A 4KCEA 5G5FA 4JEDA 2XC2A 3D0ZA 4MJCA 2RM5A 4IELA 2VCZA 2B5XA 3H4KA 4NHWA 4IP6A 4F0CA 6GSUA 4TR1A 2OBKA 1T3BA 3NIVA 3ME7A 1F3BA 1M9BA 3EU3A 1A0RP 3DRNA 5GSTA 3HVXA 2Z9SA 13GSA 4TRXA 2XHFA 2I1UA 4K7IA 1U3AA 5EL8A 2B5YA 3LORA 2K8SA 3HKRA 4O92A 3EYTA 1YQ1A 1U6TA 3S9FA 1PGTA 3CSJA 2ALBA 2LEGA 2H76A 4V2LA 1MD3A 2LKUA 3UL3A 4PXOA 4IW9A 1AQVA 4YQUA 2V1MA 2N5FA 1FO5A 3WYWA 2L4QA 3BOAA 4PX1A 3H79A 1TU8A 5AISA 4HJ2A 3N5OA 4OCEA 3VFIA 3E3EA 1K0BA 2J23A 2F51A 2C0EA 1T4YA 5LCZA 2YN1A 2A4VA 4OO4A 4ZB8A 1BX9A 5B6MA 5DAKB 3HD5A 2MMZA 1M99A 3M0FA 1ZL9A 3FRCA 4IBPA 5B8AA 1VGLA 2ZCTA 5J3RA 3O76A 2DLXA 1M7TA 1EV9A 4QL7A 4TKYA 5LD0A 1R4WA 4ULXA 3IK9A 2X8GA 2KUCA 4K8MA 1GUKA 5DBQA 3TCOA 4Q5NA 2HLSA 3CRTA 3Q18A 4PGTA 1FOVA 1BQ7A 3F4RA 5IO0A 1NSWA 1WPIA 4LL1B 1GTUA 3E0UA 3KJYA 3FR6A 3LYPA 2LSTA 3CYNA 5C00A 1S3AA 1PN9A 4DSSA 2ZUPA 4PUAA 4HS1A 3H8QA 3ED3A 1EOGA 4OO5A 5CYYA 22GSA 3G7YA 5AN1A 1A23A 4LMWA 2B7JA 4F9ZA 1TP9A 3KP9A 4ZBDA 2GSTA 3OR5A 3FW2A 2HFDA 1K3LA 4ZL8A 2DJKA 3D6IA 3GH6A 4BL7A 1M2DA 2B6MA 2E2MA 2H8LA 4NPBA 4MP4A 3QFBC 4EDYA 1U88A 4EVMA 1ACVA 5INYA 4BVXB 3IAM2 1SKRB 2CX3A 3TRQA 2HSNB 3KP8A 2GQLA 2FA8A 4WF4A 2OJLA 2O7KA 2YCDA 1SYXA 4GWRA 5G30A 3D5JA 2JSYA 4USSA 4EF0A 1JLVA 5KN2A 4POLA 1HNBA 1MDJA 6GSXA 1XFLA 2GS3A 2IMKA 2BJXA 3MDKA 2H70A 3QPMA 4MH2A 1VF1A 3MWHA 1VF3A 4ZB6A 2OE1A 3G7JA 1Z7RA 4PQIA 4KSOA 4WBRD 4XS6A 1OC3A 3ZFLA 3GTUB 4POKA 4POMA 1TI3A 2X8CA 2KP1A 4BPYA 6GSSA 2FWHA 2C1YA 3HCZA 2GGTA 2HRAA 2CZ2A 2F8FA 1X5CA 17GSA 4BWQA 3ZITA 3CTFA 4V1Ag 2FA4A 5AIVA 1WJKA 2FGXA 4X1UA 4ACSA 3P7XA 5ENUA 3HZ4A 4QL9A 1F6MC 2VO4A 4JBBA 2VL3A 2FY6A 2E0QA 3N9JA 1XCCA 3UAPA 3TOUA 2HT9A 3FY7A 2VD1A 1AIUA 4BVYA 4MCUA 2JADA 2YOIA 1MD4A 2OADA 4KX4A 5D96A 3LSZA 4F0BA 1TRUA 1C72A 4G9HA 1TI1A 1QUWA 5G2ZA 3RHBA 5COHA 1SK2A 3BCIA 3GV1A 1X0RA 3VK9A 1O7UA 1ERUA 3APSA 5DJMA 2A2SA 1PKWA 5B6NA 2HQTA 3ZVJD 4KCAA 2RIIA 4OMVA 2YJHA 5DALB 2BMXA 3WGXA 3IPZA 4EXJA 3DWVA 2VCVA 4X43A 3KGKA 3QOUA 7GSSA 4FIWA 3CMIA 1GLQA 1K0AA 1VF2A 1F3AA 4ML1A 3L78A 1SKWB 1TJDA 3AY8A 1CQGA 2WFCA 4YQMA 2OE0A 1SYRA 1DE2A 3GMFA 4MABA 3TDGA 3ZIVA 1K0DA 1MEKA 5J9CA 3VPTA 4KGIA 2P0GA 3F6DA 3ZREA 2OKAA 4WR4A 6GSVA 3EE2A 3M9KA 3U5RE 4TXOB 1SK0A 5F06A 2EIRA 3GSSA 3TKSA 1QQ2A 16GSA 2H0HA 1U87A 4KA0A 1GTIA 1TU7A 2HSYA 3CTGA 1KTEA 4DEJA 3F0IA 3LG6A 5B7CA 4ECBA 4Q5RA 5G1LA 4I2UA 2H6YA 4GTUA 3FKFA 5ECLB 2YWMA 2LQOA 2QGVA 4G10A 1PL2A 5DCGA 2R5GA 1XVQA 3RAZA 4TR0A 4IGJA 1BYEA 2XPEA 5EPFA 4I2TA 2GQMA 3DGQA 3MAKA 1R5PA 4WXTA 4WF5A 5IPGA 1YEXA 2L6DA 4AGSA 1K0NA 4FYCA 3IV4A 5E4WA 5E59A 5G31A 1N2AA 3J7Yb 3C1RA 1THXA 2HSMA 5J9BA 1E6BA 4ECJA 1WE0A 1J08A 1YY7A 4L0UA 1LBKA 5CAXA 3UEMA 3G9BA 1PX7A 6GSTA 3FR9A 1GSYA 5IMDA 4OFTA 4HUAA 1O8WA 4E8HA 3HY2A 3HJOA 1X9SB 5B8BA 2HZEB 4ZXGA 2AHEA 1T1VA 1V40A 3VLNA 1SJ6A 2GSQA 3GHAA 2AJQB 1S3DA 3KZQA 2VUPA 2PBJA 3ERGA 4K6XA 4N11A 1HQOA 2H6ZA 2F3MA 3FR3A 3GL3A 3ISOA 1X9MB 4TXOA 5CNWA 4GQFA 4KE3A 4XTSA 4NWYA 2LV3A 5KN3A 5D9XA 4TR3A 2AB6A 5ELAA 3C71A 2MZCA 5A4VA 2JU5A 2VAFA 2QSIA 3RPPA 1HD2A 2DBCA 2FWEA 3KMNA 4OFNA 1SU9A 3IA1A 2PERA 3GRXA 4DSQA 2HXKA 3BJ5A 2CX4A 3GUSA 5ECRB 1EP8A 4F2IA 4KSMA 4V1Ap 1SL0B 2LJKA 2DMMA 2YZUA 1GP1A 3KXOA 4HEA2 3MSZA 3GKXA 1TDIA 3CRUA 3P8WA 4K1FA 4NV5A 1V98A 3RBTA 3VURA 2EIQA 4JZQA 2JZRA 4FQUA 2FCHA 3EVIA 2YPMA 4D73A 2VIMA 1XVWA 5CP1A 20GSA 2RUFA 2TRXA 5AGYA 5EY6A 4KH7A 2LRTA 3FHKA 9GSSA 1CQHA 2AAWA 1TTZA 2WCIA 1A2JA 3GKKA 4HJMA 1FW1A 3LXZA 5LNKe 4LA1A 4MDCA 2WULA 1H75A 3IAS2 2O85A 4IVFA 2YWNA 4EUYA 2LRCA 1YJ6A 6GSWA 2H0IA 4BWSA 2DMLA 2AV4A 1R26A 5HFIA 2H73A 2R4VA 5DQSA 4AJ8A 1TRVA 5DCHA 6GSYA 5CRWA 4EDZA 4WEYA 2B5EA 5ECOB 2LQQA 4E8EA 1GULA 2MBTA 2WS2A 4ID0A 5DDLA 4GXZA 4WR5A 1TKDB 4YAPA 4GSSA 2QKEA 2PN8A 2ZNMA 1A24A 19GSA 2PU9C 3I9V2 2NDOA 3HDCA 1M9AA 3DD3A 3UIWA 2GSRA 3LWAA 1TK8B 5DQYA 1B9YC 3EWLA 3DKSA 2P5QA 2VM2A 2VCWA 5CRDA 1OKTA 1K3OA 1M2AA 4GLTA 1FG4A 5BMUA 1ZGNA 2IMEA 12GSA 1ZOFA 2NTOA 1MTCA 1ON4A 4HI7A 2FLSA 4L5LA 4IHUA 2L5LA 3GKNA 5HR2A 1U3IA 1YKCA 3GIXA 5ELGA 5ECSA 3TJKA 3VI7A 1B9XC 2GTUA
chains in the Genus database with same CATH superfamily
1ZMAA 2B3SA 2VL2A 1M0UA 5FWGA 1O85A 4MPGA 5H5QA 4DSRA 3EINA 2L5OA 4K0GA 1SVOA 3CSIA 5H5RA 4EL1A 1TRWA 4PQ1A 1GSQA 1BG5A 3QAVA 2H6XA 4ECCA 2D2ZA 5IOWA 3F4TA 2B1LA 4Z7XA 2VL9A 2KLXA 1QK8A 3TOTA 2P5RA 3FEUA 1XWAA 5F07A 3IXRA 1AXDA 1S4BP 2I9HA 1XWBA 4MK3A 1EV4A 2CAQA 5JCUA 4TXVA 2VKZG 4XCSA 1V58A 5A34A 4ISDA 3PR8A 4KNDA 3WD6A 3SWLA 2HE3A 3UVHA 5IMZA 4TOPA 1ML6A 3LQ7A 4O5QA 4HOJA 3LYKA 2DJ0A 2LJAA 1O81A 4RUVA 1HYUA 3APOA 4DVCA 3M8NA 4K0NA 4FYBA 4ZL7A 5J4UA 3KMOA 2MMNA 5D9TA 3QFAC 1TXUA 2FNOA 3A2XA 5DAKA 2BTOT 2WZSA 3TKSC 4PNGA 3DMLA 1K0OA 1YDKA 4FXYP 2G2QA 1BG1A 5ECPB 2CT6A 2VCQA 4HU9A 1SENA 4O32A 5HR1A 1M2BA 3M3MA 1XWGA 4HU7A 3M1GA 3GX8A 1AQWA 3KTBA 4NV2A 3W8JA 3FK8A 4OD7A 2XBIA 3UARA 2IMDA 2MYGA 3GX0A 1XW6A 2V2GA 3L9SA 5G1KA 2A2RA 2YV9A 2H72A 2GT6A 1GSDA 3L4NA 2WJUA 4Q5FA 5D73A 1Z7PA 4G0KA 4MF5A 1BF5A 3HYPA 2WVXB 3IK7A 4NXIA 3F3QA 2X64A 4GSNA 1GL8A 4BVXA 2JZTA 2E7PA 1FAAA 2HSNA 5GZZB 3L0HA 4I5QA 1JZWA 4KDUA 3C7MA 1PQNA 2HRKB 3WT2A 2HI7A 2KP2A 2M72A 3TKRA 1GH2A 3ZMLA 4EIPA 3DXBA 3Q6OA 11GSA 4JRRA 3FYGA 1GLPA 4PNFA 1OC9B 1Y25A 3EPTA 2QC7A 1V57A 1JZRA 4X0XA 2C8UA 3IC8A 1MDKA 1NM3A 2H1GA 4GRFA 1PRXA 5J5NA 1SVMA 3TJFA 1SVLA 3TGZA 4GSTA 5KOXA 3LXTA 4K2XA 3IBHA 5F0GA 2H0GA 5JWQB 3GTUA 2EFCA 3J7Yk 3A2VA 3CHXC 4AJ7A 4IS0A 4ZBAA 2PGTA 3Q19A 1B4PA 1EWXA 2YWOA 5HFKA 4I6XA 5CRHA 1EGRA 3I69A 4LL4B 3F9UA 4BIKA 5JWRB 3FZ4A 3F4SA 5IOXA 3DEXA 4ICYA 1BAYA 3PH9A 1ZYEA 3GH9A 4AKHA 1TOFA 3ERFA 2B1KA 3MNGA 1FVKA 1VF4A 3GSTA 3CXGA 2VM1A 2CV4A 3H1NA 4HZ2A 3D4MA 1PFOA 2H74A 4Q5QA 3U6VA 3IC4A 2ON7A 4ILFA 1FHEA 5IIZA 2R6KA 4NAXA 1ABAA 1X9WB 3L9UA 1XWKA 2C3NA 1SJZA 1G7OA 1JHBA 4N0VA 1A2LA 4IP1A 1SD9A 4Z2UA 3C73A 3TKPA 1YKAA 1DUGA 3W6GA 2EIOA 1OAZA 2L59A 5DALA 4J2FA 1XZOA 2R0GA 3RPNA 3VI5A 5IM9A 3HJMA 3LW9A 2X4AA 1TK0B 5JCWA 2VD0A 4ZBBA 2OBIA 3TJGA 1WOUA 18GSA 2WB9A 4K9ZA 1I1IP 1G0TA 4WKWA 1UN2A 4IN0A 4N30A 4LMVA 4RI6A 3US3A 1AW9A 3VWWA 2CA8A 2I4AA 4KDXA 4FYUA 1ZCPA 2IJYA 2DJ2A 3R3EA 1R7HA 2HYXA 2PUKC 4XS4B 1JFUA 5KOWA 4LLRA 4YQVA 1R5AA 1N25A 3IOSA 1IYIA 2FWFA 5A4WA 3DIEA 3QAWA 4RQRA 1XPVA 4EO3A 3WT1A 2C3QA 1XXUA 1G6YA 3VWUA 1K0CA 4G2EA 4OCFA 2RM6A 2GZPA 4TR1B 3DYRA 2GQKA 2CZ3A 1VRSD 1Y6EA 1S3CA 2VL2C 1XBSA 5G5EA 3D4TA 2DC5A 4MJEA 3P90A 3PPUA 3SBCA 2EFDA 1A8LA 3GFKA 1FB6A 2GDRA 3RDWA 3VWXA 2CVKA 8GSSA 1BEDA 1DE1A 4ML6A 10GSA 4MJBA 4XS1A 3KM6A 1V2AA 2K9FA 2H66A 2IMIA 4X4JA 4JU5A 3NZNA 5A1NA 1V9WA 5HR3A 4KDYA 2TIRA 3LGCA 4MJAA 1PKZA 4MLYA 1PMTA 1ZYPA 2V6OA 5IMVA 2H1AA 3LEFA 4HQZA 2HNLA 2KOKA 2GT5A 2HZEA 2HZFA 3RGBC 2LNTA 1Q4JA 1MDIA 2X8HA 1H4OA 3C1SA 4QQ7A 5A5HA 5IO2A 3KD0A 4HDEA 2H30A 3HMJG 2MMOA 2DIZA 2F9SA 3ZTLA 3A5WA 3ZFBA 4PUFC 2DJ3A 3GL5A 3R2QA 1AC1A 2HRNA 2IN3A 1X5DA 2RUEA 1T4ZA 5D9WA 2J9HA 2K6VA 4DSSB 4MZBA 1I9DA 1PA3A 3UOMA 1W4VA 3TRXA 2YANA 5A4UA 4TN8A 1EGOA 2OT3A 1SJIA 1TK5B 2H01A 3TKQA 1QFNA 1A8YA 1HNCA 2ON5A 3ERWA 3V1WA 1TRSA 1B4QA 2C0FA 4BL7B 5JWOB 5ECNB 2AUVA 1XOAA 3VPQA 3ZIJA 2M46A 3D22A 4KW6A 2VOCA 1NHYA 4I8BA 2C0DA 4EE0A 3IRAA 3W8SA 2X99A 1B48A 3NOFA 1FOHA 5D9VA 4MH3A 4N0ZA 1EP7A 4E68A 14GSA 3EC3A 5FHIA 4JE1A 5F05A 1OYJA 5FT3A 1O6JA 5BRTA 2XPDA 1S3RA 4W66A 2M80A 3C8EA 3WGDA 2G0FA 1WRYA 5GAPD 2JZSA 3IHQA 1HNAA 2FHEA 2PWJA 1EZKA 2LTKA 2H75A 3FZAA 1YEPA 4PQHA 1UA5A 2XBQA 4KUNA 2OA7A 3KTLA 5IPHA 4GF0A 4MNNA 3PINA 1PX6A 3TB2A 4PURA 2DJ1A 2GLRA 1Z9HA 1E2YA 3KIJA 1O8XA 5GSSA 1FB0A 3QR6A 2V32A 1QMVA 2YNXA 2C4JA 3ZLPA 2GZYA 4K2DA 2WRTA 2H71A 4CY8A 4TR4A 5C04A 4EIQA 4GCIA 5GAND 3K8NA 1LU4A 1TW9A 3A2WA 4BVYB 4TVEA 1IYHA 4MMMA 1GUMA 1F2EA 4IQAA 3CBUA 5KN0A 4G19A 1XOBA 1RQMA 3BD2A 1SKSB 3HVVA 2REMA 2IPAA 2VCTA 5KEJA 3LFLA 1EEMA 2IWTA 5JCGA 3I43A 3ZVJA 5A5KA 2PVOC 4XRDA 4PTSA 4XRAA 3TJBA 4XHMA 3P2AA 4ZIJA 1J9BA 2WDUA 3TKSE 2VLVA 1JLWA 1RW1A 3IDVA 1ERWA 2GSSA 2AYTA 5ECHB 2NVLA 4OFMA 2O87A 1X5EA 4KF9A 3F8UA 2DKIA 3EURA 5L71A 1USBA 1Z5YE 5J47A 4CHSA 2WZ9A 5HFGA 2O3EA 1ZYNA 3PGTA 2MMAA 3A3TA 4WETA 3HJPA 4MPFA 3QAGA 1T00A 3JCML 3UBLA 5D8IA 5CREA 1OC8A 2EFHA 5J4YA 2L4CA 2FD3A 1KNGA 1YF1A 2I3YA 2DIYA 2I81A 2IIYA 3FZ5A 2IMFA 1A0FA 1GTBA 2LJRA 3QCPA 4YAVA 3HZ8A 1AQXA 3GNJA 2R3XA 4K7NA 4J56E 1FVJA 1Z3EA 3TJJA 5EVOA 2YV7A 2FUG2 1YZXA 1F9MA 2NPBA 1ILOA 2IL3A 3HHVA 1T8EB 1Z6MA 1XW5A 4QMKA 3HVSA 3VWVA 4HQSA 4A5PA 3UJ1A 2JACA 4CW9A 1NHOA 1WP0A 4GQCA 4CDOA 5AIXA 1EOHA 4K7OA 4JR6A 4RQXA 1XIYA 4WBJA 4JR4A 5IQYA 1NW2A 3GYKA 2JL4A 2F8AA 4FO5A 2UZ8A 2V6KA 3O6TA 4V2MA 4AF2A 4F82A 3ZL5A 1I5GA 1ERTA 3UMAA 4IKHA 1T7PB 1GNWA 4ECIA 2CVBA 1GWCA 2HSMB 4RI7A 4KB3A 2K8VA 1AUCA 2OE3A 4N3ZA 3EMPA 2PPTA 1ERVA 3H93A 2C3TA 5J41A 3QD9A 5IMAA 2K18A 3TUEA 3EU4A 4IJ3A 1K3YA 3IR4A 1GSUA 5ECIB 3E9JB 2DSAA 3GN3A 2O8VB 5F8BA 3M9JA 1SL1B 1EEJA 2VCXA 4Z2RA 1N8JA 2WVXA 2LUSA 2L57A 1UC7A 1WWJA 5H5SA 1GSEA 3ME8A 5ID2B 4PHZC 1UVZA 3CSHA 4OWYA 5HR0A 1GNEA 1SK1A 1ZZYA 1QXHA 4HZ4A 3DVWA 2HRKA 4MF7A 3TU3B 3HXSA 1THOA 4MA9A 2R0PA 2FWGA 2VLTA 2YZHA 2IFQB 3I6AA 1LJRA 1W89A 5ECQB 5DJLA 2OACA 1GTAA 1OC9A 3ZZXA 1OE7A 3BBYA 1ST9A 4AJ6A 4AI6A 3KH7A 4FH8A 1KBNA 5HQPA 1TXXA 4V2NA 4ZB9A 1RK4A 4NHZA 3D21A 2MBSA 1G6WA 3F6FA 1XWCA 3GA4A 1OKDA 4L5OA 4AKXB 2EC4A 1WIKA 3HA9A 2O89A 1OE8A 1GSFA 4D73B 1XW9A 1ZYQB 4GDFA 4KAEA 5IMCA 3QMXA 2ES7A 1PL1A 5ABRA 4MZWA 4YH2A 1DSBA 3LJRA 1G7EA 3IE3A 1YF0A 1J0FA 1Q98A 3RHCA 4O5RA 5IMFA 1BJXA 2CVDA 1B8XA 4NMUA 4TW5A 1YVLA 4XIHA 1GUHA 4J57E 3ZRDA 4EC0A 2GVPA 4L8EA 4O7HA 1PD21 4MF6A 1JZOA 4IQ1A 2LRNA 2E2GA 5J4VA 5KN1A 4ZILA 2L6CA 2YP6A 5ID2A 3EMXA 1WMJA 4F03A 2VLUA 1SL2B 1PSQA 5CRGA 2HRFA 2PVQA 2V41A 2GZZA 5D93A 2JSZA 3BCKA 2KHPA 2CQ9A 4G01A 3KH9A 2LS5A 2IFQA 2N5BA 2YWIA 1AAZA 1KEBA 4EKZA 4G0IA 2NBSA 4N10A 2YJ7A 3ZMKA 2HSHA 5ECKB 3F63A 1O73A 2TRCP 4HSCX 1GSSA 1JZDA 2DJJA 2B7KA 1A2MA 3F3RA 3DVXA 2C80A 1URMA 2P31A 1SD8A 3UBKA 3TRPA 2R37A 2RLIA 4MZCA 3GURA 1OVNA 5BMUB 2PMTA 2LNSA 1Z6NA 3O3TA 2WGRA 4L0WA 3L9VA 1K0MA 3FZ9A 4H86A 3GKMA 3UVTA 2C0GA 2R2JA 1GRXA 2N5AA 3APQA 4BA7A 3Q74A 4XS4A 2H1DA 3ZYWA 4P3YB 4IJIA 2H1BA 4G0LA 5DVBA 3QDNA 3KCMA 5ECMB 5CO3A 2H19A 3WGEA 3G7IA 3KEBA 2CAIA 4I97A 1QGVA 1YEWC 4POBA 1F37A 1DBYA 4ZL9A 4KCEA 5G5FA 4JEDA 2XC2A 2O5VA 3D0ZA 4MJCA 2RM5A 4ZB7A 4IELA 2VCZA 2B5XA 3H4KA 4NHWA 4IP6A 4F0CA 6GSUA 4TR1A 2OBKA 1T3BA 3NIVA 3ME7A 1F3BA 1M9BA 3EU3A 1A0RP 3DRNA 5GSTA 3HVXA 2Z9SA 13GSA 4TRXA 2XHFA 2I1UA 4K7IA 1U3AA 5EL8A 2B5YA 3LORA 2K8SA 3HKRA 4O92A 3EYTA 1YQ1A 1U6TA 3S9FA 1PGTA 3CSJA 2ALBA 2LEGA 2H76A 5A34B 4V2LA 1MD3A 2LKUA 3UL3A 4PXOA 4IW9A 3A5IA 1AQVA 3CWGA 4YQUA 2V1MA 2N5FA 1FO5A 3WYWA 2L4QA 3BOAA 4PX1A 3H79A 1TU8A 5AISA 4HJ2A 3N5OA 4OCEA 3VFIA 3E3EA 1K0BA 2J23A 2F51A 2C0EA 1T4YA 5LCZA 2YN1A 2A4VA 4OO4A 4ZB8A 2WW0A 1BX9A 5B6MA 5DAKB 4PI2C 3HD5A 2MMZA 1M99A 3M0FA 1ZL9A 3FRCA 4IBPA 5B8AA 1VGLA 2ZCTA 5J3RA 3O76A 2DLXA 1M7TA 1EV9A 4QL7A 4TKYA 5LD0A 1R4WA 4ULXA 4Z2TA 3IK9A 2WW1A 2X8GA 2KUCA 4K8MA 1GUKA 5DBQA 3TCOA 4Q5NA 2HLSA 3CRTA 3Q18A 4PGTA 1FOVA 1BQ7A 2R0CA 3F4RA 4K5RA 5IO0A 1NSWA 1WPIA 3MYDA 4LL1B 2DKHA 1GTUA 3E0UA 3KJYA 3FR6A 3LYPA 2LSTA 3CYNA 5C00A 1S3AA 1PN9A 4DSSA 2ZUPA 4PUAA 4HS1A 3ED3A 3H8QA 1EOGA 4OO5A 5CYYA 22GSA 3G7YA 5AN1A 1A23A 4LMWA 2B7JA 4F9ZA 1TP9A 3KP9A 4ZBDA 2GSTA 3OR5A 3FW2A 2HFDA 1K3LA 4ZL8A 2DJKA 3D6IA 3GH6A 4BL7A 2X49A 1M2DA 2B6MA 2E2MA 2H8LA 4NPBA 4MP4A 3QFBC 4EDYA 1U88A 4EVMA 1ACVA 5INYA 4BVXB 3IAM2 1SKRB 2CX3A 3TRQA 2HSNB 3KP8A 2WVZA 2GQLA 2FA8A 4WF4A 2OJLA 2O7KA 2YCDA 1SYXA 4GWRA 5G30A 2WVYA 3D5JA 2JSYA 4USSA 4EF0A 1JLVA 5KN2A 4POLA 1HNBA 1MDJA 6GSXA 1XFLA 2GS3A 2IMKA 2BJXA 3MDKA 2H70A 3QPMA 4MH2A 1VF1A 3MWHA 1VF3A 4ZB6A 2OE1A 3G7JA 1Z7RA 4PQIA 4KSOA 4WBRD 4XS6A 1OC3A 3ZFLA 3GTUB 4POKA 4POMA 1TI3A 2X8CA 2KP1A 4BPYA 2H1LA 6GSSA 2FWHA 2C1YA 3HCZA 2GGTA 2HRAA 2CZ2A 2F8FA 1X5CA 17GSA 4BWQA 3ZITA 3CQFA 3CTFA 4V1Ag 2QA2A 2FA4A 5AIVA 4PI0C 1WJKA 2FGXA 4X1UA 4O5UA 3IHGA 4ACSA 3P7XA 5ENUA 3HZ4A 4QL9A 1F6MC 2VO4A 4JBBA 2VL3A 2FY6A 2E0QA 3N9JA 1XCCA 4YKGA 4YKFA 3UAPA 3TOUA 2HT9A 3FY7A 2VD1A 1AIUA 4BVYA 4MCUA 2JADA 2YOIA 1MD4A 2OADA 4KX4A 5D96A 3LSZA 4F0BA 1TRUA 1C72A 4G9HA 1TI1A 1QUWA 1PN0A 5G2ZA 3RHBA 5COHA 1SK2A 3BCIA 3GV1A 1X0RA 3VK9A 1O7UA 1ERUA 3APSA 3MIXA 2O36A 2A2SA 5DJMA 1PKWA 5B6NA 2HQTA 2A2PA 3ZVJD 4KCAA 2RIIA 4OMVA 1M3IA 2YJHA 5DALB 2BMXA 3WGXA 3IPZA 4EXJA 3DWVA 2VCVA 4X43A 3KGKA 3QOUA 7GSSA 4FIWA 3CMIA 1GLQA 1K0AA 1VF2A 1F3AA 4ML1A 3L78A 1SKWB 1TJDA 3AY8A 1CQGA 2WFCA 4YQMA 2OE0A 1SYRA 1DE2A 3GMFA 4MABA 3TDGA 3ZIVA 1K0DA 1MEKA 5J9CA 3VPTA 4KGIA 2P0GA 3F6DA 3ZREA 2OKAA 4WR4A 6GSVA 3EE2A 3M9KA 3U5RE 4TXOB 1SK0A 5F06A 2EIRA 3GSSA 3TKSA 1QQ2A 16GSA 2H0HA 1U87A 4KA0A 1GTIA 1TU7A 2HSYA 3CTGA 1KTEA 4DEJA 3F0IA 3LG6A 5B7CA 2UV8G 4ECBA 4Q5RA 5G1LA 4I2UA 2H6YA 4GTUA 3FKFA 5ECLB 2YWMA 2LQOA 2QGVA 4G10A 1PL2A 5DCGA 2R5GA 1XVQA 3RAZA 4TR0A 4IGJA 1BYEA 2XPEA 5EPFA 4I2TA 2GQMA 3DGQA 3MAKA 1R5PA 4WXTA 2WW2A 4AKGA 4WF5A 5IPGA 1YEXA 5A1NB 2L6DA 4AGSA 1K0NA 4FYCA 3IV4A 5E4WA 5E59A 5G31A 1N2AA 3J7Yb 3C1RA 1THXA 2HSMA 5J9BA 1E6BA 4ECJA 1WE0A 1XG8A 1J08A 1YY7A 4L0UA 1LBKA 5CAXA 3UEMA 3G9BA 1PX7A 6GSTA 3FR9A 1GSYA 5IMDA 4OFTA 1O8WA 4HUAA 4E8HA 3HY2A 3HJOA 1X9SB 5B8BA 2HZEB 4ZXGA 2AHEA 2QA1A 1T1VA 1V40A 3VLNA 1SJ6A 4CY6A 5A5HB 2GSQA 3GHAA 2AJQB 1S3DA 3KZQA 2VUPA 2PBJA 3ERGA 4K6XA 4N11A 1HQOA 2H6ZA 2F3MA 3FR3A 3GL3A 3ISOA 1X9MB 4TXOA 5CNWA 4GQFA 4KE3A 4XTSA 4NWYA 2LV3A 5KN3A 5D9XA 4TR3A 2AB6A 5ELAA 3C71A 2MZCA 5A4VA 2JU5A 2VAFA 2QSIA 3RPPA 1HD2A 2A4HA 2DBCA 2FWEA 3KMNA 4OFNA 1SU9A 3IA1A 2PERA 3GRXA 4DSQA 2HXKA 3BJ5A 2CX4A 3GUSA 5ECRB 1EP8A 4F2IA 4KSMA 4V1Ap 1SL0B 2LJKA 2DMMA 2YZUA 1GP1A 3KXOA 2EFEA 4HEA2 3MSZA 3GKXA 1TDIA 3CRUA 3P8WA 4K1FA 4AKIA 4NV5A 1V98A 3RBTA 3VURA 2EIQA 4JZQA 2JZRA 4FQUA 2FCHA 3EVIA 2YPMA 4D73A 2VIMA 1XVWA 5CP1A 1M3JA 20GSA 2RUFA 2TRXA 5AGYA 5EY6A 4KH7A 2LRTA 3FHKA 9GSSA 1CQHA 2AAWA 1TTZA 2WCIA 1A2JA 3GKKA 4HJMA 1FW1A 3LXZA 5LNKe 4LA1A 4MDCA 2WULA 1H75A 3IAS2 2O85A 4IVFA 2YWNA 4EUYA 2LRCA 1YJ6A 6GSWA 2H0IA 3RFRC 4BWSA 2DMLA 2AV4A 1R26A 5HFIA 2H73A 2R4VA 5DQSA 4AJ8A 1TRVA 5DCHA 6GSYA 5CRWA 4EDZA 4WEYA 2B5EA 5ECOB 2LQQA 4E8EA 1GULA 5J40A 2MBTA 2WS2A 4ID0A 5DDLA 4GXZA 4WR5A 1TKDB 4YAPA 4GSSA 2QKEA 2PN8A 2ZNMA 1A24A 19GSA 2PU9C 3I9V2 2NDOA 3HDCA 1M9AA 3DD3A 3FMWA 3UIWA 2GSRA 3LWAA 1TK8B 5DQYA 1B9YC 3EWLA 3HVNA 1Y1UA 3DKSA 2P5QA 2VM2A 2VCWA 5CRDA 1OKTA 1K3OA 1M2AA 4GLTA 1FG4A 5BMUA 1ZGNA 2IMEA 12GSA 1ZOFA 2NTOA 1MTCA 4K5SA 1ON4A 4HI7A 2FLSA 4L5LA 4IHUA 2L5LA 2WW3A 3GKNA 5HR2A 1U3IA 1YKCA 3GIXA 5ELGA 5ECSA 3TJKA 3VI7A 1B9XC 2GTUA
chains in the Genus database with same CATH topology
1ZMAA 2B3SA 2VL2A 1M0UA 5FWGA 1O85A 4MPGA 5H5QA 4DSRA 3EINA 2L5OA 4K0GA 1SVOA 3CSIA 5H5RA 4EL1A 1TRWA 4PQ1A 1GSQA 1BG5A 3QAVA 2H6XA 4ECCA 2D2ZA 5IOWA 3F4TA 2B1LA 4Z7XA 2VL9A 2KLXA 1QK8A 3TOTA 2P5RA 3FEUA 1XWAA 5F07A 3IXRA 1AXDA 2I9HA 1XWBA 4MK3A 1EV4A 2CAQA 5JCUA 4TXVA 2VKZG 4XCSA 1V58A 5A34A 4ISDA 3PR8A 4KNDA 3WD6A 3SWLA 2HE3A 3UVHA 5IMZA 4TOPA 1ML6A 3LQ7A 4O5QA 4HOJA 3LYKA 2DJ0A 2LJAA 1O81A 4RUVA 1HYUA 3APOA 4DVCA 3M8NA 4K0NA 4FYBA 4ZL7A 5J4UA 3KMOA 2MMNA 5D9TA 3QFAC 1TXUA 2FNOA 3A2XA 5DAKA 2BTOT 3TKSC 4PNGA 3DMLA 1K0OA 1YDKA 2G2QA 1BG1A 5ECPB 2CT6A 2VCQA 4HU9A 1SENA 4O32A 5HR1A 1M2BA 3M3MA 1XWGA 4HU7A 3M1GA 3GX8A 1AQWA 3KTBA 4NV2A 3W8JA 3FK8A 4OD7A 2XBIA 3UARA 2IMDA 2MYGA 3GX0A 1XW6A 2V2GA 3L9SA 5G1KA 2A2RA 2YV9A 2H72A 2GT6A 1GSDA 3L4NA 2WJUA 4Q5FA 5D73A 1Z7PA 4G0KA 4MF5A 1BF5A 3HYPA 3IK7A 4NXIA 3F3QA 2X64A 4GSNA 1GL8A 4BVXA 2JZTA 2E7PA 1FAAA 2HSNA 5GZZB 3L0HA 4I5QA 1JZWA 4KDUA 3C7MA 1PQNA 2HRKB 3WT2A 2HI7A 2KP2A 2M72A 3TKRA 1GH2A 3ZMLA 4EIPA 3DXBA 3Q6OA 11GSA 4JRRA 3FYGA 1GLPA 4PNFA 1OC9B 1Y25A 3EPTA 2QC7A 1V57A 1JZRA 4X0XA 2C8UA 3IC8A 1MDKA 1NM3A 2H1GA 4GRFA 1PRXA 5J5NA 1SVMA 3TJFA 1SVLA 3TGZA 4GSTA 5KOXA 3LXTA 4K2XA 3IBHA 5F0GA 2H0GA 5JWQB 3GTUA 2EFCA 3J7Yk 3A2VA 4AJ7A 4IS0A 4ZBAA 2PGTA 3Q19A 1B4PA 1EWXA 2YWOA 5HFKA 4I6XA 5CRHA 1EGRA 3I69A 4LL4B 3F9UA 5JWRB 3FZ4A 3F4SA 5IOXA 3DEXA 4ICYA 1BAYA 3PH9A 1ZYEA 3GH9A 4AKHA 1TOFA 3ERFA 2B1KA 3MNGA 1FVKA 1VF4A 3GSTA 3CXGA 2VM1A 2CV4A 3H1NA 4HZ2A 3D4MA 2H74A 4Q5QA 3U6VA 3IC4A 2ON7A 4ILFA 1FHEA 5IIZA 2R6KA 4NAXA 1ABAA 1X9WB 3L9UA 1XWKA 2C3NA 1SJZA 1G7OA 1JHBA 4N0VA 1A2LA 4IP1A 1SD9A 4Z2UA 3C73A 3TKPA 1YKAA 1DUGA 3W6GA 2EIOA 1OAZA 2L59A 5DALA 4J2FA 1XZOA 2R0GA 3RPNA 3VI5A 5IM9A 3HJMA 3LW9A 2X4AA 1TK0B 5JCWA 2VD0A 4ZBBA 2OBIA 3TJGA 1WOUA 18GSA 2WB9A 4K9ZA 1G0TA 4WKWA 1UN2A 4IN0A 4N30A 4LMVA 4RI6A 3US3A 1AW9A 3VWWA 2CA8A 2I4AA 4KDXA 4FYUA 1ZCPA 2IJYA 2DJ2A 3R3EA 1R7HA 2HYXA 2PUKC 4XS4B 1JFUA 5KOWA 4LLRA 4YQVA 1R5AA 1N25A 3IOSA 1IYIA 2FWFA 5A4WA 3DIEA 3QAWA 4RQRA 1XPVA 4EO3A 3WT1A 2C3QA 1XXUA 1G6YA 3VWUA 1K0CA 4G2EA 4OCFA 2RM6A 2GZPA 4TR1B 3DYRA 2GQKA 2CZ3A 1VRSD 1Y6EA 1S3CA 2VL2C 1XBSA 5G5EA 3D4TA 2DC5A 4MJEA 3P90A 3PPUA 3SBCA 2EFDA 1A8LA 3GFKA 1FB6A 2GDRA 3RDWA 3VWXA 2CVKA 8GSSA 1BEDA 1DE1A 4ML6A 10GSA 4MJBA 4XS1A 3KM6A 1V2AA 2K9FA 2H66A 2IMIA 4X4JA 4JU5A 3NZNA 5A1NA 1V9WA 5HR3A 4KDYA 2TIRA 3LGCA 4MJAA 1PKZA 4MLYA 1PMTA 1ZYPA 2V6OA 5IMVA 2H1AA 3LEFA 4HQZA 2HNLA 2KOKA 2GT5A 2HZEA 2HZFA 2LNTA 1Q4JA 1MDIA 2X8HA 1H4OA 3C1SA 4QQ7A 5A5HA 5IO2A 3KD0A 4HDEA 2H30A 3HMJG 2MMOA 2DIZA 2F9SA 3ZTLA 3A5WA 3ZFBA 4PUFC 2DJ3A 3GL5A 3R2QA 1AC1A 2HRNA 2IN3A 1X5DA 2RUEA 1T4ZA 5D9WA 2J9HA 2K6VA 4DSSB 4MZBA 1I9DA 1PA3A 3UOMA 1W4VA 3TRXA 2YANA 5A4UA 4TN8A 1EGOA 2OT3A 1SJIA 1TK5B 2H01A 3TKQA 1QFNA 1A8YA 1HNCA 2ON5A 3ERWA 3V1WA 1TRSA 1B4QA 2C0FA 4BL7B 5JWOB 5ECNB 2AUVA 1XOAA 3VPQA 3ZIJA 2M46A 3D22A 4KW6A 2VOCA 1NHYA 4I8BA 2C0DA 4EE0A 3IRAA 3W8SA 2X99A 1B48A 3NOFA 1FOHA 5D9VA 4MH3A 4N0ZA 1EP7A 4E68A 14GSA 3EC3A 5FHIA 4JE1A 5F05A 1OYJA 5FT3A 1O6JA 5BRTA 2XPDA 4W66A 2M80A 3C8EA 3WGDA 2G0FA 1WRYA 5GAPD 2JZSA 3IHQA 1HNAA 2FHEA 2PWJA 1EZKA 2LTKA 2H75A 3FZAA 1YEPA 4PQHA 1UA5A 2XBQA 4KUNA 2OA7A 3KTLA 5IPHA 4GF0A 4MNNA 3PINA 1PX6A 3TB2A 4PURA 2DJ1A 2GLRA 1Z9HA 1E2YA 3KIJA 1O8XA 5GSSA 1FB0A 3QR6A 2V32A 1QMVA 2YNXA 2C4JA 3ZLPA 2GZYA 4K2DA 2WRTA 2H71A 4CY8A 4TR4A 5C04A 4EIQA 4GCIA 5GAND 3K8NA 1LU4A 1TW9A 3A2WA 4BVYB 4TVEA 1IYHA 4MMMA 1GUMA 1F2EA 4IQAA 3CBUA 5KN0A 4G19A 1XOBA 1RQMA 3BD2A 1SKSB 3HVVA 2REMA 2IPAA 2VCTA 5KEJA 3LFLA 1EEMA 2IWTA 5JCGA 3I43A 3ZVJA 5A5KA 2PVOC 4XRDA 4PTSA 4XRAA 3TJBA 4XHMA 3P2AA 4ZIJA 1J9BA 2WDUA 3TKSE 2VLVA 1JLWA 1RW1A 3IDVA 1ERWA 2GSSA 2AYTA 5ECHB 2NVLA 4OFMA 2O87A 1X5EA 4KF9A 3F8UA 2DKIA 3EURA 5L71A 1USBA 1Z5YE 5J47A 4CHSA 2WZ9A 5HFGA 1ZYNA 3PGTA 2MMAA 3A3TA 4WETA 3HJPA 4MPFA 3QAGA 1T00A 3JCML 3UBLA 5D8IA 5CREA 1OC8A 2EFHA 5J4YA 2L4CA 2FD3A 1KNGA 1YF1A 2I3YA 2DIYA 2I81A 2IIYA 3FZ5A 2IMFA 1A0FA 1GTBA 2LJRA 3QCPA 4YAVA 3HZ8A 1AQXA 3GNJA 2R3XA 4K7NA 4J56E 1FVJA 1Z3EA 3TJJA 5EVOA 2YV7A 2FUG2 1YZXA 1F9MA 2NPBA 1ILOA 2IL3A 3HHVA 1T8EB 1Z6MA 1XW5A 4QMKA 3HVSA 3VWVA 4HQSA 4A5PA 3UJ1A 2JACA 4CW9A 1NHOA 1WP0A 4GQCA 4CDOA 5AIXA 1EOHA 4K7OA 4JR6A 4RQXA 1XIYA 4WBJA 4JR4A 5IQYA 1NW2A 3GYKA 2JL4A 2F8AA 4FO5A 2UZ8A 2V6KA 3O6TA 4V2MA 4AF2A 4F82A 3ZL5A 1I5GA 1ERTA 3UMAA 4IKHA 1T7PB 1GNWA 4ECIA 2CVBA 1GWCA 2HSMB 4RI7A 4KB3A 2K8VA 1AUCA 2OE3A 4N3ZA 3EMPA 2PPTA 1ERVA 3H93A 2C3TA 5J41A 3QD9A 5IMAA 2K18A 3TUEA 3EU4A 4IJ3A 1K3YA 3IR4A 1GSUA 5ECIB 3E9JB 2DSAA 3GN3A 2O8VB 5F8BA 3M9JA 1SL1B 1EEJA 2VCXA 4Z2RA 1N8JA 2LUSA 2L57A 1UC7A 1WWJA 5H5SA 1GSEA 3ME8A 5ID2B 1UVZA 3CSHA 4OWYA 5HR0A 1GNEA 1SK1A 1ZZYA 1QXHA 4HZ4A 3DVWA 2HRKA 4MF7A 3TU3B 3HXSA 1THOA 4MA9A 2R0PA 2FWGA 2VLTA 2YZHA 2IFQB 3I6AA 1LJRA 1W89A 5ECQB 5DJLA 2OACA 1GTAA 1OC9A 3ZZXA 1OE7A 3BBYA 1ST9A 4AJ6A 4AI6A 3KH7A 4FH8A 1KBNA 5HQPA 1TXXA 4V2NA 4ZB9A 1RK4A 4NHZA 3D21A 2MBSA 1G6WA 3F6FA 1XWCA 3GA4A 1OKDA 4L5OA 4AKXB 2EC4A 1WIKA 3HA9A 2O89A 1OE8A 1GSFA 4D73B 1XW9A 1ZYQB 4GDFA 4KAEA 5IMCA 3QMXA 2ES7A 1PL1A 5ABRA 4MZWA 4YH2A 1DSBA 3LJRA 1G7EA 3IE3A 1YF0A 1J0FA 1Q98A 3RHCA 4O5RA 5IMFA 1BJXA 2CVDA 1B8XA 4NMUA 4TW5A 1YVLA 4XIHA 1GUHA 4J57E 3ZRDA 4EC0A 2GVPA 4L8EA 4O7HA 1PD21 4MF6A 1JZOA 4IQ1A 2LRNA 2E2GA 5J4VA 5KN1A 4ZILA 2L6CA 2YP6A 5ID2A 3EMXA 1WMJA 4F03A 2VLUA 1SL2B 1PSQA 5CRGA 2HRFA 2PVQA 2V41A 2GZZA 5D93A 2JSZA 3BCKA 2KHPA 2CQ9A 4G01A 3KH9A 2LS5A 2IFQA 2N5BA 2YWIA 1AAZA 1KEBA 4EKZA 4G0IA 2NBSA 4N10A 2YJ7A 3ZMKA 2HSHA 5ECKB 3F63A 1O73A 2TRCP 1GSSA 1JZDA 2DJJA 2B7KA 1A2MA 3F3RA 3DVXA 2C80A 1URMA 2P31A 1SD8A 3UBKA 3TRPA 2R37A 2RLIA 4MZCA 3GURA 1OVNA 5BMUB 2PMTA 2LNSA 1Z6NA 3O3TA 2WGRA 4L0WA 3L9VA 1K0MA 3FZ9A 4H86A 3GKMA 3UVTA 2C0GA 2R2JA 1GRXA 2N5AA 3APQA 4BA7A 3Q74A 4XS4A 2H1DA 3ZYWA 4P3YB 4IJIA 2H1BA 4G0LA 5DVBA 3QDNA 3KCMA 5ECMB 5CO3A 2H19A 3WGEA 3G7IA 3KEBA 2CAIA 4I97A 1QGVA 4POBA 1F37A 1DBYA 4ZL9A 4KCEA 5G5FA 4JEDA 2XC2A 2O5VA 3D0ZA 4MJCA 2RM5A 4ZB7A 4IELA 2VCZA 2B5XA 3H4KA 4NHWA 4IP6A 4F0CA 6GSUA 4TR1A 2OBKA 1T3BA 3NIVA 3ME7A 1F3BA 1M9BA 3EU3A 1A0RP 3DRNA 5GSTA 3HVXA 2Z9SA 13GSA 4TRXA 2XHFA 2I1UA 4K7IA 1U3AA 5EL8A 2B5YA 3LORA 2K8SA 3HKRA 4O92A 3EYTA 1YQ1A 1U6TA 3S9FA 1PGTA 3CSJA 2ALBA 2LEGA 2H76A 5A34B 4V2LA 1MD3A 2LKUA 3UL3A 4PXOA 4IW9A 3A5IA 1AQVA 3CWGA 4YQUA 2V1MA 2N5FA 1FO5A 3WYWA 2L4QA 3BOAA 4PX1A 3H79A 1TU8A 5AISA 4HJ2A 3N5OA 4OCEA 3VFIA 3E3EA 1K0BA 2J23A 2F51A 2C0EA 1T4YA 5LCZA 2YN1A 2A4VA 4OO4A 4ZB8A 1BX9A 5B6MA 5DAKB 3HD5A 2MMZA 1M99A 3M0FA 1ZL9A 3FRCA 4IBPA 5B8AA 1VGLA 2ZCTA 5J3RA 3O76A 2DLXA 1M7TA 1EV9A 4QL7A 4TKYA 5LD0A 1R4WA 4ULXA 4Z2TA 3IK9A 2X8GA 2KUCA 4K8MA 1GUKA 5DBQA 3TCOA 4Q5NA 2HLSA 3CRTA 3Q18A 4PGTA 1FOVA 1BQ7A 2R0CA 3F4RA 4K5RA 5IO0A 1NSWA 1WPIA 3MYDA 4LL1B 2DKHA 1GTUA 3E0UA 3KJYA 3FR6A 3LYPA 2LSTA 3CYNA 5C00A 1S3AA 1PN9A 4DSSA 2ZUPA 4PUAA 4HS1A 3ED3A 3H8QA 1EOGA 4OO5A 5CYYA 22GSA 3G7YA 5AN1A 1A23A 4LMWA 2B7JA 4F9ZA 1TP9A 3KP9A 4ZBDA 2GSTA 3OR5A 3FW2A 2HFDA 1K3LA 4ZL8A 2DJKA 3D6IA 3GH6A 4BL7A 2X49A 1M2DA 2B6MA 2E2MA 2H8LA 4NPBA 4MP4A 3QFBC 4EDYA 1U88A 4EVMA 1ACVA 5INYA 4BVXB 3IAM2 1SKRB 2CX3A 3TRQA 2HSNB 3KP8A 2GQLA 2FA8A 4WF4A 2OJLA 2O7KA 2YCDA 1SYXA 4GWRA 5G30A 3D5JA 2JSYA 4USSA 4EF0A 1JLVA 5KN2A 4POLA 1HNBA 1MDJA 6GSXA 1XFLA 2GS3A 2IMKA 2BJXA 3MDKA 2H70A 3QPMA 4MH2A 1VF1A 3MWHA 1VF3A 4ZB6A 2OE1A 3G7JA 1Z7RA 4PQIA 4KSOA 4WBRD 4XS6A 1OC3A 3ZFLA 3GTUB 4POKA 4POMA 1TI3A 2X8CA 2KP1A 4BPYA 2H1LA 6GSSA 2FWHA 2C1YA 3HCZA 2GGTA 2HRAA 2CZ2A 2F8FA 1X5CA 17GSA 4BWQA 3ZITA 3CTFA 4V1Ag 2QA2A 2FA4A 5AIVA 1WJKA 2FGXA 4X1UA 4O5UA 3IHGA 4ACSA 3P7XA 5ENUA 3HZ4A 4QL9A 1F6MC 2VO4A 4JBBA 2VL3A 2FY6A 2E0QA 3N9JA 1XCCA 4YKGA 4YKFA 3UAPA 3TOUA 2HT9A 3FY7A 2VD1A 1AIUA 4BVYA 4MCUA 2JADA 2YOIA 1MD4A 2OADA 4KX4A 5D96A 3LSZA 4F0BA 1TRUA 1C72A 4G9HA 1TI1A 1QUWA 1PN0A 5G2ZA 3RHBA 5COHA 1SK2A 3BCIA 3GV1A 1X0RA 3VK9A 1O7UA 1ERUA 3APSA 3MIXA 5DJMA 2A2SA 1PKWA 5B6NA 2HQTA 2A2PA 3ZVJD 4KCAA 2RIIA 4OMVA 2YJHA 5DALB 2BMXA 3WGXA 3IPZA 4EXJA 3DWVA 2VCVA 4X43A 3KGKA 3QOUA 7GSSA 4FIWA 3CMIA 1GLQA 1K0AA 1VF2A 1F3AA 4ML1A 3L78A 1SKWB 1TJDA 3AY8A 1CQGA 2WFCA 4YQMA 2OE0A 1SYRA 1DE2A 3GMFA 4MABA 3TDGA 3ZIVA 1K0DA 1MEKA 5J9CA 3VPTA 4KGIA 2P0GA 3F6DA 3ZREA 2OKAA 4WR4A 6GSVA 3EE2A 3M9KA 3U5RE 4TXOB 1SK0A 5F06A 2EIRA 3GSSA 3TKSA 1QQ2A 16GSA 2H0HA 1U87A 4KA0A 1GTIA 1TU7A 2HSYA 3CTGA 1KTEA 4DEJA 3F0IA 3LG6A 5B7CA 2UV8G 4ECBA 4Q5RA 5G1LA 4I2UA 2H6YA 4GTUA 3FKFA 5ECLB 2YWMA 2LQOA 2QGVA 4G10A 1PL2A 5DCGA 2R5GA 1XVQA 3RAZA 4TR0A 4IGJA 1BYEA 2XPEA 5EPFA 4I2TA 2GQMA 3DGQA 3MAKA 1R5PA 4WXTA 4AKGA 4WF5A 5IPGA 1YEXA 5A1NB 2L6DA 4AGSA 1K0NA 4FYCA 3IV4A 5E4WA 5E59A 5G31A 1N2AA 3J7Yb 3C1RA 1THXA 2HSMA 5J9BA 1E6BA 4ECJA 1WE0A 1J08A 1YY7A 4L0UA 1LBKA 5CAXA 3UEMA 3G9BA 1PX7A 6GSTA 3FR9A 1GSYA 5IMDA 4OFTA 1O8WA 4HUAA 4E8HA 3HY2A 3HJOA 1X9SB 5B8BA 2HZEB 4ZXGA 2AHEA 2QA1A 1T1VA 1V40A 3VLNA 1SJ6A 4CY6A 5A5HB 2GSQA 3GHAA 2AJQB 1S3DA 3KZQA 2VUPA 2PBJA 3ERGA 4K6XA 4N11A 1HQOA 2H6ZA 2F3MA 3FR3A 3GL3A 3ISOA 1X9MB 4TXOA 5CNWA 4GQFA 4KE3A 4XTSA 4NWYA 2LV3A 5KN3A 5D9XA 4TR3A 2AB6A 5ELAA 3C71A 2MZCA 5A4VA 2JU5A 2VAFA 2QSIA 3RPPA 1HD2A 2A4HA 2DBCA 2FWEA 3KMNA 4OFNA 1SU9A 3IA1A 2PERA 3GRXA 4DSQA 2HXKA 3BJ5A 2CX4A 3GUSA 5ECRB 1EP8A 4F2IA 4KSMA 4V1Ap 1SL0B 2LJKA 2DMMA 2YZUA 1GP1A 3KXOA 2EFEA 4HEA2 3MSZA 3GKXA 1TDIA 3CRUA 3P8WA 4K1FA 4AKIA 4NV5A 1V98A 3RBTA 3VURA 2EIQA 4JZQA 2JZRA 4FQUA 2FCHA 3EVIA 2YPMA 4D73A 2VIMA 1XVWA 5CP1A 20GSA 2RUFA 2TRXA 5AGYA 5EY6A 4KH7A 2LRTA 3FHKA 9GSSA 1CQHA 2AAWA 1TTZA 2WCIA 1A2JA 3GKKA 4HJMA 1FW1A 3LXZA 5LNKe 4LA1A 4MDCA 2WULA 1H75A 3IAS2 2O85A 4IVFA 2YWNA 4EUYA 2LRCA 1YJ6A 6GSWA 2H0IA 4BWSA 2DMLA 2AV4A 1R26A 5HFIA 2H73A 2R4VA 5DQSA 4AJ8A 1TRVA 5DCHA 6GSYA 5CRWA 4EDZA 4WEYA 2B5EA 5ECOB 2LQQA 4E8EA 1GULA 5J40A 2MBTA 2WS2A 4ID0A 5DDLA 4GXZA 4WR5A 1TKDB 4YAPA 4GSSA 2QKEA 2PN8A 2ZNMA 1A24A 19GSA 2PU9C 3I9V2 2NDOA 3HDCA 1M9AA 3DD3A 3FMWA 3UIWA 2GSRA 3LWAA 1TK8B 5DQYA 1B9YC 3EWLA 1Y1UA 3DKSA 2P5QA 2VM2A 2VCWA 5CRDA 1OKTA 1K3OA 1M2AA 4GLTA 1FG4A 5BMUA 1ZGNA 2IMEA 12GSA 1ZOFA 2NTOA 1MTCA 4K5SA 1ON4A 4HI7A 2FLSA 4L5LA 4IHUA 2L5LA 3GKNA 5HR2A 1U3IA 1YKCA 3GIXA 5ELGA 5ECSA 3TJKA 3VI7A 1B9XC 2GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMA A;  2B3S A;  2VL2 A;  1M0U A;  5FWG A;  1O85 A;  4MPG A;  5H5Q A;  4DSR A;  3EIN A;  2L5O A;  4K0G A;  3CSI A;  5H5R A;  4EL1 A;  1TRW A;  4PQ1 A;  1GSQ A;  1BG5 A;  3QAV A;  2H6X A;  4ECC A;  2D2Z A;  5IOW A;  3F4T A;  2B1L A;  4Z7X A;  2VL9 A;  2KLX A;  1QK8 A;  3TOT A;  2P5R A;  3FEU A;  1XWA A;  5F07 A;  3IXR A;  1AXD A;  2I9H A;  1XWB A;  4MK3 A;  1EV4 A;  2CAQ A;  5JCU A;  4TXV A;  4XCS A;  1V58 A;  4ISD A;  3PR8 A;  4KND A;  3WD6 A;  3SWL A;  2HE3 A;  3UVH A;  5IMZ A;  4TOP A;  1ML6 A;  3LQ7 A;  4HOJ A;  3LYK A;  2DJ0 A;  2LJA A;  1O81 A;  4RUV A;  1HYU A;  3APO A;  4DVC A;  3M8N A;  4K0N A;  4FYB A;  4ZL7 A;  5J4U A;  3KMO A;  2MMN A;  5D9T A;  3QFA C;  2FNO A;  3A2X A;  5DAK A;  2BTO T;  3TKS C;  4PNG A;  3DML A;  1K0O A;  1YDK A;  2G2Q A;  5ECP B;  2CT6 A;  2VCQ A;  4HU9 A;  1SEN A;  4O32 A;  5HR1 A;  1M2B A;  3M3M A;  1XWG A;  4HU7 A;  3M1G A;  3GX8 A;  1AQW A;  3KTB A;  4NV2 A;  3W8J A;  3FK8 A;  4OD7 A;  2XBI A;  3UAR A;  2IMD A;  2MYG A;  3GX0 A;  1XW6 A;  2V2G A;  3L9S A;  5G1K A;  2A2R A;  2YV9 A;  2H72 A;  2GT6 A;  1GSD A;  3L4N A;  2WJU A;  4Q5F A;  5D73 A;  1Z7P A;  4G0K A;  4MF5 A;  3HYP A;  3IK7 A;  4NXI A;  3F3Q A;  2X64 A;  4GSN A;  1GL8 A;  4BVX A;  2JZT A;  2E7P A;  1FAA A;  5GZZ B;  3L0H A;  4I5Q A;  1JZW A;  4KDU A;  3C7M A;  1PQN A;  2HRK B;  3WT2 A;  2HI7 A;  2KP2 A;  2M72 A;  3TKR A;  1GH2 A;  3ZML A;  3DXB A;  3Q6O A;  11GS A;  4JRR A;  3FYG A;  1GLP A;  4PNF A;  1OC9 B;  1Y25 A;  2QC7 A;  1V57 A;  1JZR A;  4X0X A;  2C8U A;  3IC8 A;  1MDK A;  1NM3 A;  2H1G A;  4GRF A;  1PRX A;  5J5N A;  3TJF A;  3TGZ A;  4GST A;  3LXT A;  3IBH A;  5F0G A;  2H0G A;  5JWQ B;  3GTU A;  3J7Y k;  3A2V A;  4AJ7 A;  4IS0 A;  4ZBA A;  2PGT A;  3Q19 A;  1B4P A;  1EWX A;  2YWO A;  5HFK A;  4I6X A;  5CRH A;  1EGR A;  3I69 A;  4LL4 B;  3F9U A;  5JWR B;  3FZ4 A;  3F4S A;  5IOX A;  3DEX A;  1BAY A;  3PH9 A;  1ZYE A;  3GH9 A;  1TOF A;  3ERF A;  2B1K A;  3MNG A;  1FVK A;  1VF4 A;  3GST A;  3CXG A;  2VM1 A;  2CV4 A;  3H1N A;  4HZ2 A;  3D4M A;  2H74 A;  4Q5Q A;  3U6V A;  3IC4 A;  2ON7 A;  4ILF A;  1FHE A;  5IIZ A;  2R6K A;  4NAX A;  1ABA A;  1X9W B;  3L9U A;  1XWK A;  2C3N A;  1SJZ A;  1G7O A;  1JHB A;  4N0V A;  1A2L A;  4IP1 A;  1SD9 A;  3C73 A;  3TKP A;  1YKA A;  1DUG A;  3W6G A;  2EIO A;  1OAZ A;  2L59 A;  5DAL A;  4J2F A;  1XZO A;  3RPN A;  3VI5 A;  5IM9 A;  3HJM A;  1TK0 B;  5JCW A;  2VD0 A;  4ZBB A;  2OBI A;  3TJG A;  1WOU A;  18GS A;  2WB9 A;  4K9Z A;  1G0T A;  4WKW A;  1UN2 A;  4IN0 A;  4N30 A;  4LMV A;  4RI6 A;  3US3 A;  1AW9 A;  3VWW A;  2CA8 A;  2I4A A;  4KDX A;  4FYU A;  1ZCP A;  2IJY A;  2DJ2 A;  3R3E A;  1R7H A;  2HYX A;  2PUK C;  4XS4 B;  1JFU A;  4LLR A;  4YQV A;  1R5A A;  3IOS A;  1IYI A;  2FWF A;  5A4W A;  3DIE A;  3QAW A;  4RQR A;  1XPV A;  4EO3 A;  3WT1 A;  2C3Q A;  1XXU A;  1G6Y A;  3VWU A;  1K0C A;  4G2E A;  4OCF A;  2RM6 A;  2GZP A;  4TR1 B;  3DYR A;  2GQK A;  2CZ3 A;  1VRS D;  1Y6E A;  1S3C A;  2VL2 C;  1XBS A;  5G5E A;  3D4T A;  2DC5 A;  4MJE A;  3P90 A;  3PPU A;  3SBC A;  1A8L A;  3GFK A;  1FB6 A;  2GDR A;  3RDW A;  3VWX A;  2CVK A;  8GSS A;  1BED A;  1DE1 A;  4ML6 A;  10GS A;  4MJB A;  4XS1 A;  3KM6 A;  1V2A A;  2K9F A;  2H66 A;  2IMI A;  4JU5 A;  3NZN A;  1V9W A;  5HR3 A;  4KDY A;  2TIR A;  3LGC A;  4MJA A;  1PKZ A;  4MLY A;  1PMT A;  2V6O A;  5IMV A;  2H1A A;  3LEF A;  4HQZ A;  2HNL A;  2KOK A;  2GT5 A;  2HZE A;  2HZF A;  2LNT A;  1Q4J A;  1MDI A;  2X8H A;  1H4O A;  3C1S A;  4QQ7 A;  5IO2 A;  3KD0 A;  4HDE A;  2H30 A;  2MMO A;  2DIZ A;  2F9S A;  3ZTL A;  3A5W A;  3ZFB A;  4PUF C;  2DJ3 A;  3GL5 A;  3R2Q A;  1AC1 A;  2HRN A;  2IN3 A;  1X5D A;  2RUE A;  1T4Z A;  5D9W A;  2J9H A;  2K6V A;  4DSS B;  4MZB A;  1I9D A;  1PA3 A;  3UOM A;  1W4V A;  3TRX A;  2YAN A;  5A4U A;  4TN8 A;  1EGO A;  1SJI A;  1TK5 B;  2H01 A;  3TKQ A;  1QFN A;  1A8Y A;  1HNC A;  2ON5 A;  3ERW A;  3V1W A;  1TRS A;  1B4Q A;  2C0F A;  4BL7 B;  5JWO B;  5ECN B;  2AUV A;  1XOA A;  3VPQ A;  3ZIJ A;  2M46 A;  3D22 A;  4KW6 A;  2VOC A;  1NHY A;  4I8B A;  2C0D A;  4EE0 A;  3IRA A;  3W8S A;  2X99 A;  1B48 A;  3NOF A;  5D9V A;  4MH3 A;  4N0Z A;  1EP7 A;  14GS A;  3EC3 A;  5FHI A;  4JE1 A;  5F05 A;  1OYJ A;  5FT3 A;  1O6J A;  2XPD A;  2M80 A;  3C8E A;  3WGD A;  2G0F A;  1WRY A;  5GAP D;  2JZS A;  3IHQ A;  1HNA A;  2FHE A;  2PWJ A;  1EZK A;  2LTK A;  2H75 A;  3FZA A;  1YEP A;  4PQH A;  1UA5 A;  2XBQ A;  4KUN A;  2OA7 A;  3KTL A;  5IPH A;  4GF0 A;  3PIN A;  1PX6 A;  3TB2 A;  4PUR A;  2DJ1 A;  2GLR A;  1Z9H A;  1E2Y A;  3KIJ A;  1O8X A;  5GSS A;  1FB0 A;  3QR6 A;  2V32 A;  1QMV A;  2YNX A;  2C4J A;  3ZLP A;  2GZY A;  4K2D A;  2WRT A;  2H71 A;  4TR4 A;  5C04 A;  4GCI A;  5GAN D;  3K8N A;  1LU4 A;  1TW9 A;  3A2W A;  4BVY B;  4TVE A;  1IYH A;  4MMM A;  1GUM A;  1F2E A;  4IQA A;  3CBU A;  5KN0 A;  4G19 A;  1XOB A;  1RQM A;  3BD2 A;  1SKS B;  3HVV A;  2REM A;  2IPA A;  2VCT A;  5KEJ A;  3LFL A;  1EEM A;  2IWT A;  5JCG A;  3I43 A;  3ZVJ A;  5A5K A;  2PVO C;  4XRD A;  4PTS A;  4XRA A;  3TJB A;  4XHM A;  3P2A A;  4ZIJ A;  1J9B A;  2WDU A;  3TKS E;  2VLV A;  1JLW A;  1RW1 A;  3IDV A;  1ERW A;  2GSS A;  2AYT A;  5ECH B;  2NVL A;  4OFM A;  2O87 A;  1X5E A;  4KF9 A;  3F8U A;  3EUR A;  5L71 A;  1USB A;  1Z5Y E;  4CHS A;  2WZ9 A;  5HFG A;  3PGT A;  2MMA A;  3A3T A;  4WET A;  3HJP A;  4MPF A;  3QAG A;  1T00 A;  3JCM L;  3UBL A;  5D8I A;  5CRE A;  1OC8 A;  2L4C A;  2FD3 A;  1KNG A;  1YF1 A;  2I3Y A;  2DIY A;  2I81 A;  2IIY A;  3FZ5 A;  2IMF A;  1A0F A;  1GTB A;  2LJR A;  3QCP A;  4YAV A;  3HZ8 A;  1AQX A;  3GNJ A;  2R3X A;  4K7N A;  4J56 E;  1FVJ A;  1Z3E A;  3TJJ A;  5EVO A;  2YV7 A;  2FUG 2;  1YZX A;  1F9M A;  2NPB A;  1ILO A;  2IL3 A;  3HHV A;  1T8E B;  1Z6M A;  1XW5 A;  3HVS A;  3VWV A;  4HQS A;  3UJ1 A;  2JAC A;  4CW9 A;  1NHO A;  1WP0 A;  4GQC A;  4CDO A;  5AIX A;  1EOH A;  4K7O A;  4JR6 A;  4RQX A;  1XIY A;  4WBJ A;  4JR4 A;  5IQY A;  1NW2 A;  3GYK A;  2JL4 A;  2F8A A;  4FO5 A;  2UZ8 A;  2V6K A;  3O6T A;  4V2M A;  4AF2 A;  4F82 A;  3ZL5 A;  1I5G A;  1ERT A;  3UMA A;  4IKH A;  1T7P B;  1GNW A;  4ECI A;  2CVB A;  1GWC A;  2HSM B;  4RI7 A;  4KB3 A;  2K8V A;  1AUC A;  2OE3 A;  3EMP A;  2PPT A;  1ERV A;  3H93 A;  2C3T A;  5J41 A;  3QD9 A;  5IMA A;  2K18 A;  3TUE A;  3EU4 A;  4IJ3 A;  1K3Y A;  3IR4 A;  1GSU A;  5ECI B;  3E9J B;  2DSA A;  3GN3 A;  2O8V B;  5F8B A;  3M9J A;  1SL1 B;  1EEJ A;  2VCX A;  1N8J A;  2LUS A;  2L57 A;  1UC7 A;  1WWJ A;  5H5S A;  1GSE A;  3ME8 A;  5ID2 B;  1UVZ A;  3CSH A;  4OWY A;  5HR0 A;  1GNE A;  1SK1 A;  1ZZY A;  1QXH A;  4HZ4 A;  3DVW A;  2HRK A;  4MF7 A;  3HXS A;  1THO A;  4MA9 A;  2FWG A;  2VLT A;  2YZH A;  2IFQ B;  3I6A A;  1LJR A;  1W89 A;  5ECQ B;  5DJL A;  2OAC A;  1GTA A;  1OC9 A;  3ZZX A;  1OE7 A;  3BBY A;  1ST9 A;  4AJ6 A;  3KH7 A;  4FH8 A;  1KBN A;  5HQP A;  1TXX A;  4V2N A;  4ZB9 A;  1RK4 A;  4NHZ A;  3D21 A;  2MBS A;  1G6W A;  3F6F A;  1XWC A;  3GA4 A;  1OKD A;  4L5O A;  2EC4 A;  1WIK A;  3HA9 A;  2O89 A;  1OE8 A;  1GSF A;  4D73 B;  1XW9 A;  1ZYQ B;  4KAE A;  5IMC A;  3QMX A;  2ES7 A;  1PL1 A;  5ABR A;  4MZW A;  4YH2 A;  1DSB A;  3LJR A;  1G7E A;  3IE3 A;  1YF0 A;  1J0F A;  1Q98 A;  3RHC A;  4O5R A;  5IMF A;  1BJX A;  2CVD A;  1B8X A;  4NMU A;  4TW5 A;  4XIH A;  1GUH A;  4J57 E;  3ZRD A;  4EC0 A;  2GVP A;  4L8E A;  4O7H A;  1PD2 1;  4MF6 A;  1JZO A;  4IQ1 A;  2LRN A;  2E2G A;  5KN1 A;  4ZIL A;  2L6C A;  2YP6 A;  5ID2 A;  3EMX A;  1WMJ A;  4F03 A;  2VLU A;  1SL2 B;  1PSQ A;  5CRG A;  2HRF A;  2PVQ A;  2V41 A;  2GZZ A;  5D93 A;  2JSZ A;  3BCK A;  2KHP A;  2CQ9 A;  3KH9 A;  2LS5 A;  2IFQ A;  2N5B A;  2YWI A;  1AAZ A;  1KEB A;  4EKZ A;  4G0I A;  2NBS A;  4N10 A;  2YJ7 A;  3ZMK A;  2HSH A;  5ECK B;  3F63 A;  1O73 A;  2TRC P;  1GSS A;  1JZD A;  2DJJ A;  2B7K A;  1A2M A;  3F3R A;  3DVX A;  2C80 A;  1URM A;  2P31 A;  1SD8 A;  3UBK A;  3TRP A;  2R37 A;  2RLI A;  4MZC A;  3GUR A;  1OVN A;  2PMT A;  2LNS A;  1Z6N A;  3O3T A;  2WGR A;  4L0W A;  3L9V A;  1K0M A;  3FZ9 A;  4H86 A;  3GKM A;  3UVT A;  2C0G A;  2R2J A;  1GRX A;  2N5A A;  3APQ A;  4BA7 A;  3Q74 A;  4XS4 A;  2H1D A;  3ZYW A;  4P3Y B;  4IJI A;  2H1B A;  4G0L A;  5DVB A;  3QDN A;  3KCM A;  5ECM B;  5CO3 A;  2H19 A;  3WGE A;  3G7I A;  3KEB A;  2CAI A;  4I97 A;  1QGV A;  4POB A;  1F37 A;  1DBY A;  4ZL9 A;  4KCE A;  5G5F A;  4JED A;  2XC2 A;  3D0Z A;  4MJC A;  2RM5 A;  4IEL A;  2VCZ A;  2B5X A;  3H4K A;  4NHW A;  4IP6 A;  4F0C A;  6GSU A;  4TR1 A;  2OBK A;  1T3B A;  3NIV A;  3ME7 A;  1F3B A;  1M9B A;  3EU3 A;  1A0R P;  3DRN A;  5GST A;  3HVX A;  2Z9S A;  13GS A;  4TRX A;  2XHF A;  2I1U A;  4K7I A;  1U3A A;  5EL8 A;  2B5Y A;  3LOR A;  2K8S A;  3HKR A;  4O92 A;  3EYT A;  1YQ1 A;  1U6T A;  3S9F A;  1PGT A;  3CSJ A;  2ALB A;  2LEG A;  2H76 A;  4V2L A;  1MD3 A;  2LKU A;  3UL3 A;  4PXO A;  4IW9 A;  1AQV A;  4YQU A;  2V1M A;  2N5F A;  1FO5 A;  3WYW A;  2L4Q A;  3BOA A;  4PX1 A;  3H79 A;  1TU8 A;  5AIS A;  4HJ2 A;  3N5O A;  4OCE A;  3VFI A;  3E3E A;  1K0B A;  2J23 A;  2F51 A;  2C0E A;  1T4Y A;  5LCZ A;  2YN1 A;  2A4V A;  4OO4 A;  4ZB8 A;  1BX9 A;  5B6M A;  5DAK B;  3HD5 A;  2MMZ A;  1M99 A;  3M0F A;  1ZL9 A;  3FRC A;  4IBP A;  5B8A A;  1VGL A;  2ZCT A;  5J3R A;  3O76 A;  2DLX A;  1M7T A;  1EV9 A;  4QL7 A;  4TKY A;  5LD0 A;  1R4W A;  4ULX A;  3IK9 A;  2X8G A;  2KUC A;  4K8M A;  1GUK A;  5DBQ A;  3TCO A;  4Q5N A;  2HLS A;  3CRT A;  3Q18 A;  4PGT A;  1FOV A;  1BQ7 A;  3F4R A;  5IO0 A;  1NSW A;  1WPI A;  4LL1 B;  1GTU A;  3E0U A;  3KJY A;  3FR6 A;  3LYP A;  2LST A;  3CYN A;  5C00 A;  1S3A A;  1PN9 A;  4DSS A;  2ZUP A;  4PUA A;  4HS1 A;  3H8Q A;  3ED3 A;  1EOG A;  4OO5 A;  5CYY A;  22GS A;  3G7Y A;  5AN1 A;  1A23 A;  4LMW A;  2B7J A;  4F9Z A;  1TP9 A;  3KP9 A;  4ZBD A;  2GST A;  3OR5 A;  3FW2 A;  2HFD A;  1K3L A;  4ZL8 A;  2DJK A;  3D6I A;  3GH6 A;  4BL7 A;  1M2D A;  2B6M A;  2E2M A;  2H8L A;  4NPB A;  4MP4 A;  3QFB C;  4EDY A;  1U88 A;  4EVM A;  1ACV A;  5INY A;  4BVX B;  3IAM 2;  1SKR B;  2CX3 A;  3TRQ A;  2HSN B;  3KP8 A;  2GQL A;  2FA8 A;  4WF4 A;  2OJL A;  2O7K A;  2YCD A;  1SYX A;  4GWR A;  5G30 A;  3D5J A;  2JSY A;  4USS A;  4EF0 A;  1JLV A;  5KN2 A;  4POL A;  1HNB A;  1MDJ A;  6GSX A;  1XFL A;  2GS3 A;  2IMK A;  2BJX A;  3MDK A;  2H70 A;  3QPM A;  4MH2 A;  1VF1 A;  3MWH A;  1VF3 A;  4ZB6 A;  2OE1 A;  3G7J A;  1Z7R A;  4PQI A;  4KSO A;  4WBR D;  4XS6 A;  1OC3 A;  3ZFL A;  3GTU B;  4POK A;  4POM A;  1TI3 A;  2X8C A;  2KP1 A;  4BPY A;  6GSS A;  2FWH A;  2C1Y A;  3HCZ A;  2GGT A;  2HRA A;  2CZ2 A;  2F8F A;  1X5C A;  17GS A;  4BWQ A;  3ZIT A;  3CTF A;  4V1A g;  2FA4 A;  5AIV A;  1WJK A;  2FGX A;  4X1U A;  4ACS A;  3P7X A;  5ENU A;  3HZ4 A;  4QL9 A;  1F6M C;  2VO4 A;  4JBB A;  2VL3 A;  2FY6 A;  2E0Q A;  3N9J A;  1XCC A;  3UAP A;  3TOU A;  2HT9 A;  3FY7 A;  2VD1 A;  1AIU A;  4BVY A;  4MCU A;  2JAD A;  2YOI A;  1MD4 A;  2OAD A;  4KX4 A;  5D96 A;  3LSZ A;  4F0B A;  1TRU A;  1C72 A;  4G9H A;  1TI1 A;  1QUW A;  5G2Z A;  3RHB A;  5COH A;  1SK2 A;  3BCI A;  3GV1 A;  1X0R A;  3VK9 A;  1O7U A;  1ERU A;  3APS A;  5DJM A;  2A2S A;  1PKW A;  5B6N A;  2HQT A;  3ZVJ D;  4KCA A;  2RII A;  4OMV A;  2YJH A;  5DAL B;  2BMX A;  3WGX A;  3IPZ A;  4EXJ A;  3DWV A;  2VCV A;  4X43 A;  3KGK A;  3QOU A;  7GSS A;  4FIW A;  3CMI A;  1GLQ A;  1K0A A;  1VF2 A;  1F3A A;  4ML1 A;  3L78 A;  1SKW B;  1TJD A;  3AY8 A;  1CQG A;  2WFC A;  4YQM A;  2OE0 A;  1SYR A;  1DE2 A;  3GMF A;  4MAB A;  3TDG A;  3ZIV A;  1K0D A;  1MEK A;  5J9C A;  3VPT A;  4KGI A;  2P0G A;  3F6D A;  3ZRE A;  2OKA A;  4WR4 A;  6GSV A;  3EE2 A;  3M9K A;  3U5R E;  4TXO B;  1SK0 A;  5F06 A;  2EIR A;  3GSS A;  3TKS A;  1QQ2 A;  16GS A;  2H0H A;  1U87 A;  4KA0 A;  1GTI A;  1TU7 A;  2HSY A;  3CTG A;  1KTE A;  4DEJ A;  3F0I A;  3LG6 A;  5B7C A;  4ECB A;  4Q5R A;  5G1L A;  4I2U A;  2H6Y A;  4GTU A;  3FKF A;  5ECL B;  2YWM A;  2LQO A;  2QGV A;  4G10 A;  1PL2 A;  5DCG A;  2R5G A;  1XVQ A;  3RAZ A;  4TR0 A;  4IGJ A;  1BYE A;  2XPE A;  5EPF A;  4I2T A;  2GQM A;  3DGQ A;  3MAK A;  1R5P A;  4WXT A;  4WF5 A;  5IPG A;  1YEX A;  2L6D A;  4AGS A;  1K0N A;  4FYC A;  3IV4 A;  5E4W A;  5E59 A;  5G31 A;  1N2A A;  3J7Y b;  3C1R A;  1THX A;  2HSM A;  5J9B A;  1E6B A;  4ECJ A;  1WE0 A;  1J08 A;  1YY7 A;  4L0U A;  1LBK A;  5CAX A;  3UEM A;  3G9B A;  1PX7 A;  6GST A;  3FR9 A;  1GSY A;  5IMD A;  4OFT A;  4HUA A;  1O8W A;  4E8H A;  3HY2 A;  3HJO A;  1X9S B;  5B8B A;  2HZE B;  4ZXG A;  2AHE A;  1T1V A;  1V40 A;  3VLN A;  1SJ6 A;  2GSQ A;  3GHA A;  2AJQ B;  1S3D A;  3KZQ A;  2VUP A;  2PBJ A;  3ERG A;  4K6X A;  4N11 A;  1HQO A;  2H6Z A;  2F3M A;  3FR3 A;  3GL3 A;  3ISO A;  1X9M B;  4TXO A;  5CNW A;  4GQF A;  4KE3 A;  4XTS A;  4NWY A;  2LV3 A;  5KN3 A;  5D9X A;  4TR3 A;  2AB6 A;  5ELA A;  3C71 A;  2MZC A;  5A4V A;  2JU5 A;  2VAF A;  2QSI A;  3RPP A;  1HD2 A;  2DBC A;  2FWE A;  3KMN A;  4OFN A;  1SU9 A;  3IA1 A;  2PER A;  3GRX A;  4DSQ A;  2HXK A;  3BJ5 A;  2CX4 A;  3GUS A;  5ECR B;  1EP8 A;  4F2I A;  4KSM A;  4V1A p;  1SL0 B;  2LJK A;  2DMM A;  2YZU A;  1GP1 A;  3KXO A;  4HEA 2;  3MSZ A;  3GKX A;  1TDI A;  3CRU A;  3P8W A;  4K1F A;  4NV5 A;  1V98 A;  3RBT A;  3VUR A;  2EIQ A;  4JZQ A;  2JZR A;  4FQU A;  2FCH A;  3EVI A;  2YPM A;  4D73 A;  2VIM A;  1XVW A;  5CP1 A;  20GS A;  2RUF A;  2TRX A;  5AGY A;  5EY6 A;  4KH7 A;  2LRT A;  3FHK A;  9GSS A;  1CQH A;  2AAW A;  1TTZ A;  2WCI A;  1A2J A;  3GKK A;  4HJM A;  1FW1 A;  3LXZ A;  5LNK e;  4LA1 A;  4MDC A;  2WUL A;  1H75 A;  3IAS 2;  2O85 A;  4IVF A;  2YWN A;  4EUY A;  2LRC A;  1YJ6 A;  6GSW A;  2H0I A;  4BWS A;  2DML A;  2AV4 A;  1R26 A;  5HFI A;  2H73 A;  2R4V A;  5DQS A;  4AJ8 A;  1TRV A;  5DCH A;  6GSY A;  5CRW A;  4EDZ A;  4WEY A;  2B5E A;  5ECO B;  2LQQ A;  4E8E A;  1GUL A;  2MBT A;  2WS2 A;  4ID0 A;  5DDL A;  4GXZ A;  4WR5 A;  1TKD B;  4YAP A;  4GSS A;  2QKE A;  2PN8 A;  2ZNM A;  1A24 A;  19GS A;  2PU9 C;  3I9V 2;  2NDO A;  3HDC A;  1M9A A;  3DD3 A;  3UIW A;  2GSR A;  3LWA A;  1TK8 B;  5DQY A;  1B9Y C;  3EWL A;  3DKS A;  2P5Q A;  2VM2 A;  2VCW A;  5CRD A;  1OKT A;  1K3O A;  1M2A A;  4GLT A;  1FG4 A;  5BMU A;  1ZGN A;  2IME A;  12GS A;  1ZOF A;  2NTO A;  1MTC A;  1ON4 A;  4HI7 A;  2FLS A;  4L5L A;  4IHU A;  2L5L A;  3GKN A;  5HR2 A;  1U3I A;  1YKC A;  3GIX A;  5ELG A;  5ECS A;  3TJK A;  3VI7 A;  1B9X C;  2GTU A; 
#chains in the Genus database with same CATH topology
 1ZMA A;  2B3S A;  2VL2 A;  1M0U A;  5FWG A;  1O85 A;  4MPG A;  5H5Q A;  4DSR A;  3EIN A;  2L5O A;  4K0G A;  1SVO A;  3CSI A;  5H5R A;  4EL1 A;  1TRW A;  4PQ1 A;  1GSQ A;  1BG5 A;  3QAV A;  2H6X A;  4ECC A;  2D2Z A;  5IOW A;  3F4T A;  2B1L A;  4Z7X A;  2VL9 A;  2KLX A;  1QK8 A;  3TOT A;  2P5R A;  3FEU A;  1XWA A;  5F07 A;  3IXR A;  1AXD A;  1S4B P;  2I9H A;  1XWB A;  4MK3 A;  1EV4 A;  2CAQ A;  5JCU A;  4TXV A;  2VKZ G;  4XCS A;  1V58 A;  5A34 A;  4ISD A;  3PR8 A;  4KND A;  3WD6 A;  3SWL A;  2HE3 A;  3UVH A;  5IMZ A;  4TOP A;  1ML6 A;  3LQ7 A;  4O5Q A;  4HOJ A;  3LYK A;  2DJ0 A;  2LJA A;  1O81 A;  4RUV A;  1HYU A;  3APO A;  4DVC A;  3M8N A;  4K0N A;  4FYB A;  4ZL7 A;  5J4U A;  3KMO A;  2MMN A;  5D9T A;  3QFA C;  1TXU A;  2FNO A;  3A2X A;  5DAK A;  2BTO T;  2WZS A;  3TKS C;  4PNG A;  3DML A;  1K0O A;  1YDK A;  4FXY P;  2G2Q A;  1BG1 A;  5ECP B;  2CT6 A;  2VCQ A;  4HU9 A;  1SEN A;  4O32 A;  5HR1 A;  1M2B A;  3M3M A;  1XWG A;  4HU7 A;  3M1G A;  3GX8 A;  1AQW A;  3KTB A;  4NV2 A;  3W8J A;  3FK8 A;  4OD7 A;  2XBI A;  3UAR A;  2IMD A;  2MYG A;  3GX0 A;  1XW6 A;  2V2G A;  3L9S A;  5G1K A;  2A2R A;  2YV9 A;  2H72 A;  2GT6 A;  1GSD A;  3L4N A;  2WJU A;  4Q5F A;  5D73 A;  1Z7P A;  4G0K A;  4MF5 A;  1BF5 A;  3HYP A;  2WVX B;  3IK7 A;  4NXI A;  3F3Q A;  2X64 A;  4GSN A;  1GL8 A;  4BVX A;  2JZT A;  2E7P A;  1FAA A;  2HSN A;  5GZZ B;  3L0H A;  4I5Q A;  1JZW A;  4KDU A;  3C7M A;  1PQN A;  2HRK B;  3WT2 A;  2HI7 A;  2KP2 A;  2M72 A;  3TKR A;  1GH2 A;  3ZML A;  4EIP A;  3DXB A;  3Q6O A;  11GS A;  4JRR A;  3FYG A;  1GLP A;  4PNF A;  1OC9 B;  1Y25 A;  3EPT A;  2QC7 A;  1V57 A;  1JZR A;  4X0X A;  2C8U A;  3IC8 A;  1MDK A;  1NM3 A;  2H1G A;  4GRF A;  1PRX A;  5J5N A;  1SVM A;  3TJF A;  1SVL A;  3TGZ A;  4GST A;  5KOX A;  3LXT A;  4K2X A;  3IBH A;  5F0G A;  2H0G A;  5JWQ B;  3GTU A;  2EFC A;  3J7Y k;  3A2V A;  3CHX C;  4AJ7 A;  4IS0 A;  4ZBA A;  2PGT A;  3Q19 A;  1B4P A;  1EWX A;  2YWO A;  5HFK A;  4I6X A;  5CRH A;  1EGR A;  3I69 A;  4LL4 B;  3F9U A;  4BIK A;  5JWR B;  3FZ4 A;  3F4S A;  5IOX A;  3DEX A;  4ICY A;  1BAY A;  3PH9 A;  1ZYE A;  3GH9 A;  4AKH A;  1TOF A;  3ERF A;  2B1K A;  3MNG A;  1FVK A;  1VF4 A;  3GST A;  3CXG A;  2VM1 A;  2CV4 A;  3H1N A;  4HZ2 A;  3D4M A;  1PFO A;  2H74 A;  4Q5Q A;  3U6V A;  3IC4 A;  2ON7 A;  4ILF A;  1FHE A;  5IIZ A;  2R6K A;  4NAX A;  1ABA A;  1X9W B;  3L9U A;  1XWK A;  2C3N A;  1SJZ A;  1G7O A;  1JHB A;  4N0V A;  1A2L A;  4IP1 A;  1SD9 A;  4Z2U A;  3C73 A;  3TKP A;  1YKA A;  1DUG A;  3W6G A;  2EIO A;  1OAZ A;  2L59 A;  5DAL A;  4J2F A;  1XZO A;  2R0G A;  3RPN A;  3VI5 A;  5IM9 A;  3HJM A;  3LW9 A;  2X4A A;  1TK0 B;  5JCW A;  2VD0 A;  4ZBB A;  2OBI A;  3TJG A;  1WOU A;  18GS A;  2WB9 A;  4K9Z A;  1I1I P;  1G0T A;  4WKW A;  1UN2 A;  4IN0 A;  4N30 A;  4LMV A;  4RI6 A;  3US3 A;  1AW9 A;  3VWW A;  2CA8 A;  2I4A A;  4KDX A;  4FYU A;  1ZCP A;  2IJY A;  2DJ2 A;  3R3E A;  1R7H A;  2HYX A;  2PUK C;  4XS4 B;  1JFU A;  5KOW A;  4LLR A;  4YQV A;  1R5A A;  1N25 A;  3IOS A;  1IYI A;  2FWF A;  5A4W A;  3DIE A;  3QAW A;  4RQR A;  1XPV A;  4EO3 A;  3WT1 A;  2C3Q A;  1XXU A;  1G6Y A;  3VWU A;  1K0C A;  4G2E A;  4OCF A;  2RM6 A;  2GZP A;  4TR1 B;  3DYR A;  2GQK A;  2CZ3 A;  1VRS D;  1Y6E A;  1S3C A;  2VL2 C;  1XBS A;  5G5E A;  3D4T A;  2DC5 A;  4MJE A;  3P90 A;  3PPU A;  3SBC A;  2EFD A;  1A8L A;  3GFK A;  1FB6 A;  2GDR A;  3RDW A;  3VWX A;  2CVK A;  8GSS A;  1BED A;  1DE1 A;  4ML6 A;  10GS A;  4MJB A;  4XS1 A;  3KM6 A;  1V2A A;  2K9F A;  2H66 A;  2IMI A;  4X4J A;  4JU5 A;  3NZN A;  5A1N A;  1V9W A;  5HR3 A;  4KDY A;  2TIR A;  3LGC A;  4MJA A;  1PKZ A;  4MLY A;  1PMT A;  1ZYP A;  2V6O A;  5IMV A;  2H1A A;  3LEF A;  4HQZ A;  2HNL A;  2KOK A;  2GT5 A;  2HZE A;  2HZF A;  3RGB C;  2LNT A;  1Q4J A;  1MDI A;  2X8H A;  1H4O A;  3C1S A;  4QQ7 A;  5A5H A;  5IO2 A;  3KD0 A;  4HDE A;  2H30 A;  3HMJ G;  2MMO A;  2DIZ A;  2F9S A;  3ZTL A;  3A5W A;  3ZFB A;  4PUF C;  2DJ3 A;  3GL5 A;  3R2Q A;  1AC1 A;  2HRN A;  2IN3 A;  1X5D A;  2RUE A;  1T4Z A;  5D9W A;  2J9H A;  2K6V A;  4DSS B;  4MZB A;  1I9D A;  1PA3 A;  3UOM A;  1W4V A;  3TRX A;  2YAN A;  5A4U A;  4TN8 A;  1EGO A;  2OT3 A;  1SJI A;  1TK5 B;  2H01 A;  3TKQ A;  1QFN A;  1A8Y A;  1HNC A;  2ON5 A;  3ERW A;  3V1W A;  1TRS A;  1B4Q A;  2C0F A;  4BL7 B;  5JWO B;  5ECN B;  2AUV A;  1XOA A;  3VPQ A;  3ZIJ A;  2M46 A;  3D22 A;  4KW6 A;  2VOC A;  1NHY A;  4I8B A;  2C0D A;  4EE0 A;  3IRA A;  3W8S A;  2X99 A;  1B48 A;  3NOF A;  1FOH A;  5D9V A;  4MH3 A;  4N0Z A;  1EP7 A;  4E68 A;  14GS A;  3EC3 A;  5FHI A;  4JE1 A;  5F05 A;  1OYJ A;  5FT3 A;  1O6J A;  5BRT A;  2XPD A;  1S3R A;  4W66 A;  2M80 A;  3C8E A;  3WGD A;  2G0F A;  1WRY A;  5GAP D;  2JZS A;  3IHQ A;  1HNA A;  2FHE A;  2PWJ A;  1EZK A;  2LTK A;  2H75 A;  3FZA A;  1YEP A;  4PQH A;  1UA5 A;  2XBQ A;  4KUN A;  2OA7 A;  3KTL A;  5IPH A;  4GF0 A;  4MNN A;  3PIN A;  1PX6 A;  3TB2 A;  4PUR A;  2DJ1 A;  2GLR A;  1Z9H A;  1E2Y A;  3KIJ A;  1O8X A;  5GSS A;  1FB0 A;  3QR6 A;  2V32 A;  1QMV A;  2YNX A;  2C4J A;  3ZLP A;  2GZY A;  4K2D A;  2WRT A;  2H71 A;  4CY8 A;  4TR4 A;  5C04 A;  4EIQ A;  4GCI A;  5GAN D;  3K8N A;  1LU4 A;  1TW9 A;  3A2W A;  4BVY B;  4TVE A;  1IYH A;  4MMM A;  1GUM A;  1F2E A;  4IQA A;  3CBU A;  5KN0 A;  4G19 A;  1XOB A;  1RQM A;  3BD2 A;  1SKS B;  3HVV A;  2REM A;  2IPA A;  2VCT A;  5KEJ A;  3LFL A;  1EEM A;  2IWT A;  5JCG A;  3I43 A;  3ZVJ A;  5A5K A;  2PVO C;  4XRD A;  4PTS A;  4XRA A;  3TJB A;  4XHM A;  3P2A A;  4ZIJ A;  1J9B A;  2WDU A;  3TKS E;  2VLV A;  1JLW A;  1RW1 A;  3IDV A;  1ERW A;  2GSS A;  2AYT A;  5ECH B;  2NVL A;  4OFM A;  2O87 A;  1X5E A;  4KF9 A;  3F8U A;  2DKI A;  3EUR A;  5L71 A;  1USB A;  1Z5Y E;  5J47 A;  4CHS A;  2WZ9 A;  5HFG A;  2O3E A;  1ZYN A;  3PGT A;  2MMA A;  3A3T A;  4WET A;  3HJP A;  4MPF A;  3QAG A;  1T00 A;  3JCM L;  3UBL A;  5D8I A;  5CRE A;  1OC8 A;  2EFH A;  5J4Y A;  2L4C A;  2FD3 A;  1KNG A;  1YF1 A;  2I3Y A;  2DIY A;  2I81 A;  2IIY A;  3FZ5 A;  2IMF A;  1A0F A;  1GTB A;  2LJR A;  3QCP A;  4YAV A;  3HZ8 A;  1AQX A;  3GNJ A;  2R3X A;  4K7N A;  4J56 E;  1FVJ A;  1Z3E A;  3TJJ A;  5EVO A;  2YV7 A;  2FUG 2;  1YZX A;  1F9M A;  2NPB A;  1ILO A;  2IL3 A;  3HHV A;  1T8E B;  1Z6M A;  1XW5 A;  4QMK A;  3HVS A;  3VWV A;  4HQS A;  4A5P A;  3UJ1 A;  2JAC A;  4CW9 A;  1NHO A;  1WP0 A;  4GQC A;  4CDO A;  5AIX A;  1EOH A;  4K7O A;  4JR6 A;  4RQX A;  1XIY A;  4WBJ A;  4JR4 A;  5IQY A;  1NW2 A;  3GYK A;  2JL4 A;  2F8A A;  4FO5 A;  2UZ8 A;  2V6K A;  3O6T A;  4V2M A;  4AF2 A;  4F82 A;  3ZL5 A;  1I5G A;  1ERT A;  3UMA A;  4IKH A;  1T7P B;  1GNW A;  4ECI A;  2CVB A;  1GWC A;  2HSM B;  4RI7 A;  4KB3 A;  2K8V A;  1AUC A;  2OE3 A;  4N3Z A;  3EMP A;  2PPT A;  1ERV A;  3H93 A;  2C3T A;  5J41 A;  3QD9 A;  5IMA A;  2K18 A;  3TUE A;  3EU4 A;  4IJ3 A;  1K3Y A;  3IR4 A;  1GSU A;  5ECI B;  3E9J B;  2DSA A;  3GN3 A;  2O8V B;  5F8B A;  3M9J A;  1SL1 B;  1EEJ A;  2VCX A;  4Z2R A;  1N8J A;  2WVX A;  2LUS A;  2L57 A;  1UC7 A;  1WWJ A;  5H5S A;  1GSE A;  3ME8 A;  5ID2 B;  4PHZ C;  1UVZ A;  3CSH A;  4OWY A;  5HR0 A;  1GNE A;  1SK1 A;  1ZZY A;  1QXH A;  4HZ4 A;  3DVW A;  2HRK A;  4MF7 A;  3TU3 B;  3HXS A;  1THO A;  4MA9 A;  2R0P A;  2FWG A;  2VLT A;  2YZH A;  2IFQ B;  3I6A A;  1LJR A;  1W89 A;  5ECQ B;  5DJL A;  2OAC A;  1GTA A;  1OC9 A;  3ZZX A;  1OE7 A;  3BBY A;  1ST9 A;  4AJ6 A;  4AI6 A;  3KH7 A;  4FH8 A;  1KBN A;  5HQP A;  1TXX A;  4V2N A;  4ZB9 A;  1RK4 A;  4NHZ A;  3D21 A;  2MBS A;  1G6W A;  3F6F A;  1XWC A;  3GA4 A;  1OKD A;  4L5O A;  4AKX B;  2EC4 A;  1WIK A;  3HA9 A;  2O89 A;  1OE8 A;  1GSF A;  4D73 B;  1XW9 A;  1ZYQ B;  4GDF A;  4KAE A;  5IMC A;  3QMX A;  2ES7 A;  1PL1 A;  5ABR A;  4MZW A;  4YH2 A;  1DSB A;  3LJR A;  1G7E A;  3IE3 A;  1YF0 A;  1J0F A;  1Q98 A;  3RHC A;  4O5R A;  5IMF A;  1BJX A;  2CVD A;  1B8X A;  4NMU A;  4TW5 A;  1YVL A;  4XIH A;  1GUH A;  4J57 E;  3ZRD A;  4EC0 A;  2GVP A;  4L8E A;  4O7H A;  1PD2 1;  4MF6 A;  1JZO A;  4IQ1 A;  2LRN A;  2E2G A;  5J4V A;  5KN1 A;  4ZIL A;  2L6C A;  2YP6 A;  5ID2 A;  3EMX A;  1WMJ A;  4F03 A;  2VLU A;  1SL2 B;  1PSQ A;  5CRG A;  2HRF A;  2PVQ A;  2V41 A;  2GZZ A;  5D93 A;  2JSZ A;  3BCK A;  2KHP A;  2CQ9 A;  4G01 A;  3KH9 A;  2LS5 A;  2IFQ A;  2N5B A;  2YWI A;  1AAZ A;  1KEB A;  4EKZ A;  4G0I A;  2NBS A;  4N10 A;  2YJ7 A;  3ZMK A;  2HSH A;  5ECK B;  3F63 A;  1O73 A;  2TRC P;  4HSC X;  1GSS A;  1JZD A;  2DJJ A;  2B7K A;  1A2M A;  3F3R A;  3DVX A;  2C80 A;  1URM A;  2P31 A;  1SD8 A;  3UBK A;  3TRP A;  2R37 A;  2RLI A;  4MZC A;  3GUR A;  1OVN A;  5BMU B;  2PMT A;  2LNS A;  1Z6N A;  3O3T A;  2WGR A;  4L0W A;  3L9V A;  1K0M A;  3FZ9 A;  4H86 A;  3GKM A;  3UVT A;  2C0G A;  2R2J A;  1GRX A;  2N5A A;  3APQ A;  4BA7 A;  3Q74 A;  4XS4 A;  2H1D A;  3ZYW A;  4P3Y B;  4IJI A;  2H1B A;  4G0L A;  5DVB A;  3QDN A;  3KCM A;  5ECM B;  5CO3 A;  2H19 A;  3WGE A;  3G7I A;  3KEB A;  2CAI A;  4I97 A;  1QGV A;  1YEW C;  4POB A;  1F37 A;  1DBY A;  4ZL9 A;  4KCE A;  5G5F A;  4JED A;  2XC2 A;  2O5V A;  3D0Z A;  4MJC A;  2RM5 A;  4ZB7 A;  4IEL A;  2VCZ A;  2B5X A;  3H4K A;  4NHW A;  4IP6 A;  4F0C A;  6GSU A;  4TR1 A;  2OBK A;  1T3B A;  3NIV A;  3ME7 A;  1F3B A;  1M9B A;  3EU3 A;  1A0R P;  3DRN A;  5GST A;  3HVX A;  2Z9S A;  13GS A;  4TRX A;  2XHF A;  2I1U A;  4K7I A;  1U3A A;  5EL8 A;  2B5Y A;  3LOR A;  2K8S A;  3HKR A;  4O92 A;  3EYT A;  1YQ1 A;  1U6T A;  3S9F A;  1PGT A;  3CSJ A;  2ALB A;  2LEG A;  2H76 A;  5A34 B;  4V2L A;  1MD3 A;  2LKU A;  3UL3 A;  4PXO A;  4IW9 A;  3A5I A;  1AQV A;  3CWG A;  4YQU A;  2V1M A;  2N5F A;  1FO5 A;  3WYW A;  2L4Q A;  3BOA A;  4PX1 A;  3H79 A;  1TU8 A;  5AIS A;  4HJ2 A;  3N5O A;  4OCE A;  3VFI A;  3E3E A;  1K0B A;  2J23 A;  2F51 A;  2C0E A;  1T4Y A;  5LCZ A;  2YN1 A;  2A4V A;  4OO4 A;  4ZB8 A;  2WW0 A;  1BX9 A;  5B6M A;  5DAK B;  4PI2 C;  3HD5 A;  2MMZ A;  1M99 A;  3M0F A;  1ZL9 A;  3FRC A;  4IBP A;  5B8A A;  1VGL A;  2ZCT A;  5J3R A;  3O76 A;  2DLX A;  1M7T A;  1EV9 A;  4QL7 A;  4TKY A;  5LD0 A;  1R4W A;  4ULX A;  4Z2T A;  3IK9 A;  2WW1 A;  2X8G A;  2KUC A;  4K8M A;  1GUK A;  5DBQ A;  3TCO A;  4Q5N A;  2HLS A;  3CRT A;  3Q18 A;  4PGT A;  1FOV A;  1BQ7 A;  2R0C A;  3F4R A;  4K5R A;  5IO0 A;  1NSW A;  1WPI A;  3MYD A;  4LL1 B;  2DKH A;  1GTU A;  3E0U A;  3KJY A;  3FR6 A;  3LYP A;  2LST A;  3CYN A;  5C00 A;  1S3A A;  1PN9 A;  4DSS A;  2ZUP A;  4PUA A;  4HS1 A;  3ED3 A;  3H8Q A;  1EOG A;  4OO5 A;  5CYY A;  22GS A;  3G7Y A;  5AN1 A;  1A23 A;  4LMW A;  2B7J A;  4F9Z A;  1TP9 A;  3KP9 A;  4ZBD A;  2GST A;  3OR5 A;  3FW2 A;  2HFD A;  1K3L A;  4ZL8 A;  2DJK A;  3D6I A;  3GH6 A;  4BL7 A;  2X49 A;  1M2D A;  2B6M A;  2E2M A;  2H8L A;  4NPB A;  4MP4 A;  3QFB C;  4EDY A;  1U88 A;  4EVM A;  1ACV A;  5INY A;  4BVX B;  3IAM 2;  1SKR B;  2CX3 A;  3TRQ A;  2HSN B;  3KP8 A;  2WVZ A;  2GQL A;  2FA8 A;  4WF4 A;  2OJL A;  2O7K A;  2YCD A;  1SYX A;  4GWR A;  5G30 A;  2WVY A;  3D5J A;  2JSY A;  4USS A;  4EF0 A;  1JLV A;  5KN2 A;  4POL A;  1HNB A;  1MDJ A;  6GSX A;  1XFL A;  2GS3 A;  2IMK A;  2BJX A;  3MDK A;  2H70 A;  3QPM A;  4MH2 A;  1VF1 A;  3MWH A;  1VF3 A;  4ZB6 A;  2OE1 A;  3G7J A;  1Z7R A;  4PQI A;  4KSO A;  4WBR D;  4XS6 A;  1OC3 A;  3ZFL A;  3GTU B;  4POK A;  4POM A;  1TI3 A;  2X8C A;  2KP1 A;  4BPY A;  2H1L A;  6GSS A;  2FWH A;  2C1Y A;  3HCZ A;  2GGT A;  2HRA A;  2CZ2 A;  2F8F A;  1X5C A;  17GS A;  4BWQ A;  3ZIT A;  3CQF A;  3CTF A;  4V1A g;  2QA2 A;  2FA4 A;  5AIV A;  4PI0 C;  1WJK A;  2FGX A;  4X1U A;  4O5U A;  3IHG A;  4ACS A;  3P7X A;  5ENU A;  3HZ4 A;  4QL9 A;  1F6M C;  2VO4 A;  4JBB A;  2VL3 A;  2FY6 A;  2E0Q A;  3N9J A;  1XCC A;  4YKG A;  4YKF A;  3UAP A;  3TOU A;  2HT9 A;  3FY7 A;  2VD1 A;  1AIU A;  4BVY A;  4MCU A;  2JAD A;  2YOI A;  1MD4 A;  2OAD A;  4KX4 A;  5D96 A;  3LSZ A;  4F0B A;  1TRU A;  1C72 A;  4G9H A;  1TI1 A;  1QUW A;  1PN0 A;  5G2Z A;  3RHB A;  5COH A;  1SK2 A;  3BCI A;  3GV1 A;  1X0R A;  3VK9 A;  1O7U A;  1ERU A;  3APS A;  3MIX A;  2O36 A;  2A2S A;  5DJM A;  1PKW A;  5B6N A;  2HQT A;  2A2P A;  3ZVJ D;  4KCA A;  2RII A;  4OMV A;  1M3I A;  2YJH A;  5DAL B;  2BMX A;  3WGX A;  3IPZ A;  4EXJ A;  3DWV A;  2VCV A;  4X43 A;  3KGK A;  3QOU A;  7GSS A;  4FIW A;  3CMI A;  1GLQ A;  1K0A A;  1VF2 A;  1F3A A;  4ML1 A;  3L78 A;  1SKW B;  1TJD A;  3AY8 A;  1CQG A;  2WFC A;  4YQM A;  2OE0 A;  1SYR A;  1DE2 A;  3GMF A;  4MAB A;  3TDG A;  3ZIV A;  1K0D A;  1MEK A;  5J9C A;  3VPT A;  4KGI A;  2P0G A;  3F6D A;  3ZRE A;  2OKA A;  4WR4 A;  6GSV A;  3EE2 A;  3M9K A;  3U5R E;  4TXO B;  1SK0 A;  5F06 A;  2EIR A;  3GSS A;  3TKS A;  1QQ2 A;  16GS A;  2H0H A;  1U87 A;  4KA0 A;  1GTI A;  1TU7 A;  2HSY A;  3CTG A;  1KTE A;  4DEJ A;  3F0I A;  3LG6 A;  5B7C A;  2UV8 G;  4ECB A;  4Q5R A;  5G1L A;  4I2U A;  2H6Y A;  4GTU A;  3FKF A;  5ECL B;  2YWM A;  2LQO A;  2QGV A;  4G10 A;  1PL2 A;  5DCG A;  2R5G A;  1XVQ A;  3RAZ A;  4TR0 A;  4IGJ A;  1BYE A;  2XPE A;  5EPF A;  4I2T A;  2GQM A;  3DGQ A;  3MAK A;  1R5P A;  4WXT A;  2WW2 A;  4AKG A;  4WF5 A;  5IPG A;  1YEX A;  5A1N B;  2L6D A;  4AGS A;  1K0N A;  4FYC A;  3IV4 A;  5E4W A;  5E59 A;  5G31 A;  1N2A A;  3J7Y b;  3C1R A;  1THX A;  2HSM A;  5J9B A;  1E6B A;  4ECJ A;  1WE0 A;  1XG8 A;  1J08 A;  1YY7 A;  4L0U A;  1LBK A;  5CAX A;  3UEM A;  3G9B A;  1PX7 A;  6GST A;  3FR9 A;  1GSY A;  5IMD A;  4OFT A;  1O8W A;  4HUA A;  4E8H A;  3HY2 A;  3HJO A;  1X9S B;  5B8B A;  2HZE B;  4ZXG A;  2AHE A;  2QA1 A;  1T1V A;  1V40 A;  3VLN A;  1SJ6 A;  4CY6 A;  5A5H B;  2GSQ A;  3GHA A;  2AJQ B;  1S3D A;  3KZQ A;  2VUP A;  2PBJ A;  3ERG A;  4K6X A;  4N11 A;  1HQO A;  2H6Z A;  2F3M A;  3FR3 A;  3GL3 A;  3ISO A;  1X9M B;  4TXO A;  5CNW A;  4GQF A;  4KE3 A;  4XTS A;  4NWY A;  2LV3 A;  5KN3 A;  5D9X A;  4TR3 A;  2AB6 A;  5ELA A;  3C71 A;  2MZC A;  5A4V A;  2JU5 A;  2VAF A;  2QSI A;  3RPP A;  1HD2 A;  2A4H A;  2DBC A;  2FWE A;  3KMN A;  4OFN A;  1SU9 A;  3IA1 A;  2PER A;  3GRX A;  4DSQ A;  2HXK A;  3BJ5 A;  2CX4 A;  3GUS A;  5ECR B;  1EP8 A;  4F2I A;  4KSM A;  4V1A p;  1SL0 B;  2LJK A;  2DMM A;  2YZU A;  1GP1 A;  3KXO A;  2EFE A;  4HEA 2;  3MSZ A;  3GKX A;  1TDI A;  3CRU A;  3P8W A;  4K1F A;  4AKI A;  4NV5 A;  1V98 A;  3RBT A;  3VUR A;  2EIQ A;  4JZQ A;  2JZR A;  4FQU A;  2FCH A;  3EVI A;  2YPM A;  4D73 A;  2VIM A;  1XVW A;  5CP1 A;  1M3J A;  20GS A;  2RUF A;  2TRX A;  5AGY A;  5EY6 A;  4KH7 A;  2LRT A;  3FHK A;  9GSS A;  1CQH A;  2AAW A;  1TTZ A;  2WCI A;  1A2J A;  3GKK A;  4HJM A;  1FW1 A;  3LXZ A;  5LNK e;  4LA1 A;  4MDC A;  2WUL A;  1H75 A;  3IAS 2;  2O85 A;  4IVF A;  2YWN A;  4EUY A;  2LRC A;  1YJ6 A;  6GSW A;  2H0I A;  3RFR C;  4BWS A;  2DML A;  2AV4 A;  1R26 A;  5HFI A;  2H73 A;  2R4V A;  5DQS A;  4AJ8 A;  1TRV A;  5DCH A;  6GSY A;  5CRW A;  4EDZ A;  4WEY A;  2B5E A;  5ECO B;  2LQQ A;  4E8E A;  1GUL A;  5J40 A;  2MBT A;  2WS2 A;  4ID0 A;  5DDL A;  4GXZ A;  4WR5 A;  1TKD B;  4YAP A;  4GSS A;  2QKE A;  2PN8 A;  2ZNM A;  1A24 A;  19GS A;  2PU9 C;  3I9V 2;  2NDO A;  3HDC A;  1M9A A;  3DD3 A;  3FMW A;  3UIW A;  2GSR A;  3LWA A;  1TK8 B;  5DQY A;  1B9Y C;  3EWL A;  3HVN A;  1Y1U A;  3DKS A;  2P5Q A;  2VM2 A;  2VCW A;  5CRD A;  1OKT A;  1K3O A;  1M2A A;  4GLT A;  1FG4 A;  5BMU A;  1ZGN A;  2IME A;  12GS A;  1ZOF A;  2NTO A;  1MTC A;  4K5S A;  1ON4 A;  4HI7 A;  2FLS A;  4L5L A;  4IHU A;  2L5L A;  2WW3 A;  3GKN A;  5HR2 A;  1U3I A;  1YKC A;  3GIX A;  5ELG A;  5ECS A;  3TJK A;  3VI7 A;  1B9X C;  2GTU A; 
#chains in the Genus database with same CATH homology
 1ZMA A;  2B3S A;  2VL2 A;  1M0U A;  5FWG A;  1O85 A;  4MPG A;  5H5Q A;  4DSR A;  3EIN A;  2L5O A;  4K0G A;  1SVO A;  3CSI A;  5H5R A;  4EL1 A;  1TRW A;  4PQ1 A;  1GSQ A;  1BG5 A;  3QAV A;  2H6X A;  4ECC A;  2D2Z A;  5IOW A;  3F4T A;  2B1L A;  4Z7X A;  2VL9 A;  2KLX A;  1QK8 A;  3TOT A;  2P5R A;  3FEU A;  1XWA A;  5F07 A;  3IXR A;  1AXD A;  2I9H A;  1XWB A;  4MK3 A;  1EV4 A;  2CAQ A;  5JCU A;  4TXV A;  2VKZ G;  4XCS A;  1V58 A;  5A34 A;  4ISD A;  3PR8 A;  4KND A;  3WD6 A;  3SWL A;  2HE3 A;  3UVH A;  5IMZ A;  4TOP A;  1ML6 A;  3LQ7 A;  4O5Q A;  4HOJ A;  3LYK A;  2DJ0 A;  2LJA A;  1O81 A;  4RUV A;  1HYU A;  3APO A;  4DVC A;  3M8N A;  4K0N A;  4FYB A;  4ZL7 A;  5J4U A;  3KMO A;  2MMN A;  5D9T A;  3QFA C;  1TXU A;  2FNO A;  3A2X A;  5DAK A;  2BTO T;  3TKS C;  4PNG A;  3DML A;  1K0O A;  1YDK A;  2G2Q A;  1BG1 A;  5ECP B;  2CT6 A;  2VCQ A;  4HU9 A;  1SEN A;  4O32 A;  5HR1 A;  1M2B A;  3M3M A;  1XWG A;  4HU7 A;  3M1G A;  3GX8 A;  1AQW A;  3KTB A;  4NV2 A;  3W8J A;  3FK8 A;  4OD7 A;  2XBI A;  3UAR A;  2IMD A;  2MYG A;  3GX0 A;  1XW6 A;  2V2G A;  3L9S A;  5G1K A;  2A2R A;  2YV9 A;  2H72 A;  2GT6 A;  1GSD A;  3L4N A;  2WJU A;  4Q5F A;  5D73 A;  1Z7P A;  4G0K A;  4MF5 A;  1BF5 A;  3HYP A;  3IK7 A;  4NXI A;  3F3Q A;  2X64 A;  4GSN A;  1GL8 A;  4BVX A;  2JZT A;  2E7P A;  1FAA A;  2HSN A;  5GZZ B;  3L0H A;  4I5Q A;  1JZW A;  4KDU A;  3C7M A;  1PQN A;  2HRK B;  3WT2 A;  2HI7 A;  2KP2 A;  2M72 A;  3TKR A;  1GH2 A;  3ZML A;  4EIP A;  3DXB A;  3Q6O A;  11GS A;  4JRR A;  3FYG A;  1GLP A;  4PNF A;  1OC9 B;  1Y25 A;  3EPT A;  2QC7 A;  1V57 A;  1JZR A;  4X0X A;  2C8U A;  3IC8 A;  1MDK A;  1NM3 A;  2H1G A;  4GRF A;  1PRX A;  5J5N A;  1SVM A;  3TJF A;  1SVL A;  3TGZ A;  4GST A;  5KOX A;  3LXT A;  4K2X A;  3IBH A;  5F0G A;  2H0G A;  5JWQ B;  3GTU A;  2EFC A;  3J7Y k;  3A2V A;  4AJ7 A;  4IS0 A;  4ZBA A;  2PGT A;  3Q19 A;  1B4P A;  1EWX A;  2YWO A;  5HFK A;  4I6X A;  5CRH A;  1EGR A;  3I69 A;  4LL4 B;  3F9U A;  5JWR B;  3FZ4 A;  3F4S A;  5IOX A;  3DEX A;  4ICY A;  1BAY A;  3PH9 A;  1ZYE A;  3GH9 A;  4AKH A;  1TOF A;  3ERF A;  2B1K A;  3MNG A;  1FVK A;  1VF4 A;  3GST A;  3CXG A;  2VM1 A;  2CV4 A;  3H1N A;  4HZ2 A;  3D4M A;  2H74 A;  4Q5Q A;  3U6V A;  3IC4 A;  2ON7 A;  4ILF A;  1FHE A;  5IIZ A;  2R6K A;  4NAX A;  1ABA A;  1X9W B;  3L9U A;  1XWK A;  2C3N A;  1SJZ A;  1G7O A;  1JHB A;  4N0V A;  1A2L A;  4IP1 A;  1SD9 A;  4Z2U A;  3C73 A;  3TKP A;  1YKA A;  1DUG A;  3W6G A;  2EIO A;  1OAZ A;  2L59 A;  5DAL A;  4J2F A;  1XZO A;  2R0G A;  3RPN A;  3VI5 A;  5IM9 A;  3HJM A;  3LW9 A;  2X4A A;  1TK0 B;  5JCW A;  2VD0 A;  4ZBB A;  2OBI A;  3TJG A;  1WOU A;  18GS A;  2WB9 A;  4K9Z A;  1G0T A;  4WKW A;  1UN2 A;  4IN0 A;  4N30 A;  4LMV A;  4RI6 A;  3US3 A;  1AW9 A;  3VWW A;  2CA8 A;  2I4A A;  4KDX A;  4FYU A;  1ZCP A;  2IJY A;  2DJ2 A;  3R3E A;  1R7H A;  2HYX A;  2PUK C;  4XS4 B;  1JFU A;  5KOW A;  4LLR A;  4YQV A;  1R5A A;  1N25 A;  3IOS A;  1IYI A;  2FWF A;  5A4W A;  3DIE A;  3QAW A;  4RQR A;  1XPV A;  4EO3 A;  3WT1 A;  2C3Q A;  1XXU A;  1G6Y A;  3VWU A;  1K0C A;  4G2E A;  4OCF A;  2RM6 A;  2GZP A;  4TR1 B;  3DYR A;  2GQK A;  2CZ3 A;  1VRS D;  1Y6E A;  1S3C A;  2VL2 C;  1XBS A;  5G5E A;  3D4T A;  2DC5 A;  4MJE A;  3P90 A;  3PPU A;  3SBC A;  2EFD A;  1A8L A;  3GFK A;  1FB6 A;  2GDR A;  3RDW A;  3VWX A;  2CVK A;  8GSS A;  1BED A;  1DE1 A;  4ML6 A;  10GS A;  4MJB A;  4XS1 A;  3KM6 A;  1V2A A;  2K9F A;  2H66 A;  2IMI A;  4X4J A;  4JU5 A;  3NZN A;  5A1N A;  1V9W A;  5HR3 A;  4KDY A;  2TIR A;  3LGC A;  4MJA A;  1PKZ A;  4MLY A;  1PMT A;  1ZYP A;  2V6O A;  5IMV A;  2H1A A;  3LEF A;  4HQZ A;  2HNL A;  2KOK A;  2GT5 A;  2HZE A;  2HZF A;  2LNT A;  1Q4J A;  1MDI A;  2X8H A;  1H4O A;  3C1S A;  4QQ7 A;  5A5H A;  5IO2 A;  3KD0 A;  4HDE A;  2H30 A;  3HMJ G;  2MMO A;  2DIZ A;  2F9S A;  3ZTL A;  3A5W A;  3ZFB A;  4PUF C;  2DJ3 A;  3GL5 A;  3R2Q A;  1AC1 A;  2HRN A;  2IN3 A;  1X5D A;  2RUE A;  1T4Z A;  5D9W A;  2J9H A;  2K6V A;  4DSS B;  4MZB A;  1I9D A;  1PA3 A;  3UOM A;  1W4V A;  3TRX A;  2YAN A;  5A4U A;  4TN8 A;  1EGO A;  2OT3 A;  1SJI A;  1TK5 B;  2H01 A;  3TKQ A;  1QFN A;  1A8Y A;  1HNC A;  2ON5 A;  3ERW A;  3V1W A;  1TRS A;  1B4Q A;  2C0F A;  4BL7 B;  5JWO B;  5ECN B;  2AUV A;  1XOA A;  3VPQ A;  3ZIJ A;  2M46 A;  3D22 A;  4KW6 A;  2VOC A;  1NHY A;  4I8B A;  2C0D A;  4EE0 A;  3IRA A;  3W8S A;  2X99 A;  1B48 A;  3NOF A;  1FOH A;  5D9V A;  4MH3 A;  4N0Z A;  1EP7 A;  4E68 A;  14GS A;  3EC3 A;  5FHI A;  4JE1 A;  5F05 A;  1OYJ A;  5FT3 A;  1O6J A;  5BRT A;  2XPD A;  4W66 A;  2M80 A;  3C8E A;  3WGD A;  2G0F A;  1WRY A;  5GAP D;  2JZS A;  3IHQ A;  1HNA A;  2FHE A;  2PWJ A;  1EZK A;  2LTK A;  2H75 A;  3FZA A;  1YEP A;  4PQH A;  1UA5 A;  2XBQ A;  4KUN A;  2OA7 A;  3KTL A;  5IPH A;  4GF0 A;  4MNN A;  3PIN A;  1PX6 A;  3TB2 A;  4PUR A;  2DJ1 A;  2GLR A;  1Z9H A;  1E2Y A;  3KIJ A;  1O8X A;  5GSS A;  1FB0 A;  3QR6 A;  2V32 A;  1QMV A;  2YNX A;  2C4J A;  3ZLP A;  2GZY A;  4K2D A;  2WRT A;  2H71 A;  4CY8 A;  4TR4 A;  5C04 A;  4EIQ A;  4GCI A;  5GAN D;  3K8N A;  1LU4 A;  1TW9 A;  3A2W A;  4BVY B;  4TVE A;  1IYH A;  4MMM A;  1GUM A;  1F2E A;  4IQA A;  3CBU A;  5KN0 A;  4G19 A;  1XOB A;  1RQM A;  3BD2 A;  1SKS B;  3HVV A;  2REM A;  2IPA A;  2VCT A;  5KEJ A;  3LFL A;  1EEM A;  2IWT A;  5JCG A;  3I43 A;  3ZVJ A;  5A5K A;  2PVO C;  4XRD A;  4PTS A;  4XRA A;  3TJB A;  4XHM A;  3P2A A;  4ZIJ A;  1J9B A;  2WDU A;  3TKS E;  2VLV A;  1JLW A;  1RW1 A;  3IDV A;  1ERW A;  2GSS A;  2AYT A;  5ECH B;  2NVL A;  4OFM A;  2O87 A;  1X5E A;  4KF9 A;  3F8U A;  2DKI A;  3EUR A;  5L71 A;  1USB A;  1Z5Y E;  5J47 A;  4CHS A;  2WZ9 A;  5HFG A;  1ZYN A;  3PGT A;  2MMA A;  3A3T A;  4WET A;  3HJP A;  4MPF A;  3QAG A;  1T00 A;  3JCM L;  3UBL A;  5D8I A;  5CRE A;  1OC8 A;  2EFH A;  5J4Y A;  2L4C A;  2FD3 A;  1KNG A;  1YF1 A;  2I3Y A;  2DIY A;  2I81 A;  2IIY A;  3FZ5 A;  2IMF A;  1A0F A;  1GTB A;  2LJR A;  3QCP A;  4YAV A;  3HZ8 A;  1AQX A;  3GNJ A;  2R3X A;  4K7N A;  4J56 E;  1FVJ A;  1Z3E A;  3TJJ A;  5EVO A;  2YV7 A;  2FUG 2;  1YZX A;  1F9M A;  2NPB A;  1ILO A;  2IL3 A;  3HHV A;  1T8E B;  1Z6M A;  1XW5 A;  4QMK A;  3HVS A;  3VWV A;  4HQS A;  4A5P A;  3UJ1 A;  2JAC A;  4CW9 A;  1NHO A;  1WP0 A;  4GQC A;  4CDO A;  5AIX A;  1EOH A;  4K7O A;  4JR6 A;  4RQX A;  1XIY A;  4WBJ A;  4JR4 A;  5IQY A;  1NW2 A;  3GYK A;  2JL4 A;  2F8A A;  4FO5 A;  2UZ8 A;  2V6K A;  3O6T A;  4V2M A;  4AF2 A;  4F82 A;  3ZL5 A;  1I5G A;  1ERT A;  3UMA A;  4IKH A;  1T7P B;  1GNW A;  4ECI A;  2CVB A;  1GWC A;  2HSM B;  4RI7 A;  4KB3 A;  2K8V A;  1AUC A;  2OE3 A;  4N3Z A;  3EMP A;  2PPT A;  1ERV A;  3H93 A;  2C3T A;  5J41 A;  3QD9 A;  5IMA A;  2K18 A;  3TUE A;  3EU4 A;  4IJ3 A;  1K3Y A;  3IR4 A;  1GSU A;  5ECI B;  3E9J B;  2DSA A;  3GN3 A;  2O8V B;  5F8B A;  3M9J A;  1SL1 B;  1EEJ A;  2VCX A;  4Z2R A;  1N8J A;  2LUS A;  2L57 A;  1UC7 A;  1WWJ A;  5H5S A;  1GSE A;  3ME8 A;  5ID2 B;  1UVZ A;  3CSH A;  4OWY A;  5HR0 A;  1GNE A;  1SK1 A;  1ZZY A;  1QXH A;  4HZ4 A;  3DVW A;  2HRK A;  4MF7 A;  3TU3 B;  3HXS A;  1THO A;  4MA9 A;  2R0P A;  2FWG A;  2VLT A;  2YZH A;  2IFQ B;  3I6A A;  1LJR A;  1W89 A;  5ECQ B;  5DJL A;  2OAC A;  1GTA A;  1OC9 A;  3ZZX A;  1OE7 A;  3BBY A;  1ST9 A;  4AJ6 A;  4AI6 A;  3KH7 A;  4FH8 A;  1KBN A;  5HQP A;  1TXX A;  4V2N A;  4ZB9 A;  1RK4 A;  4NHZ A;  3D21 A;  2MBS A;  1G6W A;  3F6F A;  1XWC A;  3GA4 A;  1OKD A;  4L5O A;  4AKX B;  2EC4 A;  1WIK A;  3HA9 A;  2O89 A;  1OE8 A;  1GSF A;  4D73 B;  1XW9 A;  1ZYQ B;  4GDF A;  4KAE A;  5IMC A;  3QMX A;  2ES7 A;  1PL1 A;  5ABR A;  4MZW A;  4YH2 A;  1DSB A;  3LJR A;  1G7E A;  3IE3 A;  1YF0 A;  1J0F A;  1Q98 A;  3RHC A;  4O5R A;  5IMF A;  1BJX A;  2CVD A;  1B8X A;  4NMU A;  4TW5 A;  1YVL A;  4XIH A;  1GUH A;  4J57 E;  3ZRD A;  4EC0 A;  2GVP A;  4L8E A;  4O7H A;  1PD2 1;  4MF6 A;  1JZO A;  4IQ1 A;  2LRN A;  2E2G A;  5J4V A;  5KN1 A;  4ZIL A;  2L6C A;  2YP6 A;  5ID2 A;  3EMX A;  1WMJ A;  4F03 A;  2VLU A;  1SL2 B;  1PSQ A;  5CRG A;  2HRF A;  2PVQ A;  2V41 A;  2GZZ A;  5D93 A;  2JSZ A;  3BCK A;  2KHP A;  2CQ9 A;  4G01 A;  3KH9 A;  2LS5 A;  2IFQ A;  2N5B A;  2YWI A;  1AAZ A;  1KEB A;  4EKZ A;  4G0I A;  2NBS A;  4N10 A;  2YJ7 A;  3ZMK A;  2HSH A;  5ECK B;  3F63 A;  1O73 A;  2TRC P;  1GSS A;  1JZD A;  2DJJ A;  2B7K A;  1A2M A;  3F3R A;  3DVX A;  2C80 A;  1URM A;  2P31 A;  1SD8 A;  3UBK A;  3TRP A;  2R37 A;  2RLI A;  4MZC A;  3GUR A;  1OVN A;  5BMU B;  2PMT A;  2LNS A;  1Z6N A;  3O3T A;  2WGR A;  4L0W A;  3L9V A;  1K0M A;  3FZ9 A;  4H86 A;  3GKM A;  3UVT A;  2C0G A;  2R2J A;  1GRX A;  2N5A A;  3APQ A;  4BA7 A;  3Q74 A;  4XS4 A;  2H1D A;  3ZYW A;  4P3Y B;  4IJI A;  2H1B A;  4G0L A;  5DVB A;  3QDN A;  3KCM A;  5ECM B;  5CO3 A;  2H19 A;  3WGE A;  3G7I A;  3KEB A;  2CAI A;  4I97 A;  1QGV A;  4POB A;  1F37 A;  1DBY A;  4ZL9 A;  4KCE A;  5G5F A;  4JED A;  2XC2 A;  2O5V A;  3D0Z A;  4MJC A;  2RM5 A;  4ZB7 A;  4IEL A;  2VCZ A;  2B5X A;  3H4K A;  4NHW A;  4IP6 A;  4F0C A;  6GSU A;  4TR1 A;  2OBK A;  1T3B A;  3NIV A;  3ME7 A;  1F3B A;  1M9B A;  3EU3 A;  1A0R P;  3DRN A;  5GST A;  3HVX A;  2Z9S A;  13GS A;  4TRX A;  2XHF A;  2I1U A;  4K7I A;  1U3A A;  5EL8 A;  2B5Y A;  3LOR A;  2K8S A;  3HKR A;  4O92 A;  3EYT A;  1YQ1 A;  1U6T A;  3S9F A;  1PGT A;  3CSJ A;  2ALB A;  2LEG A;  2H76 A;  5A34 B;  4V2L A;  1MD3 A;  2LKU A;  3UL3 A;  4PXO A;  4IW9 A;  3A5I A;  1AQV A;  3CWG A;  4YQU A;  2V1M A;  2N5F A;  1FO5 A;  3WYW A;  2L4Q A;  3BOA A;  4PX1 A;  3H79 A;  1TU8 A;  5AIS A;  4HJ2 A;  3N5O A;  4OCE A;  3VFI A;  3E3E A;  1K0B A;  2J23 A;  2F51 A;  2C0E A;  1T4Y A;  5LCZ A;  2YN1 A;  2A4V A;  4OO4 A;  4ZB8 A;  1BX9 A;  5B6M A;  5DAK B;  3HD5 A;  2MMZ A;  1M99 A;  3M0F A;  1ZL9 A;  3FRC A;  4IBP A;  5B8A A;  1VGL A;  2ZCT A;  5J3R A;  3O76 A;  2DLX A;  1M7T A;  1EV9 A;  4QL7 A;  4TKY A;  5LD0 A;  1R4W A;  4ULX A;  4Z2T A;  3IK9 A;  2X8G A;  2KUC A;  4K8M A;  1GUK A;  5DBQ A;  3TCO A;  4Q5N A;  2HLS A;  3CRT A;  3Q18 A;  4PGT A;  1FOV A;  1BQ7 A;  2R0C A;  3F4R A;  4K5R A;  5IO0 A;  1NSW A;  1WPI A;  3MYD A;  4LL1 B;  2DKH A;  1GTU A;  3E0U A;  3KJY A;  3FR6 A;  3LYP A;  2LST A;  3CYN A;  5C00 A;  1S3A A;  1PN9 A;  4DSS A;  2ZUP A;  4PUA A;  4HS1 A;  3ED3 A;  3H8Q A;  1EOG A;  4OO5 A;  5CYY A;  22GS A;  3G7Y A;  5AN1 A;  1A23 A;  4LMW A;  2B7J A;  4F9Z A;  1TP9 A;  3KP9 A;  4ZBD A;  2GST A;  3OR5 A;  3FW2 A;  2HFD A;  1K3L A;  4ZL8 A;  2DJK A;  3D6I A;  3GH6 A;  4BL7 A;  2X49 A;  1M2D A;  2B6M A;  2E2M A;  2H8L A;  4NPB A;  4MP4 A;  3QFB C;  4EDY A;  1U88 A;  4EVM A;  1ACV A;  5INY A;  4BVX B;  3IAM 2;  1SKR B;  2CX3 A;  3TRQ A;  2HSN B;  3KP8 A;  2GQL A;  2FA8 A;  4WF4 A;  2OJL A;  2O7K A;  2YCD A;  1SYX A;  4GWR A;  5G30 A;  3D5J A;  2JSY A;  4USS A;  4EF0 A;  1JLV A;  5KN2 A;  4POL A;  1HNB A;  1MDJ A;  6GSX A;  1XFL A;  2GS3 A;  2IMK A;  2BJX A;  3MDK A;  2H70 A;  3QPM A;  4MH2 A;  1VF1 A;  3MWH A;  1VF3 A;  4ZB6 A;  2OE1 A;  3G7J A;  1Z7R A;  4PQI A;  4KSO A;  4WBR D;  4XS6 A;  1OC3 A;  3ZFL A;  3GTU B;  4POK A;  4POM A;  1TI3 A;  2X8C A;  2KP1 A;  4BPY A;  2H1L A;  6GSS A;  2FWH A;  2C1Y A;  3HCZ A;  2GGT A;  2HRA A;  2CZ2 A;  2F8F A;  1X5C A;  17GS A;  4BWQ A;  3ZIT A;  3CTF A;  4V1A g;  2QA2 A;  2FA4 A;  5AIV A;  1WJK A;  2FGX A;  4X1U A;  4O5U A;  3IHG A;  4ACS A;  3P7X A;  5ENU A;  3HZ4 A;  4QL9 A;  1F6M C;  2VO4 A;  4JBB A;  2VL3 A;  2FY6 A;  2E0Q A;  3N9J A;  1XCC A;  4YKG A;  4YKF A;  3UAP A;  3TOU A;  2HT9 A;  3FY7 A;  2VD1 A;  1AIU A;  4BVY A;  4MCU A;  2JAD A;  2YOI A;  1MD4 A;  2OAD A;  4KX4 A;  5D96 A;  3LSZ A;  4F0B A;  1TRU A;  1C72 A;  4G9H A;  1TI1 A;  1QUW A;  1PN0 A;  5G2Z A;  3RHB A;  5COH A;  1SK2 A;  3BCI A;  3GV1 A;  1X0R A;  3VK9 A;  1O7U A;  1ERU A;  3APS A;  3MIX A;  5DJM A;  2A2S A;  1PKW A;  5B6N A;  2HQT A;  2A2P A;  3ZVJ D;  4KCA A;  2RII A;  4OMV A;  2YJH A;  5DAL B;  2BMX A;  3WGX A;  3IPZ A;  4EXJ A;  3DWV A;  2VCV A;  4X43 A;  3KGK A;  3QOU A;  7GSS A;  4FIW A;  3CMI A;  1GLQ A;  1K0A A;  1VF2 A;  1F3A A;  4ML1 A;  3L78 A;  1SKW B;  1TJD A;  3AY8 A;  1CQG A;  2WFC A;  4YQM A;  2OE0 A;  1SYR A;  1DE2 A;  3GMF A;  4MAB A;  3TDG A;  3ZIV A;  1K0D A;  1MEK A;  5J9C A;  3VPT A;  4KGI A;  2P0G A;  3F6D A;  3ZRE A;  2OKA A;  4WR4 A;  6GSV A;  3EE2 A;  3M9K A;  3U5R E;  4TXO B;  1SK0 A;  5F06 A;  2EIR A;  3GSS A;  3TKS A;  1QQ2 A;  16GS A;  2H0H A;  1U87 A;  4KA0 A;  1GTI A;  1TU7 A;  2HSY A;  3CTG A;  1KTE A;  4DEJ A;  3F0I A;  3LG6 A;  5B7C A;  2UV8 G;  4ECB A;  4Q5R A;  5G1L A;  4I2U A;  2H6Y A;  4GTU A;  3FKF A;  5ECL B;  2YWM A;  2LQO A;  2QGV A;  4G10 A;  1PL2 A;  5DCG A;  2R5G A;  1XVQ A;  3RAZ A;  4TR0 A;  4IGJ A;  1BYE A;  2XPE A;  5EPF A;  4I2T A;  2GQM A;  3DGQ A;  3MAK A;  1R5P A;  4WXT A;  4AKG A;  4WF5 A;  5IPG A;  1YEX A;  5A1N B;  2L6D A;  4AGS A;  1K0N A;  4FYC A;  3IV4 A;  5E4W A;  5E59 A;  5G31 A;  1N2A A;  3J7Y b;  3C1R A;  1THX A;  2HSM A;  5J9B A;  1E6B A;  4ECJ A;  1WE0 A;  1J08 A;  1YY7 A;  4L0U A;  1LBK A;  5CAX A;  3UEM A;  3G9B A;  1PX7 A;  6GST A;  3FR9 A;  1GSY A;  5IMD A;  4OFT A;  1O8W A;  4HUA A;  4E8H A;  3HY2 A;  3HJO A;  1X9S B;  5B8B A;  2HZE B;  4ZXG A;  2AHE A;  2QA1 A;  1T1V A;  1V40 A;  3VLN A;  1SJ6 A;  4CY6 A;  5A5H B;  2GSQ A;  3GHA A;  2AJQ B;  1S3D A;  3KZQ A;  2VUP A;  2PBJ A;  3ERG A;  4K6X A;  4N11 A;  1HQO A;  2H6Z A;  2F3M A;  3FR3 A;  3GL3 A;  3ISO A;  1X9M B;  4TXO A;  5CNW A;  4GQF A;  4KE3 A;  4XTS A;  4NWY A;  2LV3 A;  5KN3 A;  5D9X A;  4TR3 A;  2AB6 A;  5ELA A;  3C71 A;  2MZC A;  5A4V A;  2JU5 A;  2VAF A;  2QSI A;  3RPP A;  1HD2 A;  2A4H A;  2DBC A;  2FWE A;  3KMN A;  4OFN A;  1SU9 A;  3IA1 A;  2PER A;  3GRX A;  4DSQ A;  2HXK A;  3BJ5 A;  2CX4 A;  3GUS A;  5ECR B;  1EP8 A;  4F2I A;  4KSM A;  4V1A p;  1SL0 B;  2LJK A;  2DMM A;  2YZU A;  1GP1 A;  3KXO A;  2EFE A;  4HEA 2;  3MSZ A;  3GKX A;  1TDI A;  3CRU A;  3P8W A;  4K1F A;  4AKI A;  4NV5 A;  1V98 A;  3RBT A;  3VUR A;  2EIQ A;  4JZQ A;  2JZR A;  4FQU A;  2FCH A;  3EVI A;  2YPM A;  4D73 A;  2VIM A;  1XVW A;  5CP1 A;  20GS A;  2RUF A;  2TRX A;  5AGY A;  5EY6 A;  4KH7 A;  2LRT A;  3FHK A;  9GSS A;  1CQH A;  2AAW A;  1TTZ A;  2WCI A;  1A2J A;  3GKK A;  4HJM A;  1FW1 A;  3LXZ A;  5LNK e;  4LA1 A;  4MDC A;  2WUL A;  1H75 A;  3IAS 2;  2O85 A;  4IVF A;  2YWN A;  4EUY A;  2LRC A;  1YJ6 A;  6GSW A;  2H0I A;  4BWS A;  2DML A;  2AV4 A;  1R26 A;  5HFI A;  2H73 A;  2R4V A;  5DQS A;  4AJ8 A;  1TRV A;  5DCH A;  6GSY A;  5CRW A;  4EDZ A;  4WEY A;  2B5E A;  5ECO B;  2LQQ A;  4E8E A;  1GUL A;  5J40 A;  2MBT A;  2WS2 A;  4ID0 A;  5DDL A;  4GXZ A;  4WR5 A;  1TKD B;  4YAP A;  4GSS A;  2QKE A;  2PN8 A;  2ZNM A;  1A24 A;  19GS A;  2PU9 C;  3I9V 2;  2NDO A;  3HDC A;  1M9A A;  3DD3 A;  3FMW A;  3UIW A;  2GSR A;  3LWA A;  1TK8 B;  5DQY A;  1B9Y C;  3EWL A;  1Y1U A;  3DKS A;  2P5Q A;  2VM2 A;  2VCW A;  5CRD A;  1OKT A;  1K3O A;  1M2A A;  4GLT A;  1FG4 A;  5BMU A;  1ZGN A;  2IME A;  12GS A;  1ZOF A;  2NTO A;  1MTC A;  4K5S A;  1ON4 A;  4HI7 A;  2FLS A;  4L5L A;  4IHU A;  2L5L A;  3GKN A;  5HR2 A;  1U3I A;  1YKC A;  3GIX A;  5ELG A;  5ECS A;  3TJK A;  3VI7 A;  1B9X C;  2GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...