2VDKL

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkL01
2Z4QB 1F6FB 4NN5C 5IWLC 4YBLB 1I8LC 1UEYA 2F54D 4X5LA 4JN1L 1MHCA 4DKFL 3WBDA 4U4BA 4HUMB 2L7UA 3QQ9C 1N3NA 4ACPA 3LKRB 1RJYB 4G6JL 4NBZB 1CD1A 4X4MA 4RWYH 2ED8A 4KV5E 3MFFB 2EYTB 4X7TA 2P5WB 4HWBH 1LO2H 5J1AB 3O2DA 2QQNL 3X3FL 4X6BA 4MB4A 4N5ED 4U6XB 4YE4H 2D9QB 4C83B 1A4JB 4CMMA 5HPOA 1HYSD 2QSCH 1T7VA 2YUVA 5D8JL 1KUMA 1FQ9C 1KB5A 2AXHA 4HMEA 1I3GH 2OZ4H 2E8YA 1YEKH 4G8EB 1V5JA 5IOPB 2ADIA 5EBMA 2FH6A 4U1SB 1XMWA 3BD3A 1A7NL 3LHPH 1S7WA 3H9YA 3NACH 4XPHL 1KNOB 1J1XH 2QJDA 1WSST 4LFHD 3RY4A 4DEPB 5EB9A 2XZQL 4Y5YC 1LDSA 3LH2H 3FQXB 2WNGA 4IJ3B 3MV7E 1F58L 3F6IA 4WHTA 4H5SA 5KSAC 4OFKA 1MLBA 1BIIB 4M02A 1S7RA 3QQ9D 4MJIA 3RGVA 2NY6B 5KSVA 4P9HL 4OF0A 3CPLA 1MCIA 2WW8A 4GAJH 3QO0A 5F88A 1IC5H 4D9RE 4F7PA 4CW1A 2BVQA 2Z35B 4NRZA 3ABZA 5IKCA 2E27H 2PW2A 1Q0XH 4OLWL 2BRRL 1EA9C 4EZMA 3SDYL 1OAYL 3K46A 5IROA 5ACZB 2FO1A 4PRNA 1FVEB 1JFQH 3C5JB 3VXRD 4AMKH 4UDUA 5BRZA 1QTYT 1FFNB 4FQLL 3OTTA 3WE6A 1ZVSA 4NM8L 4NC2B 1N6QH 4FFYH 3V4UH 2CUHA 1NGQL 4W4OC 3T04D 4F80A 3I6GA 5EO0A 1MF2H 1KN2H 4EUPG 1MH5B 3CU1A 5CSBA 3L3JB 3I2CL 5BS0D 1D9KA 5K9KA 2HG5A 1ZOXA 2F8OA 4GRMB 4HXBL 1EHLL 5HY9A 4JDTH 4ODVH 1MCOH 4OFYD 3RAJL 3QYCA 2CKNA 4LLQB 2HP4A 4UILH 1O0VA 5C0EA 5H2BA 3TIDA 1FIGL 3VG0H 4Y4FA 5HYEA 2KQMA 4YDIH 3QDGD 4M8QB 5T1DH 1XZ0B 1LK2A 1EIBA 3DXAE 4G7YH 35C8H 2VQ1A 2ICCA 4OTXH 3BKCL 4UU9B 1RZJC 5I18L 3KJ4C 3RZCA 1LP9F 2IFFH 3QUZC 5KSAD 1H3VA 2YPVH 3B6SB 1FRGH 4IHOA 5IBUG 4ODSH 3T4YB 3MRDA 3U2SA 2XKUA 3TJEL 5GIRB 5CJXA 4G6FB 3ULVH 3FO9A 4PRIE 2W0FA 3EJYC 2VR5A 4CGTA 4R26H 2D7MA 1WK0A 1BMGA 1SJEA 4PRDB 5BOZG 4M62L 4YBHA 1ZLWH 4QOKB 1QO3B 3W9DA 4PJ7F 4WW2F 1IAOA 2AI0H 3BQUA 1WFNA 5C09D 5HHVL 4PYGA 1E6JH 5B4MC 1KFAL 3J8F7 1NCNA 2R2EA 4JEGB 3BD5A 4FTVD 1E4XH 3CLFL 3BW9A 2EYSA 1Q1JH 4RAUA 1NAML 3IETB 2JELH 1Z0MA 3KPSA 5EOCJ 5JQ6H 5CWSA 3NCBB 3IDUA 4M7JH 2ZCHH 1XR8A 3I9GL 1E4WL 1NCCL 3TNMB 1UM6H 3B5TA 3LS4H 5IMLA 3D0LB 2VLRA 3DVNB 4HD9A 4NQCA 1G7MB 2PO6B 3N1PC 4H0IA 3FHAA 5FK9B 2B5IC 1YJDC 4S1QH 5GGRB 1X5GA 4HBQA 4ZUVA 4M48L 3DURA 2DYPD 4WI6A 1RPQA 4Z77A 3EHBC 3U36A 5B22A 3QUZD 2QADB 4Y4KA 1RZ7H 4MDJA 1PSKH 2F74B 2EDOA 4WUUA 2CIIB 3FB5B 3EJYD 4XP6H 4CVZA 2FO4A 4XCCL 2GITA 4OF8A 4MHHI 4WW1A 3SDAC 4IRJC 4CVXA 5D7SH 2BNQD 1J1OL 5MI0B 1QSZA 5LCVL 1ZLSL 4DZBB 4L8SB 4OSUH 3MNWB 3IS1X 5GGTL 5B4MD 5MHSE 4HIIB 1BQHG 4F9LA 1K5NA 5F3BA 5JDJA 2GT9B 5TQ2L 3HMXL 5I8OH 3EJJX 1VADA 4R6UA 3RWCB 2IANB 3CSPA 3FCTB 4NQEE 3L3KB 5CBEA 5CMAA 2DI7A 2XOTA 3BXNA 4WGVB 2PXYB 4WO4A 2FHFA 2IQ9L 1QVOB 2D4FA 1K9TA 5IEKB 3O11A 5DJCA 1BOGA 5F96H 4CN6A 2VN7A 1FZKB 2YSSB 3MNVB 1K6QL 1YN7A 5C0RH 3R1GL 1T1WB 4HH9B 1ODAA 1DE4B 2AK4D 4NO2B 4HXAH 3T77B 2VRAA 4H8WL 5C2BH 5DT1H 1I7ZB 4P2QE 5I66A 3B3IB 3EHBD 3U30B 4M5ZH 5EZLA 1Q9LA 3MXWL 4PRPA 4BSWA 2A9MH 4QXWA 5DD0H 1BLNA 1R5VB 1OPGH 2X9XA 4XAKD 2NW3B 2A1WL 1UCBL 2VDQL 2R8SL 5EUOF 3SDAD 2OYPA 3IGAB 2OX5A 4IRJD 4FFVC 3MMEA 3SO3B 1AR2A 3VMNA 3MCLL 2QHRH 4D3CH 1UWEH 1ND0B 5IUSA 3GBML 3AU1B 3HAEG 2VLME 3KPMA 3PHOA 3BSZH 3QEQE 5F9OH 3MRMB 3Q5TA 4XNZB 3U4EB 5C70A 1CFSA 3K1KC 2VTFA 5AYUH 5D7IF 1QQDA 2Y5TA 2EECA 5DD1H 4YHIA 4XZUA 1NGYA 1HCVA 1T5WA 1BZ7B 3ME0A 4Q9CA 5CHNA 1SJVA 1NAKL 3A6OA 4L4VE 4N68A 4BFBD 1RZ8B 1U8KB 1TZIA 1RZKL 2OR8A 1BVZA 4V1DB 2VZSA 4G6JH 3KAAA 1NFDF 5EOTA 1CLYL 3B9KA 3X3FH 5DF0A 2JTDA 1TCMA 5I1GH 4APQC 3ARDB 1A9BB 1D5BA 1QFWM 2BVTA 4JZJB 3C9NB 5J9PB 5D8JH 5C08D 3SE3C 2EC9T 2OL3B 2V6HA 5KSBE 4P4RA 2J8UB 4DCQA 3D85A 4ZOCA 1A6PA 4UDTA 4ODUB 3WO4B 1UB6A 1QFUL 3B9DA 2DMKA 4Z0XA 4CDGC 4KHXL 4NKOB 2CJUL 4XPHH 4FFVD 1UH4A 2NY1C 4L29A 5D2NE 3O8XA 4JO1L 1FG2A 4NN7B 2XZQH 2JB6A 4XXCA 1RK0B 4WTXA 3JV6A 3MROB 1XF4A 1DFBH 1J8HE 2WINA 2VLLB 3IRPX 4HIXL 5DYOA 3T65B 3FHQA 1DUZB 5HYJA 3L3OB 3QJFB 1IL1A 4LIQL 3SDXA 4PBVC 4QRRB 2PNDA 5EO9A 5IHLB 3T1WA 1J5OL 4GG6A 4P9HH 4YO0B 1YNKL 2CK0H 2Z91A 4V2BA 4GKZB 5CD3B 4FP8L 4PTUA 5K59F 3RFZC 5K9QG 4DW2L 3O9WC 2DLTA 4S0SD 2F53E 2YPKA 3SDYH 3D3VB 4APQD 1AY1H 5FO7A 5IIEA 1AHWC 1I1AB 3TBVA 4FNLL 1F02I 1RV6X 4ZG1A 1HILA 1VENA 4NM8H 4U1HA 3TIEB 5J6HB 1EAJA 4PLKC 1NGQH 4QRPA 3C5ZC 4NWUL 1ZGLB 4QY8B 3WL9A 4PV8B 1QEWA 3SQOL 15C8H 3O45B 5E4EB 5KJRH 1C5BL 3MYZA 3I2CH 5TQ0H 1UXSB 2NY1D 1I9IH 1DR9A 3DBXA 3RAJH 1K2DB 2XG4A 4UNUA 4Y19D 1EZVY 1FIGH 4JRXA 1MCNA 3CJJA 1CF8L 4WU5B 5TDPA 4I2XB 1RIVL 2HFFB 1G7JB 1R3LB 3KNBA 5DMYA 3MRIA 4YGAB 2IJ0C 3BKCH 3PDGA 4J1UB 3QIUA 5I18H 5HVGB 2DRUA 3EJZC 2GJ6E 5BZWA 3ALWA 5FKAA 2ZJSH 3KYKL 1QRNA 5DVLA 2R0KL 3SCMC 3CZJA 3TJEH 4BH7A 3KPPB 3O2DL 5DHXB 3OG6B 4FQXB 3HPJA 3E8UH 5CILL 3P0YL 5HYSA 1OT2A 1Q9OA 3DIFB 4XPBH 3VFTB 5MEQB 4JGUA 1A7OL 1WFTA 3ECBB 4JB9H 4UTBH 5D7LD 5DUBA 4PJEA 3O9WD 5C92A 2FSEB 2F54B 3NGBB 4AIOA 3RWHB 2P8MB 1AI1H 2FYYA 3BEVB 1G7IA 4LSTL 3KYMA 1KFAH 4QRQA 3U7AA 3CLFH 2AGJL 4JFEE 5L8KB 3P9LA 4PJGB 3KLAA 4PLKD 5FUCC 1NAMH 4Z7OE 2Z9TA 3C5ZD 4UMGA 4HGWA 1DQJB 3G5ZA 1PG7W 1WITA 3T1FB 4OCMC 2AERT 2W0LA 2FLBT 3FN3A 2V9QA 1KCVL 4I13B 1UG9A 1BBDL 1QG3A 5I0DA 3UJJL 2MSPA 1ITBB 5HYIA 1RFDH 2P8LB 1FN4A 3JBG7 3ARUA 4WY7L 3RKPA 2ERJB 4M48H 1KIRA 4Y4HC 5DJZB 3CX5J 3EJZD 3HZMA 3GSXB 3LPWA 4R7NA 3OG4B 2J6EL 4MAYC 4HUWA 3F5WA 1OW0A 2HJKA 4P5KA 4Z76A 3CDGA 4FMKA 3QAZB 3SCMD 1ES0B 1HQ4A 4KVCH 1HHGA 4N9OB 3W2DL 5IBTL 1WBZA 1MFDL 2K7QA 3GI9L 3ZKXC 3ARQA 3IDYC 2C3HA 4NN5B 1QSFE 5JW5A 1EO8L 1D6EA 1J1OH 5LCVH 1ZLSH 2MCPL 3HUJE 3O0RH 5GGTH 4HS8L 3BDXA 4N0YL 5CKAA 4H1LG 1IC4H 4XXDB 5HJ3B 5JZ7C 1OGTA 3OMZA 4L8DA 3I6KA 2CLZA 1S9WA 4KJYA 4MJ2A 3KG5A 5ETUA 5TQ2H 2C1OA 4Z78A 1E27A 1ORQB 2XG5A 4CAGA 4WI9A 1H5BC 4AENA 1KLGB 1A47A 2LU3A 1MREL 1HNGA 3Q3GA 4NN6C 3VXRB 2IQ9H 2ZUSA 5CAYB 4MB5A 3ARPA 4N0UB 3OF6A 1BF2A 2EKSA 3OKDB 4ZPVB 3RPIB 1J05A 4MXWL 3OXSB 3MCKA 4LGRB 4JHAL 2WZPD 3R1GH 5DR5L 4CL7A 2X05A 1CDBA 1AE6L 2X42A 4PJHB 4JM4L 4ELKB 3REWB 1DDHB 4H8WH 1S9XA 1FBIH 2Z31A 5HHNB 4KRNA 4Y4HD 5BS0B 4GT7A 5ERWB 5F7DB 3MODL 1CK0L 4MAYD 3MXWH 1HNFA 2QSTA 5IVXB 3TLRA 3TT1L 4IDJH 1ZKAA 4Y5YB 3RWFA 1SY6A 3BN9C 5J1SC 3T0EB 5L2KE 5FYJL 2A83A 4BZ1H 1E28B 5HGBA 1JN6A 2D2OA 1IMHC 4O2CA 5C0JA 2A1WH 5ICZB 3ZHDA 1UCBH 2VDQH 5HBBA 3EOTH 2R8SH 1J8KA 4LNRA 2YC1B 3V0VA 3SOBL 4L9LA 5A2IH 1I8MA 3GGWB 3QQ3A 4HCRA 4M1CC 1AXTH 2DKMA 3MCLH 5GISH 5IV2B 3NFPA 1LWRA 3KYOA 4LAQL 5HHXL 5LQBH 4AY0A 3ZE0F 4HS6B 1GAFH 3PGFH 5JZ7D 5TDOB 3MREB 2W91A 4L3CB 3QUYA 2XPGB 3QQ4B 1KC5L 4NYLA 2YD7A 4K94L 2H2PC 1AGCA 2ZCLH 2XY1A 4GW4B 4MGXA 5LBSL 1ACYH 2QSVA 4KY1H 2VLJA 1A0QL 5C09B 5J1TC 1JUFA 3QXDB 3SKUD 1NAKH 4S10A 3ZDYE 4FTVB 2PTUA 3O3BA 2APWA 2ZOLB 1RZKH 4UIMB 5CKGA 2IF7A 4RA3A 5KS9B 5SWZD 1I1YB 1YUHA 5DFVC 1I8KA 1H3GA 4YLQT 3OAYH 5T5NG 3U46B 4L4TD 1RJYA 5FGBC 3VI4F 4X9IA 5DRZB 1JRHL 4L4JA 1FYTA 4R4FL 3T2NL 4QRTB 2P5WA 2C7UB 3BI9X 4G9FD 4LEOA 2N4IA 3JVGC 4JREC 1UM4H 4HPOL 4U6XA 4K9EL 4F3FA 1N0XH 3GSNL 3BN9D 3D39B 4KQ4L 5SWSE 2DYPB 2R9HC 5I1JH 3KJ4B 2R1WB 1QFUH 3HB3C 3QUZB 4MSWB 3B4NA 1AIFA 2PYFA 3T3PE 4ETQB 4JCLA 1OD7A 2CJUH 2H32H 5TE7H 2YD2A 5JHDD 1O7SA 3BMWA 4I5BB 4M1CD 3CSBA 4JO1H 2Y25A 1OAKH 1FC1A 4ZQKA 5L9DL 3U7YH 3QRGL 5INCB 5D70L 3DRQA 4N90E 5EIIA 1GL4B 5HGDB 3PP3H 2P4AB 4X9FA 1JI1A 1EBAA 4ZUUB 5MENA 2XWJA 2BNQB 2DWEA 2H2PD 4P3CL 4Y8DC 4U1KA 5ANMB 4HIXH 4EEEA 1BJMA 3H6JA 5DHVA 4LIQH 1YDPB 2ZP0T 1BAFL 1V3KA 5ALCH 4EI5C 3JTSB 4KZDL 1J5OH 4WEBL 3L5HA 4TUJB 4CN1A 2ICEA 4TRPL 5E5MB 2P48B 4EI6B 5DFVD 4OZ4A 1RIHL 4FP8H 3LRSA 5KN5A 1IAKB 1U3HC 1MCKA 2P49B 5L8LB 3OKNB 4G8GD 1Z5LA 5EA0L 2H6PB 3PL6A 4P5MA 4OIIH 2XN9E 3HC4H 4FNLH 1EXUB 2LVCA 1QBLL 1X5LA 1BJ1H 2UZYB 1T7XA 1BFVL 4QHLB 3HMWL 2AK4B 4JO2L 2B5IB 3IDJB 4LPUA 2C3VA 3UPRB 1QFOA 4NWUH 5LKNA 5F7HA 1CCZA 2NY5L 2R9HD 2VL4A 4OGZA 4U49A 4Z7VF 3HB3D 1DQLL 1C5BH 3W81A 4JY6A 4F33B 2H45A 3VG9C 4YR6A 3GMMB 4L3EA 3RJQB 1B4RA 5TGBB 3MLYL 4D9QD 4CJ1A 1MI5A 1U8NA 4RAHA 5DI8B 4E42B 3V2AR 3V6OE 4WTZA 1RIVH 3ILPB 4JR9H 1HXYB 3O6LL 3SDAB 2BHZA 4IRJB 4Y5VC 4LARL 7FABL 1E6OL 3JSSA 5BW7A 2V2WB 1RJCA 1P6FA 1MFBL 1B6DA 1J11A 3VFGH 3BKML 3KYKH 4EI5D 1S5HB 2Z92B 1ZT7A 2BVPA 4RGOH 3TH3T 3B6SA 3QDJA 4PJDB 2EXWC 3T4YA 5E7BA 4GOSA 2A6JB 4IOFC 4RRPG 5CIPH 1OM3L 4XP1H 1WBXA 2YA2A 3UZQA 4UV4L 4P9ML 1U3HD 4X6CB 1JHLL 4PRDA 1B4JL 5IJVB 1ZE3C 4LSTH 4PJXE 4CADA 4QOKA 1TJGL 1YMMD 3KPRA 2GTWA 1MFCL 2XNAB 1VGEH 5K33A 1JF1A 4NDMB 2ESVE 3OKOB 4YFLI 2AGJH 4PJBB 4ODBD 4U1NB 4PJ5A 2RIKA 4LASL 1I1FA 4LBEA 3FTGA 2PYEB 4U1IA 4G8IA 3LB6C 3LAFA 4W68A 2LABA 4OM1H 3KLSA 4XBPB 5IESH 1JNHA 3CUPB 4KH2A 3X12B 5C08B 4D0BB 1KCVH 3NCMA 5JR1H 4XMPH 1YPZA 1KT2B 3S35L 1GIGL 5A40E 5T1MB 3ZMRA 1EVTC 3NPSC 1INDL 4P2RE 2PO6A 5C07B 3TCLB 1FCGA 2WQRA 2X4PA 1SHMA 2J6EH 3P4MB 2DD8H 2R2HA 3LKQB 1HKFA 3T8XB 4P5TC 3QDAA 5C86A 1HK6A 4MHHG 1HZHL 2EXWD 4HBCL 2XI9A 3W2DH 3GI9H 4IOFD 2CIIA 1UXWB 2E7LA 1A3RL 3FB5A 1YEGH 2NQCA 5FO9B 3DRTA 5IW6B 1Z2KA 4HKXA 2AQ3A 2E9WA 1R3JB 4HWUA 4LMQE 3BVNB 1XFPA 4MJ4A 2MCPH 4HS8H 2VLKA 4N0YH 3S37L 3RBGA 5IQ7H 3RTQC 5TF1H 4A2LA 4DZBA 4L8SA 2NZIA 4DK3A 5CP3A 4FRWA 5B21A 5M7QA 3IF1B 5E8PB 3UTTA 1MREH 3MV7D 3LB6D 4APQB 3BP5B 1EGJL 3Q0HA 4PREB 1T89A 3RWCA 3L3KA 4NSKB 1EHXA 3F7PC 1AP2B 3KPLB 4UQ2A 3O4LB 4JHAH 5IEKA 4N1EA 5DR5H 2KKQA 1FZKA 4D9RD 4JM4H 4FQQA 5IFHL 1F4YH 4YH6A 4EOWL 3SN6N 2VUOA 1U8IB 1IJ9A 4OF6A 2XTJE 4CNIB 2AV7B 1RK1B 3MODH 2NY1B 4WU7B 3T3ME 1P7HL 4AEEA 2ITCA 1CK0H 2Q8AL 4YFEA 1W8OA 2HTKC 1MFAL 2D0GA 3OKMB 3QO1A 4XBEH 1I7ZA 2AJYL 4Y19B 1T22A 3VD9A 3ZTNL 5F3HB 3V8CA 4P5TD 2UUDK 4ONGH 4KI1A 1U58A 4QHNA 4ORGA 1T1ZA 3MRPB 4IIQC 5FYJH 4K8RL 4F7TA 1LE9B 3EOAB 3CVIH 4Y0GA 3I50L 3KPNB 2EH7L 2NW3A 3SOBH 4ZS7H 3HPLA 1ZT4A 4X6EB 4LAQH 3RTQD 1OAQL 5D6DC 5J56B 1BWMA 1F90L 2RCSH 3FO1B 3KHOA 5D7LB 3RA7H 3K0WA 4DN4H 3LV3A 3O9WB 5DMKB 1LP9E 2HT4C 2W0KA 3DXAD 1QA9A 1ZANL 2R4RL 4D8PB 1IKFL 4K94H 2AK1L 3MRMA 5CGTA 1ED3A 1A7QH 2E7HA 1AHWB 1A1OA 4KTDL 1CDHA 1JPGA 3DI2B 1IZJA 1SJHA 3UTQA 4OZHF 4PV9B 4J3UA 4PRID 5ITFA 1V7NL 2FWOB 1RZ8A 2LU7A 3LEYL 1IGTA 5AUMB 2H3NB 4DK6A 2A6KA 2BC4A 4PJ7E 3V5KB 1Y6NR 1JRHH 1JVKA 3NN8B 4R4FH 4JJ5A 3F58H 3HE7A 2OTWB 3IDMA 1S7XB 5C3LD 3WXWL 1LVEA 4PTTB 4OQ1A 2HTKD 3MRQB 4HPOH 1MNUL 1DSFL 2HWZH 3ARZA 4K9EH 3ARDA 1X5HA 5E9DA 3GSNH 4JZJA 3C9NA 2G60H 1VA9A 4XAWH 4UOW1 4EBQH 5EORL 6FABH 1MPAL 2CR6A 4HFUL 2J8UA 3DMMA 5I76B 3QCTL 1DBAL 4HKJB 4JZNB 2WM0A 3SCMB 1JTOA 3L3DA 3P2TA 4R3SA 2P5EE 4HJGB 4YIQA 1ZLUK 5D70H 5HDOA 3VRIA 3T0XA 5JPMB 5ID0A 5JW3L 1INQB 2A73B 2HT4D 1FFPA 3ARGA 1G7LB 1OARL 3MRCA 4MCYB 1AJ7L 4P3CH 4Y5XC 1BVKA 1OF2B 1ZEAH 3FONB 4OKVA 4KZDH 1CLOL 2BNUA 5D71L 4AK1A 4TRPH 3QJFA 4QHMB 3VGGA 3IXAB 4OCRL 4TSAL 5EZJB 1RIHH 3KYAA 1QRKA 1Z9LA 2B4CH 4OZGA 2R0WL 4JFYB 3UZVB 3HI5L 5DVNA 5CD3A 3U9UB 3S5LA 1HN1A 4Z7WB 1EUTA 3P11L 3CSGA 4M6NL 4WHYG 5GS2H 1MWAL 1QBLH 3G6AA 1KB9K 5MHSD 2ORBL 1AFVL 2V9RA 1BFVH 4WI4A 3HMWH 5IJKC 4JO2H 2NY0C 1OOAA 5H35B 3MLUH 4Y4HB 4NQED 5E08H 5JOFA 5DRWA 3PWPA 4Q9BA 1DQLH 4MAYB 5ICXB 3OV6A 4XB7A 2VQUA 5DSCA 2F5BL 3VMOA 5LGKA 3QA3A 4YQXL 5EWIL 1QLRB 1UVQB 1N8ZB 3X11A 3CVHB 5J13C 2EYRB 2YRLA 3ZKXB 3IDYB 1K2DA 2VXQL 3OL2A 4M6ML 3RNKB 2R2BA 3MSPA 3O6LH 3VWKC 4AJ0A 5C71A 3S97C 4LARH 4P2QD 3Q1SL 3CH8A 1BQLH 4K7PX 3QIBC 3BJLA 2CKBA 1MFBH 4YXKL 1ZAGA 1F13A 1AC0A 4PJ8C 3VFUB 1W72A 3DV6B 4F58L 1XF5B 5GSRA 3BRDA 4DFHA 3GSWA 1H5BB 3VFOA 3ILQC 4KU1A 5EUOE 4WNQB 1OM3H 2XXMB 4DOHB 4UV4H 4P9MH 4MMXC 4NN6B 3ARBC 1JHLH 3BKJL 3RIAF 3VXTB 1QLEH 5I1AB 1B4JH 2CUMA 4G6AC 2CRIA 1BD2D 1TJGH 2IQAB 5D2NC 4R7DB 1MFCH 4JPIB 3PGDB 5SWZB 4OB5H 4IOIA 2P8MA 5A2JH 5DJ6B 3QUXA 2VO5A 2VLMD 5HHME 3STZA 5C0BE 3QEQD 2NY0D 4I18B 5D7JC 5HVWA 1UWXH 4RNRB 1KJ3L 3RRQA 3RUGA 5DC0A 3AS0A 3QZWA 4P57A 4G9FB 1H0DA 2NY3C 4LRIC 4M1DL 4MJ5B 25C8L 1JWSA 5C0CA 4OJFL 4P49A 1EFQA 1HWHB 2OJZL 1NFDE 4LQ1A 5IVZA 4RGNE 1NGZB 4JQXC 4LDEB 3S35H 1GIGH 4NO0D 4NRXB 5EDXA 1F97A 2A9NL 5ITBL 2YWYA 4XGZB 1INDH 2EC8A 3VWKD 4JG1L 3VFRB 3AS3A 3WDIA 1CN4A 5HGHB 5JHDB 3GO1L 1QSEA 2BZDA 3QIBD 5HDQL 4NM4L 2Y1VA 5GS1A 4PJ8D 3X14A 4X8XA 2O5XH 3GSXA 3WUWB 3BPCA 5FEBA 2YEZB 3VA6A 1HZHH 1ZHLA 1CD9B 4X6DB 1JP5A 1EJOL 3FO2B 3SDXF 1MEXL 3ILQD 1NFIA 1W0WA 3SJVB 5H37G 4GG6F 4LLUB 4HUXA 3ARBD 5IT2H 2R1XB 3ELAT 4XMKL 5JPNB 4I0KA 4G6AD 1NBYB 3V7AG 1T4KA 2AS5M 3S37H 2OBGA 4BZ2H 1T7ZA 2CLVA 2XA3A 1B90A 4LQFL 2YZ8A 3VFPA 5I30L 1NUNB 2ADGA 3GMLA 1BVLA 5D7JD 4G8GB 5SWQA 1VKXA 4EIGB 5DJYB 3HZKB 1VFAA 5F93C 4F7MA 1J8HD 1EGJH 2NY3D 4KZEH 4JREB 4PJFA 2MJWA 5E0QA 5I1LB 1FVCB 4Z7QF 2A74A 1R5WA 2MQ0A 2VQTA 5EUKA 1U3ZA 2FECI 1NGXA 5LG1A 1YEDB 4ODXA 5IFHH 1U36A 2X7LB 3I75A 5ILTL 1T6WA 1DZBA 1YMHA 1DLHA 1A6WL 4TYUA 2CXGA 4JPWL 2GW5A 2JJSC 4NCDA 2AJYH 1AGFB 4OFYA 1ADQA 1H3WM 3HS0A 4P3DB 1VPOL 3BIKA 3FRPA 3OR7B 4GRLC 3E6HB 1VGKB 4RFEB 1ITCA 3QDGA 4QLRA 4LSDA 3LQMA 3GBNL 4CRPA 4YFLF 5ID1A 3GB7A 2EH7H 1UYWL 1J87A 1HE7A 3QWOB 4EI5B 2P7TB 3QNZB 2Y9RT 1KTLB 2DS4A 3P3YA 1HHKB 5KSAA 3BO8A 4PJEF 2YC1A 4ELMB 2CO7B 3ZO0A 2BVOB 3W11C 1OAQH 4M93C 1F90H 2AKRA 4MWFB 2VDPL 4WJ5B 2M2DA 1JGLL 1U3HB 2GJZB 1ZANH 5TDOA 4YX2L 1MRFH 3MREA 2AK1H 1IE5A 3V4PH 3QCUL 3S6CA 4L3CA 5DD3H 2GJ6D 1C8PA 1YMMB 3QQ4A 2BOCB 1G6RA 4KTDH 5AAMA 1J1PL 2RB8A 5GGSB 3VRLF 5MERB 4NO3B 5F6HJ 1AO7A 1U95A 3LEYH 1D5XB 3QDMA 4HDIB 4QRUA 3TJHC 3CX2A 1SYVB 4YXHL 5KS9A 1QBML 4F7EB 5CCKL 4BUHA 4H88L 4X5XA 2Q86A 4PRHE 1PZ5A 3CSYB 4K23H 3VG9B 3FT3B 3WXWH 5IQ9B 4I8DA 3JWNC 1JZ4A 1DSFH 1MLCB 3OZ9H 2WWMC 3TBTB 3LZFL 2C1PA 1EAPA 4JFED 3C8KB 1AQDB 4GRLD 2PETA 4PGDA 1TITA 5HGAB 2CSPA 2DQTL 4Y5VB 5EORH 4U6YB 4HFUH 2ARJA 3QI9C 3H42H 4XCFH 4OZFA 2D03L 3GKZA 5DWUL 4NOFA 3FN9A 1U8PA 3FQUB 2CR3A 3QXVA 2VIRA 3W11D 2DJUA 3IVKB 4ZAKB 1UJ3A 4ZNEE 1UZ6F 1EPFA 1OB1B 1OARH 4N1HB 1AJ7H 3CNKA 1FO0A 3KJ6H 4MDIB 2WLZA 4WHCA 2VJXA 4I48B 2AQ1A 5D71H 4TSAH 1ZSDB 3AREC 5HVHC 3B83A 4TSBL 3TJHD 2R29L 4TUJA 4DZ8A 3EKCA 3MX0A 2E6QA 3WSQL 3AUVA 1QSFD 4OD2B 4GG8B 1LNUA 3NIGF 4PLOB 5EU4B 4S1DC 2YOCA 3LQZB 4M6NH 3FT2B 3QEUA 3C2SA 1AD9B 3KDMA 3TFKC 2BHUA 4YDJA 2HN7A 3BUTA 1TVBB 5I8EB 4G8FA 3RWDA 1RU9H 2H6PA 2WWMD 3V5HA 5JTWA 4HJ0C 4U6VL 4HGKC 4OQTA 1NCAL 4YHPA 5HHPA 3WKMH 3NPSB 1X5IA 2FEEL 2NMSA 2YBRB 1PX3A 2AK4A 3NCFB 3IDJA 3QI9D 1DTUA 4G6ML 1EMTL 3LS5L 1JPFA 1RHHA 1HH6B 4P5TB 1SM3H 4YQXH 3VRJA 1CXLA 5HHQA 1F3RB 1D6VL 1FZJA 2B1HH 5GJTH 4BFIB 1MHPH 3FAXA 4KRPC 1PY4A 1PY9A 5DK2A 3QIWA 5DI8A 2AJZB 5E8OB 5AZ2L 1P2CB 1I85A 1CFQB 3VFNA 4PRBA 5C0NC 4GAYB 5JLZB 4IRJA 2FJHA 3RTQB 3S3JA 4DVRL 4F58H 3CXDH 2V2WA 5KOMC 5GS0C 4J8RA 4JFDD 1Q72L 5L2KD 3ARED 3LQAC 1XGTB 2Z92A 4F15C 2UZIL 3MV8A 3CMGA 4HUUB 1R6VA 2W9EL 4UUJA 3RDTA 3AMLA 4M61B 5F7WC 3BPNC 3PNWA 3V0WH 2ARJQ 3R8BB 1SEBA 1NC2D 2IAMC 4S1DD 1RMFH 1GPOL 3FJTA 5HYSG 4X6CA 3S8WA 3ZE0E 2EC9U 3L5WB 4PRIB 3TFKD 2OL3L 3T0WA 1NMCC 5E24E 4YPJA 4HJ0D 1TCRA 4XCEB 2VR9A 4MMZC 5EULV 1CS6A 1KJ3H 2CIKB 2FX8L 3MLWL 5T5FL 2VZVA 4UT9L 2RAMA 25C8H 1U42A 4OJFH 1GSMA 5F97E 2EDHA 2RBLA 2F58L 4QTIL 5A16A 4S2SB 3GMPA 2VSDA 4K2UL 3MJ6A 2CH8A 4IIQB 3CUPA 1MCWM 3QG6B 4AQOA 1A3LH 1YEEL 3GIZL 4OZIE 2A9NH 3WIHA 3NAAL 4KRPD 2BSRB 4KK5C 4QHUB 2BCKA 3UCRA 5JNYA 1NBVH 5FFLA 3GK8L 3GO1H 1H3TA 1TDQA 5DVMA 4K3DL 3WFEH 5C0ND 1T3FB 4NM4H 3HLAB 2G2RA 1YQ2A 1CVSC 3RIFF 3G08B 2D3VA 4TTGA 4JLRA 1PKQA 3JWOH 3P4MA 2BSTA 4LLVB 6CGTA 1FFOB 5GS0D 5MEOA 4E41A 1JTPA 1P1ZB 1EJOH 3IFOA 1MEXH 4K3HA 4NT6B 4NQDE 3FOMB 5SWSD 3EOBA 5GPRA 3W39B 5A43C 1VFBA 4XMKH 2W65A 1K85A 4AEFA 3HHRB 4ZSOB 2NCMA 2IAMD 1LEIA 1RJZB 1BGXL 5ICYA 5F7YC 1IGFL 3BVNA 3STLB 5DK0B 1IQDB 5DC4B 3TYFA 4KAQL 5HYQB 4LQFH 3CFEA 4N90D 3V6OC 4XRCB 1BOYA 4G6KL 9CGTA 1OGAB 4U2ZA 1TTGA 4XX1G 4BA8A 5LGHL 4W70A 3UJTL 4X99B 5EBLB 3OBAA 2GUOB 1WFUA 3EDKA 4BSVA 5F7FA 4QO1A 3P30L 4HKZA 1L0YA 3WJJC 2X4OB 3QUMH 2QR0A 4LKXA 1QLFA 3MO1B 4K94C 3L3GA 4U6HA 4NQEB 2CRYA 1C08B 3MJ9A 4ZDHB 3D9AH 4XP4H 5E2JA 5ILTH 2YUXA 3DO7B 4KK5D 3JTTB 4FZ8H 5FOBB 4UQ3B 1A6WH 3MNZB 3FRUB 1KCUH 2XN9D 1U8IA 4U33A 4Q0XL 3ZTJG 4YK4B 1MFEL 3MC0A 4WU7A 2BMKB 3RL2A 4R4NC 3OKMA 1VPOH 2BVUA 3LKSB 3WFHA 4X98A 1F42A 4Z7VE 1VEPA 2IH1A 1L6XA 4IMKA 4QF1A 2FNBA 4P2QB 4Y5XB 3LKNA 2EIEA 4N0FB 1VEOA 3GBNH 4RIRA 4K9EC 4UNTA 4V1DE 5F6HI 4LPYA 2DQHL 3EOAA 3N9GL 4RQQA 5IHBA 1IKNA 3DX9B 5DUMH 4WEMB 3KPNA 5FF6B 3KPQA 4R4BA 3ZYZA 1PQZB 1ZVHA 4FFWC 3OKEB 2DICA 4D94A 3DUUB 2FJFA 1HEZB 3AFLA 5DUPH 1I7RB 5LXGL 4DFIA 3AY4C 1YEIL 4MD4B 4O00A 4S1SL 3TV3L 4L8CB 5D7LA 1BD2B 1FZOA 2XFXB 1EDQA 5FCUH 4ZUTB 2X4QB 4D8PA 2V7NB 5F7MC 1MCSA 3B2VL 5DLML 1ZLVH 1KIQB 2YN3A 3FO0H 1H8SA 1AHWA 2NY0B 2Y4SA 2NXZC 1AGDA 1I9EA 3VD5A 5D2LF 4X4ME 4YXHH 1JV5B 4H88H 3WFDL 4LPCA 1BZQK 3EBAA 3C5ZA 1KPVB 2NPLX 1YPZF 3HG1D 5FYLE 4ZMAT 1CFTB 4OLZH 2OMBA 1ZHKA 4JPKH 5KVDH 1T20A 2OTWA 5J13B 2FJGB 3D2UA 4RMSA 4YHKL 1I7TA 2B4CC 4NO0B 2ESVD 5GGUA 4R4ND 5CBAA 1B6UA 1HSAA 3LZFH 3MLTA 1WIOA 2YD4A 1GXEA 1KULA 3VWKB 3U4BH 4HH8A 1R5IA 2DQTH 4QRRE 3SDDC 3QIBB 3RQ3A 3KPOA 2H8PB 1DBMH 5DWUH 1DBBH 1DUYA 4PJ8B 1PLGL 1FNAA 5CJBA 3GI8H 3GSRA 4ENEC 1XCQB 1TENA 5EU6D 4ZXBC 1PG7X 4OD1L 4FFWD 3MRJB 5FM5O 3ARBB 1CU4L 4P2RD 1IGYA 1WZMA 4POZC 2XTJC 4LLYA 3TA3C 1Y6KR 5D2NB 2MHAB 4N8CH 4DGIL 4XVSL 1G7LA 2NW2B 1O7VA 1EFXD 1SQ2N 3MV9E 1IEAB 5KW9H 4M6AA 3FONA 3AXLB 3U0PA 5D7JB 2NXZD 3VXSB 2VMFA 3VGHA 3WD5L 4TSBH 2R29H 5GRVK 5GGRY 1J8HB 1O5DT 5E6IA 4EUPA 3NVQA 3WMSA 1S8DB 2NY3B 3VJ6B 4HIJA 3BZFA 4HLJA 3VFWA 4QT5B 4AH2A 4EVNA 43C9B 1NBQA 3M1BA 5CSZA 5E4IA 5I1KL 3HRPA 2DQEL 2C4FU 1LO5A 4I3RL 4PG2C 1GGYA 3SE4A 4HEPG 3CFBB 4WCYL 5BRZE 3M8OL 5FM5M 1NCAH 1IAMA 4MD5B 1XF2A 4K07A 1X9QA 4P4KC 1QFWI 1IT9L 1S7SB 4WGWB 3SKNB 5E00B 3IFPA 4W6YB 3SDDD 5HPMB 4Y88A 5H35A 4OI7A 3HN3A 4G6MH 4OCYL 3HC3L 3MGOB 1WAAE 3QBTB 1TETH 4R90L 4JFPA 4ENED 3WDJA 2VERN 4ZXBD 1UVQA 4ONFL 3CVHA 4O02H 4X6FB 4A6YA 4ZTOL 4XPGL 3IU4H 4WW2C 1FDLH 1CIUA 1PEZA 4POZD 2XTJD 4H25B 4TTDC 5DRNA 3WFCL 4WV1A 1P4BL 4F9PA 3TA3D 3DARA 1IBGL 3ARXA 5E8NB 2MMXA 1ZV5A 3FMGL 4XTRC 3MRHA 5JOPE 2ZUQC 5HSFA 2YRPA 5K9OB 4PJ9A 5KVMC 1OVZA 2N7BA 5BOPA 3L95B 2UZIH 4H0GA 4Z7NF 2W9EH 1ZA3A 1UQSB 2GJ6B 1Y18B 3TYGL 3HCVA 1GPOH 2X40A 2JCCA 4XNUL 2AJ3B 2BHYA 2N7AA 3K2MC 1S9YA 1DQQB 1JTTA 1NUDA 5GRUL 4RGMC 1BBJB 2IQAA 2Q3ZA 4UB0L 2QV2A 4R7DA 3CXHK 4P4KD 5SWZA 4P23A 3FFDB 4UZGA 1RZJL 5D1QC 5DMIH 2FX8H 2W60A 4HG4K 5T5FH 2ZNXA 1CICA 4L4TA 4UT9H 1QKZL 1SBSH 4U6TA 5DO2C 2HFEA 3SE9L 5CP7B 3CCHA 1YC7A 4OZHE 3AVEA 4QTIH 1R0AL 4G9FA 4I1NB 2X1OA 4K2UH 5FYLH 4D0CA 4JFEB 3RHWF 4GRLB 4HPYL 1XGYH 2F15A 4MXVF 1YEEH 1JNJA 2NX5A 2VLRE 4O51B 1ZLVK 5KVGL 4NQCE 3U6RB 1UKTA 1LO4L 3WS6A 4NQXB 3UDWC 4JVWA 4WI3A 1B3JA 2V17H 4TTDD 4Z5RB 3EYVA 1MVUA 3KXFE 2PR4L 4XTRD 4JRYB 2R1YB 2GSGA 5IVNA 4M93B 5HGHA 4ZUWA 1NDGA 2PW1B 3CIQA 4WUUE 1CT8B 4N9GB 4JHBA 2X2YA 3V7AE 4LDOB 4LK4A 1OAZL 1EEZB 1NLBH 4OT1L 1BGXH 4X4YB 1KJVA 4OZGF 3EO0A 1C16B 3BP7B 4PJHE 4OCNC 2I24N 1KEGL 1UH3A 1NBYA 4PJAB 4KAQH 1AD0A 1YJDL 4PJCA 5I8CB 1MJ8H 1MIEL 2EE2A 2ADFL 1QSFB 1TVHB 3CK0L 2A6DB 4J3OC 5D1QD 4KGLA 4RX4D 1BX2A 4OV5B 2XT1B 4DGVL 2CO6B 3UJTH 5DO2D 3L7FA 3VXOB 3HUJB 4G8GA 3F7VB 3CAFA 1JYWA 5DJYA 1N64L 3HZKA 3T0EE 3P30H 4GAFB 3BAEL 4E5XA 1EH9A 5AWNL 4O2EB 3Q2CA 3VXPB 5HDBE 1FLRL 1QR4A 3O2VL 1LILA 4FMFA 3ROOB 3TO4A 3QI9B 3VFMA 1CE6A 1NL0L 2N1KA 4F7CB 2YA1A 3G5YA 3NBNA 4HT1L 1JCKA 2FBOJ 1CD8A 3E1F1 4Q0XH 3HAEA 1WIPA 4M7LL 2QQLL 5EC2B 5FAAA 3H9SA 2I60H 2X4NA 1U2CA 5DQ9A 2B0SL 1A1NA 1F4WL 5F8RC 2FR4A 1A6UH 3WEXB 2DQHH 5JW4M 2DLFH 3SQBA 2GEEA 4XP9L 4NUJA 2R15A 4RGNC 4JFDB 1MCPL 1U8MA 2B7DT 5L2KB 3AREB 5HVHB 3ALXA 3PWUA 5KANI 1X4XA 3WDHA 1TQCC 4WI7A 5ENWB 3DX7A 2BVOA 5LXGH 1KSRA 1YEIH 1OSZA 4S1SH 1E4JA 1NC2B 2D31B 4CMHC 4LDLB 2XQYG 3E3QE 5IGXL 2YMXH 3QFDB 2GJZA 1U8LB 2CDGA 2YA0A 2FL5B 3D39E 4XBGB 2ATKA 1XF1A 4UT7L 3RUGF 5FGSA 3WIHL 2PUQT 1PW3A 1JHTB 2BOCA 1ZHBB 2H41A 1U3JA 2PCPA 3SGEI 2JLLA 1CGUA 3FQWA 2WP3O 2YD9A 3B5GA 1WT5C 3P4NA 3DETC 3WFDH 4KUCF 4LHUA 4NFDA 1MQ8A 1S7UA 3X13B 1FJ1B 4I77L 2EE3A 2I9LA 1M7DB 3UBXB 4YHKH 1U91B 1KCSH 1Y6MR 5KAQG 5IQ9A 5HHMD 1KCKA 5C0BD 5ANME 4KRPB 4NRYB 3D18A 1XGQB 4PJIA 2AEQH 2ZG3A 2IADA 2NYYC 1ZA6B 2XRAH 3C8KA 2X6MA 4Q6YA 4KI5E 2DBLL 4M1GL 1CE1L 3QH3A 3F12B 2EEBA 1U93B 1PLGH 4NNXB 1Q9KA 1D5MB 3EOYG 2Z8RA 4RGND 5C6TL 1V3LA 2L7JA 1M71B 3FQUA 1T2XA 4F15B 3WFZA 5SWSB 1M1SA 4FS0A 3RX5A 3BYYA 3MRKB 1CU4H 1N59A 3BPNB 2IAMB 5GQBA 5BVJB 1QPPA 1S7TA 4JFOB 2COQA 4DGIH 1J86A 3C60C 4NPYA 4LPVA 3BHBA 1NMCB 3SDXE 1X3DA 5TDNB 1UADC 3HNTH 2RGSA 4GG6E 2P43B 4M7ZC 2ATPA 4YBLC 4PJFF 4MDIA 3WD5H 4U1MA 4I48A 3PABB 4WWKD 2OJEB 4G9DB 2FBJH 3DETD 2Q76B 1PX4A 1T2QL 4P59L 1KEML 5HD8C 3MV7A 4LCIH 5I1KH 2X1XR 3KYNB 4XAKE 4OD2A 1N6UA 5CJ5A 3CDCA 1U8OA 3S36H 2DJ4A 3BEWB 3FT2A 4S0TD 1HHJB 1ONQA 1G7QA 3S5LG 4MNHB 1IT9H 2HLFC 3TF7C 4KMTL 1FL5B 1F00I 1LEGB 2NYYD 1X5AA 4QRPE 2VL5A 5DC9B 3C5SB 2XN9B 4Z7QE 4OCYH 2EDQA 2JE8A 4R90H 5C8JB 5DJ8A 4Y7MA 2ADJB 3V5DA 4BYHA 4LLWA 4X8JA 1MRCH 1ZS8A 4O9HH 1RJLB 3MGTA 4N8VB 4ONFH 3MRNB 1XGPA 2DOCA 4XPGH 1A1MB 3ZZ1A 3IJHB 1T0NB 4HQQL 2X4TB 3WFCH 4NP4L 4BFIA 1P4BH 5I1HL 5FO8B 1MCRA 4DUVA 3C60D 4PJBE 4WHDA 5DTFB 5GGQL 4GRWF 1G9NC 8FABB 2PYEE 3IDGA 4GXUM 2VDNL 5F7EL 4NNYB 2IWGA 4GMTL 3RTQA 4HFWB 4ODTL 3MUGB 5DA4A 2YUWA 1YA5A 3TYGH 2DTML 2GKIA 3DXAA 2VDOH 5HD8D 3JWOC 4MLIA 5I17B 4HUUA 1G9ML 4NZUL 4M61A 4KDWA 1P84J 4TNWF 5FHAL 5GRUH 5C07E 1EO5A 2A6IB 4UB0H 2WLYA 3L5WA 4JDZB 2HLFD 1CR9L 3FQTB 1RZJH 4MD0B 2QBWA 1E4KA 3BYTA 3HG1B 4YEFA 4NQUA 5BQ7A 1QKZH 3T0BA 4PJXB 2WMPA 2YXMA 1NJ9A 2MKWA 3VRLE 1MRDL 3X17A 4HSQA 2W07A 3IS0X 1X5FA 2Y5EA 4PY7B 3VWJA 3QZWG 5DEFB 3M17A 1FL3B 5KVGH 1LO4H 5B3JE 3EFDL 3BIBX 3F65A 1TNMA 3N85L 1BFSA 3D0VA 4PRHD 4XPAL 1KOAA 1T80A 5T1LA 3L3IA 1NDMA 2BSRA 2ITDB 1ZHNA 5D4QA 1CDCA 4H1LA 1YN6B 5EU6B 5C0IA 2C5DC 1B88A 1K8IA 1T3FA 4HV8B 3HLAA 3UYOD 5D6DA 4P2RB 1YEHL 4F8TA 4GMSL 3H9HB 1T03L 1FFOA 3D69B 3K2UH 1OAZH 3ULUF 2NLJB 5DJ0A 4R0LA 4PUBL 5IMKA 4UINL 4OT1H 3O4LE 3QULB 1S7QA 1EFXB 4O58L 3B5HA 1HKLL 2Y36L 5DEGB 2W1NA 5EBWB 2NXZB 1RIUL 1LO3L 1KJ2B 1IC7L 1UACL 4KXZI 5JDSA 3FB7B 3RP1A 4FHBD 3AAZA 1MIEH 1JIBA 5IW1A 4JDVB 4JM2A 3R0MA 5ADOL 4QHKJ 1BQHB 1REIA 4Y19E 3OKKB 3MRBA 3HR5B 3CVHL 3IFNH 1F3DJ 2KZ1B 1A6AA 4Z0BL 1G7HB 2OXHA 3P77A 3NIGE 5SV4A 2X4OA 3DSFL 2VZ1A 4OLVL 4PGCB 2AVGA 4DQOL 3VDAA 1NL0H 5KTEL 1A6VL 2VZOA 1WWCA 3MJ7A 1F5WA 3Q48A 5D9SB 3DO7A 2IPUG 3NCYP 4UQ3A 1A6ZB 4M7LH 2DQGL 2UYLB 2QQLH 4ZXBB 3TNNB 4LSRL 3DVFA 5AZEL 2BMKA 2B0SH 3PGCB 2XTJB 5IK3B 3CFIC 4UOW0 1WFOA 3TA3B 3BE1L 1X7QB 4YZFF 4G6FD 4P2QA 3FRPG 4YUEL 3GMRB 3CFDB 3LPFA 1KCRL 2HJLB 1W8NA 1MCEA 3BH8A 1TZGH 3L3HA 1YEFL 1FORH 2PTTB 2X89A 4JY4A 1QR1A 1PQZA 1P4LB 2FHBA 2R2CA 3DUUA 3S7GA 2Q6WA 1T1XB 1N0LA 4PB0L 1MIML 3WJLC 2WAHA 1V3MA 4L8CA 4HWBL 1LO2L 2F8VA 4UT7H 5E94A 4LKCB 4Y16C 4P4KB 3PWNB 2APTA 2FEDC 4YE4L 4WVRA 5C0AA 43CAA 1LP9B 5HI4C 2QSCL 4LGSB 3QEQA 3BFOA 3MRGB 5IR1A 4LEXH 4U1JA 2HYMA 4O5LL 1WCBA 2OZ4L 5CLWA 1CGTA 4Z9KB 5DK3A 1FYTE 1MJJB 4NBYB 4RAVB 3DVGB 3BT2H 2O61B 5D1ZA 2X41A 4L4VA 2GAZB 1DP0A 3OJ2C 3MYJB 3NACL 1OTTC 1BFOB 1NAMA 4NQVA 4XC1L 5AG9A 2WWKO 2FJGA 4PJ7B 4WW2B 4ISVA 4ZUSB 3GRWL 4NO0A 3KLHC 1GC1C 4AYFA 3EGSB 2Y72A 1Z9MA 2NY7L 4P2YA 5JO5B 2I07A 2DL2A 1A7RL 3LH2L 4FXGA 5HHOE 5CUSH 5B38A 2ZUQB 3QIBA 4E0RB 1R3HB 2GCYB 2UZXB 3RIAK 4NWTH 5C6TH 1EV2E 2J5LC 4PJ8A 4OZFG 4Z7WE 3O6MH 3V6ZA 5KSBA 1XCQA 3CLEH 5K93A 2X4UA 5J11C 4AM0A 2FIKB 2V7HA 5MENE 4RMWA 5EC1A 5GRXG 4JHWL 1J7VR 4GAJL 4MA3A 3VMPA 1MUJB 1DL7L 2E27L 2V5YA 4RGMB 1Q0XL 4D0DA 1B9ZA 1T5XB 4WI8A 2MHAA 4Y16D 3THML 2FEDD 5DJXA 5K9QI 2NW2A 1PD6A 3DPBA 5D1QB 3RWGB 4NQDD 5HI4D 4LCUB 1C12B 4M4RA 3AXLA 3V79C 2BJML 2GY5A 5BXFA 1ZWIA 4I0PA 4GBXC 3ARFC 5B39A 1T2QH 4P59H 5I71C 5J6GA 4NQTA 4FFYL 5GGTA 4LRIA 2XACC 1CTOA 4NKMA 1MF2L 1KG0A 4GFTB 4QT5A 1KN2L 3HMXA 4RA0C 4BQ9A 3EFFA 2FD6H 1OTTD 1NCBL 1NGPH 4KMTH 1RZGA 4JDTL 1MCOL 5CLTA 3KLHD 4JKPL 3OJDB 4GW5A 3SKNA 3GIVB 2B2XH 1OD9A 1VCAA 3ULSB 3GSOB 5T1DL 2VE6B 2F53A 5CGMA 4OFDA 3H3PH 2A2QT 1FH5H 1HDMB 3GBLA 4G42B 3IXTB 32C2B 2YPVL 1MI5E 1W0VB 3LVEA 5FA3B 2XZZA 1NUFA 1SYSB 3EDJA 3PJSA 3VFVB 1TMCB 4HQQH 4NN7C 4BZYA 1M4KA 5I1HH 4Q2ZA 1F3JB 1NMBH 4ERSH 3UJIL 3VU2A 1D5IL 4HZLB 1GOFA 3MUY1 2VDNH 2ZOKB 1IM9A 1NKRA 5IVOA 4ODTH 5K9OA 4BK4A 2HJFB 4GW1A 4B0MM 4LPXA 1E4XL 4GBXD 3ARFD 4ZO6A 2WBWB 5CINH 3CZFA 1G9MH 4NZUH 4O2FA 3ESVF 1CL7I 3MRFB 4OFVA 2JELL 3OJVC 1IGCL 4X83A 4M7JL 3LIZH 2V9TA 3R06A 3KPRE 5FHAH 2ZCHL 2P8PB 3RL1B 3E6FB 1XR9A 5EUOB 4NO5A 1DQQA 2V5MA 5F7LB 1CR9H 5KSUA 2OR9H 5ISZD 5JIPA 4PJ5E 3LS4L 3IU3A 2HVJA 4YWGL 1MRDH 1QBAA 4HF5L 4MNQA 4X6DE 1JK8B 3FKUS 2DQCL 3JWDH 5D7IB 5DHYA 4M4PA 4ZFZA 3P4OB 3SJVE 5HHMB 5D2LE 4QYOA 5C0BB 3PIQB 3CX5K 3RGVC 2J88H 3U82B 1UKQA 3HRZA 4QTHB 5F89B 1WBYA 3F7QA 5D5MA 2QL1A 4ZTPL 3EFDH 4GRLA 4Z8FL 2J4WL 3N85H 3T09A 4XPAH 4XP6L 4JFXB 3HI6L 2L0DA 5FYLD 4PS4H 2RFXA 1HIML 1I7UA 3EYOB 3HZVB 1NFDB 4RGNB 5IROC 1F8TH 4GUPB 3PE9A 2HA1A 2HFTA 4Y1AE 4QHKI 1QZ1A 1TQCB 5D7SL 1RZFL 5I1CL 4MZ3A 3VFSB 4LLMB 1DCLA 3TZVB 1MAML 3QXAB 4CMHB 2P45B 2H32A 5DGQA 4PUBH 3G5VB 4UINH 2JIXA 5DD5L 4XT1C 4FQXC 1KPUA 2ILLA 4NZRL 5GHWL 5IFAH 4O58H 4HIEB 5C9JA 3C6SA 2Y36H 1R24B 4IBLT 2R23B 4PP2B 1X44A 3W9EB 3ZT7A 4IRSC 5CEZE 2VLKE 1I9RL 5SX5K 1UACH 1IC7H 4G80A 3EYQC 1C16A 3RKDC 4WWKB 4AG4L 4Y4FC 4MQ7B 5F96L 2DI9A 3L7EA 5LAXB 2IH3B 5C0GA 5C0RL 3PWLB 2FZ3B 5IG7A 5FHBH 1CLCA 5IB1A 3B9AA 3NOIA 5TE4H 3RZCC 3LRHA 1J18A 1JYNA 3MV9D 1RULL 1A4KB 5DJDB 5DT1L 4EIZC 5KVEH 3HUJA 3MQIA 4OCXH 4Z0BH 5CJXC 3B8SA 2ZSVA 2JK5B 3RGVD 5BVPH 2KL6A 2VISB 3ZE1F 1TTFA 5C6WH 2GHWB 2NR6C 5DD0L 3SBWA 3DSFH 2OTUB 4OUUB 4OLVH 3T0AA 4DQOH 5CD5C 3T2QA 1FVDA 1A6VH 1VB9A 4J3XA 1SVCP 2Q7YB 4EDWL 3QI9A 2QTEA 3ZL4H 2R0ZH 1I1CA 2Q8BL 2C3XA 3S98A 2EE9A 3BQUC 3KWWB 1CFNB 3ES6A 2BOBA 2DQGH 3EO1A 1FE8H 2VOTA 4F57L 5BRZD 5INDB 1MCLA 5JIIA 3BZEA 4EXKA 2GFBA 4HW6A 1L7IL 3EW3B 1LEKB 2AXGB 3A6BL 1OLLA 2P24B 3BE1H 5ACMA 1ORSA 3C60B 5F9OL 1G0XA 4NJ9L 1UT9A 4FQXD 5IB3B 3V6BR 3S9DB 1T83A 4YUEH 5FV1L 4M7ZB 1KCRH 4EN3C 4IRSD 5DD1L 1CZ8H 2WIIB 5AD0A 2I26N 3EYQD 2JCCF 3OR6B 3RKDD 1YEFH 3K7UA 4Y4FD 4LF3A 5EU7E 2D0FA 3BGFC 2OMNA 1DN2A 5ENWA 5FGCE 4PB0H 1MIMH 5EPMA 4J3VA 4JAMA 3RZCD 2V2TB 5I73B 4CDHA 5JOPD 4Y4KC 4LSVH 3PDOB 3QFDA 3MLPA 4Z7NE 1SEQH 5I1GL 3BUYA 4ESKA 2K9UA 4XBGA 5CIPA 3HI1B 3BGMA 3IJSB 4U3XA 4B5EA 1R3IL 4XNMA 2NR6D 4LPTA 2XV6B 4KRLB 4O5LH 1I8IA 3AROA 5CD5D 2IPTH 2FH8A 4S1RL 3O3DB 3P9MB 1LQSR 1T2JA 3GSVB 2OSLA 5FA4A 1FV1A 1U92B 3BQUD 5DQJA 3NZ8B 3G9VA 5FB8A 4XC1H 4F9LC 3UTZA 3VGDA 1M7DA 3GRWH 1NBZA 3JV4A 3BH9B 4P48A 2WBJA 4PRHB 5EZOH 1Y0LB 4RCAA 4BQ6A 3REVB 2NY7H 3PV6A 1A7RH 4IS6B 1ZGLM 4NHUA 4ZYKB 1K4DB 4WO4C 4ZFFB 3T0EC 2RQ8A 1DFBL 1MHHB 3Q6FB 3SY0B 2XKNB 5FKPB 4B7LA 2X1PA 4YDLC 3F12A 4EN3D 2UY7A 1U93A 5J7CC 4GSDH 3V6FB 3VXME 3WNPA 2VLRD 4NQCD 3QFJA 1BZ9B 2J6EA 5GJSH 3GUTB 4PJCF 1YNTA 2CK0L 2EDWA 4JHWH 3U79A 1PYWB 3KXFD 1DL7H 5C0FA 4KGJA 1M05B 4Y4KD 1K4CA 2GTZB 2G75A 3V4VH 3O3UN 1I1RA 2VZTA 3THMH 3O6FA 3C6LA 3FOLB 4WUUD 1TPXC 1AY1L 2WV3A 5TDNA 4KUZL 4MX7B 2BJMH 5CEZH 3TPUA 5I9QC 3BKYL 1I3RB 1J9CT 4HLZG 3M07A 3QNYA 2XA8L 1T04A 1NANI 1XGRB 4X0KB 5E1AB 15C8L 4JZOB 1V7MH 3O3AA 5KJRL 4XH2B 1NCBH 3F7YA 5TQ0L 2V5TA 3RIFK 1I9IL 3T4AB 5CEYB 4YNYA 4JKPH 1EVUA 3SE8H 1HQRB 3SDCA 7CGTA 4UI2A 3QUMB 3E3QC 4HKBA 3DV4B 5IMOB 5EU5B 2AXFA 4WO4D 3T0ED 2NY2C 1AXSB 1P7QA 4YDVA 1K8DB 2APXA 4X7FC 3QNXA 2J8OA 4YHNB 2G9HA 5GZOC 2ZJSL 4XWGH 2XY2A 3EO9L 4QRSB 3B9KC 3IFLH 3E8UL 3MR9B 4EDXB 3MRNA 1TIUA 3RZWA 1D5ZA 3IKCA 1I4FB 3LN5B 4MYWB 4XPBL 3B43A 5GSVB 3IJHA 2B8OT 1T0NA 3WIFA 3UJIH 4JB9L 4K7FB 4UTBL 2ZSWB 4PRPD 1D5IH 1MELA 2LQRA 5C3TA 2XQBL 1AGBA 3ZDZF 4GKOA 2CD0A 3OXRA 1AI1L 1JWMB 2VITA 3ORJA 4IMLA 4M7LT 4JFFE 8FABA 3ULVF 1LD9B 3DGGA 4NNYA 4ZO9A 4OAWB 4XNYL 4KI5C 3MUGA 3BWAA 4OD3L 2JB5H 4GAGL 1IGCH 3MCG1 4LP4A 1QPXA 3G5XB 3WJJA 1FZMA 1FIEA 1B2WH 3BISA 1P7KB 1PGRB 1XH3A 4JDZA 1RFDL 1XF3B 4YWGH 3RUGE 4EKXA 5IHZB 5L8JB 5CS7A 4HF5H 3SGJA 4PJIF 1G7PA 3D39D 4RDQG 4LCWA 2DQCH 2NY2D 4PJXA 1A9EA 4RMRA 2I9TB 5MEPB 1GJIA 4OM0H 2ESVA 3DX8A 4PY7A 5GZOD 4ZSOE 4M3JA 2X70B 4ZTPH 4Z8FH 4C4KT 2J4WH 2CQVA 2H26A 3TVMA 4RBPK 1G9EA 4ODWB 3B9KD 3HI6H 3ET9F 4KVCL 3CC5A 1HIMH 1U8JA 5IFJA 5E5UB 5GGSY 1QSEE 3L5JA 3G04B 3GSNA 1FFRA 5DS8B 1OGAE 5I1DA 2ICWI 3DTXB 2BNRB 3S96B 1RZFH 2JJVA 4OZIB 5I1CH 1YN6A 4PGEA 5F1SA 5BZDB 4FQHA 2UWEA 5GZNC 3O0RL 1DN0A 1MAMH 4YAQB 3WLBB 3VE0A 1IC4L 3D85D 5GGVL 3OQ3B 3VXQA 3QB7C 1KCLA 2GK0B 1HXMA 4KI5D 4P2RA 3O3EB 4FQIL 2ICWB 5DD5H 4D9LL 2FB4L 4NZRH 5GHWH 4AT6A 4BH8A 1MHEA 2NLJA 2Z93A 4Y16B 3MJ8A 2VKWA 1I9RH 3O8XD 5EFIB 4BJLA 5KG9B 4NQDB 4IDLA 3S35X 3VGEA 3WS3A 4AG4H 5BJTB 3TBWA 1HHIB 2OK0H 3T0DA 5A3IC 5F1NA 5TE6L 3DUSA 3OGCB 4JDVA 4NBXB 3PF2A 3DNKA 1FBIL 4PJFE 1A5FL 1N5AB 1RULH 3LN4B 5IHUL 1A8JH 2EIZA 4PGBA 1NC4D 4WEUD 1CG9B 1T21B 4JN2A 4OF7A 4ONHB 2CDFB 2V2XB 2DM4A 4IDJL 4JANA 1X5XA 4BUGA 1CDYA 1XCTB 4DAGH 3KPTA 1UM5H 4HIHA 4NZDA 3SDDA 4EDWH 1QACA 2R69L 3G6JA 3FB8B 4BZ1L 4I4WA 2Q8BH 1A7BA 5EIVA 3BP6B 2J5LB 3S37X 1IVLA 3EOTL 1MY7A 4F57H 1MQKL 5DJAB 2MNUA 1WTGT 1BD2E 2DQFB 1L7IH 1QFHA 5J11B 1AXTL 5GZND 5GISL 1B0RA 3GMQB 3A6BH 4QRPD 5LQBL 5F9AC 3H7BA 1HI6A 1GAFL 3PGFL 4NJ9H 1DEEA 3L5XH 2XXCB 5JOEA 4BKLA 1JWUB 3RVTC 4C56A 1X7QA 4L8BA 5TJWK 1AGEA 2ZCLL 4PRAB 12E8H 3FQNB 3SPVA 4Z7VB 1ACYL 1R3KA 4KY1L 3OB8A 4FOMA 3F6LA 3L9RB 2V5RA 4HX1A 4GBXB 3ARFB 5I71B 5E2UL 4FXKB 3WN5A 5A3ID 1H15B 3AC0A 4PR5A 2PTTA 1N2RA 1U8QB 1P4LA 3VGAC 1LGVA 1HSBA 1OW0C 4XNXL 4U1GC 4Q74A 2PYED 2OS7A 3BPOC 3MV11 3NA9L 3TN0C 5FYKE 1AO7E 3NCJH 2IPKA 1R3IH 4LLAA 3TBSB 5EIQA 5IF0A 3VDBA 5ISZB 1CBVL 4JHZA 1UM4L 3MRLA 4LKCA 2AAVA 1KJMB 4XNQA 1DQDL 2LFGA 3ROLB 2AABH 3GHBL 1YY9C 1LP9A 1N0XL 4N0RA 3EIFA 4LL9A 4S1RH 1JGUH 1MHCB 1IZKA 4BELD 2XQYK 2XZAH 5I1JL 1JHKH 2BDNL 3VXNB 1IEBA 1UGNA 1VDGA 4KKBC 1N3NB 1MJJA 1T66C 4RAVA 1VHPA 4LHUG 1KLUA 5C07D 5TE7L 1CD1B 4OGYL 3DUHA 5E8EA 4X7TB 2G5BA 4F2MA 2GAZA 1OAKL 4R2GC 4GQ9H 4UTAH 3WYRA 4X6BB 3U7YL 5DMGC 2DQDL 4H26A 1FGNL 2HLAA 3VXSE 5A2FA 2OQJA 4CMMB 5JO5A 3RVTD 1KB5B 1CTNA 4NQSA 1HOCA 4E0RA 1R3HA 2GCYA 5ALCL 4K3JL 3RU8H 4DVBA 4LCCA 1JI2A 1CXFA 2W9DH 2VXVL 4J7RA 1S7WB 1CGXA 4GKNB 3EYFB 3SGDI 1KGCE 2Z31C 4HWZA 5TF0A 5DD6A 1YEJL 4JM2F 4ZPTA 1CWVA 2P5EA 2WQ8A 3TC9A 3TN0D 3ULUE 4OIIL 1ETZA 2CXKA 3HC4L 4KUZH 1T5XA 2GSIA 3RHWK 3BKYH 1YY9D 4WHTB 4POUB 4H5SB 1UB5B 3Q6GL 1S7VB 2XA8H 3RWGA 1S9VA 5DA0B 3RWJA 3FFCE 3O4LD 3RNQA 3N06B 4C4KO 1MLBB 3MV9B 1KIUA 1S7RB 4L9LC 2EDJA 3RGVB 4KKBD 5KSVB 1T66D 2HRPL 3CPLB 4YHLH 3HNSL 3IT8D 4R96A 5F88B 4HWNA 4F7PB 1UKSA 4CW1B 3I02A 1G9MC 2BVQB 1EGJA 3GKWH 3QUYC 4NRZB 4R2GD 5IKCB 2PW2B 5DMGD 4ETYA 1DVFA 4PRNB 3OKLA 2ZPKH 4JR9L 2OM5A 4UDUB 3RWEB 5BRZB 5EO1A 3GIVA 4K7PH 4CVWA 3OF6D 3ULSA 1GZQA 3WE6B 5F8QC 3V52H 1F4HA 1ZVSB 3ESUF 3WLWC 3VFGL 5IEHB 3QJHA 3AS1A 3EO9H 3GFUA 2CMRL 4RGOL 3I6GB 3IXTA 1VFMA 5EO0B 3JWDC 5T5NF 1DBJL 1EJ6A 1W0VA 4J4PC 5FA3A 2Z31D 5K9KB 2HG5B 3X3GL 3VFVA 4XP1L 3QUKA 1CIDA 4G43A 4GKSA 4Z7UA 4IRSB 5HY9B 3PQYE 1F3JA 2XQBH 1WUNT 5DJ2A 5H2BB 3TIDB 5C0EB 5A2LH 4Y4FB 4YZFE 1C7SA 1LK2B 5JW4Q 1VGEL 1YYML 3MA7A 4JFQB 1NSNL 3LKPA 3MV8E 3C8HA 4XNYH 4OD3H 3RZCB 2LTQC 3DHMA 1UC6A 4IHOB 4GAGH 5I16A 4U3CA 3WHXA 4LLDB 1AQKH 4TNVF 3U2SB 3MOQA 1Z9SA 3FO9B 4OM1L 1QSVA 2W0FB 5IESL 1T7YA 4NFBA 4NC1E 5JR1L 1SJEB 3ZYIA 1EEUA 2P8PA 4JRYE 4XMPL 3QUYD 2P44B 5FYKH 2YZ1A 5FECA 1FPTH 3W9DB 4XPFH 1H8OA 2FHCA 4Y2DA 3BQUB 1EEYA 4UIKL 3QSKB 1OP3K 5GS0L 4HEME 5IB5B 2R2EB 4OFIA 2EDEA 1IGJA 3SGKA 2EICA 3LQAL 3BW9B 2EYSB 2DD8L 1C1EL 3WLWD 4RAUB 4XHQA 5CWSB 4KTEH 2BFVL 3BWUC 3MACL 5H94A 4JQVA 4LCYB 3PV7A 4OZHB 1XR8B 4PJAE 4J4PD 1XIWC 4M7KH 4FABH 1FYTD 5KSBF 1M7IB 2EEDA 4RMQA 3Q5OA 2Y6SC 3U7WH 3PL6C 4EN3B 1YEGL 4JFXA 5CJ8A 3DX6B 3HZVA 3RVWC 5IMLB 3S4SB 2VLRB 4NQCB 4UT6L 1JRHI 3AB0B 1J0JA 4E41E 2DTSA 3BGFB 4XMLL 5IQ7L 5GGVH 4ZUVB 3E2HB 3DURB 5TF1L 3KXFB 4LLMA 4M3KB 4D9LH 4Z77B 4FQIH 2FB4H 5DGRA 4Y4KB 5HHOD 1WC7A 3B2UC 4MDJB 3VH8B 4DJMA 5MP6L 4HK0A 4WUUB 2N56A 4OCLC 4CVZB 2PTVA 2FO4B 2OI9C 4MJ6A 4XC3H 5HGGS 2GITB 3VXUA 3LKOA 4CJ0A 1VESA 4QXTA 4P46A 4WW1B 4YHZL 5TE6H 4NGHL 1WT5A 5MEND 4CVXB 3E0GA 5BW7C 5LAXA 4I18C 2IH3A 4WRLA 1F4YL 4MQSB 1JZ7A 3PWLA 1A5FH 2YPLA 5IHUH 4JVPA 5F3BB 5GRJL 2QKIA 3A67L 4M43L 3H0TB 1Q9WB 2DJSA 3GJEA 4XBEL 1JF6A 5TH2B 4U7SA 1VADB 4TQEH 2BX5A 2B20A 2C4FT 5CBEB 1S5IL 3N1GC 3IDNA 4UV7L 4Q9RL 5CMAB 2RJMA 4ONGL 3P0GB 5GRWA 4JFDE 3BXNB 4Y89A 4WO4B 4OQTH 2D7OA 1XIWD 4OBSA 1MWAA 4JJHA 2R69H 3DYMA 3SKOA 4LMQI 5I2IA 4HWEH 4MAUH 3O11B 2Y6SD 5DJCB 1BHGA 4YDLB 3PL6D 3CVIL 2ID5A 1MQKH 4HZAA 3RVWD 2VDKL 1YN7B 5D6CA 4NKDA 5EOQH 4ZS7L 5IW3A 4YPGA 3QEHA 5INDA 5CJOL 4OI9A 4JRWA 5GGVY 3RX7A 1F11B 4RZCB 2RCSL 5I66B 1PAMA 5EZLB 1Q9LB 3U0TA 3RA7L 1WEJH 4DN4L 2VXSH 3C08L 4PRPB 4BSWB 3B2UD 1SMAA 1F6AA 4S11A 3PWJA 5EU3A 4PIRF 3GSQB 1BLNB 1A7QL 1TPXB 4WI5A 4HHAA 1GZPA 2Z4QA 1MI5D 4LGPB 5I9QB 1VSCA 4G3YH 5E2UH 2OLDA 3OAUL 2QLVB 4KKCC 4JFHE 3NPZB 4KK9C 3K4AA 3MMEB 3LKRA 3BOVA 4XNXH 3MFFA 4FG6C 2EYTA 1UFUA 3F58L 1GGUA 3KPMB 3NA9H 3PHOB 2V2TA 5J1AA 1CBVH 1CFSB 5C7XH 2HWZL 1DQDH 3BIAX 5ELIA 4C83A 1A4JA 3GHBH 1Q0YH 2Y5TB 2E7LC 2G60L 4YHIB 4XZUB 1NGYB 3V95A 1T5WB 2NY2B 5D5MF 4XAWL 3TM6A 4G8EA 5I19H 4EBQL 5IOPA 6FABL 2BDNH 4Z7OF 4LSSL 3KPRD 4U1SA 3ZE2F 1CI5A 1V3JA 1BEYH 2JKXA 4OGYH 5EOTB 3DHJA 3NZ8A 5IMMB 3U48A 2IBZY 3RY6C 3B9KB 4PJ5D 3P73B 5I8KH 1KNOA 4YHOL 2X4RB 3CU7A 3UTPE 2DQDH 1FGNH 4X80L 2FX9H 1N4XH 1D5BB 5GS3A 5FGRA 3SJVD 1F4XL 1KJ2L 3UZEA 1ZEAL 5EZIL 1FNSH 3FQXA 5JXEA 4P4RB 1CQYA 5LGJB 3RJDA 4DCQB 3D85B 4K3JH 5B38G 4L3AA 4TNWK 1OL0A 2VXVH 1UB6B 1YECH 1BIIA 3AGVA 4Z0XB 4KKCD 4YFDB 4KK9D 1YEJH 5K9JH 2B4CL 4L29B 3O8XB 3GUTA 1RUPL 5TPWH 2VWEC 4HGMA 1FG2B 4FG6D 4Y1AD 1AH1A 2OXGA 2UUDH 2JB6B 4XVTL 2Z35A 5L6YL 2GTZA 4DKAA 3JV6B 4UAOC 1XF4B 3WKNA 5ACZA 1FVEA 2WINB 3C5JA 3QWRD 3Q6GH 3QHZH 4ZNEA 1NCUA 5DYOB 4P99A 4MX7A 3EYSH 1IL1B 3SDXB 1FFNA 3MLUL 2MWCA 3UYPA 5E08L 5EO9B 1NC4B 4GG6B 2W38A 5CEZD 2HRPH 2VLKD 4W4NA 5B39G 2O5ZL 4RFOH 2Z91B 3HNSH 4PTUB 1MH5A 1A14L 4FA8A 3L3JA 4XH2A 5EU7C 5ABDE 3O81A 2QHLA 4GRMA 4LSUL 4TOYL 4HUVB 5FO7B 5IIEB 2YS4A 4LLQA 5JIKA 3TBVB 4NNPH 3QUMA 1U41A 3ZE1E 1HILB 1H3UA 4M8QA 1RZIB 1XZ0A 1BQLL 5FUOL 1FG9C 4U1HB 4UU9A 4QRPB 1X5KA 1MCQA 2CMRH 3WL9B 3GM0A 4KVNH 3QXTA 1DBJH 2QQKL 3UO1H 3HE7C 4GXVL 5GIRA 4TULL 3X3GH 3MOBH 4MVBC 3DBXB 4ZAKC 4EDXA 3ETBF 3H3BC 3HG1E 1QLEL 3S88L 2ZSWA 1QO3A 3PP4L 3KNBB 4OB5L 1YYMH 3K8KA 1NSNH 3MRIB 4JGJA 3U1SL 1JWMA 3DMMC 3SGEH 1LD9A 5BZWB 5BV7C 1DQTA 3U83A 4J2XA 1OQOA 4BH7B 4TVPE 1KTDB 3IETA 3HPJB 1ZLUH 5HYSB 1Q9OB 2VKXA 2I5YH 5DUBB 4PJEB 5EU6E 3TNMA 1Z0NA 5I1EH 1ZK9A 1XGUB 3ARGC 3QG7L 2NNAB 2DLHA 2FYYB 1G7IB 3D0LA 4UIKH 5GS0H 3KYMB 3DVNA 1G7MA 2E6JA 5IHZA 3OSKA 3MBEC 5FK9A 3LQAH 4QRQB 4BQCA 5GGRA 1C1EH 3P9LB 5MEPA 1JGDB 4ZD3L 2NX5E 2O5XL 2BFVH 3UYRL 3MACH 3G5ZB 2DLEA 3HE7D 2F74A 3WXVL 4MVBD 4DTGH 4ZAKD 5IT2L 4LSPH 4UT6H 1FN4B 3G04A 5E9DD 3V0AC 4YC2C 4XMLH 4BZ2L 4OZIA 2LE9A 1KIRB 5BZDA 2X5PA 3J7HA 3MNWA 3UTOA 5E7FA 4R7NB 2ENSA 3DMMD 4YAQA 4YHML 3I3DA 4HIIA 3VGAB 3GHEH 1CXHA 2HJKB 4JKMA 4P5KB 4U1GB 5MP6H 1P9MC 2GT9A 4Z76B 3BPOB 4XPTL 3TN0B 3C09C 4NHCH 4KZEL 2IANA 1HHGB 3FCTA 3VXMD 1WBZB 4N8PA 5LWYL 4PJCE 3AM8A 2PXYA 1NCDL 4NQDA 4KKLC 1QVOA 4YHZH 4NGHH 2D7TL 1D6EB 3ARGD 3CD4A 4E9LA 4HS3B 2YSSA 3MNVA 2VZUA 4EUPH 1T1WA 4HH9A 3MBED 1MSPA 5JW4R 4KJPC 1DE4A 4NO2A 5GRJH 1L0XA 3CDFA 3T77A 3A67H 2JJUA 3I6KB 2CLZB 4KJYB 4M43H 4YDKL 1RURH 3LN4A 4R2GB 3B3IA 1S5IH 4UV7H 4Q9RH 3Q3GB 3B9EA 4QGYA 1R5VA 1TZHB 3MZGB 2EKSB 1J05B 2VDKH 1S78C 3QUXC 1TQBC 2X9YA 1IFHL 2LU4A 3IGAA 3H9SE 5CJOH 1S9XB 2PN5A 2Z31B 3NFNB 2MPAL 1LMKA 3PWPD 5ESVB 4FZEL 3C08H 1ND0A 2XWTB 3AU1A 1P4IL 1MRFL 4JO4L 3U4EA 3V4PL 4KDTC 5DD3L 1BFTA 2VYRE 4LAJH 4KPHL 5BCAA 2EKJA 4OCWH 3I6LE 2A83B 3EDDA 3GJFH 3FQNA 5HGBB 1JN6B 4Z7VA 4O2CB 1BZ7A 3OAUH 4KKLD 3D87B 4LNRB 1U8KA 4GBXA 3V0VB 3DOSA 1N7MH 5T3ZL 4L9LB 4V1DA 5ALBL 3ZDZE 1I8MB 3QQ3B 1A22B 1H8NA 3ULVE 3B8YA 5GS1C 4K23L 1G0DA 4KJPD 5FCSH 2BY2A 1QHOA 3QUYB 4JFFD 3RVXC 1I9JH 3OZ9L 1A6TB 1JYVA 1A9BA 1AGCB 2R0LL 5J9PA 3DYOA 1JUFB 3G9AB 2OL3A 4WIQA 3ROLA 3O3BB 5F1OB 1RUAH 5E6ZA 1LO0H 4HJJL 4LSSH 4XCFL 3H42L 1BF8A 2W0PA 4XVJH 3BZ4B 3KGRA 1YUHB 4PD4J 4X4ZA 1I8KB 4ODUA 1S78D 3VXNA 3QUXD 5I15L 4NKOA 4PJIE 1PG7H 4YK4C 4YHOH 1FYTB 1KN4H 4X80H 3NIDF 5D93C 1CDJA 3KLDA 2UWEF 4LEOB 5C0CD 3UBXG 1RK0A 2ZCKL 1F4XH 1KJ2H 4F3FB 5EZIH 3MROA 4KUCD 3KJ6L 3L1OL 4ZNCD 2VLLA 1EHAA 3T65A 1OY3B 3RWIB 1DUZA 2H2SC 3L3OA 2LTQB 4ZOEA 5HHOB 1A02N 1AIFB 2PYFB 4KXZH 4QRRA 4KK8C 1QSED 4YO0A 1RUPH 4GKNA 3EYFA 4GKZA 1OGAD 4ZQKB 4KMQA 4XVTH 5J3HC 5L6YH 2VNCA 3DRQB 5EIIB 2AJXH 1KYOJ 3RVXD 2HH0L 3D3VA 5MENB 2XWJB 4OCSL 1RU9L 2DWEB 1I1AA 4U1KB 2HT3C 2A77H 3WKML 1JGEB 5DHVB 3NH7H 5J89A 1UB5A 4RMUA 1CGSH 1S7VA 3TIEA 5JMRA 3S3SA 5J6HA 2ICEB 2O5ZH 3K74B 3MV9A 2EH8L 1SBBA 1ZGLA 4QY8A 3G6JF 4PV8A 4OZ4B 1YYLH 4FQ2H 3O45A 1A14H 1SM3L 3LRSB 5KN5B 1UXSA 2B1HL 5GJTL 1XIWB 1IGIL 1GVIA 1Z5LB 4LSUH 4TOYH 3HNVL 1MHPL 3PL6B 4P5MB 2CRMA 3D25B 5CZVL 1NH6A 5ESQB 4WU5A 4I2XA 2HFFA 5FUOH 1G7JA 1R3LA 3IB4A 3RWEA 2C3VB 3T3MF 4J1UA 4X7EC 4R97C 3CXDL 1ZXQA 3HAEH 2H2SD 2EZ0C 2QQKH 3OAZH 5IEHA 2FDBP 4JY6B 1WZ1H 4GXVH 1JZ3A 4TULH 3KPPA 4KK8D 4FQXA 4L3EB 3U9PH 1WAAA 3S36X 3DIFA 1F4AA 1TXKA 3V0WL 3LMJL 3VFTA 1MI5B 5MEQA 1U8NB 2OI9B 1CYGA 1RMFL 4N8VG 3ECBA 3S88H 5J3HD 4IRSA 3D1MC 3PP4H 4X7CC 2FSEA 2F54A 1MJ7L 5E2VH 5T3ZE 3RWHA 5D7IE 3U1SH 3BEVA 3PHSA 2HT3D 3NTCL 4AZ8A 2DKSA 4JFQA 4GLRI 3W82A 1EO7A 3MUHL 1ZT7B 2BVPB 4PJGA 5IB2B 3QDJB 4LLDA 1WQVT 3HFMH 3U0WL 1DQJA 1WBXB 3T1FA 3V7MA 1UJ3C 3WNKA 1CFVH 3UTSE 5SX4I 3GJFK 1A3LL 3QG7H 1PDKA 4CADB 1G9NL 2YKLH 3KPRB 2GTWB 2P8LA 3DO3A 1NCTA 3OB0K 4RFNC 1NEZB 1JF1B 2D4DA 1NBVL 3G6DL 3PHQB 1FFQA 5J8OA 3WFEL 3ULUC 5FYKD 5IB5A 1AO7D 4ZD3H 4PJ5B 5DJZA 2DIJA 2E6PA 3QDMD 1I1FB 4LBEB 3FTGB 5GRVL 3JWOL 4U1IB 4G8IB 1PBYA 4HK3J 3UYRH 2EZ0D 3HE6C 1JNHB 1ES0A 3WXVH 4M5YL 5D2LB 5L7XL 4OZHA 4LCYA 4MCZB 3QWQB 1URLA 2DWDB 1M7IA 4C59B 3CMOH 1YPZB 5IWLA 1MCCA 4EN3A 3NIFF 1I8LA 3NABL 3DX6A 3S4SA 1GH7A 1NMAL 4GO6B 1OTUC 4NZJA 4XP5H 1MCWW 2X4PB 4YHMH 4JG0L 3VXSD 1GGCL 2R2HB 4XXDA 5HJ3A 1CGVA 4MNGE 4Y1AB 3KXFA 4UBDC 3WHE1 3RGHA 4XPTH 1ORQA 3N1FC 2FGZA 3VH8A 1KLGA 1IAII 5LWYH 4L1DA 2ZKHL 1NCDH 3VXRA 2YD8A 5K59E 3DRTB 3QUML 4HKXB 4N0UA 3QIWC 4PG9B 2D7TH 5T1KD 3HR6A 1KGCD 1I85C 3OKDA 4ZPVA 3RPIA 3TCXA 3VD7A 3OXSA 3D9AL 4XP4L 2VLKB 1LHZA 4FZ8L 4PJHA 4ELKA 2Z8SA 3REWA 1DDHA 1NQBA 3ULUD 2RHEA 4YDKH 1KCUL 1L4IA 5HHNA 5BS0A 5ERWA 5F7DA 1AKJD 3UTTB 3H0TA 1Q9WA 3RDTC 2IGFH 5IVXA 5TH2A 1L0QA 3FFCD 5E95B 4DKEL 3BESR 1H3PL 3HE6D 4Y5YA 4OI8A 3VDCA 3T0EA 2YD5A 1OQXA 3SKMB 4UQ2B 1E28A 4NC1C 5ICZA 1IFHH 5DUML 3TP4A 4Z7UF 4FQQB 4XWOC 8CGTA 4WFFE 4LHJB 1MOEA 2MPAH 3GGWA 2XIDA 1OTUD 2ITCB 5IV2A 4FZEH 5DUPL 3QO1B 2AJUH 4HS6A 1P4IH 2VDRL 1T22B 4NZTL 1F11A 4RZCA 1OAXL 4JO4H 4UBDD 3W0WE 1P5UA 2FEEI 2XPGA 1NFKA 1GCFA 1U58B 4QHNB 4FQ1L 4ORGB 5FCUL 1T1ZB 4KPHH 1WTLA 5HTSA 4UAOB 3DSNA 4QGTA 1CL7H 4GW4A 3GSQA 2IMMA 4F7TB 1IEHA 3FO0L 5C09A 4YXLH 3QXDA 1CDIA 4JKLA 4FTVA 5JW4N 3QIWD 1BQUA 2ZOLA 4UIMA 5T3ZH 5ALBH 3HPLB 1I1YA 1IQWH 1A7PH 1RY7B 3OAZK 3WFBL 3PQYD 4W4OA 5JHLL 1ZT4B 3U46A 4AL8H 1FGVL 4OLZL 5E99L 4JPKL 5KVDL 2O5YL 3LD8C 5DRZA 1DEDA 1Z3GH 3LV3B 5C0AE 5E8DH 1YY8B 4QRTA 1QA9B 2C7UA 5FGCB 3MV8D 2R0LH 2XICA 3RDTD 1ED3B 1A1OB 4HC1L 3U4BL 3ZHKA 5D96B 4HJJH 1JPGB 3D39A 1SJHB 3UTQB 4NCC1 4JN1H 5DMJB 5ITFB 1DBML 4DKFH 4Z18A 2DYPA 1DBBL 4KWUA 1M7XA 1IGTB 2R1WA 3QUZA 3F7RA 2JJTC 5I15H 4MSWA 3GI8L 4X5WB 4XWOD 2A6KB 2BC4B 4ETQA 4JRYD 3ZKNC 4JJ5B 1YZZA 3HE7B 3IDMB 4I5BA 1X5ZA 5IMMA 3P73A 2QQNH 1P6AB 5DDHB 2X4RA 3V8OA 5INCA 3FZUC 5B8CC 2ZCKH 5HGDA 3PG2A 5E9DB 1ZLWK 2VN4A 4ZUUA 1F3DH 4WFGE 4N8CL 3UROR 4ZO7A 2BNQA 3L1OH 4DWHA 5ANMA 4H1LH 2BY1A 2YK1L 5KW9L 4OLXL 3DMMB 1YDPA 5LGJA 5BV7B 3JTSA 1A7NH 3LSOB 4M8VA 5E5MA 5HYFA 3L3DB 4R3SB 3LCYA 4EI6A 4U3HA 3I3BA 5F7KC 3VXMB 4YIQB 3VRIB 1IAKA 1GC1L 4OIBA 3OKNA 3T2PA 5ID0B 4E41D 4IMKC 2HH0H 2NY4C 2I25N 4OCSH 1FFPB 3ARGB 3MRCB 5GRZA 1BVKB 1EXUA 3BRGC 2VAJA 1F58H 3MBEB 4OKVB 4QHLA 2DAVA 1IKNC 2UVEA 2BNUB 3UPRA 2P1YA 2EH8H 5EBGA 4OLUL 1NC4A 5J0BA 1TETL 4OZGB 4F33A 3ZKND 3GMMA 1IGIH 2AEWA 5D72L 3S5LB 1KPRB 3I85A 4PLNC 3HNVH 5TGBA 1CD0A 4O02L 4OLWH 2BRRH 3IU4L 4JVUA 1FDLL 1WV7T 5FIEA 5CZVH 3G6AB 3FZUD 1OAYH 4E42A 4U0RC 1OHQA 4HMCA 3ILPA 4HUVA 1HXYA 1MFNA 2YXFA 3SDAA 4M00A 2VB5A 4YC2B 3IDIB 1JE6A 5E6YA 1RZIA 2OTPA 4FQLH 2EDLA 5JOFB 5DRWB 3PWPB 5DZLA 2R56L 2UV3A 1S5HA 5DSCB 3UAJC 2VSCA 4PJDA