2VDKL

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkL01
4JFQB 2EKJA 4F9LC 4DTGL 5BW7C 5DQDL 5CCKL 4BUHA 2VR9A 5DD5L 1OGAE 2B1AH 3ZYJA 2R23B 4I18B 1OTTD 5HHVH 4UNUA 2YKLL 2R1XA 3WFBH 1NSNH 5GJSH 1R5IA 4YGVB 5CUSH 5EU3B 5C0BD 3GMQB 1UJTA 5LBSH 2HH0L 3NIFF 1B88A 4KKCD 5BRZB 2YMXL 4NDMA 4OGYH 4PRHD 3C5SA 2VO5A 3NTCL 4M8VA 4WNQB 3GSRB 2OX5A 3EYUL 3IFOA 4UILH 3UTPD 3ULVL 2AJZA 2L7JA 1I9RH 4IIQA 4P2RE 4MWFA 3VWKC 3RIFK 2NY7H 5FM4A 4CBPA 2MCPH 5HGGS 3VXSB 1OAUH 2FO4A 1BZ7B 5I1LA 5ID0A 3T04D 3CD4A 1EUUA 1JNLH 3S36L 4UUJA 2FWOB 1MCPH 5J3HD 1XF2A 4MSWB 1FNGA 4JRYB 2RGSA 1VACA 1G7HA 2P8PA 4C83B 5EU7C 3U36B 3MLYL 1INQA 1J7VR 3QIUA 4PGJA 4YFDB 1EXUA 4G8EB 5EZJB 3UTSA 2PETA 1BQLH 5C2BH 1V3LA 4P2OD 2HLFC 3MLXH 3JTSA 4OCWH 1U95B 2UWEB 4QHUB 3DVGA 1AJ7H 4UT9H 4WEUD 4OZGE 3PQYB 2DLHA 5EB9A 4XRCB 1CDCA 3S37H 4MD5B 1E0OB 3UYPA 4LSUH 2LTQB 4GAFB 3IFLL 4Z7VF 1SJXA 1OAXL 3MV7B 2OR8A 3O4LA 5B8CC 2AJVL 5DHVH 5FF6A 3RL1A 3W0WA 3IU3A 4FQXD 3STLA 3RRQA 1P4IH 1NCWL 4PJHA 1RJYB 5D2LA 3X11B 3GB7B 4FZ8L 3QEUB 3VRIB 3BZ4A 4PRIB 4YZFE 4GKSA 1PJ9A 4TSBL 4M7KL 3OXSB 4PY8I 3RU8H 5D8JH 5KOMC 1CFQB 4Y16C 4PD4J 5GS2H 4XNYH 1T66D 3DMMC 3OJDB 5ENWB 5KTEL 1D5BB 12E8H 4RCAA 3LMJH 2DI7A 5CEYB 4C56D 5A2KH 1WICA 3HUJF 3TIEB 5D1XB 1IILE 5KZCB 5D2NB 1MFCH 2FB4H 3VFNA 3BP6A 4IEFB 4F8QA 4HFWA 3GSXB 5INDB 1HHJA 1JWSA 1BQHG 3OKDA 4LCWE 4PJGE 2A9ML 3RTQA 4X98B 3B8SA 2H9GB 2FIRT 5INCA 3UDWA 2GCYA 3ARBA 1DCLA 1TQCB 3RA7L 5CEZH 4LHUB 1DUZB 4GG8B 5F9JA 5I15L 3K0WA 4LQFL 2B4CC 4KZEL 2BVEA 5I15H 4NNYA 4C59B 1NQBA 5C0RH 5DXWA 1YNKL 4GG8A 3MACH 1ZWIB 4ZXBD 3V8OA 1XGRB 5D6CA 4WW1A 4RWYH 2IGFL 2VLLA 1A7BA 2J8UE 1JPTH 5E9DD 3T0EB 3SDCB 1N0XL 2IADB 3I9GL 4L29A 4N0CC 4LSTH 1JNNH 2CUHA 1OGAB 2B7DT 4ZUSB 4LDOB 1EERB 3R1GH 3VXUE 4OZHF 4P46B 1QOKA 1AD9B 1CTOA 3HC3H 5SWZE 4M7KH 5IESL 1ED3A 4A2MA 1S7UB 4I9WE 4ONOA 3SPVA 2Q7YB 5GS1B 2ENSA 4RGMC 4M1DH 1H3UA 4P9HL 2BNQD 1JF1A 2IBZY 3ULUE 4WU5B 4KROB 4ZDHA 2ITDB 3B3IB 4BM7A 3EYOA 4PS4L 4YHNB 5E0QA 1AGEB 3EOBA 1A0QL 2DLGA 3DBXA 1WAAF 1G7IB 5ADPL 2A6JA 4YXLL 1YNTB 1QFWI 1ADQA 1RD6A 1IT9H 3TN0B 3BRFA 4HLZG 1HNFA 5IFHH 4ZOCA 1D9KD 5MEND 3KLAA 2ZP0T 4G8GE 5INCB 4KJPD 2NX5B 4RMVA 1FVCB 4OB5L 3UYRH 2Q7NA 4J4PD 2IPKA 3IRZA 2R9HC 4I2XA 5HVFB 4PGBB 1I3RA 2NY5C 5DVMA 2GEEA 2HT4D 3LPGA 4M6ML 4POZD 3K74B 2ZCLH 3D25A 5IKCA 4Z7WE 1OAUL 5HDBE 4LKCA 5EUOE 5C0AD 3PQYE 3KDMA 1CXIA 5E7FA 4B7IA 4JDVB 5EWIH 4GRLA 4ZMAT 1F4YH 4LSTL 3O4LE 3RX7A 1MCSA 4ZG1A 5KVEH 4L9LC 2R29L 5DRXB 2DTSA 1CN4A 1WFTA 1IGTB 1EV2E 3WLBA 3Q3GB 4LRNH 4WIQA 3HUJB 5BXFA 3EOTH 4X8XA 2XTJE 1TETH 4JPIB 4QHKI 4HV8B 3BE1L 1OQOA 1FNSH 3LQMA 2NXYC 3DV6A 2WWKO 1RK1A 1Y18A 3DOSA 4LARL 1WZ1L 4EI5D 5DS8A 2QR0A 5EBMB 5KTEH 3TCLA 1DLFH 1K5NB 3ARGB 3DX9B 3SGEI 2PXYB 3U6RA 4MVBC 3VRLF 4QXTB 4NJAH 5JHDA 1FL5A 4HKZB 3OKMB 3U6RB 3WDHA 5I71C 5HYFA 3WIHA 3GSWA 1EH9A 4EUPA 1GGBL 5FGCB 4XVJL 2AABH 1NBVH 5CUSL 4MS8D 3QFDB 1GIGL 3DLQR 4XCNB 3K2MC 4WWKB 5J6HA 3KXFA 4KJWD 5EU6D 1KJ3H 4HLZH 3RPIB 4XCNA 3QIWD 2AV7A 4M7JL 2DM4A 3BEVB 1NCCL 4H1LH 3LKQB 2BY3A 3MRBB 3IFLH 3PGDA 4HT1L 5DD3L 3RUGA 2H45A 5L0QC 2GK2A 1CFSA 4XVSH 3RZWA 3QUXA 2JJVA 4NBYB 4FOMA 4NO2A 2ARJB 4QT5B 2NR6C 3NCEB 3MFFA 3HI1B 4HS3A 5T5FH 4M00A 3K7UA 1KNOB 4Z0XA 4QRPA 3TT1H 1XAUA 1V7NL 1G6RL 3WFEH 1Q38A 1BZQK 4NFDA 4PJBE 3W81A 1YEDB 5C0DB 3TPKA 3TF7C 2WLZA 5DQJA 3V52L 2XYCA 1MCIA 1UC6A 4XNUH 1IVLA 3LHPH 4Y5XC 2F9BT 4JG1H 2ZUSA 1X3DA 2UV3A 5SWZA 1AGBB 2GJ6A 5CP7A 3OPZH 2AKRA 3P73B 5GRZA 1MCPL 1LD9B 3S35X 3HKFA 4WFGE 5E2UH 1BLNB 3MRGB 2UZIH 5D2LF 3LKPB 4NZTH 3QWOA 3CFKB 4Y2OA 4FQHA 2J6EA 4UU9A 1BVKA 4X6FB 4RMSA 1QPPA 5C07B 3V0AC 1T5WA 3B2UC 4PJAE 3W82A 3OAYK 4PGEA 1I9EA 1UM6H 1T20A 2PTUA 4MQ7A 4H25A 4J12A 3TCXA 3EYSL 3EO0B 5EUOB 2ZJSL 3IJHB 3EO0A 5CS7A 3EO1A 5CIPA 4O2CB 4HF5L 3RTQC 1GYAA 3HFML 1JZ7A 4TUOB 1GPOH 1ZTXL 2BVPA 1UH4A 3S4SB 5ITFA 1NAMB 2QHLA 1NGXA 4J3XA 5FO7B 1BZ9A 3S4SA 2OK0H 3MRQA 1FZMA 5D1QB 5CCKH 2NCMA 3DI3B 1GJIA 1Z9LA 3QXTA 4LSQL 1R6VA 1FNHA 2FX9L 4L1HA 5IMMA 1XGPB 4KZDL 1I9JL 1YEGH 2YMXH 2HRPH 4O02H 2ESVA 4Z7QF 2W59A 1JI2A 1IGFL 4L4VB 4YDKH 4OLVL 2ADIB 4G9FA 1IC5L 1T2JA 4IJ3B 5C0DA 1KBGL 4NKQB 4KHTH 2VN7A 5L8KB 1BVLA 1BOYA 2DYPB 1TENA 2LU7A 5I71B 4Y19D 4GAGH 5KS9E 2DIAA 3MSPA 2E3VA 5C0JA 4KTEH 3O41B 3TPUB 4RQQB 3R8BB 1IGFH 5H35B 1NDMA 5IEKB 1A7OL 5HGHA 5FA4B 3OKEB 4QHMB 2FEDD 5ALBH 1PG7H 4PFEA 1IBGH 5ESAB 5IEKA 3GHEL 1E28B 8FABB 3H0TB 1RUQH 3D69A 1EEYA 4NC1C 4HW6A 1G7LA 4RX4A 5JIHA 5E6YA 2AGJL 3D6GA 4JJHA 1D9KC 1U8MA 2VLKD 2Q3ZA 3L3KB 4N8VA 4E41B 4R0LC 1BECA 3T4YB 4OKDA 1KSRA 4Q9RL 3L7EB 1LE9A 3REVB 5CJOH 4XNQA 5EOTB 2DKUA 4OKVA 3WNNA 3H3PH 1NFDA 1ZE3C 2IAMD 3G5ZA 1KJVA 5F96H 3PQYD 3TZVC 2HKHL 3L3JB 5ITBL 2R0WL 3MCLL 4PP2A 3MXVL 1ZSDB 2BNRD 3KPSE 3RAJL 3WUWA 3L3JA 2QTEA 1UM6L 1WAAA 3UPCA 2EDHA 3MTRA 4S1DD 2F8VA 4XXDA 3V0VB 5GS1C 4RGMB 3WDIA 5IJVA 4XVJH 3D3VD 4NZTL 3NCYS 3E3QE 2W1NA 2VUOA 5JHLL 1UXSB 4Z95H 2A0LD 5JPMA 4JFED 1YY9C 5I2IB 3H3BC 1KPVA 3DTXA 4P57B 3GGWA 4MD5A 2FLBT 5GZOC 1JYVA 4BSVA 2NXZB 5KVFH 1MJ8L 2H2SC 1NGPL 4LCCB 3TNMA 3LDBC 4PRIA 1RZ8A 1TTGA 4JDZA 4ZS6D 2AXGB 3FHAA 2IPTL 5BVJB 3HE7D 2DJUA 3ET9F 5DVNA 5IFHL 5IHBA 4G43B 1CCZA 4LPTA 1T04A 1YMHB 3DXAE 1FG2A 3TT1L 2FJGB 3QIUD 1NJ9A 5CGYD 1LWRA 4UILL 4XP1L 4R8WH 4LF3B 4PRNA 3EJYC 4KDVA 5TDNA 3KYMB 4X7TB 1AIFA 2GUOA 4KVCL 3EOAA 5C07E 1MWAH 3JWNC 4XVSL 5D96C 5HY9B 1AIFB 2GUOB 3F6IA 1EAPB 3T2NL 1K4DB 4XNUL 5DJ2A 1G1YA 5F6IC 3WYRA 5D1QC 5D2NA 4PJAA 1GVIA 1EFXB 3VFRB 2BVQA 4O58L 3U1SH 4X7EC 2CIKB 3MJ6A 3PNWB 4QWWD 4RMUA 5GS0H 5TDPA 2MSPA 4K9EH 3ESVF 5IVXB 3GHEH 3WBDA 1W72L 3TJHD 5ALCH 5I30L 5EU6E 1D5ZA 1I8IA 2KZWA 3G5XA 3GIZH 1JGDA 2O5ZL 4P5KA 3WFCL 5JXEC 4JFZL 1J1OH 1IT9L 1RIVH 3RVUD 2Y5TA 5TE6H 4X7FC 1FQ9C 1HKLH 2YD7A 4NNYB 3N1PC 5IOPB 4ELKB 4GMTH 3MV7A 1PKOA 4YHOH 1FNEA 3RGVC 1IARB 4DOHB 1UWXK 2RJMA 5MP6H 3GI8H 1QFWM 2B20A 1IC7L 2HT2D 3TO4D 2NLJB 3NBNA 5J56B 5JW4Q 3ZE1E 3L5IA 2BY0A 4EI5A 1OF2A 1MHCA 1FG2B 3PWLB 3BFOA 5IESH 4MA8H 4WJ5A 4YLQT 1OD9A 4X6EA 1R24A 4M02A 5IFAL 3QNXB 1MFCL 1TJHH 2HTLC 3F7RA 5E8OB 2OR9H 3QI9C 1JRHH 4YE4L 2APXA 1XGTB 4MJ5B 3VMPA 3QUYC 4WW2C 2X4TB 3HI6H 1H3GA 4MX7B 3WJLA 5HYSB 2E7LC 2DD8L 1U0QA 3RTQD 1PEWA 5HYQB 5IM7B 3WIFB 1YN6B 2FHFA 4PJBA 4Y4HA 4HXBL 4EEEA 5HPMB 3WHE1 1ZLWK 1OW0C 4KZEH 3CSYB 4HIHA 4W70A 1OP9A 3W9DB 4MA1C 4N1EA 1NFDE 2F53E 3IT8D 3IVKA 3GMRA 5AZEL 3UTZB 5FAAA 2NY4C 2R2HA 4S1QH 3NCBB 2B0SL 2HVJA 2NY3C 2VABB 5D7JB 3KGRA 1U8JA 1NCAL 4XP4L 1FFOA 5DC9B 3FAXA 1MFAL 1BFOB 1QEWA 1S5HA 2FD6H 5E2WH 5E8EB 2XQYK 4JN2B 2DWDB 4AT6B 2FB4L 4I0CC 3S37L 3JUYA 2PN5A 4LAQH 3WCYA 3G04A 5GZND 1D7FA 2EICA 4JZOA 2XTLA 4UOJA 4KKCC 1NCCH 1ADQH 3LQAH 2O5YH 5GGTH 1S9YA 4L3EA 4U1MB 1NMCC 4PRBA 2BNQE 1HQ4A 1I7RA 5EO9A 3ARGD 3QH3B 4J3UA 4OCMC 4EI5B 1YUHB 1S9WA 2GITA 3C2AL 5KJRH 2CO6B 3HNVL 4XNXH 4EN3C 3ARWA 2EDNA 2G9HA 4MHHI 3SQOL 3CFEB 1HI6A 3QUXD 4HG4J 4DW2H 3ECBA 1DLFL 1AQDA 3VDAA 1XGTA 3NIGF 4YFLF 1C5DB 4WFGD 1BJMA 5EBWA 2FEDC 2CQVA 5IVXF 1GIGH 1S78C 3WNKA 1NLDL 4NZJA 4XC1L 3EJZC 1CL7L 3W0WE 1CU4H 4EUPB 1CDYA 4JFFE 1EHAA 5D96B 4JY4A 4UT7H 1B9ZA 1NLBL 4PGZA 2D7MA 4GKZB 1KLGB 3MV11 7FABL 3LN9A 1B4RA 4XP1H 2NNAA 3S35H 4HMCA 3D39A 2MKLC 3B2VH 4XZUB 3EYVA 5DC0A 2FZ3B 5E6IA 4QXUH 4YO0A 1FVDA 2VISB 4XC1H 4YFLI 1CLYH 3D3VB 2VLKA 1A6PA 2P46B 1KTRL 2Z8WC 2BVUA 3C9NB 4LHUG 3KPMB 5C9JA 5FXCH 2ERJC 1WIUA 3MFFB 3QWRD 3IFNH 5SWSB 3TBTB 4HIIB 4MXQC 3KNBB 3S5LG 5C09E 4C56E 2R0KH 3JV6B 2OR7A 1OSPH 3HCVA 3QA3B 4G5ZL 5I73B 5D7KE 4GRLB 4DGYH 5TFSL 2AJUL 2X9XA 1INDH 4G6FB 3ILQD 3DURB 3RWHA 3MLPA 3QIWA 2H6PB 5DYOB 3AREB 4H1LA 2GTZA 3RWJA 4D9LH 1EZVY 4G9FD 1IQWL 3RAJH 2AERT 2AKRB 12E8L 3MO1A 1NEZB 5ITBH 3ECBB 5BV7L 1RIUL 5BZWB 1EEZB 2NTFB 3N1QC 1C5CL 1DSFH 4QXGL 5TDOB 43CAA 5L2KD 1A6ZA 4HBCH 1QPXA 2NY3B 4XBPB 5EU4B 1KFAH 5EBMA 2CK0H 4RAHA 1KYOJ 1FRGL 3SE8L 5D1ZB 1WC7B 2HYMA 2FX7L 4IOFD 1FGNH 4FTVB 1AHWC 5MENE 5DEGB 4K55A 4UOW1 3AY4C 4LLQB 1J8HB 1G7IA 1G9MH 3SE3C 4ORZC 4MLIA 4BUGA 4UT6H 3FB7A 2PR4H 1SMOA 3SBWA 4H0GA 1AO7B 4EXKA 4M1DL 4WO4B 5EBGA 1DBAL 4KC3B 3FOLB 3TO2A 4JZJB 3PDGA 1N3NA 3L5HA 3WDJA 4MZ2A 3CU7A 4K8RH 4RWYL 4NKMB 1AGCA 1MCWW 1Q0YH 1YJDL 3IDMA 1K8DA 3ALPA 5IFAH 2FBOJ 1VFAB 2UUDH 1KELH 1A2YB 5GXBB 4HS8L 1L0YA 3OGCA 3BYYA 2A77H 3TO4B 3E3QC 5EBLA 3FRPA 4PV8B 1WV7T 3BPOC 3CLEL 1P7QB 3U9UA 3CFDA 5TF1L 2IGFH 5GGRA 3LN5A 4AK1A 4PV8A 5JDSA 3KPOA 2GAZB 3PUCA 3VXUB 1FVEA 1AHWA 1S3KL 3RDTD 4L8CB 3KJ4B 5L9DH 1ZMYA 2CJUL 1PEZA 5TPWL 1HHGB 3FQTB 3QYCA 2VDLH 5J0BA 4X4YA 4Z7NE 4HPYH 2COQA 4J3TA 3VFGH 5I1EL 4L8CA 4MZ3A 4LPUA 2D0HA 1SYSB 1ORQA 1R0AL 3OAZH 2NY0B 3FFCB 3V5HB 4U33A 3OR7A 5MERB 1A1MB 4MB5A 3VXSE 2BXYA 1HQRB 1X4ZA 2VL5A 4NNXA 1SYVB 4PJXE 2ZSWB 3BH8A 4PJDB 3IXTA 5EC2A 3MV7E 1CXHA 2V9RA 4Y5VB 1J8HA 2C3XA 4JM2D 4QRUA 3RU8L 4OZHA 2GSIA 4K07A 3H9ZA 5E94B 4NN7B 3QQ3A 2L4OA 5BO1H 2GHWB 5M7QA 4NNPH 5CLWA 3FO2A 5I17B 4O2EB 4ZFOB 5C0CE 4K7PH 4ZNEA 3T2NH 1HCVA 3LSOB 3HR5A 3C8KB 4EDXA 1KB9J 4P23B 4WY7L 4CW1B 1WQVT 1OPGH 3WE6A 2DM3A 4H5SB 3FTGB 3MLSL 1PZ5A 4R8WL 2FL5B 4R97C 1MJJB 3OKNA 4KY1H 1BZ9B 3RVUC 4P46C 4DUXA 4XNZB 5IJVB 4F15C 4Y1AE 2ERJB 3TESA 1UKSA 1QZ1A 1A6AA 1WFUA 1WBXA 3PL6C 1BBJB 3L1OH 1YEEH 4Y5YC 4QXWA 1ONQB 1J0KA 2VDNL 1F8TL 3D48R 5F1IA 5E5RB 3SGKA 4NKOB 5GSRB 3CDYA 4HC1A 3QWRA 3E8UL 4K3EH 2DL9A 4Z9KB 3O6FC 3O8XA 2WANA 5BS0A 4EN3D 4WI6A 2X9WA 1AY1H 3GMNA 3ARVA 1MEXL 3GSQB 3HAEB 1YEHH 2R2EA 5DJZB 3T3PE 5DEFB 4GSDL 3JVGA 2E7CA 1U8HB 2Y72A 3QO1B 2NY1C 3NGBC 3I84A 5DGRA 1J12A 5B4MC 4K2UH 2DOCA 3VGAC 2NXYD 2PYEE 5TDPB 5IVXA 4KMTH 5KVDH 5E00B 3HE7A 1M1SA 5D6DA 2A9NL 3L7EA 1LE9B 3CXDL 3QIBA 3SDAA 1ZHLA 3VXRB 4Z7QE 3MA7A 1UCBL 5CINL 4DVRH 3QG6A 4UINL 4PR5A 2P8MB 3KYKH 5I1JH 1UJ3B 4ZSOA 3U79A 5C3LD 3HG1D 4KROD 1BPVA 4F7CA 1B3JA 2CUMA 4OCNC 4PUBH 4ODTL 3HUJE 4LFHD 4XH2A 1KIUA 4X9IA 3HB3D 4YBLB 3V4PH 3C8DA 5T1KD 5ERWA 5A3IC 2VLJD 3UBXA 4OFKA 2W0LA 2F5AL 1TITA 1MH5A 2EEAA 3CVHA 4Y5VC 3MNWA 4ZTPH 4M3KB 1RZ8B 4ORGA 4GRWH 4NKOA 5GSRA 1YEFH 2DBJA 4JAMA 3BX7C 4O2FA 5EC1B 2V2TB 1WT5C 1ZT7A 4AL8H 1TTUA 4LVEA 4OF5A 4QOKA 4YHKH 3RWGB 4ZXBA 4Q2ZA 1JPST 2WUBL 3MBXL 5ETUB 4HAGA 5HGHB 1XR9B 3GMQA 2DI8A 3ISWA 1HINH 3I6KA 3OF6A 2XQYG 1JFQH 4V1DA 1MFBL 3QDAA 2YHGA 4U1HB 1LEKB 2RQ8A 5FHBL 1RZ7H 2B4CH 2FLRT 1GAFL 4KAQL 4Y4KC 2EYTB 3MRRA 1N6QL 2HTKC 2CDFA 4NJ9L 5IBLD 2AJZB 4CAGA 3O6KL 1LO0H 1CDIA 3V0WH 4XNZC 2C1PA 1X4YA 4DGIH 3B3IA 3P3YA 3MOAH 1S8DA 2WBJD 1MRFL 4FQ1H 4O5LL 3BDBA 2VDNH 1LEGB 3EYSH 4KI5F 2C1PB 1FCGA 4ZO9A 4POUB 1WCBB 4OZFB 1KXTB 1IFHL 3GNMH 3H6JA 2J4WL 1RSFA 1BIIA 2IH1A 3HC3L 5ICXA 3CAFA 3THML 5DK0A 4M6OH 2OZ4L 5F7WC 4GMSL 3BD5A 4KU1A 1MFEH 4LHUA 1WVZA 2F54E 1HSAA 1O5DT 1U58B 2X6MA 3MNZA 3OG6B 1S9KC 1IJ9A 5HVGB 4F7PB 1QRNA 1A7PH 4K7PL 1S7WB 1VESA 4PY7A 1QSZA 3P11L 3PWUA 4I3SH 2BFVH 3CMOH 5EOCL 2ADJB 1KCUH 4WUUE 3WNPA 4FQIH 2CKNA 2R1XB 2XG5A 3KPSA 1EDQA 1S9YB 3PHQA 4N0YH 3WXWH 5FK9A 2VIRA 2BJML 2OJEA 2QADC 3Q6FA 4NCC2 4K8RC 2Y7QA 2YPVH 5T5FL 1OGAA 1XR9A 1TXKA 2QSCH 3L5WA 4KTDL 3TYFA 4G5ZH 4GAYA 3VJ6B 5EPMA 4Z7UE 2CR3A 4KRPC 1FN4A 5T1LD 3QJHA 3T0ED 2YD4A 5F1KC 4YNYB 3KYMA 4X7TA 2KQNA 1F6FB 2EDFA 3GSNB 4LEOA 3MJ8B 3SGJA 2I26N 1CZ8L 3C09B 3NPSB 3IFNL 3G08B 1IGCL 3SKMA 5JZ7D 2NY6D 2ZKHL 3BESR 2H3NA 5FA3A 1RK1B 1Y18B 1A6TA 4AY0A 5KBNC 3U2SA 1N6UA 3BKCL 1CFVH 3SE9L 3EJJX 1C08A 4FHBD 5J6GA 4FMFA 4N5EC 1FO0L 1VGKA 1WCBA 1A22B 4PRPE 4UDUB 3BH9B 2HG5A 2ZCKL 3OKMA 4MJ6B 1JZ8A 4CADB 3S35L 5CHNA 1LNUB 1U2HA 1UEMA 5EUKB 5C92A 5LGHH 1BEYH 3OAUL 1QSFE 2MJWA 5ANMB 2EDLA 3T2OA 2VLJA 4Y8AA 1CQYA 2OZ4H 3L7FA 1UACH 3MUY1 4N90D 3MRHB 4NQEA 2KBGA 3BEVA 2XPGB 5E95B 3V4VL 3V9FA 3BP5A 4JHWH 4B50A 3UTTD 3MRHA 2BSRB 4XPBL 2J4WH 3B2UD 1BQSA 1P2CB 3QUYA 4WW2A 5HTSA 3ARBB 2C3VB 1DL7H 4PJFA 2C3HA 4RNRA 3P9MB 1PGRB 2BOCA 1FLRL 3CFCL 3HZMB 3KNBA 2B5IC 4PJHE 3CDFA 3P77A 3QUKB 1A9BB 1C1EH 4IDLA 3HMWL 3I2CH 5CD3A 5GGUB 1JGVL 1RJYA 4M1GH 2DQJL 5IB2B 4U1GC 4YQXL 1FRGH 5I6XC 5CMAA 1JRHI 3PWLA 1DBJL 5JLZB 2H2PC 2A83B 2XY2A 4DW2L 2WUBH 3LPFA 4NKIH 4JKWA 1BWWA 3P0GB 2H32H 3B43A 2P24A 1JZ3A 3L95A 1MI5A 2AV1A 4E5XB 1WTGT 2PXYA 3C6LC 4LLDB 4QCIB 5F9WC 4LLQA 3S34H 1D6EB 5B39G 1A7NH 3MLZL 3INUL 2Q6WB 1JF6A 5FYKE 5HSFA 4F9PC 1WC7A 3K80A 3NA9L 4M5YH 4BZYA 3QFDA 3LZFL 1LE5B 1DJSA 3QDMD 1LP9E 2J5LC 2FZ3A 1U3HB 1TJIH 1XT5A 3EYUH 1T0NB 3P4OB 5C0EB 1FNFA 3OZ9H 4M1CC 4X7DC 5DZNA 5EZOH 1QR4A 3ABZA 2R0KL 1F4XL 5FM5M 4P5TA 3NFPA 4TYUA 3FB6A 4GXVH 5FV1L 1DQDL 3ZYZA 1EGJL 4ZTOH 5E24E 3GMMB 3TV3L 2QADB 2IBGA 4PJAF 1HZHL 4WHDA 3BO8B 2ARWA 4KKLC 3AM8A 3MRQB 5JQ6H 4HLJA 4PLNC 5CJBA 1GCFA 1EJOL 4WWKD 5IQ9A 3FN3A 2J8UB 4UQ2B 2IJ0C 5GRYA 1RURH 3O6MH 1ZHBB 3IDGA 3HB3C 4M48L 2E5EA 4NWTL 4GS7C 4Z5RA 1HXYA 3VGAB 4ETYA 2GY5A 3VGDA 1JTOA 1HXYB 1MCCA 4Z8FL 1M05A 1ITBB 3HNSH 5JLZA 5IB5A 5E08H 4PBXA 4E0RA 3EGSA 3TYGH 4HXAH 1HHGA 3VMNA 1TQBB 2NMSA 3QP3A 4NP4L 3TYGL 1I4FB 3DV4B 3H7BB 4NSKA 1MQKL 2FEEI 4ODVL 1NMBL 1YMMD 2Y06H 1FZOB 4PJDA 4AM0B 5L8LB 3RY4A 2YK1L 2NY1D 4AG4H 5EA0H 4LVNB 3P4MB 4WEBL 1JK8A 4NRZB 1GHFL 2MHAA 1FYTA 3C09C 4WO4D 4S2SB 1EEQA 3HG1A 5IBLC 2X4QA 3DUUB 3QDHA 1JYWA 1T5WB 1T0NA 5HYSG 3QUYD 5BOZG 4NM8H 5D7SH 3CU1A 4R4BA 4IDJH 3L3DA 5ITFB 1MHEA 4V1DD 1SMAA 2F54B 2HN7A 4XMPH 2MCG1 3EO1B 4H8WL 5CIPB 3V6ZA 4M9PA 1I7UA 1Y6MR 4P4RB 4Z78A 5IW1A 3BQUB 3UC0H 2NY0C 4Y2DB 3TIDA 3LSOA 1I7UB 1JP5A 1MCKA 4FP8L 4XVUD 4Z78B 2HLFD 4MNGB 1WLHA 3K4ZA 3M45A 3QDGB 1FBIL 1GL4B 1N7MH 5I16B 3MRBA 1FZMB 5D1QA 5D2NC 3X3FL 3GKWH 4JPVH 5E9DE 4YR6B 1JZ2A 4DVRL 2EKSA 4WV1B 2AK4B 4TPRL 3CLFH 3ZKXB 2IQ9L 4LIQH 3MUZ1 3MR9B 3FT4B 2AVGA 4FQLH 1KCKA 4GBXA 5HHXL 4EN3A 5MENB 3DGGA 4OLWL 5BJTA 1IAIM 5F70A 4JFEA 4BZ2H 1S7XB 3E6FB 2EO1A 1OLZA 1VFMA 3D2UD 4LKXA 1J05B 5FUCC 4XWGL 1QYGH 2HJFA 1ZGLA 4X4YB 5HHOE 1YMHA 5B38B 3BVNB 5DVKA 3AVEA 1RV6X 3QWOB 2J2ZA 3GMNB 3OSKA 2FSEA 3QIBD 4MXVE 1B0WA 1YEIL 4BFBD 3SDCC 4NO3A 1LD9A 2ESVD 4TNVK 5F89A 4S2SA 5JMRA 1TCRB 2YSSA 2NY6C 1EAPA 1VERA 3IAPA 3VFUB 1CGXA 2YPKA 5I1JL 5JHDB 5HJ3A 2E7LA 1G0XA 4UINH 1N59B 3E2HC 4Z95L 1MVFA 3FO0H 1P53A 5FUOH 4ZNCD 3L3DB 5A40E 3BDYH 3U46A 1Q8MA 5I8CA 5J13C 1WIOA 3HI5L 1UM4H 5FECB 3RPIA 2W38A 2MCPL 4QTIH 1KPRA 1Q0YL 1YJDH 3KPRA 3MRIA 3BKJH 1KJ2L 1AGCB 1QLFA 1CIUA 2VQ1A 1EXUB 2F5BL 4OGZA 4FQCL 3QPXL 5FUOL 1TCMA 1RUPH 4PLJC 1CFSB 4LLWB 2FH8A 4TVPE 3O9WD 3QEQD 3HPJA 4JANA 4X6DA 3BKJL 3MJ7A 5F3BB 5TQ0H 3HE6D 1TLKA 3HRZB 4L4TB 4GBXB 1H8SA 3H3KA 4ZO7A 5K9JH 4MJIB 4O58H 5K9KB 5HBBA 3MCG1 4DGVH 4ZAKB 3SDXA 2BHYA 3B5GA 1VA9A 1IGCH 4PG9B 1BWMA 4UAOB 3ROOA 4ZXBB 3K8KA 3LEVL 4QKXB 4LCCA 3TNMB 2P5WA 3DHMA 2VLJE 4G9DB 4X4XB 5GGQL 3ME0A 3TVMB 5MEQA 5TDNB 2H2PD 1VHPA 5KVGL 3O3AB 5E2VH 2AXFA 3TPUA 4RBPK 3EFDH 2I27N 2VYRE 1KLUB 2BJMH 5DRWB 2WP3O 2OQJA 1JHTB 2A9NH 1FAKT 1CVRA 5IVZB 5ADOH 2CH8A 5DD1H 1I1FB 1I3UA 2QQKL 2X89A 1KXQE 5SX5K 3T09A 3QNYB 3K4DA 1J1XL 1YN7A 4HK0A 1EZVX 5EZIL 4NFBA 5FYJU 2ZJSH 1WWWX 1X44A 3GRWL 3VRJB 5EULV 1T1XA 2ZG1A 1I7TA 3F7PC 4Z7OE 1QD0A 1T3FA 5K9JL 1X6NA 1EFXD 1OTSC 1SVCP 1IGYA 1J0ZA 5D5ME 2Q8BH 3ZKMC 2B2XH 3B2VL 3PWUB 2QBWA 4K7PX 3RWDA 2PO6D 3RDTC 4R0LB 3BKMH 4JN2A 2EDYA 5I2IA 5H37H 1RJLA 3SJVE 5GGSA 5T1LB 1X5AA 4EQ3A 2OJEB 1LP9A 2B2XL 3TM6A 1S7TB 1HQ4B 2J7LA 3HE6B 4L3AA 3KPSB 2NW2A 5FKPA 2R23A 4LDEB 3CLFL 4I4WA 3KHQA 4NRYA 4LSSL 3GSRA 3O3AA 3L3GA 1OF2B 3J8F7 2VSCA 5I1GH 3VJ6A 3M8OL 4K94L 1IEHA 3WIIH 4OLUL 2DM7A 3JBG7 3QDMA 5DUBA 3HNTL 5DUML 4ERSH 5GS1A 3DUHA 1ZLVK 3ZE2F 3N85L 3U0PA 2O26U 1UA6H 1MI5E 3RZCA 4KUCF 3W9DA 2ESVE 1M7IA 3RL2B 4YHNA 2YA0A 2VZ1A 3WIFA 3L5XH 3RNKA 2VZVA 4XVTL 4HHAB 4YPGB 5DFTA 5IJKC 4X98A 5HHOD 1Q9LA 4DN3L 5B8CA 5K9OA 4YPGA 4MJ4A 1V8HA 1Q9WA 1XZ0B 1MAJA 4HWUA 1U58A 1RU9L 3OKKB 3TBSA 1EK3A 2VDML 3HA0A 1PYWB 2D7OA 4M7JH 4N0YL 5HGAB 1AD0B 2DQHL 1DEDA 4GG6A 4JKPH 1QFHA 2BC4A 4KKNA 2CK0L 3CXDH 1KIRA 1TVDA 1INEL 3P11H 5SWSD 2DWDA 1X7QA 4KKAD 5FKAA 1Q9KA 3JV6A 1U6AH 2NXZC 5C6TH 5I8OL 2F8OA 1H5BA 1NBYB 4TVPH 2RFXB 2YN3A 1NFIA 4IDJL 4JDVA 4AJ0A 1QSED 3QEUA 1PD6A 2VXSL 1AXTH 5I74C 3BZ4B 2GTZB 2X89D 3ARED 2XWBB 1NLDH 1ITCA 3QHFL 5D7LE 5EFIA 4TRPH 4RFNB 3FL7A 3ALXA 3FQXA 3IXAA 5B4MD 3VGEA 3CH8A 2A2QT 4CMMB 2YD3A 4OM1H 4LDLB 3ZDXE 3QDMB 2BVOB 3CVIL 4IMKA 1CGSH 2G60H 4R7NB 1RZFH 4Z7WF 2B5IB 5C8JB 3ARQA 3VU2A 5HY9A 4OT1H 3FJTA 1MI5B 4HIJB 5C8JA 5EWIL 1A4JB 2HFFB 1T4KA 4OIBA 2H32B 4DUVA 4HFUH 1IM9B 1Q72L 1CDBA 1HK6A 1U3HA 5C0EA 3EJYD 1H3PL 5FOBA 3FN0H 3RGVB 3BJ91 1E6OL 4KH2A 3WL9B 4PP1D 1LO3L 3WS3A 2VXUH 1G6RH 3WFEL 4AQ1B 4GW5B 2D2OA 3NABH 3RGVA 4NO0A 1CD0A 4Z8FH 4ZFGH 4JPKH 5GRWA 3SQBA 3WFCH 2HLAB 5EO0B 3RVVD 4HAFA 3ROLB 5A1AA 5IV2B 1EO7A 1LNUA 1D5ZB 4BFIB 2HWZH 4IRSA 2OMNA 1KEML 3CH1B 3TJEH 5HYEA 3VGGA 2A6IB 4MQSB 4PJFB 4ZTPL 3TP4A 3EZJB 1NCAH 3C9NA 2VDQH 4NM4H 1Z6JT 2FR4B 1ZT4A 3BP5B 1F45A 1P69B 5I8KH 2V2WB 1KB9K 1QO3B 5LGHL 3HC0A 2XT1B 1TVHA 5DGQA 5E8NA 2J6EL 5DRNA 4X5XA 3HCVB 4C55A 1ZEAH 5C0ND 4HZLB 1JPSL 4J3OC 4NJAL 5D9SA 3KPOB 4O9HH 1ZEAL 1N0LA 4MAYA 3JWDH 4X6DF 3PL6A 4XHJD 3PWPD 2NY1B 1NEUA 5IBUB 3KPRE 1ZANH 2Y07H 4L8SA 1G9NH 3RWJB 3N1FC 2IANE 1YQVH 1I8MB 5FUCE 2VXUL 3PP3H 2FH6A 1KB5B 1AD9A 3WLBB 1OSZA 3G08A 3SKMB 1BQHA 2R0LL 4UBDD 4NN5B 3P30H 5C6PB 2AEQL 4ZUVB 1MJ8H 1QKZH 5DUMH 4XP6L 4JB9H 2ITDA 1ES0B 4UQ3A 4KFZC 4TN9A 3K2UH 4L4JA 3X14A 2BXZA 4BSJA 4EUPH 1W2KT 3QFJA 4HWBH 4U1NB 3U48A 3CLEH 1VGKB 1JF1B 4YHML 3BH9A 2IQAB 4M5ZH 1P1ZA 1CGSL 2G60L 2ADFL 3CX2A 3CUPA 5JIIA 4DZ8B 2YUXA 5C0AA 1SJHB 4W6XB 3GMRB 4GRWF 3WNLA 3SCMD 3C5JB 1YNTA 4Q9QH 2DIBA 3C60B 1R5VA 3VA6A 1ZVYA 4CN1A 1MLCB 2WIIA 5I16A 2Z4QA 2C1OA 4OFYD 2GYSA 2H26B 1QEWB 2E9JA 3HN3A 4N0CD 4RNRB 4OSUL 4LCIH 4PJ9B 5SX4I 3TA3B 2BNRB 1ZHBA 5IT2H 5J1AA 4CDHA 3GM8A 2OL3L 3RBSA 4YUEH 2H1PL 4Q6YA 4YR6A 5J7CC 4TSBH 2EKSB 4WV1A 5F7DA 4JKPL 4HH9A 4S1QL 4WHTB 4OZGB 3DURA 1AI1L 3VXSD 1T89A 4P9HC 4XT1C 1A3QA 4TVPL 2EE9A 3BW9A 4PS4H 2VDOL 3TV3H 15C8L 2OJZH 5KS9B 1D3CA 4KV5F 1IAOA 4IS6A 5D93B 4L3EE 4QNPF 3MYZA 3U0WH 2BNQA 2GJZB 1A7PL 1EO5A 1DFBL 5HGBA 1MJ7H 3VXNA 2D7PA 43C9A 1G7QA 1SVZA 4NO3B 1BOGB 5I1IL 1BQHB 5DZOA 4YHIB 3VW3L 2Z31C 2ZUYA 1S7QA 4R7DB 1U8QA 1YECH 3MRMA 1RUKL 4QRUB 4MA3B 3LKPA 3VGHA 2YA1A 1AE6H 1F6LL 1AGFA 2YXFA 4FRWA 4U1JB 1IM3A 3FO1A 1ZLVH 3UJIH 2P5WD 4O51A 1YPZA 1J11A 1NC4D 5ACMA 2ENYA 4AZ8A 4XCCH 2X9YA 1JGLH 4P3CL 1O0VA 3GBNH 4KXZI 4EKXA 2CJUH 1DQJB 4XPFL 4FS0A 1IC4L 5C0IA 2XKNB 5TQ0L 3A67L 1QSEA 4PRID 4JANB 4X6DB 4Z77A 2QQNH 1QG3A 3DYOA 2ARJA 4QT5A 4P5TD 3SY0A 1IGIL 3CVHH 2KH2B 4HMEA 1U8KB 1S7SB 1XIWB 3IDGB 3RUGB 3MXVH 4WVRA 3DX6A 3E2HB 1UXSA 3TH3T 1BREA 3BUTA 3THMH 5IB1B 4JDTL 5LCVH 2H6PA 3K1DA 5DYOA 2R4RH 5ABDE 4OLZH 4PJIB 5I8EB 3BOVA 5BS0B 1QTYT 2I07A 3TBWB 2DDQH 4J2XA 5HHVL 1E4XL 4WRLA 3GIZL 2F74A 2EYRB 3IDNA 5HDLA 1J0HA 4LSPH 2AXJA 3O6KH 1KOAA 5JHLH 1W72A 2F74B 4PV9B 3IDNB 1L6ZA 5E2TL 1QSFB 3HMXL 1C5BH 4CJ0A 1ORSA 3DGCR 3ZT5A 1GGCL 1S7VB 2ADGA 4RAUB 3T4YA 4EI5C 1ZK9A 4R9HA 25C8H 2ATPA 2V5YA 5E00A 5F88B 4DZBA 2N7AA 4KHTL 1KPUB 1A7RL 4PP2B 1X5XA 5ISZD 4QYOA 4JRYA 3T1WA 5C0AE 4W6WB 2VRAA 2VQ1B 4RBPH 1RZGB 2WAHA 1DBBL 3MLVH 5HI4C 2YEZA 2XKNA 1KPRB 2B0SH 5EU5B 4L9DA 2V9QA 4UIMB 4LVOC 1U93B 2CD0A 2X4NA 4Z7UB 3MLRL 5E2VL 2AW2A 1NAMA 1PKQA 3X3FH 1RJCA 1PZ5B 4XP9H 3DX6B 3IGAA 5IG7B 5FO8B 2ESVB 3JUZA 3I50L 2DQTH 4J6RL 4LSPL 4NC1E 5TF0A 5IP4A 3LN5B 3G6JA 3KYKL 3QR2A 5MENA 2Z92A 1YC7A 4YXKL 1A6AB 1GC1H 1WBXB 1NC2D 2I07B 5ANME 4FABH 2V6HA 5I9QB 5IQ7L 2ICWI 2J8UF 4WFEE 4M6OL 4N68A 3LKNB 1BVLB 4TSAL 2LFGA 4JDZB 4ZFZA 4KJYA 3W9EA 3QCTH 4JG0L 5BV7C 5IHZB 3CCHB 1MAMH 1T6VN 1HQRA 2VL5B 4NNXB 2QQNL 3U7YH 5AWNL 4BZ1H 1IGIH 4JJ5B 3TNNA 5KG9A 2X2YA 2ZPKH 3U7WL 1M7IB 3RL2A 4APQA 3TBVA 3REVA 3SKOB 4PJXB 2BOBB 3K8MA 4HK3N 2IH1B 4PJXA 1QSVA 5DD5H 3L3IA 3ULUL 4KGLA 4R26L 3LOWA 1KBGH 3LAFA 3S37X 1TPXC 4PJDF 5CHNB 4XAKD 3QEHA 4JFXA 4Y5XB 4JZNB 4AL8L 5CFHA 1QRND 3OV6A 1AFVL 3FQWB 3GSXA 4EJ1C 3SGDH 3VG0H 1YY8A 2ZSVB 3A6CH 1ERNA 4F58L 2F53D 2CRMA 1PBYA 5GRUH 2R69H 4D0BB 1MWAB 5GGVL 2NY4B 1BAFL 2DQCL 5ADPH 1DUZA 1GSMA 1T7YA 3UPAA 5F9JB 2VDKL 4HPOH 4OLVH 1LP9B 3GFUA 3ARFB 1A1OA 1OT1A 2LQRA 1X5ZA 4YDJB 1S7RB 1DQDH 3MGTB 5B3JE 4RAVA 3V7AG 3IB4A 2IH3B 4MYWB 5AWNH 1PSKH 2Z35B 3DTXB 2WBJA 1NANI 4ONHB 2NYYD 2CRZA 5HDBF 3ZTNL 1JPFA 3OXSA 2VIRB 3V7MA 3CZFA 3NFNB 3D0LA 4D9LL 2NW2B 3PGCA 4NT6B 5E8OA 4YWGL 3OXRB 4LLUA 1EMTL 1RIHL 3G9VA 3R0MA 3QULA 4MS8C 4U1HA 5I1AA 2BX5A 2ZUTA 3QQ4B 4P4KD 4KMTL 5KVDL 2EIEA 3PP4L 4KJWC 4OSUH 2H32A 3ZL4L 3T0BA 1LO5A 1OSPL 3O81A 2WSKA 2CXKA 5D5MF 5F7LB 3VFWB 3EOAB 3IYLW 3QCUH 3QNYA 4F33B 1KN4L 2DLFH 4CJ1A 5JOPE 4XPGL 2EEBA 3K3QA 3FFDA 1ZHLB 2XZQH 4YQXH 2HJKA 1DE4A 2PYFA 2BVQB 1T1YA 3U30B 3NN8A 5BRZE 1JN6A 4G80B 5CBEA 2ZNXA 5I9QC 4I77H 4IOFC 3G5XB 3FB6B 1YPZF 4YC2C 1JV5B 1XCTB 2CRYA 4F7CB 5E9DB 4KMLB 3GI8L 4MD4B 5FEBA 3K46A 3OKOA 4PTTA 2BVYA 3P30L 3VWJB 1XGRA 3HC0B 4CVZA 2R4SL 2BSRA 4M03A 5B39B 3QUYB 2YUZA 4WW2B 2O61A 4OZFH 4P2OB 3MC0A 4M6AA 5BVPL 5B39A 1FE8H 1RVFH 4P2OA 5SV3A 3QUMB 1EBAA 1CQKA 1L0QA 2I9TA 1N2RA 1FHGA 2OXGA 1DBKH 4ZUTB 3CFEA 1OW0A 4HT1H 5DD3H 1ZLUH 4EVNB 2XXCB 3VH8G 4UTBL 3P0VL 3PE9A 3V6OA 2NY5L 1B6UA 2B1HL 2FHBA 3IDJB 3GMOB 4WU7B 2NZ9C 3X12A 2FEEL 2Z31D 1P4IL 3S9DB 1WZ1H 3VWKA 3EDKA 3OWEA 3C60D 5FA3B 4MMZC 4WFFE 4Y16A 2DQUL 2A6KB 3VXME 2GSGA 3BPLB 4NM4L 1C5DA 4P2QD 4UMGA 1FNSL 5LJYH 5DFVC 5KSUB 2BSTB 1EAJA 1A7QH 2YXMA 3G5YA 5DJ8A 4HIJA 1FYTB 1RIUH 2WNGA 3BSZH 4U6YA 1HXMA 1N0XH 4UB0L 1NBZB 2X1QA 5JXED 1I7ZB 4L4TE 4MD0B 2A73A 4JPKL 4OQ1A 1UB6A 4X8JB 4NGHH 3I3EA 3DROB 3HPLB 4OGXL 2G5BA 3EOTL 1WEJH 3NGBB 2HTKD 5IGXL 1LQSR 2WP3T 4QRRE 4PGBA 2NZIA 2XV6B 3DPBA 4KPHH 4HF5H 4IRSB 3CXHK 2OMBA 2VXQL 3UAJD 1KIQB 2A74A 4HWBA 3HS0A 4E41E 4D8PB 3NZ8B 5IF0A 3NFSL 1X7QB 5IK3A 4WUUB 1MI5D 3RY5A 3AMKA 2QEJA 4G6FD 2MWCA 1QLEL 1BJ1J 3V8CA 3PHQB 5BQ7B 2R2BB 1VFUA 4U1KA 2YD5A 3WLWC 4KMQA 4JQIL 3UCRA 2VR5A 3VXNB 5HHME 3VXUA 1KACB 1ZA3A 1G7QB 5A16A 4J1UB 3QXAB 3G6JF 4TUKH 5DMJB 1HCFX 4GAYB 3MQIA 3QQNA 1SQ2N 3NTCH 5GJTL 2FO1A 4YBLC 5IBUG 2JTDA 4ZOBA 2HP4A 2FD6L 4H0IA 5E2WL 2X4RA 4M93C 2Q7YA 1DEEB 5BZWA 4AEIH 4GBXD 2UVEA 1WZKA 2FBJH 4X6BB 4U1IB 4TTDD 2DQUH 3C08L 4ACPA 4HQQL 4X6CA 4APQC 2X1OA 1DLHB 1QRNE 1RUAL 1LMKA 4LEXH 1W0WA 1D6EA 3Q1SH 3P0VH 1VEMA 3HG1B 5JZ7C 3QFJB 2VWEE 3SGEH 5D7LA 2BSSB 4FTVE 4M4PA 5TH2B 2A0LC 2AQ2A 5TQ2H 4P4RA 1XF4B 3GO1L 3KLAB 5IV2A 5JA8B 4Y4KB 1MLCA 2PKDA 1QBML 4OTXH 3UBXI 1EO8H 3C6LA 2XG4A 4PTUB 5IMOA 1F5WA 3TN0D 1VFAA 4PJXF 3WO4B 3MGAA 3C6LB 3HE6C 4NQSB 3WXVL 4NKMA 2PW2B 3OJVC 3R1GL 4HKXA 1FZJA 5E56A 4NQXA 1JNNL 4XBEL 1I9JH 1U8LB 3Q48A 5DK2A 1R3KB 1UWXH 4GQPH 4NQCE 2R8SH 4N0UB 1AXSB 1HH6A 3ZTJG 4HIIA 3BW9B 4R90H 1F4WH 1MCOH 4ZAKA 5I6XB 3FQTA 3FQUA 1UENA 4GG6F 4LLMB 5I19H 4PRPB 3O11B 1FGVH 4Q6IC 5FM8A 1YQVL 1M05B 3I75A 3Q3GA 3MJGX 1I1AC 1ZKAA 3FRUB 4P3DB 5JIPA 1D5XB 2JJTA 1DVFD 4E5XA 1CR9H 2VXVL 5K33A 1CL7I 1NL0L 4PB9L 2XN9B 4RISH 4FQXB 1AGFB 3VXMA 2W0KA 3M17A 4FN0A 1N6QH 3MJ9H 1MEXH 4PJEA 1OWWA 5DHVB 1ETZA 3KPPA 1TNMA 4XBGA 4YXKH 3MLYH 4O2CA 3DVNA 2ICWJ 1GOHA 4G6KH 2IANA 4Y4KA 2Q86B 4NKDA 3RX8A 4C4KO 3U9PH 3Q0HA 2YD9A 5CD5D 5J89A 3FMGH 3BPNB 4V2CB 3Q6GL 1FYHB 3NA4A 1RUMH 3P4NB 2Q86A 5DJDB 4G8IB 3LKQA 1NC2B 3KPLA 4WEMB 2IBBA 3SN6N 1OTUD 3JWOL 4Z77B 4L4VD 1GAFH 3VCLB 5KSAC 2ICWA 1A2YA 3EFFA 4LCYA 5CWSA 1QLFB 4JFHD 2E6QA 4QNPE 3OL2A 2BRQA 4OCWL 4LCYB 5E6ID 2HMIC 4X5WA 5D70H 5I18L 2AGJH 1DBML 3EFDL 4JFOB 1K4CB 2OCFD 5J8OA 4KK6C 2BK8A 1HOCB 1A4KB 2GFBB 3GSVB 4K3HA 3NACL 5IMKA 5C08D 4KQ4L 3IDIB 1FAIH 5GGQH 3L9RB 1NGPH 3DUSB 1J0IA 1XGPA 5C0FB 2FJHA 3D9AL 4UBDC 5F7MC 3ILQC 4EN3B 3SDXB 1U8IA 3EW3B 2WZPD 2EECA 3TFKC 3F7VB 4WDIB 4M1CD 5BVJA 3MLTB 4XB7A 4DTGH 1NFKA 3WJLC 2VDRH 3O8XB 2ZPKL 2WWMC 2IG2L 4NUJB 4ZAKD 4TOYH 5GRUL 3ZE1F 5MEQB 3DHJA 4XHJC 4XPAH 1SYVA 1U2CA 1I9RL 1JGEA 3QI9A 4YZFF 1ACYL 4MDJA 1A1MA 1HWHB 2VXTH 2NXYB 1FE8L 4H25B 1U6AL 4F15B 1WJ3A 4XBGB 4OKVB 3L3IB 2D31A 3UTTA 3KLHC 4ESKA 4OGAC 4LRIC 3MBEA 5C07D 2X70B 4YDVB 4DKEH 2NY7L 3RWFA 4B53A 5J4MA 4QHLB 4FABL 3D5OF 1XF1A 3O4OC 3PWVB 3Q6GH 2ZSVA 5IIEA 2XZZA 2WUCH 4XCEA 1W0VB 1T0PB 4LIQE 3GRWA 4N9OB 1I1AA 3PDOA 3O6FB 4JFXB 5DMGC 3QDJB 4Y5XA 1NMAH 6FABL 1PG7L 1I1AB 3PDOB 3WS6A 3M1BA 2J1KA 4ZOEA 4WV1C 5T1MA 3LKSA 4YAQB 4TSAH 2GJ6E 4KI5E 1FDLL 3OKNB 4JO3H 2DBLL 5DMKB 4YAQA 1VFBA 4HWNA 5C86A 2DLFL 5SWSE 1QYGL 3V5DA 4TVSa 1GC1C 4ONHA 3UPRB 5E4EB 5T1LA 1NBYA 3DYMA 3MMEB 4YX2H 1OL0A 35C8H 1FORL 1TPXB 2Y5EA 3BQUD 5T3XL 1HEZA 1DN0B 4LQ1A 5E70A 2ICEA 3L3GB 2R1YA 3LS4H 4RQQA 1TVBB 2VZTA 3NACH 5FHAL 4OF8A 4YGVA 5EU3A 1DBMH 5AG8A 1TJGH 4MNGE 1Z9OA 4NUJA 2X41A 4JRWA 2Y23A 2FGWL 1RHHA 2YBRB 4G43A 1UGNA 5DRWA 4PGCA 3P4LA 1FFPB 4Y4FD 3TNNB 5KG9B 4LEOB 3QJFB 4XCYB 3W11C 3SGJC 2LABA 5DUBB 5C0BB 1AGDB 1TMCB 1UFUA 2MTPA 4DCQB 4YEFA 3HFMH 4GW1B 4I13B 1DN2A 3QIBC 4FXLA 3TLRA 5BMFH 3DRTA 1VACB 1ZOXA 1FL6A 2C4XA 3ZHDA 4JO1H 1AI1H 1WF5A 4PREB 3WKMH 1NGWB 1X5YA 5FDWA 3VXQA 4PJGB 3MJ9L 1E4KA 2EC9U 1DE4B 2PYFB 1A14H 5FOJA 1FGVL 5L88H 3NAAL 4YDKL 3VG0L 1WAAE 1ZXQA 1QFWH 1QLEH 4FFVC 5F7YC 3RTQB 5E2UL 5JPNB 4JZNA 2H9GA 1PLGL 3L3HA 3LH2H 1JI1A 2F19H 1BGXH 5DI8A 3NCJH 4XRCA 1Q9KB 5HVHC 2DM2A 2DMKA 4ELKA 1J86A 1VFBB 5GS2D 3W39B 2A38A 4ALAH 3CVHB 2IF7A 3QG7H 4IRJD 2Y5TB 2CKBL 4BKLA 4MCZB 3RX5A 1S7TA 4YEEA 1UT9A 4JKKA 3VXMD 1I8KB 5IJKA 1IGML 1NEZG 4L29B 4QOKB 4L9LB 1EHXA 2P45B 2R29H 1BFVL 3K4AA 3GO1H 2EZ0C 4WNQA 4JB9L 5IW6B 3AUVA 1BFSA 5L2JB 1KCSL 1EUTA 4M6NL 3C8HA 1KV3A 2FCBA 4OV6F 4F80A 2NW3A 3FQXB 3IXAB 1XF5A 4CMMA 1BHGA 4DKFH 1JHTA 4HIXL 5CZKA 1R5WA 3SKNA 4V1DB 4NQCA 3H42L 5JQ6L 1WWBX 1KJ3L 5FOBB 1A6UL 4WCYL 1NBZA 1V7MH 4PG2A 2NY2B 2Y25A 2HFFA 5HI4D 3LVEA 4HUUA 2LV4A 3SCMC 2R1WB 1B2WL 4MCYA 5JW3L 1UB5A 4I5BA 4AEIL 1G7HB 2P8PB 4TOYL 4JRXE 2DQDL 1HDMB 3ROLA 3HNVH 2W60B 4C4KT 1Q9OA 4M62L 4PJCF 1LDPH 4GW5A 4KTEL 1KJMB 3ZT6A 4LPWA 1I1YA 4P5MB 1OY3B 3IVKB 2J5LB 3MLVL 1KJMA 3D3VA 1JWUB 3OHXA 5C0CB 3V6FA 3BGMB 2VLJB 3VWJA 1YEJH 1F3RB 1OAXH 1E6OH 1QFUL 1UH3A 3RDTA 4WENB 1YMME 3NZHL 1HKFA 2QHRH 2R4SH 3LRSB 5E9DA 1Q0XH 3DX7B 3BDYL 1S7WA 2QHRL 3GI9H 3MLWH 5E8EA 4X5XB 1X4XA 5MHSD 1IAKA 25C8L 3R4DA 1OP5H 1W8OA 3NIFE 4WW1B 5C08A 5ISZE 4OZGA 1M7XA 5IB2A 4ZS7H 2CDEB 4IRJB 4YJZL 3CZFB 5SWQA 5K59E 5IB5B 5L2JA 4ZUSA 5T1DL 3QJHB 3CDGA 5CKGA 3ULVF 2V17H 3L95B 5FGBC 3IDUA 3QFJD 2CIIB 1D5IL 1DL7L 3O0RL 5D7IB 5T3ZE 2VE6A 4OZIB 3O2WH 4Y4KD 1IGMH 3SPVB 3KXFD 5EU6A 4LSRL 1OCWL 4WHCA 4BJLA 2VAAB 4JCLA 4LCWD 4BYHA 4DZ8A 4F7MB 5GS0D 4TPRH 3RKPA 3BP7A 4G8FB 2DQHH 3RA7H 2XZAH 5F6IB 3QHZL 3QXVA 5D7LB 3RWCB 4C58B 2HG5B 3MLUH 1FVCA 1CL7H 3OKYA 3KS0H 1B0GB 3O9WC 3X13A 1INEH 2HN7B 1I1CA 5I0ZA 2H8PA 5JW3H 1KCLA 2BSED 3GBML 5AAMA 4AH2A 4EOWL 4NCDA 4F3FB 4HJJL 3AXLB 2B1AL 2YUVA 1T2XA 2LVEA 3GSUB 4NM8L 3MRPA 4FA8A 4PJ8B 1CZ8H 4XTRC 3MLWL 1R3JA 4HUKB 4PJ9A 4F7TA 1KC5H 1DVFB 1L7TH 4NO2B 4O4YH 5FYLH 3LB6C 5F3HA 4NHCH 4QGTA 1ZA6A 1UVQB 5F1NA 4G7YL 1X5IA 5JO5B 3QIUC 5CGYC 1MELA 3RY6C 4MNQA 4XWOD 1JUFB 3OR6B 5SWQB 3OG4B 1QR1B 3MV8D 1E4WH 3ULUH 3WXWL 5F9AC 5LVEA 1JNHB 1NDGA 3GMOA 4WU7A 3WHXA 4IM8A 4HS6B 1KT2B 5GZOD 4YDIL 4WFED 2NX5E 3K8LA 5CP7B 3PABB 4LCUA 4PV9A 3P4MA 1LO4H 5H8DA 2YZ8A 2PF6A 2ZG3A 5DVOA 2P24B 1LK2A 2I60H 3UZQA 1FZOA 5LQBH 3MRLA 4LASH 1RUAH 1FJ1A 4F7MA 1BVKB 4X5LA 3KLHD 3SCMA 1CXEA 1MFNA 3A6OA 3QUZC 5DVLA 2AJYL 3GJEB 5CKAA 3TBYA 3FQNA 1CICC 4OIIH 4IIQC 1CK0L 3MX0A 3BKYH 4JRXA 1FVDB 2PO6B 4P2YA 5D1ZC 3S3PA 4ZPTB 3O0RH 4R2GC 4MXVF 3ZTNH 4CMHB 2N56A 4JM4H 2DQGL 5CJQH 4PPTA 3VFSA 3NFPB 5D5MA 3C8KA 3OB0K 1T83A 1CT8B 2Z8SA 4KK8D 4IRJC 1KJ2B 2VTFA 5CEXA 4OZIE 3IKKA 1K4CA 5C70A 1LVEA 1HOCA 5FM5O 2PYED 2RR3A 5AUMB 3G5VB 1YEKH 4NQSA 2V2WA 4Z76B 4LLAA 2Y1VA 4MDIB 3H7LA 5B21A 4QRPB 4M5YL 1ZAGA 4KI5C 2EYSA 5FUZL 4YK4B 1F11A 1NGQL 4A2LA 3QXDA 3ULSA 4OZHE 3ZYIA 4MMXC 3O2DL 4Z6AT 3DIFB 2FIKA 1HH6B 1CXFA 3A6CL 1OHQA 5IVNA 1H9VA 4PRHB 3GI9L 4PG9A 1H15A 1MRCH 1BP3B 4HJGB 4HS6A 3LV3A 1CFNB 2Y6SD 4CU8A 3MA9H 4GFTB 4HV8A 1BLNA 3MRGA 1CFNA 3AU1A 3NPSC 4NRXB 1BOGA 1IZJA 3MRLB 3IXTB 1PSKL 2IAND 4JRYD 1MHHB 1QHOA 4Y1AA 1Z5LB 4FNLH 5E8PA 3MZTA 4OM0L 4ODSH 1FL3A 4O2EA 3NCMA 3UMTA 2J8OA 4PJEB 3IRPX 4C56A 1KIPB 1MF2H 4XPBH 2JCCB 5J6HB 3QQ3B 3HE7B 4I48A 4P2QB 4OLZL 1YNLH 5I8CB 2P8LB 2UYLA 4RGOH 3QIUB 2UY6A 4M6NH 2HWZL 2DTMH 5KVFL 2SEBA 4EDXB 1NC4A 1X5JA 4BFGA 4WHYG 4DN4L 1N8ZB 1YYLL 2SEBB 1Y0LA 4LSQH 5D70L 2X10A 1CGUA 4KUZH 3Q5OA 1QSEB 3U7AA 3ZE0E 2HH0H 4MJIA 2YR3A 1H0DA 5F7DB 1URLA 5HI5D 2E6PA 3UAJC 1AHWB 1U8IB 4JKMA 3VI4E 1U3JA 1PFCA 4POZC 3U7YL 1XGUA 2GJZA 3C5SB 4Q6IA 4KK9C 4I77L 2EZ0D 2EDWA 1KULA 3IKCA 2HKFH 4OZGF 2BHUA 3QHFH 3SGKC 3LD8C 3G9AB 3T0XA 4X7CC 4JKLA 5I0DA 4KRMB 4XNMA 3AS2A 1U8QB 3MRMB 1Z0NA 4GUPA 4TQEL 3CFKA 2LU3A 3QDJE 3TBVB 4QRRB 1UEYA 5EC2B 3VXRD 5E4EC 1QFPA 3WKML 3H9SB 2OTPA 1FH5H 1D5BA 3UZVB 4EIGB 4NBZB 1HHIB 4GRMB 4N9GA 2K1MA 3ARSA 3LKRA 1FSKB 2OP4H 3FMGL 1I9IL 3SJVB 4WUKH 3UTPE 5IIEB 5DURD 5T3XD 1UZ6E 4OUOA 4NWUL 2R15A 3CDCA 4NCC1 3TN0C 5EOCJ 3BP4B 4K3DL 5ICXB 4CGTA 3FFCE 3BT2L 1Z9MA 4ODSL 3TGXA 2XZCL 3ZE2E 3LEXB 1WZMA 4K71B 1IBGL 1A6WH 2NTSP 2XFXB 2BP3A 3OMZA 3KR3L 4KQ4H 5GRJL 3V7AE 3RVXC 3IDIA 1UJ3C 2MNUA 5I18H 4RGNB 4XAWL 3AGVA 4OD2A 2ZOKB 2MKWA 4NBXB 3FQRB 2BVTA 1G0YR 4PJHB 4GLRI 5EORH 4U1LA 5D2LB 4U1SA 2HFGH 2QSVA 5HGDA 3FT3A 3IDYC 1ZTXH 4Q2ZB 5ETUA 5FF6B 3RUGF 4ZO8A 2AXHA 2DIJA 3BYTA 2ZWLT 4Y4FB 5FCSH 3EYQD 4P5TC 5C08E 3SOBL 1ZT1A 5DJAA 5C9KA 1ZT7B 1W72B 4N0FA 4G3YL 2O5XH 4NPYA 4P23C 3EHBD 1X9QA 1T1ZA 2KKQA 4ISVA 2BVOA 2CDFB 3N1MC 4P99A 5I1KL 1VSCA 5E4IA 5DDHB 2R4RL 3SKOA 3SKNB 1KLUA 1A9EA 3UDWC 4MAUH 3VDCA 3L3KA 3VFRA 4DK3A 5KW9H 1C12B 4JRYE 3NIGE 1ZVHA 4KKLD 2PW1A 4HZAA 1IM9A 1K4DA 3BUYA 1DQLH 3MZGB 3ULVH 1RFDL 5BS0E 1HXMB 2QV2A 3KR3H 2X4PB 3RNQB 5KVEL 3I50H 4J6RH 1FNGB 2P8MA 4YHPB 3UP1A 2VKWA 3BP6B 4HHAA 4K3JL 3V52H 3LEXA 5BW7A 2IQ9H 4LFHG 5IQ7H 3ARDB 3LZFH 1HZHH 1RY7B 4OZ4B 2R0ZL 4XH2B 4LHJB 1C16B 3OKOB 5C71A 4PLKD 4CVXA 1AKJB 1XCQA 3ORJA 4XP6H 3FRPG 1F4XH 3CJJA 2BOCB 4OFPA 2PCPB 4ODHL 4J4PA 4Y0GA 4CVXB 2D7TH 2GJ6D 4KI5D 1FAIL 4U3CA 5GJTH 4TSCL 5F72S 4D94A 3K81A 4G8GA 1U91A 3ARFA 5T3XE 5HHXH 1U3ZA 4ONFL 5EIVA 1IQWH 1VPOH 5DJCB 1R5IB 4RGND 2BRRL 4XC3L 1P6AB 2J88H 3TFKD 1G6VK 5GGUA 2Z8VC 5DJCA 1QBMH 4OTXL 4X4ME 3HE6A 4LPYA 2EE6A 4X6EB 2PYEA 4U7SA 4PRDA 5EZLB 3QQ9D 4MNQE 2XY1A 5T1KA 4APQD 3BSZL 4O9HL 4V1DE 1MHCB 4X9GA 1S9XA 1MJUH 3X3GL 3FO0L 2CGRH 3Q1SL 4QHKJ 2CIIA 4Q97A 3T77B 5C0BA 4DCQA 4PJFE 3S3SA 1OT2A 3L3OB 3O45B 5D7IE 1ACZA 1R5WB 4M43H 1AP2A 3ARDD 5AZ2L 3WS3B 4RMRA 1A6TB 4YHLL 2Q6WA 5BVPH 5IGXH 3ES6B 1Q1JH 2JKXA 3UTSD 4OLYL 1UCTA 3EYFB 1M7DB 3PF2A 4KVNH 4JY5H 1IRAY 2FRGP 2YK1H 1M7DA 3SDCD 5C6TL 5I8OH 5DHXB 4MXQD 3D87B 4OQTL 5JW4M 1J0YA 2ZCKH 3MRPB 3JVGC 2VABA 3NVQA 1IC4H 4YXHH 2EIZA 2JCCF 3SDXF 3B5HA 1FFQA 3QG7L 4CVWA 3QUKA 5JO5A 4GT7A 5D1XC 1QBLH 4QF1B 3SDDD 5J1AB 4DWHA 3MRJA 5CBAA 4WUUA 4HS3B 1OAYL 2P48B 2IADA 2NY2D 2A9MH 1B0RA 1GZPB 1OAKH 4GXUN 2NLJA 4G7YH 1P7KB 1PLGH 4Z5RB 4NN6C 1IMHC 2IPUG 4OFDA 4XMLH 1S5IH 1AR1D 3WHXB 2X7LB 4R96B 2I9TB 4LLMA 1N64L 4G6MH 3PWNA 4GKSB 1KCRL 1S7UA 1PQZA 2HVKB 5ILTH 4J7RA 2O5YL 4P3CH 3QNXA 3RZCC 3PWNB 3EGSB 2E7BA 3NH7H 4P46A 4RFOL 4R4FH 2E8YA 3H9SE 5E6ZA 5CJXC 4MAYD 1QA9B 1QBBA 2P49B 5ENWA 1JZ5A 5TQ2L 3LRGA 4U05A 4NKIL 2VDPL 5GRVL 3QCVH 3PWJB 4HKBB 5I1HL 3TCLB 4OLXH 5DMIH 3GHBH 3ES6A 5D1XA 1XGQB 2JELH 4YXLH 4D9RD 4A6YA 2PNDA 3SKJL 3CX5K 1MQ8A 1MFEL 3V4UL 5DWUL 5KSAD 5B3NA 3WL9A 5DEZA 2X4UB 4JO4L 5EOCH 5F7EL 3Q5YA 2DQDH 1CLZH 1I7ZA 5GRXG 4WWID 5FO9A 3HC4L 2X4OB 2IMNA 3FOLA 5B22A 2Q8AH 3TT3L 1AFVH 1KTDB 4MD4A 3BQUA 4JREC 5E99H 3JV4A 2P5ED 3TBTA 4BFIA 2WIIB 3VFVA 1IEBA 2PTVA 4KROC 5J11C 2JB5H 4K7PY 4HGKC 1BAFH 4MQXD 2X05A 4M8QA 1JRHL 1YNKH 3MACL 4YE4H 4AIZB 1UM5L 1ZT4B 1HE7A 3KYNA 4DQOH 1T7XA 1G1CA 1KCSH 4LPVA 4FQ2L 2BNUA 3MPCA 2NQCA 1Q72H 4JHAH 3MCKB 2C3WA 2PO6C 3O3BA 4S1SL 5IB3A 1LO4L 4HZLA 3T1FA 3O3BB 1S7XA 3E6FA 5IB3B 4K94C 4GS7B 4OI8A 2HTLD 3BIKB 3KPNA 3O41A 1KB5A 2K7QA 2CKBH 2XI9A 5HYJE 4KRPB 3SKJH 3ZHKA 4Y89A 3WNOA 3O8XD 4NN5C 1JL8A 4JFZH 4N5UA 3NCJL 5ISZA 1I75A 1N64H 4G6ML 4MNHB 4MDJB 2ZOLB 1YPZB 5KVMC 2HJLA 4IBLT 1HILA 3QI9D 4U6HB 5I1DA 3DX9A 5DRZB 4NKDB 5JUEL 1OAKL 1LILA 2R39A 5F88A 4OCRH 1VENA 5KSVB 4ZPTA 5DMGD 3HAEH 5DJ6A 5TGBA 4N0RA 2CLZA 2UWEF 1VGEL 3DROA 3T0EE 1DQJA 2EDDA 4FZ8H 2Z93B 5T3ZL 1DBJH 1TZGH 3KPSD 4XPTH 5CWSB 3BGFB 5MEOB 1P9MA 3TO4C 5CEXB 3BPCA 4M7LL 2WBJC 5KN5A 4OJFH 2EDOA 1RU9H 1IEBB 4G8IA 3ULVD 4I2XB 1NCNA 3SE4A 3VFSB 4YIQA 4UZGA 1R3KA 3TH4T 1J1PL 2H26A 4KQ3H 4UV7H 4F7TB 3PWPB 2YPLB 4KVNL 1FZJB 3QISA 4PJCA 5GHWL 4GMSH 4QHNB 5DMKA 3MYJA 4JFPA 4JVWA 2AK4A 3I6LE 4FFZH 2DYPA 1WCQA 4OCSH 4NQVA 1HH9B 5FYJH 3PGFL 2VL4A 4RX4D 5DRXA 2YS4A 3SE3A 3E8UH 2ICEB 3BKML 4Y1AD 1V3MA 4RIRB 2XRAL 4HUWA 4R4ND 4P2RB 5AYUL 1A02N 2FJGA 3MV9D 4U49A 4OM1L 3RUGE 1LO3H 3DV6B 4PRAA 4PGCB 4GUPB 1PX3A 4UNTA 4PB0H 3VXPB 5I1CL 4K3JH 4OZHB 1RK0A 2IFGA 5D71H 1G7LB 1YMMB 3SO5A 4CU6A 1PW3A 2GTWB 3BN3B 5E1AA 4P2QE 5A2IH 3IETA 2OSLB 1GOFA 4GRMA 3IJHA 1UKTA 3MNVB 2I5YH 1F90H 4N5ED 4X80H 5F96L 1T7VA 3MOAL 4Z7WB 4JQXC 2DDQL 3LD8B 1BBDL 2IFFH 4HWEH 3NCFB 5IMLB 3ARPA 2E8ZA 5FO7A 5FECA 1NAMH 2C9AA 1Z9SA 2FATH 2YKLH 3BRDA 1CS6A 2J3SA 3LKSB 5D7JC 5J13B 4R90L 4BQ6A 1WSST 2ILLA 4TUJA 4CNIB 3D18B 4DFHA 5IMMB 4WI5A 3G6JB 1N8ZA 3BXNB 4CNIA 1P7QA 3QDGD 5LBSL 4FP8H 1D6VL 3V6BR 3DI2B 1UXWB 4HUVB 1CXLA 4OJFL 5FO8A 4EXPX 5IG7A 5HGDB 4KJQD 3SBWC 3ROOB 2VN4A 1YEDA 2YPLD 1MH5B 3GBNL 1WTLA 1U8OB 2VDKH 4W4NA 3GSNL 3HG1E 1UWEH 3QT2A 1MRCL 3LV3B 1OGTA 5ICZB 2DQEH 1OAZL 2AXFB 5DFWH 4LK4A 4XXCC 1R3IH 3GNML 2O5XL 4QRQB 1N6VA 4YDLC 4X4MA 1CDHA 3W9EB 4S1RH 3ZSTA 4AEHH 5TE7H 1V3KA 5D1ZD 3EDFA 3WFDL 3MBED 4K3DH 4X6FA 5C07A 5JOPD 5C0NC 4N8VG 2VDLL 1L4IA 1FCCA 4KDTC 4NWUH 4YHYB 3PV6B 1CD1A 5DHVA 3ZMRA 1VKXB 4DQOL 3JWOH 5CEYA 1K6QL 4RAUA 5F8RC 1UWGH 2RIKA 4H1LG 4IHOB 3U46B 4EZMA 4PJAB 1AQKL 1JFQL 3MV9A 2EXYD 4GQ9L 1LEGA 3MGOB 1HDMA 5J12B 5D93C 4LSSH 4WUUD 3RNQA 4ZSOB 1IKNA 5GRJH 2VNCA 2ZUQB 1JWMA 2DTML 3HZYA 2CSPA 3JTSB 4PR5B 1KENL 4PIRF 3RBGA 1U95A 4LCWB 3OHXB 3V6FB 5C0CA 2Q76B 3FO9B 3VD3A 3TWCH 5EU5A 4GG6B 3QDME 1IFHH 2ZUXA 1TQCC 4XXDB 1DDHA 2ORBL 3G04B 2NY3D 2QLVB 1EGJH 4ZTOL 3E1F1 3MUGB 3BMVA 2Q3AA 4YH6A 1ZV5A 4Z7NF 4P9MH 5JPMB 5JTWA 3P0YH 1ZLWH 4L4TD 4S0TD 4Y4FA 5FYJL 3QH3A 3LKNA 1G84A 4GRLC 4Y88A 2KQMA 3IU3B 1DQML 3T0DA 3C6SA 4JFYA 3AFLA 5E6IC 2HMID 4MA7L 2D7NA 1XF5B 5DMIL 5CJ8A 5AAWA 4TQEH 4X6DE 4ISVB 1FFNB 1UQSA 1FBIH 1KFAL 1UZ6F 4IIQB 5HD8C 3UJIL 3D69B 4HSQA 3QI9B 1S9XB 1CG9A 4Q9BA 3PGFH 5IM7A 2R1WA 4NO0D 1YNLL 1FH5L 4I0PD 3CK0H 3T65B 2O93L 5CEZE 2CIKA 5JR1L 2Z31A 4QO1A 3OKLB 3VXQB 3MROB 4UTAH 4RA0C 3EUUA 3DBXB 3NCCB 2A6JB 2DLEA 4XMLL 1FZKB 4JN1L 3D39B 3EYVB 3TBSB 1WBZA 1GHFH 3P40A 2GCYB 4UTBH 5TF1H 1Q9LB 4YHMH 5FB8B 3L3HB 2EE2A 4HKJA 1HHJB 1JWSB 1HSBA 2JE8A 4JHAL 5EO1A 3TEUA 5D7JA 2UWEA 4DGVL 3F65A 2D3VA 3ARDA 4P59L 1BF2A 4PRPD 1OTSD 3GSUA 3TC9A 4XP5L 2XOTA 4X83A 2FJFA 1P84J 4XB8A 2RFXA 3ZLQC 3C5ZB 5IEHB 1UYWH 1U8PA 4L8DB 5FYKL 4J3WA 4BSVB 5DJYA 2VC2H 4NOBA 1B0RB 1DN0A 1GZPA 4OQTA 3D0VA 4JR9H 2ID5A 4YDJA 4OF7A 3T0EA 5EN2B 4OLYH 5IVOA 4NRYB 1CLZL 1XR8A 5A16B 5I1CH 2RAMA 1MQKH 1GZQB 2W0PA 3F7YB 1BVZA 1ODAA 4AENA 5I1AB 1JNHA 4NP4H 1TJIL 2YBRA 5L6YH 4Y16B 3STZA 4KV5E 3ZDZF 5EU6B 4HC1H 1GH7A 4OLXL 3TVMC 4JGMA 1CWVA 2JB5L 5FYLD 4ZDHB 4YNYA 1IGJB 1AO7D 3VFWA 1RI8A 4ZYKA 2H2SD 4G6JH 3CK0L 2DRUA 3UYRL 5F21B 1QKZL 5T5NF 4BQBA 4UDUA 5BV7H 2Q8AL 3N50A 2X4TA 4NHCL 5FGCE 4FFYL 4OB5H 1W0WB 4UT6L 2X4UA 1XGYL 1KEGH 3WEXB 3MV9E 4A6YB 5DWUH 4YWGH 1Z2KA 1U41A 4HD9A 3PDDA 3SE8H 4HIHB 4Z7VE 4WWKA 4CDGC 4M62H 4G6AD 4YBQD 1N3NB 4FFYH 2IPKB 2X1WL 3BGAA 3FB8A 1N7ML 1JGDB 3TT3H 1SEBB 2XNAA 4E9LA 4P5KB 1BFOA 4OI7A 1E6JH 3O9WA 4OLWH 5IF0B 4D8PA 4F7PA 3GSOA 5H37G 5JXEA 1HNGA 2C1OB 1HIMH 3D2UA 3PGDB 2EH7L 4J23A 4F57L 2WINB 3MRDB 1YQ2A 1EVUA 3VFMA 4UTAL 1FLRH 3RDTB 1TVHB 2ARJQ 3OGCB 2Y36H 1T7ZA 1V3JA 3O4OB 1L6XA 5IQ9B 4PRBB 3ZKXC 4FZEL 2R2BA 2J8UA 1MUJA 1T22B 2GI7A 3VI3F 4XAKE 3QCVL 2CR6A 4YBHA 1SY6L 1FC2D 4P4KC 5ECJE 2H1PH 1S9VA 2X4SB 1U42A 2PXYC 2E7MA 3W0WB 5F1NB 2F53A 2W07A 5CGTA 1A9BA 3AROA 1IGTA 3I9GH 4Y5YB 4JM4L 3L5WB 3TYFB 4MAYB 4IS6B 4C54A 5LQBL 1A6ZB 4NFCA 3MV7D 1ZA3B 2PUQT 2YC1A 1CFQA 3CIQA 4GLRH 1OM3L 1IC7H 1QBLL 3MO1B 3LS5H 4KPHL 3QHTC 4HC1L 1ED3B 3VD7A 1UWGL 1QVOB 4NQCB 4P59H 5GGRY 4PJGF 2BFVL 3CMOL 1NANH 3SCMB 3OAUH 4FQXA 3VXMB 1UKQA 4Q0XH 5KSVA 4NRZA 1X5KA 4GG6E 3GHBL 4LOUC 3LRHA 4XAWH 1A3RL 2JCCE 2HJLB 5IFJA 5SV4A 1IM3B 2OI9C 3FB5B 1LGVA 3DVNB 5EO0A 1FNAA 3C60A 5F71A 1LE5A 2QSCL 4KTDH 1QUNA 4JQXA 4WI2A 5HD8D 3FO2B 5I17A 4JRXB 4P2QA 2YPVL 5TE6L 1K8DB 5JR1H 1RULH 4OQTH 1MSPA 3OAZK 2CKBB 1M71B 4TSCH 4FQQB 5HI3D 1XMWA 3GBMH 5JDJA 3NZ8A 3MRDA 2EH7H 1ZVSB 3NPZB 3PHOA 5DTFA 4N0UA 1DR9A 2OP4L 3ETBF 5A2FA 1T5XB 4JE4B 4LMQE 4PJ7B 1JTPA 3QXDB 1NMCB 1CFTA 3MRNA 4JO4H 5F7EH 1H5BC 3VFOA 4NQVB 4UQ2A 1S9VB 2X4SA 2EYSB 2ZZUT 3Q2CA 3WN5A 3QIWB 5F7UA 3WS6C 3MYJB 5IKCB 2MQCA 4QRTB 4UNVA 3C08H 4J3SA 2P44B 5TE7L 3RWIB 2BRRH 3MUJA 3IU4L 4QRPD 3HE7C 1JHLL 1OP3K 1OCWH 3OR6A 1V5JA 4HWEL 3H2WA 5EIIB 5H2BA 3VFTB 2X4RB 2DMBA 4LKXB 4ODHH 5KSBF 3PABA 4LCUB 5BRZD 1TNNA 3D3VE 5LXGL 3RVXD 4O5LH 4U2YA 3KWWA 1KT2A 2DBLH 4CUCA 4TNVF 3KYOB 1WGOA 1S7VA 2ADGB 2AAVA 3BHBB 4ODUA 5LKNA 2DMCA 4PUBL 1RAMA 3I2CL 4Y19E 4OI9A 4U3XA 4OLUH 2W9DL 5HYIA 4I1NB 3WN5C 4O51B 3MNVA 4JR9L 4ZQKB 3B4NA 3I6LD 5IW1B 2IANB 5D7KD 3LQZA 2ORBH 3HI6L 3PWVA 5C0IB 4Z7VA 4GMTL 2DL2A 1WT5A 4LSDA 3KPRB 1NAML 5C09D 2ATKB 5KW9L 1G7PA 4OGXH 3OQ3B 4F3FA 1TTFA 1F02I 4PTUA 5IMOB 1JYNA 4FFZL 3C5ZD 1F3JB 8CGTA 3RVTD 3ZSSA 4KY1L 4P2OC 3MBXH 5T5NG 2OZ4A 4LNVA 4HBQA 4L4VA 4QY8A 4KHXH 5F3HB 2NYYC 4GOSA 3OJ2C 3QPQC 1CU4L 4S0SD 3MCKA 1MNUH 4K3GA 1MHPH 2MQ3A 4LAJH 4UV4H 3QRFM 1ROWA 3FT4A 4CMHC 5GS0L 1PG7W 3IDXL 4OCXL 4U1LB 3EHBC 2QL1A 3WKNA 4LVHB 4WW2F 5FGSA 3ARZA 3B8YA 2DQCH 4OD3L 4A6YL 2G2RA 4F37K 2NY5H 3OB0H 5DQDH 1KTLB 5HDQH 8FABA 5DR5L 3PP3K 1KCVL 4JPWL 4WFFD 3B9AA 2XWTA 4GBXC 1AGBA 2GJ6B 3OKEA 4QHMA 5E8DH 5IHZA 3GIVB 3SO3C 5H94B 1R3HA 1T66C 2GTWA 4F9LA 4FXKA 3T4AA 4HGMA 5ADOL 5CINH 3OJMB 5DSCA 2WK2A 3N0PB 2FATL 1I1FA 4FQJL 4RGNC 1CFBA 4FFWD 5E94A 5JW5A 1R0AH 3BT2H 1C12A 1I8LA 4UU9B 1KLFA 4L3CB 4C56B 4XTRD 3GUTB 5J9PB 3U1SL 1UADC 3LB6D 1RZGA 4RDQG 4ZD3L 3LQZB 5DJDA 5DJ0B 3RVVC 3WSQL 4ZFOA 4GW4A 1NGQH 3BI9X 4FQLL 4M7ZC 3DO7B 15C8H 3SOBH 5F44A 5LWYL 4X5WB 4FTVD 1TZHB 3CXHJ 2H41A 4H88H 3SDAD 4JM2F 3K1KC 5ERWB 3UZEA 1SM3H 1K85A 4PJCB 1CICD 1HKLL 1J8KA 4RISL 2IFFL 5L7XL 2FJHB 3KG5A 3MJ7B 4R2GD 5F1IB 5EC1A 2X1XR 1GGUA 2ZUQC 3L9RA 3UJTL 4ORGB 4GQ9H 5DQJB 2HA1A 4DK6A 2OR9L 3GMLB 5GSVB 3MLTA 1NJ9B 1JPGB 3X11A 4ENEC 1JPGA 2KZ1B 4GAJL 4KK5C 3HNSL 2JK5B 3MJ8A 3CVHL 4NN7C 3CCHA 1WK0A 3V95A 2WUCL 4DAGH 4ZOAA 2YPKB 1EA9C 4LP4A 4N9GB 4XX1E 4DKDC 2EE3A 1U8HA 1J1XH 1AGDA 1K6QH 2RCSL 5AEAA 3AMLA 4KRPD 2DQEL 4WWKC 5DA0B 3B9KC 4TTDC 4U7KA 5BO1L 3ZO0A 3ULUF 1VKXA 4Q9RH 1RIVL 4ODWB 4KUZL 1NH6A 3FFDB 2BDNH 5TJWK 4DOHE 3UTSB 2X40A 3F7QA 4S1RL 1FDLH 4KK6D 3RP1A 3V4PL 4AEHL 5FDWB 5TPWH 5F97E 1TIUA 2C26A 3U36A 1YEGL 4DGYL 3GM0A 3I02B 4HIEB 4Q9CA 1JV5A 1XCTA 2JB6B 1G9ML 2VITA 1K8IB 2V2XA 1WWCA 3LEVH 1H3VA 3EBAA 5DHYB 4MCZA 1KIRB 4WI7A 1A8JH 5DHYA 2O61B 2D0FA 5I1HH 4L1DA 1PY9A 4DKEL 4I18A 3O4LB 4HXAL 2BMKA 1D6VH 4PJ8D 5E1HB 3RPKA 4ODXB 1QFOA 4Q6IB 2IH3A 4N8PA 4PJ7F 4DN4H 3FN9A 1S9WB 2GITB 3ARFC 4MLSA 5BRZA 1FFNA 1UQSB 2VZ3A 2E6JA 2VAJA 1NDMB 4OGYL 4U0RC 4FQ2H 2AJ3B 3MRFA 3WNMA 3HAEA 4MJ5A 3NABL 4LVHC 1KELL 1WBYA 1TQBC 1YEHL 1P5VA 4PJEF 1OVZA 4UIKL 4LNRA 4KK9D 2MPAL 1JGVH 1WBYB 4PGDA 3U0PB 1NGYA 1AP2B 2ZCLL 4LVOB 4Y19B 1T1ZB 3S5LB 2PTTB 5KSBA 1YN6A 1PY4A 4G6JL 1NCUA 1WITA 4G8GD 4PJBB 4JG1L 3SO3B 3LCYA 1F4YL 3IDYB 3MV9B 3NCYP 4OUUA 1VCAA 5ALBL 3KS0J 3ZKQD 1A7OH 2P5EE 3HLAA 4LP5A 2HVJB 3BP4A 5DK0B 1C7TA 4NQEB 5JORA 4K3EL 4GAGL 1L7IH 1E4WL 2VISA 4POYA 3HZYB 5B38G 2JIXB 3LEYL 1EEUA 5ANMA 2E9WA 1ADQL 3QO0A 5E2JA 3D9AH 1JJUA 4AT6A 1H3XA 4HDIB 3IF1B 2Q87A 3O2VH 3O9WB 4M3JA 5ACLA 1FFOB 3LIZL 4NZRH 1XCQB 1KIQA 2A74B 1MRDL 2VLLB 3DJ9A 2EDEA 3VXOB 2WW8A 3C5ZA 5IEHA 1B2WH 1FNEB 2XN9D 5J06A 1ZWIA 3D25B 3E0GA 5FUZH 1EVTC 2OL3B 1F4WL 4GXUM 3BD3A 4X0KA 3ZKNC 3IFPA 1KXVC 4Y4FC 3VGBA 4KKBD 3B9KB 1XR8B 2VZSA 4G8GB 2E7HA 1JHKL 4ONGH 4FXGB 4OFYA 2Y6SC 3D0VB 4XNXL 4OV5B 3QXUA 3BZFB 1F4AA 1AC0A 2V7NB 1FO0H 5F9OH 4QXGH 1ZGLP 3DYPA 1V7ML 5CD5C 3PWPE 4PGDB 5T1KB 1N5AB 3MRRB 2UY7A 4L5FH