2VDLA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdlA00
3T3MA 3ZDYA 3ZDZA 3NIGA 3K72A 5E6UA 3VI4A 4WK2A 1M1XA 4MMXA 3FCSA 4WK4A 2VC2A 4MMYA 3FCUA 3V4VA 5E6SA 4MMZA 4O02A 3V4PA 4UM8A 4IRZA 3NIDA 5E6RA 5HDBA 3ZE1A 3ZDXA 3ZE2A 3VI3A 1L5GA 5FFOA 2VDMA 2VDRA 3K6SA 3ZE0A 5FFGA 2VDQA 1U8CA 2VDLA 4WK0A 2VDNA 4Z7OA 4Z7QA 4UM9A 3K71A 2VDOA 4G1EA 1JV2A 3T3PA 2VDKA 4G1MA 4Z7NA 3NIFA 2VDPA 3IJEA 4NENA 4WJKA 1TYEA
chains in the Genus database with same CATH superfamily
4ZOYA 2OVRB 1UTCA 5HQGA 3K72A 4PXWA 3VH0A 5EARA 3UR4A 3OW8A 4J81A 4J73A 2HESX 4MMYA 4BP8A 1JOFA 4E5ZA 5HDBA 3O4JA 4O45A 4ZN4A 1GP2B 4J87A 2J55H 3JZNA 4K3JB 4QAMA 1GOTB 4BP9A 5GXIA 3IULA 4PSWB 4BCDA 5SXMA 5C86A 4O1QD 5IJ8E 1K8KC 4JHNA 3SFZA 1PEVA 5FXYA 2IURA 3I2NA 4A0BA 3IIYA 3SBPA 4H5JA 5EMKB 4GM3A 4ERQA 4A0AA 1N6EA 4PBZA 2H6QA 1H2YA 4D9SA 4A11B 5FKSA 2AGXA 3OTTA 4L1QD 4GGCA 3PXSD 3UVMA 2VZ1A 4FAVD 2CN2A 1JMXB 3MKSB 5HE1B 2XU7A 5H17A 1B9YA 3EWEA 3JZHA 2PM9A 4XYHA 2HYEA 2IUPA 3OL2A 3V5WB 1C9IA 3EI3B 3T3MA 2CN3A 3RN1D 2BBKH 4CC9A 2IUQA 5K19A 5M5VA 3OKYA 3SN6B 3MZKA 4J0XA 3K26A 2HU5A 3EI1B 5I5IA 4JHPC 2CNXA 2PM9B 3O4HA 3ZDXA 1BPOA 5FKTA 3C5MA 4Z8LA 2B5LA 2YMUA 1VE7A 2VDQA 1R5MA 3SWSD 2G9AA 5IGQA 2CO0C 4D0KA 3BG1A 2YBAA 4JSVC 3ORVD 3GREA 4QQEA 3SVWD 4ESGA 2I3TA 1PI6A 3CFSB 3NIFA 4GM9A 3IJEA 4JSPC 2EICA 1VYHC 1H2ZA 4IMMA 4NSXA 1S4UX 1GG2B 1K32A 1MG2A 2HJ4A 4XEIC 4A08B 3GC3B 1O6FA 3IUMA 4HDJA 5JWZA 3IURA 2PM6B 4O9DA 4E54A 3OL2B 4UI9R 4J8BA 4CZXA 2EIBA 4MK0B 1GOFA 5FKRA 2QR5A 4X63B 5GMKn 2H3XA 2YNPA 4J77A 2H14A 5HE2B 3IUQA 2BCJB 3OF7A 4CI3A 4PC0A 4A2LA 4PSXB 3JAMg 3O4IA 4Y7RA 4FA5D 2AGYA 3N0EA 3UVNA 4L1MA 1B9XA 4I79A 5C2VB 2HXCA 1A0RB 2P9LC 4J78A 3UVKA 3UKRC 2YNNA 4MMXA 2EIDA 2J56H 4K3ID 4U1EI 3EI4B 4KFMB 1PBYB 4YVDA 2P9PC 5E6SA 2OIZA 4AEZA 2XDWA 2P9SC 3AL8A 3F3FA 5GXHA 2AGZA 4FB1D 3SBRA 2BKLA 3SCYA 2QC5A 2G99A 4GQBB 2I0RA 5FFGA 4A2MA 4BUJC 3K71A 3EI2A 5EMLB 3W15A 1E8NA 1JMZB 4Z7NA 2XE4A 2H6NA 3PVUB 5H1MA 1C9LA 4A0AB 4A11A 3V7DB 5M61A 2OVPB 1I2MB 5A2Qg 4CY5A 3EQ8A 5FA5B 4ZOZA 1O6GA 2AH1A 3EI2B 4RE6A 2OK6A 3J80g 1A12A 3PE7A 4GGAA 1YR2A 4A0BB 1SQ9A 4NC4A 3IUNA 3FM0A 3JB9L 2EBSA 2P9UC 3FGBA 3SBQA 1TBGA 4BL0A 5FLXg 3IJ1A 3DWLC 3DXKC 4J8GA 3SJLD 5EAPA 3BWSA 3OKWA 4BCCA 3I8CA 4AMYA 3V4PA 3RSEC 2H9LA 4QL1A 1OLZA 5I5MA 2AGWA 2OJYA 4D6VA 2YB8B 3IVMA 4CZVA 4L3HD 4GQ1A 2W18A 4AMZA 4R7AB 3OKYB 4Z7OA 2H9NA 2IUVA 4JXMA 5IC7A 4FA1D 3MKQA 5TEFA 2H6KA 4J0WA 4NENA 3OKTA 3JZGA 3I7OA 3I89A 4L9OA 5H14A 4FA9D 2XL3A 4JT5C 5I5JA 4XYIA 3KRWB 4IRZA 3AH8B 5E6RA 2PBIB 3VGZA 1UOPA 2CE9A 3ZE2A 2MTAH 1XIPA 4E54B 4RE5A 3FRXA 3N0DA 4CY2A 3L4MD 3ZE1A 5M5SA 3SLED 4WJKA 5HE0B 5FQDA 1P22A 3IKOA 3AL8B 3JROA 1N6FA 4X61B 4IA9A 2H9MA 2AQ5A 1L0QA 4CY3A 4X60B 3RLMD 4O2WA 3GD1I 1U2VC 2EIEA 3I7HA 2GC4A 3CFVA 4FAND 5EALA 2VDRA 4GQ2P 2HU8A 4ERZA 5CXBB 5C92A 3O4GA 1QNIA 3EI4A 3KRXB 3RRMC 3RMZD 4JSNC 4JT6C 3T3PA 4GM8A 2VDKA 1U4CA 2UZYB 2Z2OA 4G1MA 4J84A 3PSCB 5AFU3 3IJCA 3ZDZA 4ZOXA 3VI4A 5EM2A 1NR0A 3I7NA 4J82A 3F3PA 3CIKB 5AJAA 4FWWA 4ES0A 4PNKB 4UM8A 3EI3A 1GXRA 4CZYA 3P4FA 1E5TA 5KDOB 3RFHA 1XKSA 2JKXA 5FFOA 5M5RA 3UVOA 3I7PA 5C2WB 2VDLA 3AFCA 1T2XA 3GFCA 4OZUA 3IIWA 3DM0A 1K3IA 4LG9A 2H68A 4LGNA 3V9FA 1M1XA 3PSLA 1H2XA 2HJBA 4MMZA 4CI8A 3NVXA 1MDAH 1VZ2A 3MMYA 4LG8A 5HYNB 1YFQA 4CI2A 3EQ7A 5K1CC 2I0SA 2P9NC 2XYIA 3MUOA 2YNOA 3PVWB 5HE3B 4U7AA 3SXTD 1E8MA 4ZOVA 3PXWD 4G1EA 4CY1A 3NIGA 2AH0A 4EWRA 2HKMA 3C99A 3IJ0A 4DNVA 2TRCB 3FCSA 4BH6A 2VC2A 3E0CA 2Z2NA 3NVQA 1VE6A 3MVDK 4G55A 4A09B 3MZLA 5IGOA 3K6SA 1L5GA 3F3GA 3ZE0A 3JPXA 4O3UB 3EI1A 2VDNA 1NEXB 2I3SA 4UM9A 4AN0A 4A08A 3NVNA 2GC7A 2H9PA 4DNUA 4FHLA 3MUNA 5CYKA 2UZXB 4AN1A 3HFQA 3MXXA 2VDPA 3C9CA 2XL2A 4A7JA 5FKQA 4E5ZB 5E6UA 1SHYB 4OWRA 4WK2A 5THAA 4WK4A 1SQJA 1ERJA 3V4VA 5CXBA 4O02A 4TZ4A 3ULEC 2O9KA 2GNQA 5TF2A 3JRPA 3NIDA 5M5UA 3A0FA 3U4YA 3EQ9A 1UOOA 4H5IA 2P9IC 2H13A 5AMSA 3K27A 2OK4A 1Q47A 2PM7B 2B5NA 5CXCB 3KCIA 1H2WA 2HU7A 5B4WA 1TYQC 1MG3A 1TYEA 2QXVA 2J57G 3B7FA 3BG0A 3EMHA 4L3GD 5C9ZB 1GOGA 5EMMB 3VA6A 3UVLA 2I0TA 5TEEA 3FCUA 1PGUA 2Z2PA 4AX4A 3AL9A 4O3TB 5GSAA 5EM2B 2CO0A 4PBYA 2P9KC 2WQ8A 2Q7QA 3C75H 4WK0A 3ODTA 5EMJB 4Z7QA 2VDOA 4GZ8A 3EU7A 4X3EA 4N14A 3RFGA 3I8EA 1OMWB 1RI6A 5CXCA 3EG6A 4CI1A 2IWKA 2VZ3A 3IUJA 4NBMA 3UKUC 3PXTD 4FA4D 1XHMA 5IJ7E 2OVQB 1UOQA 4GGDA 2B4EA 2VDMA 3DDUA 4J79A 1JTDB 1U8CA 3QHYB 1FWXA 4DNWA 2H47A 4JD2C 4NAAA 3DSMA 2CE8A 5EAMA 2QZPA 3DXMC 3SMRA 4BCBA 4QT8A 3ZWLB 4ERYA 3ZDYA 2IWFA 1N6DA 2XZGA 3QI0A 1GOHA 2AGLA 3I7LA 5TDHB 4AOWA 5M5TA 3L4OD 1QFSA 5IT9g 1VZ3A 3J81g 4JSXC 3RN0D 2IAAA 3VI3A 2HKRA 5CYKB 4G56B 2B5MA 4J86A 1QFMA 4Y5RD 4A09A 1JV2A 4QRJA 1JJUB 4GMBA 3SHFA 3I7KA
chains in the Genus database with same CATH topology
3T3MA 3ZDYA 3ZDZA 3NIGA 3K72A 5E6UA 3VI4A 4WK2A 1M1XA 4MMXA 3FCSA 4WK4A 2VC2A 4MMYA 3FCUA 3V4VA 5E6SA 4MMZA 4O02A 3V4PA 4UM8A 4IRZA 3NIDA 5E6RA 5HDBA 3ZE1A 3ZDXA 3ZE2A 3VI3A 1L5GA 5FFOA 2VDMA 2VDRA 3K6SA 3ZE0A 5FFGA 2VDQA 1U8CA 2VDLA 4WK0A 2VDNA 4Z7OA 4Z7QA 4UM9A 3K71A 2VDOA 4G1EA 1JV2A 3T3PA 2VDKA 4G1MA 4Z7NA 3NIFA 2VDPA 3IJEA 4NENA 4WJKA 1TYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3M A;  3ZDY A;  3ZDZ A;  3NIG A;  3K72 A;  5E6U A;  3VI4 A;  4WK2 A;  1M1X A;  4MMX A;  3FCS A;  4WK4 A;  2VC2 A;  4MMY A;  3FCU A;  3V4V A;  5E6S A;  4MMZ A;  4O02 A;  3V4P A;  4UM8 A;  4IRZ A;  3NID A;  5E6R A;  5HDB A;  3ZE1 A;  3ZDX A;  3ZE2 A;  3VI3 A;  1L5G A;  5FFO A;  2VDM A;  2VDR A;  3K6S A;  3ZE0 A;  5FFG A;  2VDQ A;  1U8C A;  2VDL A;  4WK0 A;  2VDN A;  4Z7O A;  4Z7Q A;  4UM9 A;  3K71 A;  2VDO A;  4G1E A;  1JV2 A;  3T3P A;  2VDK A;  4G1M A;  4Z7N A;  3NIF A;  2VDP A;  3IJE A;  4NEN A;  4WJK A;  1TYE A; 
#chains in the Genus database with same CATH topology
 4ZOY A;  2OVR B;  1UTC A;  5HQG A;  3K72 A;  4PXW A;  3VH0 A;  5EAR A;  3UR4 A;  3OW8 A;  4J81 A;  4J73 A;  2HES X;  4MMY A;  4BP8 A;  1JOF A;  4E5Z A;  5HDB A;  3O4J A;  4O45 A;  4ZN4 A;  1GP2 B;  4J87 A;  2J55 H;  3JZN A;  4K3J B;  4QAM A;  1GOT B;  4BP9 A;  5GXI A;  3IUL A;  4PSW B;  4BCD A;  5SXM A;  5C86 A;  4O1Q D;  5IJ8 E;  1K8K C;  4JHN A;  3SFZ A;  1PEV A;  5FXY A;  2IUR A;  3I2N A;  4A0B A;  3IIY A;  3SBP A;  4H5J A;  5EMK B;  4GM3 A;  4ERQ A;  4A0A A;  1N6E A;  4PBZ A;  2H6Q A;  1H2Y A;  4D9S A;  4A11 B;  5FKS A;  2AGX A;  3OTT A;  4L1Q D;  4GGC A;  3PXS D;  3UVM A;  2VZ1 A;  4FAV D;  2CN2 A;  1JMX B;  3MKS B;  5HE1 B;  2XU7 A;  5H17 A;  1B9Y A;  3EWE A;  3JZH A;  2PM9 A;  4XYH A;  2HYE A;  2IUP A;  3OL2 A;  3V5W B;  1C9I A;  3EI3 B;  3T3M A;  2CN3 A;  3RN1 D;  2BBK H;  4CC9 A;  2IUQ A;  5K19 A;  5M5V A;  3OKY A;  3SN6 B;  3MZK A;  4J0X A;  3K26 A;  2HU5 A;  3EI1 B;  5I5I A;  4JHP C;  2CNX A;  2PM9 B;  3O4H A;  3ZDX A;  1BPO A;  5FKT A;  3C5M A;  4Z8L A;  2B5L A;  2YMU A;  1VE7 A;  2VDQ A;  1R5M A;  3SWS D;  2G9A A;  5IGQ A;  2CO0 C;  4D0K A;  3BG1 A;  2YBA A;  4JSV C;  3ORV D;  3GRE A;  4QQE A;  3SVW D;  4ESG A;  2I3T A;  1PI6 A;  3CFS B;  3NIF A;  4GM9 A;  3IJE A;  4JSP C;  2EIC A;  1VYH C;  1H2Z A;  4IMM A;  4NSX A;  1S4U X;  1GG2 B;  1K32 A;  1MG2 A;  2HJ4 A;  4XEI C;  4A08 B;  3GC3 B;  1O6F A;  3IUM A;  4HDJ A;  5JWZ A;  3IUR A;  2PM6 B;  4O9D A;  4E54 A;  3OL2 B;  4UI9 R;  4J8B A;  4CZX A;  2EIB A;  4MK0 B;  1GOF A;  5FKR A;  2QR5 A;  4X63 B;  5GMK n;  2H3X A;  2YNP A;  4J77 A;  2H14 A;  5HE2 B;  3IUQ A;  2BCJ B;  3OF7 A;  4CI3 A;  4PC0 A;  4A2L A;  4PSX B;  3JAM g;  3O4I A;  4Y7R A;  4FA5 D;  2AGY A;  3N0E A;  3UVN A;  4L1M A;  1B9X A;  4I79 A;  5C2V B;  2HXC A;  1A0R B;  2P9L C;  4J78 A;  3UVK A;  3UKR C;  2YNN A;  4MMX A;  2EID A;  2J56 H;  4K3I D;  4U1E I;  3EI4 B;  4KFM B;  1PBY B;  4YVD A;  2P9P C;  5E6S A;  2OIZ A;  4AEZ A;  2XDW A;  2P9S C;  3AL8 A;  3F3F A;  5GXH A;  2AGZ A;  4FB1 D;  3SBR A;  2BKL A;  3SCY A;  2QC5 A;  2G99 A;  4GQB B;  2I0R A;  5FFG A;  4A2M A;  4BUJ C;  3K71 A;  3EI2 A;  5EML B;  3W15 A;  1E8N A;  1JMZ B;  4Z7N A;  2XE4 A;  2H6N A;  3PVU B;  5H1M A;  1C9L A;  4A0A B;  4A11 A;  3V7D B;  5M61 A;  2OVP B;  1I2M B;  5A2Q g;  4CY5 A;  3EQ8 A;  5FA5 B;  4ZOZ A;  1O6G A;  2AH1 A;  3EI2 B;  4RE6 A;  2OK6 A;  3J80 g;  1A12 A;  3PE7 A;  4GGA A;  1YR2 A;  4A0B B;  1SQ9 A;  4NC4 A;  3IUN A;  3FM0 A;  3JB9 L;  2EBS A;  2P9U C;  3FGB A;  3SBQ A;  1TBG A;  4BL0 A;  5FLX g;  3IJ1 A;  3DWL C;  3DXK C;  4J8G A;  3SJL D;  5EAP A;  3BWS A;  3OKW A;  4BCC A;  3I8C A;  4AMY A;  3V4P A;  3RSE C;  2H9L A;  4QL1 A;  1OLZ A;  5I5M A;  2AGW A;  2OJY A;  4D6V A;  2YB8 B;  3IVM A;  4CZV A;  4L3H D;  4GQ1 A;  2W18 A;  4AMZ A;  4R7A B;  3OKY B;  4Z7O A;  2H9N A;  2IUV A;  4JXM A;  5IC7 A;  4FA1 D;  3MKQ A;  5TEF A;  2H6K A;  4J0W A;  4NEN A;  3OKT A;  3JZG A;  3I7O A;  3I89 A;  4L9O A;  5H14 A;  4FA9 D;  2XL3 A;  4JT5 C;  5I5J A;  4XYI A;  3KRW B;  4IRZ A;  3AH8 B;  5E6R A;  2PBI B;  3VGZ A;  1UOP A;  2CE9 A;  3ZE2 A;  2MTA H;  1XIP A;  4E54 B;  4RE5 A;  3FRX A;  3N0D A;  4CY2 A;  3L4M D;  3ZE1 A;  5M5S A;  3SLE D;  4WJK A;  5HE0 B;  5FQD A;  1P22 A;  3IKO A;  3AL8 B;  3JRO A;  1N6F A;  4X61 B;  4IA9 A;  2H9M A;  2AQ5 A;  1L0Q A;  4CY3 A;  4X60 B;  3RLM D;  4O2W A;  3GD1 I;  1U2V C;  2EIE A;  3I7H A;  2GC4 A;  3CFV A;  4FAN D;  5EAL A;  2VDR A;  4GQ2 P;  2HU8 A;  4ERZ A;  5CXB B;  5C92 A;  3O4G A;  1QNI A;  3EI4 A;  3KRX B;  3RRM C;  3RMZ D;  4JSN C;  4JT6 C;  3T3P A;  4GM8 A;  2VDK A;  1U4C A;  2UZY B;  2Z2O A;  4G1M A;  4J84 A;  3PSC B;  5AFU 3;  3IJC A;  3ZDZ A;  4ZOX A;  3VI4 A;  5EM2 A;  1NR0 A;  3I7N A;  4J82 A;  3F3P A;  3CIK B;  5AJA A;  4FWW A;  4ES0 A;  4PNK B;  4UM8 A;  3EI3 A;  1GXR A;  4CZY A;  3P4F A;  1E5T A;  5KDO B;  3RFH A;  1XKS A;  2JKX A;  5FFO A;  5M5R A;  3UVO A;  3I7P A;  5C2W B;  2VDL A;  3AFC A;  1T2X A;  3GFC A;  4OZU A;  3IIW A;  3DM0 A;  1K3I A;  4LG9 A;  2H68 A;  4LGN A;  3V9F A;  1M1X A;  3PSL A;  1H2X A;  2HJB A;  4MMZ A;  4CI8 A;  3NVX A;  1MDA H;  1VZ2 A;  3MMY A;  4LG8 A;  5HYN B;  1YFQ A;  4CI2 A;  3EQ7 A;  5K1C C;  2I0S A;  2P9N C;  2XYI A;  3MUO A;  2YNO A;  3PVW B;  5HE3 B;  4U7A A;  3SXT D;  1E8M A;  4ZOV A;  3PXW D;  4G1E A;  4CY1 A;  3NIG A;  2AH0 A;  4EWR A;  2HKM A;  3C99 A;  3IJ0 A;  4DNV A;  2TRC B;  3FCS A;  4BH6 A;  2VC2 A;  3E0C A;  2Z2N A;  3NVQ A;  1VE6 A;  3MVD K;  4G55 A;  4A09 B;  3MZL A;  5IGO A;  3K6S A;  1L5G A;  3F3G A;  3ZE0 A;  3JPX A;  4O3U B;  3EI1 A;  2VDN A;  1NEX B;  2I3S A;  4UM9 A;  4AN0 A;  4A08 A;  3NVN A;  2GC7 A;  2H9P A;  4DNU A;  4FHL A;  3MUN A;  5CYK A;  2UZX B;  4AN1 A;  3HFQ A;  3MXX A;  2VDP A;  3C9C A;  2XL2 A;  4A7J A;  5FKQ A;  4E5Z B;  5E6U A;  1SHY B;  4OWR A;  4WK2 A;  5THA A;  4WK4 A;  1SQJ A;  1ERJ A;  3V4V A;  5CXB A;  4O02 A;  4TZ4 A;  3ULE C;  2O9K A;  2GNQ A;  5TF2 A;  3JRP A;  3NID A;  5M5U A;  3A0F A;  3U4Y A;  3EQ9 A;  1UOO A;  4H5I A;  2P9I C;  2H13 A;  5AMS A;  3K27 A;  2OK4 A;  1Q47 A;  2PM7 B;  2B5N A;  5CXC B;  3KCI A;  1H2W A;  2HU7 A;  5B4W A;  1TYQ C;  1MG3 A;  1TYE A;  2QXV A;  2J57 G;  3B7F A;  3BG0 A;  3EMH A;  4L3G D;  5C9Z B;  1GOG A;  5EMM B;  3VA6 A;  3UVL A;  2I0T A;  5TEE A;  3FCU A;  1PGU A;  2Z2P A;  4AX4 A;  3AL9 A;  4O3T B;  5GSA A;  5EM2 B;  2CO0 A;  4PBY A;  2P9K C;  2WQ8 A;  2Q7Q A;  3C75 H;  4WK0 A;  3ODT A;  5EMJ B;  4Z7Q A;  2VDO A;  4GZ8 A;  3EU7 A;  4X3E A;  4N14 A;  3RFG A;  3I8E A;  1OMW B;  1RI6 A;  5CXC A;  3EG6 A;  4CI1 A;  2IWK A;  2VZ3 A;  3IUJ A;  4NBM A;  3UKU C;  3PXT D;  4FA4 D;  1XHM A;  5IJ7 E;  2OVQ B;  1UOQ A;  4GGD A;  2B4E A;  2VDM A;  3DDU A;  4J79 A;  1JTD B;  1U8C A;  3QHY B;  1FWX A;  4DNW A;  2H47 A;  4JD2 C;  4NAA A;  3DSM A;  2CE8 A;  5EAM A;  2QZP A;  3DXM C;  3SMR A;  4BCB A;  4QT8 A;  3ZWL B;  4ERY A;  3ZDY A;  2IWF A;  1N6D A;  2XZG A;  3QI0 A;  1GOH A;  2AGL A;  3I7L A;  5TDH B;  4AOW A;  5M5T A;  3L4O D;  1QFS A;  5IT9 g;  1VZ3 A;  3J81 g;  4JSX C;  3RN0 D;  2IAA A;  3VI3 A;  2HKR A;  5CYK B;  4G56 B;  2B5M A;  4J86 A;  1QFM A;  4Y5R D;  4A09 A;  1JV2 A;  4QRJ A;  1JJU B;  4GMB A;  3SHF A;  3I7K A; 
#chains in the Genus database with same CATH homology
 3T3M A;  3ZDY A;  3ZDZ A;  3NIG A;  3K72 A;  5E6U A;  3VI4 A;  4WK2 A;  1M1X A;  4MMX A;  3FCS A;  4WK4 A;  2VC2 A;  4MMY A;  3FCU A;  3V4V A;  5E6S A;  4MMZ A;  4O02 A;  3V4P A;  4UM8 A;  4IRZ A;  3NID A;  5E6R A;  5HDB A;  3ZE1 A;  3ZDX A;  3ZE2 A;  3VI3 A;  1L5G A;  5FFO A;  2VDM A;  2VDR A;  3K6S A;  3ZE0 A;  5FFG A;  2VDQ A;  1U8C A;  2VDL A;  4WK0 A;  2VDN A;  4Z7O A;  4Z7Q A;  4UM9 A;  3K71 A;  2VDO A;  4G1E A;  1JV2 A;  3T3P A;  2VDK A;  4G1M A;  4Z7N A;  3NIF A;  2VDP A;  3IJE A;  4NEN A;  4WJK A;  1TYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...