2VDLA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdlA00
1L5GA 2VDPA 4UM9A 4MMXA 4Z7QA 2VC2A 2VDRA 4O02A 4NENA 5E6UA 4MMYA 3K6SA 3ZDYA 4IRZA 4G1MA 1TYEA 4Z7OA 4WK0A 4Z7NA 3VI3A 5HDBA 3NIDA 4G1EA 3T3PA 4WJKA 2VDNA 5E6RA 3VI4A 3T3MA 4WK4A 5E6SA 3ZDZA 4UM8A 1JV2A 2VDOA 3NIFA 5FFGA 3IJEA 3V4PA 3V4VA 4MMZA 2VDKA 3ZDXA 3ZE1A 1M1XA 3FCSA 4WK2A 2VDMA 3ZE0A 3FCUA 3NIGA 3K71A 2VDQA 1U8CA 5FFOA 3ZE2A 2VDLA 3K72A
chains in the Genus database with same CATH superfamily
1OMWB 5EMMB 3EI3B 5M5RA 1VZ3A 3SBPA 3O4IA 1TBGA 3GC3B 2AGWA 3DDUA 2Z2OA 2EICA 2QC5A 2YBAA 1SQJA 2H9MA 4MMYA 2H14A 4AOWA 3JZNA 2P9IC 1MG2A 3I7PA 5M5TA 4FA1D 3UVLA 5IJ8E 4JHPC 4JXMA 1JMZB 2VDOA 3EMHA 3RSEC 3ZDXA 4X3EA 3V9FA 2CO0A 1L0QA 3SLED 5IGQA 5CXCB 3NIGA 1O6FA 1OLZA 4H5IA 5FKSA 4HDJA 2IAAA 2I3SA 3K26A 4QQEA 3O4HA 2XDWA 2P9UC 1GOHA 4JSNC 3OKTA 2VC2A 3EQ7A 2VDRA 5E6UA 4BCBA 4CY5A 2P9PC 3JPXA 3VGZA 2MTAH 2WQ8A 3EQ9A 3I7LA 3ZDYA 2OVQB 2HU7A 2BBKH 4G56B 3NVXA 3MXXA 3I7OA 2G99A 2IURA 3RN1D 5IJ7E 3FCSA 4JD2C 3SHFA 5EARA 4ZOZA 2PM7B 4CC9A 3W15A 2XU7A 3RN0D 4O3TB 4J78A 4FB1D 1U8CA 2I0SA 3FM0A 5FFOA 5A2Qg 5C92A 3CFVA 4DNWA 4UM9A 4J82A 5KDOB 4L1QD 2PM9A 4O02A 5EALA 4QT8A 4QRJA 5C86A 2H9LA 1N6EA 5FKRA 4QL1A 5EMLB 2HU8A 3KRWB 1GOFA 5E6SA 4O9DA 4Y7RA 3F3GA 3ZE2A 1VYHC 3ZE1A 4FA4D 3IUQA 5CXBA 3KRXB 1H2WA 4Z8LA 1L5GA 1TYQC 2B5LA 3I89A 3PVUB 3IULA 4AEZA 4GGDA 3JZHA 3C9CA 3PXWD 2HJ4A 3T3PA 1Q47A 2YB8B 3T3MA 2BCJB 3ORVD 5H17A 2EIEA 3I8CA 4MMZA 3VH0A 4J81A 1H2XA 4Y5RD 3K71A 4KFMB 4U7AA 2B4EA 4AMZA 2I3TA 3C99A 4CI3A 1JTDB 5H1MA 2PBIB 3PXSD 4J0WA 2QXVA 1H2YA 3ODTA 4E54B 1N6FA 3OKWA 2EIBA 2OK4A 4GM8A 4JHNA 4BUJC 3MVDK 3UVOA 2I0RA 3C5MA 3JRPA 4PC0A 5HDBA 1PI6A 3RFHA 4NBMA 1UOPA 3VA6A 3AL8B 4J73A 1B9XA 1XHMA 3SJLD 3IJEA 2IWKA 2VDKA 3IIWA 4J77A 5TEEA 4O45A 4E5ZB 3SN6B 2B5MA 1XIPA 2J56H 4N14A 1R5MA 5EMKB 4D6VA 2J55H 1K8KC 3OKYB 2YNOA 5I5MA 1U2VC 4GGAA 4PSXB 2XL2A 4ERYA 2OVPB 3QHYB 5TF2A 1E8MA 4IRZA 1TYEA 2EIDA 4A08B 1PEVA 1UTCA 3OL2A 2VZ3A 4GM3A 3JB9L 2OK6A 4CY3A 3F3PA 2CN2A 4UI9R 4ZOVA 5HE1B 3V7DB 2Z2NA 5I5IA 4IA9A 5IC7A 4PBYA 4FHLA 5H14A 1YR2A 4O3UB 1SQ9A 5FKQA 3PXTD 4BCDA 4ZOYA 1E5TA 4J86A 4ERQA 3NVQA 3O4JA 4A2LA 3J81g 5EAPA 4PNKB 4BP9A 3I7NA 3JROA 4RE6A 3AL8A 4J87A 4A7JA 4GZ8A 4GM9A 4AN0A 2XZGA 3EI2A 5CYKA 2H6KA 1JV2A 5TEFA 3JZGA 4X61B 4E5ZA 2GC4A 5B4WA 2H9NA 4L3HD 3EI3A 4U1EI 3IJCA 1RI6A 3IUMA 2Q7QA 2XYIA 1SHYB 3CFSB 1K3IA 2AGYA 4GMBA 1UOOA 3UR4A 3A0FA 3N0DA 3RLMD 3BG1A 3IUJA 2VDNA 3EQ8A 5IGOA 2O9KA 3VI4A 5EAMA 5M61A 3ZDZA 3CIKB 4OWRA 2PM6B 3PSCB 5FFGA 4DNVA 2XL3A 3JAMg 4J0XA 4PSWB 3OW8A 3UVMA 3SXTD 3EI4B 5IT9g 3OKYA 5EMJB 1UOQA 5HQGA 1U4CA 1PGUA 1VE6A 4A0AA 3C75H 4NC4A 3RFGA 2HU5A 1XKSA 2P9NC 5AJAA 2YNPA 4LG8A 3SCYA 2YMUA 4L1MA 4I79A 2P9LC 4NAAA 5C2WB 2JKXA 3I8EA 5HE0B 4CY1A 1M1XA 4CI8A 1B9YA 5I5JA 3DXKC 3AFCA 5M5UA 4CI2A 3IJ1A 4TZ4A 3DXMC 4GQ1A 3SWSD 4A09B 3K72A 4IMMA 3U4YA 4G55A 4R7AB 4EWRA 3K27A 2G9AA 3AH8B 1S4UX 5M5VA 3SBQA 3DWLC 5FKTA 3F3FA 2UZYB 4WK0A 2GC7A 4XEIC 4O1QD 3NIDA 1A12A 2CNXA 4WJKA 4PXWA 3EI2B 1VZ2A 4FWWA 1BPOA 2IUVA 4A08A 4BL0A 2AH0A 4CZXA 3J80g 3HFQA 1GXRA 3IVMA 2H47A 1O6GA 3V5WB 2VZ1A 4BP8A 2QR5A 4QAMA 2VDPA 5C9ZB 5K1CC 3ULEC 3EI1B 3FGBA 4A0AB 4CZVA 5TDHB 4XYIA 2OJYA 5E6RA 3EU7A 2H6QA 3L4MD 2Z2PA 4WK4A 4A2MA 5GXIA 3DSMA 3BG0A 4LGNA 3V4PA 3SVWD 4J84A 2IUPA 2H68A 3AL9A 1C9IA 2H3XA 2H6NA 1JJUB 4X63B 3I7HA 1GP2B 3UVKA 4JT5C 2AQ5A 1NR0A 1A0RB 4Z7NA 2HKMA 2PM9B 3EWEA 3MZLA 2AGLA 4G1EA 4D9SA 4FAND 1MG3A 1JMXB 4UM8A 3V4VA 4DNUA 4AMYA 5THAA 5EM2A 3UKUC 3OTTA 2CO0C 2AH1A 4CY2A 4A09A 2HXCA 4XYHA 1FWXA 4NSXA 2OVRB 5AFU3 1T2XA 5GSAA 3EI4A 4JSXC 2XE4A 4FA5D 3MKQA 4G1MA 4ZOXA 2UZXB 3MUOA 4O2WA 4AN1A 5FLXg 5C2VB 3DM0A 1ERJA 5FQDA 1N6DA 3P4FA 2EBSA 4FAVD 4JSVC 3ZE0A 4K3JB 2OIZA 1E8NA 4ERZA 3OF7A 4CI1A 4J79A 3SBRA 3I2NA 4D0KA 3KCIA 4L3GD 1K32A 5M5SA 4ES0A 3MMYA 2IUQA 4BCCA 4JT6C 4K3ID 2GNQA 5HE2B 2AGZA 4A11A 2QZPA 4Z7OA 3BWSA 2CE9A 2HYEA 5CYKB 1NEXB 4E54A 3L4OD 5HYNB 2CN3A 4ESGA 1GOTB 3NIFA 2HESX 3GFCA 3QI0A 1JOFA 3PSLA 5EM2B 5CXCA 1MDAH 4A0BA 1YFQA 3UKRC 5GXHA 1QNIA 4CZYA 5SXMA 2VDLA 3IIYA 4GGCA 5GMKn 3MKSB 4GQBB 4MMXA 2YNNA 5AMSA 5FXYA 4FA9D 1QFSA 2AGXA 4YVDA 5FA5B 4X60B 3E0CA 3EI1A 3SMRA 3VI3A 2J57G 1C9LA 2IWFA 3EG6A 5HE3B 4J8BA 3RRMC 1QFMA 1PBYB 3OL2B 2P9SC 2H13A 1GG2B 4LG9A 2TRCB 2P9KC 2VDQA 3IJ0A 3NVNA 2BKLA 3RMZD 2W18A 4AX4A 4ZN4A 1I2MB 4MK0B 3GREA 3PVWB 4Z7QA 3N0EA 3IUNA 4NENA 4A11B 3K6SA 2I0TA 3PE7A 2H9PA 2HKRA 4JSPC 3ZWLB 3GD1I 3O4GA 4L9OA 3MUNA 4J8GA 1H2ZA 3SFZA 5K19A 2HJBA 2B5NA 3FRXA 4H5JA 4BH6A 3I7KA 3MZKA 1GOGA 1P22A 4WK2A 2VDMA 4PBZA 4A0BB 5CXBB 1VE7A 3FCUA 4RE5A 3IKOA 3IURA 4OZUA 4GQ2P 3UVNA 2CE8A 3B7FA 5JWZA
chains in the Genus database with same CATH topology
1L5GA 2VDPA 4UM9A 4MMXA 4Z7QA 2VC2A 2VDRA 4O02A 4NENA 5E6UA 4MMYA 3K6SA 3ZDYA 4IRZA 4G1MA 1TYEA 4Z7OA 4WK0A 4Z7NA 3VI3A 5HDBA 3NIDA 4G1EA 3T3PA 4WJKA 2VDNA 5E6RA 3VI4A 3T3MA 4WK4A 5E6SA 3ZDZA 4UM8A 1JV2A 2VDOA 3NIFA 5FFGA 3IJEA 3V4PA 3V4VA 4MMZA 2VDKA 3ZDXA 3ZE1A 1M1XA 3FCSA 4WK2A 2VDMA 3ZE0A 3FCUA 3NIGA 3K71A 2VDQA 1U8CA 5FFOA 3ZE2A 2VDLA 3K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5G A;  2VDP A;  4UM9 A;  4MMX A;  4Z7Q A;  2VC2 A;  2VDR A;  4O02 A;  4NEN A;  5E6U A;  4MMY A;  3K6S A;  3ZDY A;  4IRZ A;  4G1M A;  1TYE A;  4Z7O A;  4WK0 A;  4Z7N A;  3VI3 A;  5HDB A;  3NID A;  4G1E A;  3T3P A;  4WJK A;  2VDN A;  5E6R A;  3VI4 A;  3T3M A;  4WK4 A;  5E6S A;  3ZDZ A;  4UM8 A;  1JV2 A;  2VDO A;  3NIF A;  5FFG A;  3IJE A;  3V4P A;  3V4V A;  4MMZ A;  2VDK A;  3ZDX A;  3ZE1 A;  1M1X A;  3FCS A;  4WK2 A;  2VDM A;  3ZE0 A;  3FCU A;  3NIG A;  3K71 A;  2VDQ A;  1U8C A;  5FFO A;  3ZE2 A;  2VDL A;  3K72 A; 
#chains in the Genus database with same CATH topology
 1OMW B;  5EMM B;  3EI3 B;  5M5R A;  1VZ3 A;  3SBP A;  3O4I A;  1TBG A;  3GC3 B;  2AGW A;  3DDU A;  2Z2O A;  2EIC A;  2QC5 A;  2YBA A;  1SQJ A;  2H9M A;  4MMY A;  2H14 A;  4AOW A;  3JZN A;  2P9I C;  1MG2 A;  3I7P A;  5M5T A;  4FA1 D;  3UVL A;  5IJ8 E;  4JHP C;  4JXM A;  1JMZ B;  2VDO A;  3EMH A;  3RSE C;  3ZDX A;  4X3E A;  3V9F A;  2CO0 A;  1L0Q A;  3SLE D;  5IGQ A;  5CXC B;  3NIG A;  1O6F A;  1OLZ A;  4H5I A;  5FKS A;  4HDJ A;  2IAA A;  2I3S A;  3K26 A;  4QQE A;  3O4H A;  2XDW A;  2P9U C;  1GOH A;  4JSN C;  3OKT A;  2VC2 A;  3EQ7 A;  2VDR A;  5E6U A;  4BCB A;  4CY5 A;  2P9P C;  3JPX A;  3VGZ A;  2MTA H;  2WQ8 A;  3EQ9 A;  3I7L A;  3ZDY A;  2OVQ B;  2HU7 A;  2BBK H;  4G56 B;  3NVX A;  3MXX A;  3I7O A;  2G99 A;  2IUR A;  3RN1 D;  5IJ7 E;  3FCS A;  4JD2 C;  3SHF A;  5EAR A;  4ZOZ A;  2PM7 B;  4CC9 A;  3W15 A;  2XU7 A;  3RN0 D;  4O3T B;  4J78 A;  4FB1 D;  1U8C A;  2I0S A;  3FM0 A;  5FFO A;  5A2Q g;  5C92 A;  3CFV A;  4DNW A;  4UM9 A;  4J82 A;  5KDO B;  4L1Q D;  2PM9 A;  4O02 A;  5EAL A;  4QT8 A;  4QRJ A;  5C86 A;  2H9L A;  1N6E A;  5FKR A;  4QL1 A;  5EML B;  2HU8 A;  3KRW B;  1GOF A;  5E6S A;  4O9D A;  4Y7R A;  3F3G A;  3ZE2 A;  1VYH C;  3ZE1 A;  4FA4 D;  3IUQ A;  5CXB A;  3KRX B;  1H2W A;  4Z8L A;  1L5G A;  1TYQ C;  2B5L A;  3I89 A;  3PVU B;  3IUL A;  4AEZ A;  4GGD A;  3JZH A;  3C9C A;  3PXW D;  2HJ4 A;  3T3P A;  1Q47 A;  2YB8 B;  3T3M A;  2BCJ B;  3ORV D;  5H17 A;  2EIE A;  3I8C A;  4MMZ A;  3VH0 A;  4J81 A;  1H2X A;  4Y5R D;  3K71 A;  4KFM B;  4U7A A;  2B4E A;  4AMZ A;  2I3T A;  3C99 A;  4CI3 A;  1JTD B;  5H1M A;  2PBI B;  3PXS D;  4J0W A;  2QXV A;  1H2Y A;  3ODT A;  4E54 B;  1N6F A;  3OKW A;  2EIB A;  2OK4 A;  4GM8 A;  4JHN A;  4BUJ C;  3MVD K;  3UVO A;  2I0R A;  3C5M A;  3JRP A;  4PC0 A;  5HDB A;  1PI6 A;  3RFH A;  4NBM A;  1UOP A;  3VA6 A;  3AL8 B;  4J73 A;  1B9X A;  1XHM A;  3SJL D;  3IJE A;  2IWK A;  2VDK A;  3IIW A;  4J77 A;  5TEE A;  4O45 A;  4E5Z B;  3SN6 B;  2B5M A;  1XIP A;  2J56 H;  4N14 A;  1R5M A;  5EMK B;  4D6V A;  2J55 H;  1K8K C;  3OKY B;  2YNO A;  5I5M A;  1U2V C;  4GGA A;  4PSX B;  2XL2 A;  4ERY A;  2OVP B;  3QHY B;  5TF2 A;  1E8M A;  4IRZ A;  1TYE A;  2EID A;  4A08 B;  1PEV A;  1UTC A;  3OL2 A;  2VZ3 A;  4GM3 A;  3JB9 L;  2OK6 A;  4CY3 A;  3F3P A;  2CN2 A;  4UI9 R;  4ZOV A;  5HE1 B;  3V7D B;  2Z2N A;  5I5I A;  4IA9 A;  5IC7 A;  4PBY A;  4FHL A;  5H14 A;  1YR2 A;  4O3U B;  1SQ9 A;  5FKQ A;  3PXT D;  4BCD A;  4ZOY A;  1E5T A;  4J86 A;  4ERQ A;  3NVQ A;  3O4J A;  4A2L A;  3J81 g;  5EAP A;  4PNK B;  4BP9 A;  3I7N A;  3JRO A;  4RE6 A;  3AL8 A;  4J87 A;  4A7J A;  4GZ8 A;  4GM9 A;  4AN0 A;  2XZG A;  3EI2 A;  5CYK A;  2H6K A;  1JV2 A;  5TEF A;  3JZG A;  4X61 B;  4E5Z A;  2GC4 A;  5B4W A;  2H9N A;  4L3H D;  3EI3 A;  4U1E I;  3IJC A;  1RI6 A;  3IUM A;  2Q7Q A;  2XYI A;  1SHY B;  3CFS B;  1K3I A;  2AGY A;  4GMB A;  1UOO A;  3UR4 A;  3A0F A;  3N0D A;  3RLM D;  3BG1 A;  3IUJ A;  2VDN A;  3EQ8 A;  5IGO A;  2O9K A;  3VI4 A;  5EAM A;  5M61 A;  3ZDZ A;  3CIK B;  4OWR A;  2PM6 B;  3PSC B;  5FFG A;  4DNV A;  2XL3 A;  3JAM g;  4J0X A;  4PSW B;  3OW8 A;  3UVM A;  3SXT D;  3EI4 B;  5IT9 g;  3OKY A;  5EMJ B;  1UOQ A;  5HQG A;  1U4C A;  1PGU A;  1VE6 A;  4A0A A;  3C75 H;  4NC4 A;  3RFG A;  2HU5 A;  1XKS A;  2P9N C;  5AJA A;  2YNP A;  4LG8 A;  3SCY A;  2YMU A;  4L1M A;  4I79 A;  2P9L C;  4NAA A;  5C2W B;  2JKX A;  3I8E A;  5HE0 B;  4CY1 A;  1M1X A;  4CI8 A;  1B9Y A;  5I5J A;  3DXK C;  3AFC A;  5M5U A;  4CI2 A;  3IJ1 A;  4TZ4 A;  3DXM C;  4GQ1 A;  3SWS D;  4A09 B;  3K72 A;  4IMM A;  3U4Y A;  4G55 A;  4R7A B;  4EWR A;  3K27 A;  2G9A A;  3AH8 B;  1S4U X;  5M5V A;  3SBQ A;  3DWL C;  5FKT A;  3F3F A;  2UZY B;  4WK0 A;  2GC7 A;  4XEI C;  4O1Q D;  3NID A;  1A12 A;  2CNX A;  4WJK A;  4PXW A;  3EI2 B;  1VZ2 A;  4FWW A;  1BPO A;  2IUV A;  4A08 A;  4BL0 A;  2AH0 A;  4CZX A;  3J80 g;  3HFQ A;  1GXR A;  3IVM A;  2H47 A;  1O6G A;  3V5W B;  2VZ1 A;  4BP8 A;  2QR5 A;  4QAM A;  2VDP A;  5C9Z B;  5K1C C;  3ULE C;  3EI1 B;  3FGB A;  4A0A B;  4CZV A;  5TDH B;  4XYI A;  2OJY A;  5E6R A;  3EU7 A;  2H6Q A;  3L4M D;  2Z2P A;  4WK4 A;  4A2M A;  5GXI A;  3DSM A;  3BG0 A;  4LGN A;  3V4P A;  3SVW D;  4J84 A;  2IUP A;  2H68 A;  3AL9 A;  1C9I A;  2H3X A;  2H6N A;  1JJU B;  4X63 B;  3I7H A;  1GP2 B;  3UVK A;  4JT5 C;  2AQ5 A;  1NR0 A;  1A0R B;  4Z7N A;  2HKM A;  2PM9 B;  3EWE A;  3MZL A;  2AGL A;  4G1E A;  4D9S A;  4FAN D;  1MG3 A;  1JMX B;  4UM8 A;  3V4V A;  4DNU A;  4AMY A;  5THA A;  5EM2 A;  3UKU C;  3OTT A;  2CO0 C;  2AH1 A;  4CY2 A;  4A09 A;  2HXC A;  4XYH A;  1FWX A;  4NSX A;  2OVR B;  5AFU 3;  1T2X A;  5GSA A;  3EI4 A;  4JSX C;  2XE4 A;  4FA5 D;  3MKQ A;  4G1M A;  4ZOX A;  2UZX B;  3MUO A;  4O2W A;  4AN1 A;  5FLX g;  5C2V B;  3DM0 A;  1ERJ A;  5FQD A;  1N6D A;  3P4F A;  2EBS A;  4FAV D;  4JSV C;  3ZE0 A;  4K3J B;  2OIZ A;  1E8N A;  4ERZ A;  3OF7 A;  4CI1 A;  4J79 A;  3SBR A;  3I2N A;  4D0K A;  3KCI A;  4L3G D;  1K32 A;  5M5S A;  4ES0 A;  3MMY A;  2IUQ A;  4BCC A;  4JT6 C;  4K3I D;  2GNQ A;  5HE2 B;  2AGZ A;  4A11 A;  2QZP A;  4Z7O A;  3BWS A;  2CE9 A;  2HYE A;  5CYK B;  1NEX B;  4E54 A;  3L4O D;  5HYN B;  2CN3 A;  4ESG A;  1GOT B;  3NIF A;  2HES X;  3GFC A;  3QI0 A;  1JOF A;  3PSL A;  5EM2 B;  5CXC A;  1MDA H;  4A0B A;  1YFQ A;  3UKR C;  5GXH A;  1QNI A;  4CZY A;  5SXM A;  2VDL A;  3IIY A;  4GGC A;  5GMK n;  3MKS B;  4GQB B;  4MMX A;  2YNN A;  5AMS A;  5FXY A;  4FA9 D;  1QFS A;  2AGX A;  4YVD A;  5FA5 B;  4X60 B;  3E0C A;  3EI1 A;  3SMR A;  3VI3 A;  2J57 G;  1C9L A;  2IWF A;  3EG6 A;  5HE3 B;  4J8B A;  3RRM C;  1QFM A;  1PBY B;  3OL2 B;  2P9S C;  2H13 A;  1GG2 B;  4LG9 A;  2TRC B;  2P9K C;  2VDQ A;  3IJ0 A;  3NVN A;  2BKL A;  3RMZ D;  2W18 A;  4AX4 A;  4ZN4 A;  1I2M B;  4MK0 B;  3GRE A;  3PVW B;  4Z7Q A;  3N0E A;  3IUN A;  4NEN A;  4A11 B;  3K6S A;  2I0T A;  3PE7 A;  2H9P A;  2HKR A;  4JSP C;  3ZWL B;  3GD1 I;  3O4G A;  4L9O A;  3MUN A;  4J8G A;  1H2Z A;  3SFZ A;  5K19 A;  2HJB A;  2B5N A;  3FRX A;  4H5J A;  4BH6 A;  3I7K A;  3MZK A;  1GOG A;  1P22 A;  4WK2 A;  2VDM A;  4PBZ A;  4A0B B;  5CXB B;  1VE7 A;  3FCU A;  4RE5 A;  3IKO A;  3IUR A;  4OZU A;  4GQ2 P;  3UVN A;  2CE8 A;  3B7F A;  5JWZ A; 
#chains in the Genus database with same CATH homology
 1L5G A;  2VDP A;  4UM9 A;  4MMX A;  4Z7Q A;  2VC2 A;  2VDR A;  4O02 A;  4NEN A;  5E6U A;  4MMY A;  3K6S A;  3ZDY A;  4IRZ A;  4G1M A;  1TYE A;  4Z7O A;  4WK0 A;  4Z7N A;  3VI3 A;  5HDB A;  3NID A;  4G1E A;  3T3P A;  4WJK A;  2VDN A;  5E6R A;  3VI4 A;  3T3M A;  4WK4 A;  5E6S A;  3ZDZ A;  4UM8 A;  1JV2 A;  2VDO A;  3NIF A;  5FFG A;  3IJE A;  3V4P A;  3V4V A;  4MMZ A;  2VDK A;  3ZDX A;  3ZE1 A;  1M1X A;  3FCS A;  4WK2 A;  2VDM A;  3ZE0 A;  3FCU A;  3NIG A;  3K71 A;  2VDQ A;  1U8C A;  5FFO A;  3ZE2 A;  2VDL A;  3K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...