2VDLA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdlA00
2VDKA 4MMXA 3V4PA 3ZE2A 1JV2A 5FFGA 4Z7QA 3ZDYA 2VDMA 4UM9A 3FCUA 5E6SA 3VI3A 3FCSA 3ZDZA 3K71A 4G1EA 2VDPA 5E6RA 3K6SA 3T3PA 3T3MA 4NENA 4Z7OA 2VDLA 4O02A 4MMYA 4UM8A 3ZE0A 3IJEA 4WJKA 2VC2A 5HDBA 4MMZA 3ZDXA 3NIFA 4G1MA 4WK0A 4WK2A 3NIGA 5FFOA 3ZE1A 4Z7NA 4WK4A 3K72A 2VDRA 2VDOA 2VDNA 3VI4A 5E6UA 3NIDA 4IRZA 1TYEA 1M1XA 1L5GA 2VDQA 3V4VA 1U8CA
chains in the Genus database with same CATH superfamily
5EM2A 3IVMA 3SLED 2BCJB 2PBIB 2YB8B 4UM9A 2OIZA 4QL1A 1GOFA 2QR5A 3DSMA 4G1EA 2H3XA 1NEXB 3O4GA 4PSXB 4Z7OA 3HFQA 4D9SA 2AGXA 1GOGA 3I7KA 3PSLA 4FA4D 5K19A 2VC2A 4NBMA 3VA6A 3I7OA 3UVOA 3RSEC 4AOWA 1SHYB 3ULEC 4E5ZA 4YVDA 5H17A 3C5MA 2H6NA 5H14A 5IGQA 4NSXA 1VE7A 5K1CC 1TYEA 1L5GA 2EICA 4U7AA 1U8CA 3ZE2A 4CI2A 5JWZA 4E54B 5FXYA 2UZYB 2I0RA 3I2NA 3VI3A 1N6DA 4CY3A 5B4WA 5IC7A 4JT6C 3PXTD 5HDBA 4MK0B 2PM9A 4MMZA 1R5MA 3E0CA 4JSPC 1VE6A 4IA9A 3AL9A 4K3JB 3C75H 3EU7A 3RFGA 4J0WA 5M5TA 3ZWLB 4J73A 4O2WA 2OVRB 4PXWA 4OWRA 4A2LA 2I3SA 5HQGA 3DWLC 4PNKB 4GMBA 3MUNA 4GM3A 3AH8B 1JJUB 5IJ8E 3IJ0A 3ORVD 4GQ1A 4Y7RA 1H2XA 3OKTA 3J81g 1C9IA 3IIYA 3V5WB 4ERYA 2HU5A 5AMSA 3IUNA 4FA5D 3NIGA 1GOTB 2P9SC 5E6UA 5HE0B 2CO0A 1ERJA 3UVLA 4BCDA 1XIPA 1JTDB 4Z7QA 5EM2B 2XDWA 4E54A 5E6SA 1MDAH 4I79A 4J82A 4PBZA 2OK4A 3O4JA 3EG6A 2MTAH 3OW8A 1JOFA 2HJ4A 4DNUA 4GM8A 3SVWD 2J56H 4A0AA 5C86A 3OF7A 3RN0D 5TEEA 3PVUB 1JMZB 3SMRA 3DDUA 4E5ZB 5FFOA 4XYHA 3FGBA 4PSWB 3MKSB 2VDOA 2VZ1A 1YR2A 1U2VC 4EWRA 4FB1D 5FLXg 4IMMA 5FKTA 3IJCA 4ZOVA 4CY2A 1U4CA 3IURA 3V4PA 2H9PA 4J8GA 4TZ4A 2QZPA 3SBPA 1QNIA 4J77A 4J84A 3SXTD 4PC0A 1H2ZA 4O3UB 2P9IC 2CE9A 4FHLA 4GQBB 3PXSD 4BCCA 3NVQA 3UVMA 3IJEA 3MVDK 3N0DA 2PM9B 3ZDXA 4GGAA 3PE7A 3K27A 5H1MA 5AFU3 4GZ8A 2O9KA 2TRCB 4A7JA 3K72A 2YNNA 3BWSA 2I0TA 3C99A 1M1XA 5AJAA 1SQJA 3C9CA 3RN1D 3MUOA 2CN3A 5KDOB 4JHPC 1O6GA 2XYIA 5EMKB 4A08A 1OMWB 2Z2NA 1GOHA 1UOQA 2HESX 3FM0A 1L0QA 3F3FA 2BKLA 5FA5B 2IAAA 2J57G 1PI6A 4DNVA 1N6FA 1XKSA 3V7DB 4WK2A 2Z2OA 3OKYA 1GXRA 4Z7NA 5I5IA 1K3IA 2B5LA 3EI2B 4LGNA 4R7AB 5M5SA 2OJYA 4PBYA 3UR4A 4DNWA 1VZ3A 3I7LA 5IGOA 1TBGA 5CXBB 3JZGA 2IURA 2P9UC 3PSCB 4GGDA 4UM8A 4J87A 4AMYA 3OTTA 4GGCA 4A0AB 1A12A 3MMYA 5IT9g 4X60B 4D0KA 5M61A 1VZ2A 4O3TB 4ES0A 1FWXA 4O9DA 1MG3A 1QFSA 3V4VA 4A0BB 4XYIA 4CC9A 4ZN4A 1JV2A 2GC4A 2B4EA 2VDMA 2YNPA 3EMHA 2H13A 3IULA 1S4UX 3JZNA 3UVNA 3B7FA 4NENA 3A0FA 3KRXB 3CIKB 3SN6B 2CO0C 3ZE0A 1OLZA 3UKRC 5EMJB 5CXCB 4L3HD 3GREA 3NIFA 3SHFA 4WK0A 3SBQA 4QT8A 1H2YA 3FRXA 2HYEA 3CFVA 4Z8LA 4X63B 3IIWA 4J86A 3O4IA 1GP2B 4WK4A 4GM9A 3SWSD 4J81A 3EI2A 5TDHB 2XL2A 4JXMA 3SJLD 3F3PA 4RE6A 2VDQA 2HU8A 2H6KA 3RFHA 3MZLA 5M5VA 1I2MB 4J78A 4A08B 4KFMB 2VDPA 1K8KC 3RLMD 1E8MA 2CNXA 3IUMA 5CXBA 2XU7A 2OK6A 1O6FA 4ESGA 5HE1B 2IWFA 3EWEA 4FA9D 2BBKH 3GFCA 3OKYB 3EQ8A 1PBYB 3K26A 3I7HA 4IRZA 3F3GA 2OVQB 4A0BA 5EMMB 3QHYB 3MXXA 5GSAA 4HDJA 4NAAA 3EI1A 3ZDZA 2AH1A 3T3PA 2P9PC 4RE5A 5HE3B 2EIEA 3BG0A 5FKRA 3OL2A 5FKSA 1B9XA 1B9YA 2H9NA 2HJBA 2J55H 2YBAA 4G56B 1UOOA 1NR0A 3MKQA 1RI6A 5CYKB 5CXCA 5I5MA 1P22A 4N14A 4J8BA 3BG1A 3IKOA 4O45A 5HE2B 5TEFA 3J80g 4ZOYA 3N0EA 4G55A 5C92A 3JZHA 4AMZA 4U1EI 2YNOA 1UTCA 3JAMg 2VDKA 4GQ2P 1SQ9A 5EAPA 3JPXA 2IUPA 3FCUA 3NVXA 3I8CA 3SFZA 4FA1D 3ODTA 2IUVA 3NVNA 5E6RA 3K6SA 3QI0A 4CZYA 4CY1A 2AGZA 4CZVA 3GD1I 3KCIA 1TYQC 2AQ5A 2QC5A 4BCBA 2GNQA 2H6QA 4A11B 1T2XA 3VI4A 3PXWD 3I7NA 1PEVA 3MZKA 1H2WA 5EALA 2EBSA 2HKRA 3SCYA 4MMXA 2XZGA 5FFGA 2XE4A 4AN1A 4QRJA 4A09A 1UOPA 2GC7A 5THAA 3UVKA 2AGYA 1XHMA 4JSNC 3T3MA 4AX4A 4O02A 3EQ9A 3AFCA 4MMYA 4JSXC 4QQEA 4WJKA 2G99A 5GMKn 4QAMA 4BUJC 3CFSB 5CYKA 3GC3B 3UKUC 5M5RA 4L9OA 4K3ID 2CE8A 3EQ7A 3AL8B 4J79A 3L4MD 1E8NA 5A2Qg 3I8EA 3O4HA 2H9MA 1C9LA 2VZ3A 2H68A 2AGLA 3ZDYA 4L3GD 2PM6B 5IJ7E 1YFQA 3EI1B 3DXMC 4CI3A 1GG2B 4BP9A 4LG8A 3OL2B 4CI8A 4FWWA 5EMLB 4AN0A 4H5IA 2QXVA 4A11A 4JD2C 4AEZA 4UI9R 2HKMA 4X61B 3P4FA 4H5JA 5EARA 3VH0A 5C2WB 2HXCA 2VDNA 4O1QD 3PVWB 4CZXA 4LG9A 2EIDA 3FCSA 2Q7QA 4CI1A 3JROA 3EI3B 3DM0A 2G9AA 2OVPB 3U4YA 5FKQA 4ZOXA 3OKWA 2W18A 3V9FA 3KRWB 2Z2PA 2H9LA 4JSVC 4ERZA 2AGWA 2VDRA 3AL8A 4JT5C 3EI4B 5FQDA 3VGZA 2PM7B 2B5MA 4JHNA 2P9KC 5HYNB 5M5UA 4X3EA 4A09B 2P9NC 3JB9L 2UZXB 3I7PA 3JRPA 3SBRA 2AH0A 3I89A 4BP8A 2I0SA 2YMUA 4A2MA 1E5TA 1MG2A 3IUQA 1JMXB 2H14A 3IJ1A 1N6EA 1Q47A 4CY5A 2EIBA 1A0RB 2B5NA 2HU7A 3W15A 4G1MA 4J0XA 5GXIA 2H47A 3ZE1A 4XEIC 1PGUA 2P9LC 4BL0A 4L1QD 3IUJA 4NC4A 4FAND 1VYHC 3DXKC 5TF2A 4ZOZA 1K32A 3K71A 2XL3A 2CN2A 3EI3A 5EAMA 2VDLA 2IUQA 4D6VA 2JKXA 5GXHA 5SXMA 4Y5RD 1BPOA 2WQ8A 4ERQA 5I5JA 3L4OD 5C9ZB 4L1MA 4OZUA 3RMZD 3RRMC 4FAVD 3NIDA 4BH6A 1QFMA 3EI4A 2I3TA 5C2VB 2IWKA
chains in the Genus database with same CATH topology
2VDKA 4MMXA 3V4PA 3ZE2A 1JV2A 5FFGA 4Z7QA 3ZDYA 2VDMA 4UM9A 3FCUA 5E6SA 3VI3A 3FCSA 3ZDZA 3K71A 4G1EA 2VDPA 5E6RA 3K6SA 3T3PA 3T3MA 4NENA 4Z7OA 2VDLA 4O02A 4MMYA 4UM8A 3ZE0A 3IJEA 4WJKA 2VC2A 5HDBA 4MMZA 3ZDXA 3NIFA 4G1MA 4WK0A 4WK2A 3NIGA 5FFOA 3ZE1A 4Z7NA 4WK4A 3K72A 2VDRA 2VDOA 2VDNA 3VI4A 5E6UA 3NIDA 4IRZA 1TYEA 1M1XA 1L5GA 2VDQA 3V4VA 1U8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDK A;  4MMX A;  3V4P A;  3ZE2 A;  1JV2 A;  5FFG A;  4Z7Q A;  3ZDY A;  2VDM A;  4UM9 A;  3FCU A;  5E6S A;  3VI3 A;  3FCS A;  3ZDZ A;  3K71 A;  4G1E A;  2VDP A;  5E6R A;  3K6S A;  3T3P A;  3T3M A;  4NEN A;  4Z7O A;  2VDL A;  4O02 A;  4MMY A;  4UM8 A;  3ZE0 A;  3IJE A;  4WJK A;  2VC2 A;  5HDB A;  4MMZ A;  3ZDX A;  3NIF A;  4G1M A;  4WK0 A;  4WK2 A;  3NIG A;  5FFO A;  3ZE1 A;  4Z7N A;  4WK4 A;  3K72 A;  2VDR A;  2VDO A;  2VDN A;  3VI4 A;  5E6U A;  3NID A;  4IRZ A;  1TYE A;  1M1X A;  1L5G A;  2VDQ A;  3V4V A;  1U8C A; 
#chains in the Genus database with same CATH topology
 5EM2 A;  3IVM A;  3SLE D;  2BCJ B;  2PBI B;  2YB8 B;  4UM9 A;  2OIZ A;  4QL1 A;  1GOF A;  2QR5 A;  3DSM A;  4G1E A;  2H3X A;  1NEX B;  3O4G A;  4PSX B;  4Z7O A;  3HFQ A;  4D9S A;  2AGX A;  1GOG A;  3I7K A;  3PSL A;  4FA4 D;  5K19 A;  2VC2 A;  4NBM A;  3VA6 A;  3I7O A;  3UVO A;  3RSE C;  4AOW A;  1SHY B;  3ULE C;  4E5Z A;  4YVD A;  5H17 A;  3C5M A;  2H6N A;  5H14 A;  5IGQ A;  4NSX A;  1VE7 A;  5K1C C;  1TYE A;  1L5G A;  2EIC A;  4U7A A;  1U8C A;  3ZE2 A;  4CI2 A;  5JWZ A;  4E54 B;  5FXY A;  2UZY B;  2I0R A;  3I2N A;  3VI3 A;  1N6D A;  4CY3 A;  5B4W A;  5IC7 A;  4JT6 C;  3PXT D;  5HDB A;  4MK0 B;  2PM9 A;  4MMZ A;  1R5M A;  3E0C A;  4JSP C;  1VE6 A;  4IA9 A;  3AL9 A;  4K3J B;  3C75 H;  3EU7 A;  3RFG A;  4J0W A;  5M5T A;  3ZWL B;  4J73 A;  4O2W A;  2OVR B;  4PXW A;  4OWR A;  4A2L A;  2I3S A;  5HQG A;  3DWL C;  4PNK B;  4GMB A;  3MUN A;  4GM3 A;  3AH8 B;  1JJU B;  5IJ8 E;  3IJ0 A;  3ORV D;  4GQ1 A;  4Y7R A;  1H2X A;  3OKT A;  3J81 g;  1C9I A;  3IIY A;  3V5W B;  4ERY A;  2HU5 A;  5AMS A;  3IUN A;  4FA5 D;  3NIG A;  1GOT B;  2P9S C;  5E6U A;  5HE0 B;  2CO0 A;  1ERJ A;  3UVL A;  4BCD A;  1XIP A;  1JTD B;  4Z7Q A;  5EM2 B;  2XDW A;  4E54 A;  5E6S A;  1MDA H;  4I79 A;  4J82 A;  4PBZ A;  2OK4 A;  3O4J A;  3EG6 A;  2MTA H;  3OW8 A;  1JOF A;  2HJ4 A;  4DNU A;  4GM8 A;  3SVW D;  2J56 H;  4A0A A;  5C86 A;  3OF7 A;  3RN0 D;  5TEE A;  3PVU B;  1JMZ B;  3SMR A;  3DDU A;  4E5Z B;  5FFO A;  4XYH A;  3FGB A;  4PSW B;  3MKS B;  2VDO A;  2VZ1 A;  1YR2 A;  1U2V C;  4EWR A;  4FB1 D;  5FLX g;  4IMM A;  5FKT A;  3IJC A;  4ZOV A;  4CY2 A;  1U4C A;  3IUR A;  3V4P A;  2H9P A;  4J8G A;  4TZ4 A;  2QZP A;  3SBP A;  1QNI A;  4J77 A;  4J84 A;  3SXT D;  4PC0 A;  1H2Z A;  4O3U B;  2P9I C;  2CE9 A;  4FHL A;  4GQB B;  3PXS D;  4BCC A;  3NVQ A;  3UVM A;  3IJE A;  3MVD K;  3N0D A;  2PM9 B;  3ZDX A;  4GGA A;  3PE7 A;  3K27 A;  5H1M A;  5AFU 3;  4GZ8 A;  2O9K A;  2TRC B;  4A7J A;  3K72 A;  2YNN A;  3BWS A;  2I0T A;  3C99 A;  1M1X A;  5AJA A;  1SQJ A;  3C9C A;  3RN1 D;  3MUO A;  2CN3 A;  5KDO B;  4JHP C;  1O6G A;  2XYI A;  5EMK B;  4A08 A;  1OMW B;  2Z2N A;  1GOH A;  1UOQ A;  2HES X;  3FM0 A;  1L0Q A;  3F3F A;  2BKL A;  5FA5 B;  2IAA A;  2J57 G;  1PI6 A;  4DNV A;  1N6F A;  1XKS A;  3V7D B;  4WK2 A;  2Z2O A;  3OKY A;  1GXR A;  4Z7N A;  5I5I A;  1K3I A;  2B5L A;  3EI2 B;  4LGN A;  4R7A B;  5M5S A;  2OJY A;  4PBY A;  3UR4 A;  4DNW A;  1VZ3 A;  3I7L A;  5IGO A;  1TBG A;  5CXB B;  3JZG A;  2IUR A;  2P9U C;  3PSC B;  4GGD A;  4UM8 A;  4J87 A;  4AMY A;  3OTT A;  4GGC A;  4A0A B;  1A12 A;  3MMY A;  5IT9 g;  4X60 B;  4D0K A;  5M61 A;  1VZ2 A;  4O3T B;  4ES0 A;  1FWX A;  4O9D A;  1MG3 A;  1QFS A;  3V4V A;  4A0B B;  4XYI A;  4CC9 A;  4ZN4 A;  1JV2 A;  2GC4 A;  2B4E A;  2VDM A;  2YNP A;  3EMH A;  2H13 A;  3IUL A;  1S4U X;  3JZN A;  3UVN A;  3B7F A;  4NEN A;  3A0F A;  3KRX B;  3CIK B;  3SN6 B;  2CO0 C;  3ZE0 A;  1OLZ A;  3UKR C;  5EMJ B;  5CXC B;  4L3H D;  3GRE A;  3NIF A;  3SHF A;  4WK0 A;  3SBQ A;  4QT8 A;  1H2Y A;  3FRX A;  2HYE A;  3CFV A;  4Z8L A;  4X63 B;  3IIW A;  4J86 A;  3O4I A;  1GP2 B;  4WK4 A;  4GM9 A;  3SWS D;  4J81 A;  3EI2 A;  5TDH B;  2XL2 A;  4JXM A;  3SJL D;  3F3P A;  4RE6 A;  2VDQ A;  2HU8 A;  2H6K A;  3RFH A;  3MZL A;  5M5V A;  1I2M B;  4J78 A;  4A08 B;  4KFM B;  2VDP A;  1K8K C;  3RLM D;  1E8M A;  2CNX A;  3IUM A;  5CXB A;  2XU7 A;  2OK6 A;  1O6F A;  4ESG A;  5HE1 B;  2IWF A;  3EWE A;  4FA9 D;  2BBK H;  3GFC A;  3OKY B;  3EQ8 A;  1PBY B;  3K26 A;  3I7H A;  4IRZ A;  3F3G A;  2OVQ B;  4A0B A;  5EMM B;  3QHY B;  3MXX A;  5GSA A;  4HDJ A;  4NAA A;  3EI1 A;  3ZDZ A;  2AH1 A;  3T3P A;  2P9P C;  4RE5 A;  5HE3 B;  2EIE A;  3BG0 A;  5FKR A;  3OL2 A;  5FKS A;  1B9X A;  1B9Y A;  2H9N A;  2HJB A;  2J55 H;  2YBA A;  4G56 B;  1UOO A;  1NR0 A;  3MKQ A;  1RI6 A;  5CYK B;  5CXC A;  5I5M A;  1P22 A;  4N14 A;  4J8B A;  3BG1 A;  3IKO A;  4O45 A;  5HE2 B;  5TEF A;  3J80 g;  4ZOY A;  3N0E A;  4G55 A;  5C92 A;  3JZH A;  4AMZ A;  4U1E I;  2YNO A;  1UTC A;  3JAM g;  2VDK A;  4GQ2 P;  1SQ9 A;  5EAP A;  3JPX A;  2IUP A;  3FCU A;  3NVX A;  3I8C A;  3SFZ A;  4FA1 D;  3ODT A;  2IUV A;  3NVN A;  5E6R A;  3K6S A;  3QI0 A;  4CZY A;  4CY1 A;  2AGZ A;  4CZV A;  3GD1 I;  3KCI A;  1TYQ C;  2AQ5 A;  2QC5 A;  4BCB A;  2GNQ A;  2H6Q A;  4A11 B;  1T2X A;  3VI4 A;  3PXW D;  3I7N A;  1PEV A;  3MZK A;  1H2W A;  5EAL A;  2EBS A;  2HKR A;  3SCY A;  4MMX A;  2XZG A;  5FFG A;  2XE4 A;  4AN1 A;  4QRJ A;  4A09 A;  1UOP A;  2GC7 A;  5THA A;  3UVK A;  2AGY A;  1XHM A;  4JSN C;  3T3M A;  4AX4 A;  4O02 A;  3EQ9 A;  3AFC A;  4MMY A;  4JSX C;  4QQE A;  4WJK A;  2G99 A;  5GMK n;  4QAM A;  4BUJ C;  3CFS B;  5CYK A;  3GC3 B;  3UKU C;  5M5R A;  4L9O A;  4K3I D;  2CE8 A;  3EQ7 A;  3AL8 B;  4J79 A;  3L4M D;  1E8N A;  5A2Q g;  3I8E A;  3O4H A;  2H9M A;  1C9L A;  2VZ3 A;  2H68 A;  2AGL A;  3ZDY A;  4L3G D;  2PM6 B;  5IJ7 E;  1YFQ A;  3EI1 B;  3DXM C;  4CI3 A;  1GG2 B;  4BP9 A;  4LG8 A;  3OL2 B;  4CI8 A;  4FWW A;  5EML B;  4AN0 A;  4H5I A;  2QXV A;  4A11 A;  4JD2 C;  4AEZ A;  4UI9 R;  2HKM A;  4X61 B;  3P4F A;  4H5J A;  5EAR A;  3VH0 A;  5C2W B;  2HXC A;  2VDN A;  4O1Q D;  3PVW B;  4CZX A;  4LG9 A;  2EID A;  3FCS A;  2Q7Q A;  4CI1 A;  3JRO A;  3EI3 B;  3DM0 A;  2G9A A;  2OVP B;  3U4Y A;  5FKQ A;  4ZOX A;  3OKW A;  2W18 A;  3V9F A;  3KRW B;  2Z2P A;  2H9L A;  4JSV C;  4ERZ A;  2AGW A;  2VDR A;  3AL8 A;  4JT5 C;  3EI4 B;  5FQD A;  3VGZ A;  2PM7 B;  2B5M A;  4JHN A;  2P9K C;  5HYN B;  5M5U A;  4X3E A;  4A09 B;  2P9N C;  3JB9 L;  2UZX B;  3I7P A;  3JRP A;  3SBR A;  2AH0 A;  3I89 A;  4BP8 A;  2I0S A;  2YMU A;  4A2M A;  1E5T A;  1MG2 A;  3IUQ A;  1JMX B;  2H14 A;  3IJ1 A;  1N6E A;  1Q47 A;  4CY5 A;  2EIB A;  1A0R B;  2B5N A;  2HU7 A;  3W15 A;  4G1M A;  4J0X A;  5GXI A;  2H47 A;  3ZE1 A;  4XEI C;  1PGU A;  2P9L C;  4BL0 A;  4L1Q D;  3IUJ A;  4NC4 A;  4FAN D;  1VYH C;  3DXK C;  5TF2 A;  4ZOZ A;  1K32 A;  3K71 A;  2XL3 A;  2CN2 A;  3EI3 A;  5EAM A;  2VDL A;  2IUQ A;  4D6V A;  2JKX A;  5GXH A;  5SXM A;  4Y5R D;  1BPO A;  2WQ8 A;  4ERQ A;  5I5J A;  3L4O D;  5C9Z B;  4L1M A;  4OZU A;  3RMZ D;  3RRM C;  4FAV D;  3NID A;  4BH6 A;  1QFM A;  3EI4 A;  2I3T A;  5C2V B;  2IWK A; 
#chains in the Genus database with same CATH homology
 2VDK A;  4MMX A;  3V4P A;  3ZE2 A;  1JV2 A;  5FFG A;  4Z7Q A;  3ZDY A;  2VDM A;  4UM9 A;  3FCU A;  5E6S A;  3VI3 A;  3FCS A;  3ZDZ A;  3K71 A;  4G1E A;  2VDP A;  5E6R A;  3K6S A;  3T3P A;  3T3M A;  4NEN A;  4Z7O A;  2VDL A;  4O02 A;  4MMY A;  4UM8 A;  3ZE0 A;  3IJE A;  4WJK A;  2VC2 A;  5HDB A;  4MMZ A;  3ZDX A;  3NIF A;  4G1M A;  4WK0 A;  4WK2 A;  3NIG A;  5FFO A;  3ZE1 A;  4Z7N A;  4WK4 A;  3K72 A;  2VDR A;  2VDO A;  2VDN A;  3VI4 A;  5E6U A;  3NID A;  4IRZ A;  1TYE A;  1M1X A;  1L5G A;  2VDQ A;  3V4V A;  1U8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...