2VDLA

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 108
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdlA00
5FFOA 4WJKA 5E6SA 3FCSA 3ZDZA 3T3MA 3ZE1A 3NIGA 4MMYA 1U8CA 3IJEA 4NENA 4O02A 3V4PA 2VDOA 3ZDXA 5HDBA 4MMXA 2VDLA 4MMZA 4UM8A 5E6RA 3T3PA 5FFGA 3VI4A 4G1EA 3ZE2A 3NIFA 2VDNA 4Z7OA 2VDRA 4Z7NA 4Z7QA 2VDQA 1M1XA 2VDMA 4WK2A 3K71A 3K6SA 3V4VA 4WK0A 4IRZA 2VDPA 1JV2A 2VDKA 3VI3A 3FCUA 3ZDYA 3K72A 3NIDA 5E6UA 1L5GA 4G1MA 4UM9A 3ZE0A 1TYEA 4WK4A 2VC2A
chains in the Genus database with same CATH superfamily
3F3GA 3I7NA 3JPXA 4J0WA 5B4WA 3UVKA 4ESGA 3I7HA 3MZKA 4A0BA 4ZOYA 2BKLA 3O4JA 4X63B 1T2XA 2EIBA 5CXBA 1E8NA 3N0EA 3EI2A 2EICA 3VI4A 5M5VA 1U2VC 3JB9L 5FA5B 2XL3A 2PM6B 3C99A 1K8KC 5I5MA 4Z7QA 2OIZA 4DNVA 2VDMA 3SN6B 5M5TA 3EI4B 5K1CC 1QFMA 3OKWA 3V5WB 4WJKA 2OVQB 5TDHB 4PXWA 2H68A 2AGWA 4GM8A 4MK0B 5HE1B 4PNKB 3ZE1A 4AMYA 3EQ7A 3BG0A 2AGZA 5CYKB 3GREA 2CNXA 5K19A 2XZGA 4Z7NA 4D6VA 2VDQA 4ERYA 4A11B 3CIKB 1NR0A 1XKSA 5EAMA 4K3ID 4IA9A 4GGAA 3ZE0A 4D9SA 1OMWB 2GNQA 3C5MA 5EMJB 5FKSA 5H1MA 3SVWD 3OKYA 4G56B 4N14A 4Z8LA 3MVDK 2HKMA 1PI6A 3PSLA 2O9KA 2IURA 3OL2B 4AEZA 1GOHA 4A0AA 2QR5A 3CFVA 5GXIA 4A08B 4R7AB 5EM2B 3EI4A 1ERJA 3AFCA 4HDJA 4FA4D 2H6QA 2H9MA 2VZ1A 4J77A 5TEEA 4L3HD 2HU5A 2G99A 4PSXB 4LG9A 4ZOVA 2P9LC 4JSXC 3KRXB 4PBZA 2HJ4A 1TBGA 5FQDA 5HQGA 3UVNA 5IGOA 1VZ2A 4FWWA 4MMXA 3W15A 1YFQA 3IUMA 4G1EA 4GQ1A 3UKRC 2I0SA 4A11A 5CXBB 2CN2A 5TEFA 1OLZA 1GOTB 2WQ8A 2YMUA 2AH0A 1PBYB 2JKXA 5C86A 3MKSB 3V4VA 3L4MD 4FAVD 2OVRB 3GC3B 2XDWA 4UM9A 4IRZA 4WK4A 1QNIA 3ULEC 5GXHA 4RE6A 4CY5A 1N6DA 4AN0A 3OL2A 2TRCB 3L4OD 2AGYA 5I5JA 3JROA 3SCYA 2H47A 5I5IA 4A08A 2VDOA 1H2YA 4KFMB 4GQBB 3O4GA 4BP9A 4U7AA 4CI2A 3SBRA 4YVDA 5CXCB 3GFCA 5E6UA 3IIYA 4I79A 2I3TA 3IUQA 4CY1A 5A2Qg 1A12A 5HE2B 3IJ0A 1TYQC 2HYEA 4CZXA 3ZDZA 2YNPA 4J73A 1C9LA 1BPOA 3OKYB 2B5MA 1U8CA 1VZ3A 3IURA 4PSWB 1MDAH 5EALA 1O6FA 1N6FA 2YNNA 3NIFA 4A0AB 1E5TA 5HE3B 1JTDB 2J56H 5EMLB 3EI1B 3J80g 5EARA 2IUQA 3I7PA 1Q47A 4BCCA 4A09A 3IJCA 2VDKA 3VA6A 2YB8B 3HFQA 4NC4A 4G1MA 2P9KC 2G9AA 3SBQA 3N0DA 3I8EA 1N6EA 4ERQA 2OJYA 3FRXA 4H5IA 5SXMA 1XIPA 4J8GA 3SBPA 5C2WB 5M5SA 4BCDA 4JSVC 4J8BA 4NENA 1PGUA 3ZDXA 2AH1A 5HYNB 4A2LA 2P9SC 2YBAA 2HESX 4ZN4A 1H2WA 3O4HA 3PXSD 5C2VB 4UI9R 4X3EA 3EU7A 5CXCA 1L0QA 1GXRA 2QC5A 4ZOXA 5KDOB 3SLED 4GMBA 1MG2A 4FAND 1L5GA 2Z2OA 4DNWA 4GM3A 3RFHA 2VC2A 3SHFA 3EWEA 1P22A 3ODTA 3PXWD 4JT5C 3PE7A 4TZ4A 3MZLA 4GGDA 3AH8B 2HU8A 4AOWA 2IUPA 3U4YA 4EWRA 1GOGA 3EI1A 1S4UX 1B9XA 4OWRA 3P4FA 4Z7OA 2EBSA 4CZYA 2CO0C 3KRWB 3UVOA 4JT6C 4LG8A 1I2MB 3KCIA 1K3IA 1QFSA 2IAAA 3SJLD 5C92A 1GG2B 1B9YA 4O9DA 3JRPA 4U1EI 1XHMA 3IUJA 3T3MA 2H9LA 4JXMA 3CFSB 3UVLA 4RE5A 3O4IA 3NVQA 4GQ2P 4UM8A 1YR2A 2H6KA 1VE7A 1UOOA 3A0FA 3MUNA 2VDRA 2VZ3A 3OF7A 3V7DB 5AJAA 2CO0A 3IUNA 2CE9A 3EI3A 4A2MA 4QAMA 4NAAA 3VI3A 3ZDYA 2Z2PA 1MG3A 4BH6A 5EMMB 5C9ZB 3DWLC 3E0CA 4A09B 3OKTA 3ZWLB 4D0KA 5FFOA 2CE8A 4O2WA 3I7KA 2J57G 2IWFA 3EQ9A 3RMZD 1O6GA 4BL0A 5THAA 1C9IA 3JZGA 4O02A 4QL1A 1SQ9A 3MUOA 2H14A 5AMSA 3DDUA 4O3UB 1M1XA 3RN0D 1R5MA 2PM9A 3K72A 4A7JA 5EAPA 2HU7A 1TYEA 5HE0B 4Y5RD 2H9PA 1GP2B 2HJBA 1FWXA 2UZXB 2P9UC 4JHNA 4L9OA 5TF2A 3SXTD 3AL9A 1UTCA 3NVXA 1E8MA 4ZOZA 4CI3A 3F3FA 3OW8A 2H3XA 4CY2A 4CI1A 3IULA 5EMKB 3V9FA 2VDLA 5AFU3 5FFGA 1VE6A 3VGZA 4DNUA 4LGNA 5M5RA 2XYIA 4JHPC 4NSXA 5GSAA 2QXVA 1JMZB 4CZVA 4G55A 2EIDA 2VDPA 3RN1D 1JV2A 2OK6A 3AL8B 4XYIA 5FKTA 3SMRA 4J86A 2XL2A 2OVPB 4CY3A 1H2ZA 3OTTA 3UR4A 1JJUB 4J78A 4QT8A 3NIGA 3DXKC 3QI0A 4J87A 4O45A 5FXYA 3I8CA 3T3PA 4J82A 4XEIC 3K27A 3DSMA 3BWSA 3QHYB 5JWZA 2AGXA 3VH0A 1RI6A 3PVWB 4ES0A 3F3PA 3NIDA 3BG1A 4GM9A 4FHLA 2HXCA 3UVMA 4ERZA 3EI3B 3ORVD 4E5ZB 3FCSA 3C75H 4FA5D 3EG6A 3IIWA 3GD1I 5M61A 1SHYB 2EIEA 2CN3A 3IJ1A 3K26A 5IJ7E 3I89A 4J84A 4FA9D 2MTAH 5E6RA 5FKRA 1NEXB 4K3JB 3UKUC 3MXXA 2VDNA 3RFGA 3RRMC 2XE4A 2H9NA 3AL8A 4QQEA 4AX4A 3RLMD 2YNOA 4L1QD 3IVMA 3SFZA 4O1QD 2I0RA 3B7FA 4H5JA 3EQ8A 4WK0A 3C9CA 2PM9B 3DM0A 4J79A 2GC4A 3NVNA 4BP8A 5H14A 4IMMA 2BCJB 3PXTD 1JOFA 4J81A 5FLXg 4JSPC 3V4PA 2GC7A 2W18A 3IKOA 3I7OA 5HDBA 2PBIB 4MMZA 4OZUA 4E54B 4QRJA 5FKQA 3SWSD 1VYHC 4GGCA 4O3TB 4BCBA 3K71A 4J0XA 4GZ8A 3FGBA 2B4EA 4XYHA 2P9NC 3FM0A 4E5ZA 4X60B 3RSEC 3PVUB 4NBMA 4FA1D 2HKRA 4PC0A 2H6NA 3MKQA 5H17A 1GOFA 4L1MA 3J81g 5CYKA 3EMHA 4MMYA 2PM7B 4A0BB 4CI8A 2B5NA 2B5LA 3DXMC 1U4CA 3EI2B 3I7LA 2IWKA 3JZNA 3K6SA 4JD2C 1PEVA 4L3GD 4CC9A 5IJ8E 5IC7A 2H13A 4X61B 2XU7A 2P9IC 2P9PC 3I2NA 1UOPA 5GMKn 5E6SA 4JSNC 4FB1D 1K32A 2QZPA 2Z2NA 1H2XA 2I3SA 4BUJC 1UOQA 2OK4A 3MMYA 2J55H 3IJEA 2I0TA 5M5UA 4E54A 5EM2A 1JMXB 2UZYB 4Y7RA 5IT9g 2AGLA 2BBKH 3JAMg 3ZE2A 4AMZA 3JZHA 2IUVA 4WK2A 4PBYA 3PSCB 2AQ5A 4AN1A 1A0RB 3FCUA 5IGQA 1SQJA 2Q7QA
chains in the Genus database with same CATH topology
5FFOA 4WJKA 5E6SA 3FCSA 3ZDZA 3T3MA 3ZE1A 3NIGA 4MMYA 1U8CA 3IJEA 4NENA 4O02A 3V4PA 2VDOA 3ZDXA 5HDBA 4MMXA 2VDLA 4MMZA 4UM8A 5E6RA 3T3PA 5FFGA 3VI4A 4G1EA 3ZE2A 3NIFA 2VDNA 4Z7OA 2VDRA 4Z7NA 4Z7QA 2VDQA 1M1XA 2VDMA 4WK2A 3K71A 3K6SA 3V4VA 4WK0A 4IRZA 2VDPA 1JV2A 2VDKA 3VI3A 3FCUA 3ZDYA 3K72A 3NIDA 5E6UA 1L5GA 4G1MA 4UM9A 3ZE0A 1TYEA 4WK4A 2VC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFO A;  4WJK A;  5E6S A;  3FCS A;  3ZDZ A;  3T3M A;  3ZE1 A;  3NIG A;  4MMY A;  1U8C A;  3IJE A;  4NEN A;  4O02 A;  3V4P A;  2VDO A;  3ZDX A;  5HDB A;  4MMX A;  2VDL A;  4MMZ A;  4UM8 A;  5E6R A;  3T3P A;  5FFG A;  3VI4 A;  4G1E A;  3ZE2 A;  3NIF A;  2VDN A;  4Z7O A;  2VDR A;  4Z7N A;  4Z7Q A;  2VDQ A;  1M1X A;  2VDM A;  4WK2 A;  3K71 A;  3K6S A;  3V4V A;  4WK0 A;  4IRZ A;  2VDP A;  1JV2 A;  2VDK A;  3VI3 A;  3FCU A;  3ZDY A;  3K72 A;  3NID A;  5E6U A;  1L5G A;  4G1M A;  4UM9 A;  3ZE0 A;  1TYE A;  4WK4 A;  2VC2 A; 
#chains in the Genus database with same CATH topology
 3F3G A;  3I7N A;  3JPX A;  4J0W A;  5B4W A;  3UVK A;  4ESG A;  3I7H A;  3MZK A;  4A0B A;  4ZOY A;  2BKL A;  3O4J A;  4X63 B;  1T2X A;  2EIB A;  5CXB A;  1E8N A;  3N0E A;  3EI2 A;  2EIC A;  3VI4 A;  5M5V A;  1U2V C;  3JB9 L;  5FA5 B;  2XL3 A;  2PM6 B;  3C99 A;  1K8K C;  5I5M A;  4Z7Q A;  2OIZ A;  4DNV A;  2VDM A;  3SN6 B;  5M5T A;  3EI4 B;  5K1C C;  1QFM A;  3OKW A;  3V5W B;  4WJK A;  2OVQ B;  5TDH B;  4PXW A;  2H68 A;  2AGW A;  4GM8 A;  4MK0 B;  5HE1 B;  4PNK B;  3ZE1 A;  4AMY A;  3EQ7 A;  3BG0 A;  2AGZ A;  5CYK B;  3GRE A;  2CNX A;  5K19 A;  2XZG A;  4Z7N A;  4D6V A;  2VDQ A;  4ERY A;  4A11 B;  3CIK B;  1NR0 A;  1XKS A;  5EAM A;  4K3I D;  4IA9 A;  4GGA A;  3ZE0 A;  4D9S A;  1OMW B;  2GNQ A;  3C5M A;  5EMJ B;  5FKS A;  5H1M A;  3SVW D;  3OKY A;  4G56 B;  4N14 A;  4Z8L A;  3MVD K;  2HKM A;  1PI6 A;  3PSL A;  2O9K A;  2IUR A;  3OL2 B;  4AEZ A;  1GOH A;  4A0A A;  2QR5 A;  3CFV A;  5GXI A;  4A08 B;  4R7A B;  5EM2 B;  3EI4 A;  1ERJ A;  3AFC A;  4HDJ A;  4FA4 D;  2H6Q A;  2H9M A;  2VZ1 A;  4J77 A;  5TEE A;  4L3H D;  2HU5 A;  2G99 A;  4PSX B;  4LG9 A;  4ZOV A;  2P9L C;  4JSX C;  3KRX B;  4PBZ A;  2HJ4 A;  1TBG A;  5FQD A;  5HQG A;  3UVN A;  5IGO A;  1VZ2 A;  4FWW A;  4MMX A;  3W15 A;  1YFQ A;  3IUM A;  4G1E A;  4GQ1 A;  3UKR C;  2I0S A;  4A11 A;  5CXB B;  2CN2 A;  5TEF A;  1OLZ A;  1GOT B;  2WQ8 A;  2YMU A;  2AH0 A;  1PBY B;  2JKX A;  5C86 A;  3MKS B;  3V4V A;  3L4M D;  4FAV D;  2OVR B;  3GC3 B;  2XDW A;  4UM9 A;  4IRZ A;  4WK4 A;  1QNI A;  3ULE C;  5GXH A;  4RE6 A;  4CY5 A;  1N6D A;  4AN0 A;  3OL2 A;  2TRC B;  3L4O D;  2AGY A;  5I5J A;  3JRO A;  3SCY A;  2H47 A;  5I5I A;  4A08 A;  2VDO A;  1H2Y A;  4KFM B;  4GQB B;  3O4G A;  4BP9 A;  4U7A A;  4CI2 A;  3SBR A;  4YVD A;  5CXC B;  3GFC A;  5E6U A;  3IIY A;  4I79 A;  2I3T A;  3IUQ A;  4CY1 A;  5A2Q g;  1A12 A;  5HE2 B;  3IJ0 A;  1TYQ C;  2HYE A;  4CZX A;  3ZDZ A;  2YNP A;  4J73 A;  1C9L A;  1BPO A;  3OKY B;  2B5M A;  1U8C A;  1VZ3 A;  3IUR A;  4PSW B;  1MDA H;  5EAL A;  1O6F A;  1N6F A;  2YNN A;  3NIF A;  4A0A B;  1E5T A;  5HE3 B;  1JTD B;  2J56 H;  5EML B;  3EI1 B;  3J80 g;  5EAR A;  2IUQ A;  3I7P A;  1Q47 A;  4BCC A;  4A09 A;  3IJC A;  2VDK A;  3VA6 A;  2YB8 B;  3HFQ A;  4NC4 A;  4G1M A;  2P9K C;  2G9A A;  3SBQ A;  3N0D A;  3I8E A;  1N6E A;  4ERQ A;  2OJY A;  3FRX A;  4H5I A;  5SXM A;  1XIP A;  4J8G A;  3SBP A;  5C2W B;  5M5S A;  4BCD A;  4JSV C;  4J8B A;  4NEN A;  1PGU A;  3ZDX A;  2AH1 A;  5HYN B;  4A2L A;  2P9S C;  2YBA A;  2HES X;  4ZN4 A;  1H2W A;  3O4H A;  3PXS D;  5C2V B;  4UI9 R;  4X3E A;  3EU7 A;  5CXC A;  1L0Q A;  1GXR A;  2QC5 A;  4ZOX A;  5KDO B;  3SLE D;  4GMB A;  1MG2 A;  4FAN D;  1L5G A;  2Z2O A;  4DNW A;  4GM3 A;  3RFH A;  2VC2 A;  3SHF A;  3EWE A;  1P22 A;  3ODT A;  3PXW D;  4JT5 C;  3PE7 A;  4TZ4 A;  3MZL A;  4GGD A;  3AH8 B;  2HU8 A;  4AOW A;  2IUP A;  3U4Y A;  4EWR A;  1GOG A;  3EI1 A;  1S4U X;  1B9X A;  4OWR A;  3P4F A;  4Z7O A;  2EBS A;  4CZY A;  2CO0 C;  3KRW B;  3UVO A;  4JT6 C;  4LG8 A;  1I2M B;  3KCI A;  1K3I A;  1QFS A;  2IAA A;  3SJL D;  5C92 A;  1GG2 B;  1B9Y A;  4O9D A;  3JRP A;  4U1E I;  1XHM A;  3IUJ A;  3T3M A;  2H9L A;  4JXM A;  3CFS B;  3UVL A;  4RE5 A;  3O4I A;  3NVQ A;  4GQ2 P;  4UM8 A;  1YR2 A;  2H6K A;  1VE7 A;  1UOO A;  3A0F A;  3MUN A;  2VDR A;  2VZ3 A;  3OF7 A;  3V7D B;  5AJA A;  2CO0 A;  3IUN A;  2CE9 A;  3EI3 A;  4A2M A;  4QAM A;  4NAA A;  3VI3 A;  3ZDY A;  2Z2P A;  1MG3 A;  4BH6 A;  5EMM B;  5C9Z B;  3DWL C;  3E0C A;  4A09 B;  3OKT A;  3ZWL B;  4D0K A;  5FFO A;  2CE8 A;  4O2W A;  3I7K A;  2J57 G;  2IWF A;  3EQ9 A;  3RMZ D;  1O6G A;  4BL0 A;  5THA A;  1C9I A;  3JZG A;  4O02 A;  4QL1 A;  1SQ9 A;  3MUO A;  2H14 A;  5AMS A;  3DDU A;  4O3U B;  1M1X A;  3RN0 D;  1R5M A;  2PM9 A;  3K72 A;  4A7J A;  5EAP A;  2HU7 A;  1TYE A;  5HE0 B;  4Y5R D;  2H9P A;  1GP2 B;  2HJB A;  1FWX A;  2UZX B;  2P9U C;  4JHN A;  4L9O A;  5TF2 A;  3SXT D;  3AL9 A;  1UTC A;  3NVX A;  1E8M A;  4ZOZ A;  4CI3 A;  3F3F A;  3OW8 A;  2H3X A;  4CY2 A;  4CI1 A;  3IUL A;  5EMK B;  3V9F A;  2VDL A;  5AFU 3;  5FFG A;  1VE6 A;  3VGZ A;  4DNU A;  4LGN A;  5M5R A;  2XYI A;  4JHP C;  4NSX A;  5GSA A;  2QXV A;  1JMZ B;  4CZV A;  4G55 A;  2EID A;  2VDP A;  3RN1 D;  1JV2 A;  2OK6 A;  3AL8 B;  4XYI A;  5FKT A;  3SMR A;  4J86 A;  2XL2 A;  2OVP B;  4CY3 A;  1H2Z A;  3OTT A;  3UR4 A;  1JJU B;  4J78 A;  4QT8 A;  3NIG A;  3DXK C;  3QI0 A;  4J87 A;  4O45 A;  5FXY A;  3I8C A;  3T3P A;  4J82 A;  4XEI C;  3K27 A;  3DSM A;  3BWS A;  3QHY B;  5JWZ A;  2AGX A;  3VH0 A;  1RI6 A;  3PVW B;  4ES0 A;  3F3P A;  3NID A;  3BG1 A;  4GM9 A;  4FHL A;  2HXC A;  3UVM A;  4ERZ A;  3EI3 B;  3ORV D;  4E5Z B;  3FCS A;  3C75 H;  4FA5 D;  3EG6 A;  3IIW A;  3GD1 I;  5M61 A;  1SHY B;  2EIE A;  2CN3 A;  3IJ1 A;  3K26 A;  5IJ7 E;  3I89 A;  4J84 A;  4FA9 D;  2MTA H;  5E6R A;  5FKR A;  1NEX B;  4K3J B;  3UKU C;  3MXX A;  2VDN A;  3RFG A;  3RRM C;  2XE4 A;  2H9N A;  3AL8 A;  4QQE A;  4AX4 A;  3RLM D;  2YNO A;  4L1Q D;  3IVM A;  3SFZ A;  4O1Q D;  2I0R A;  3B7F A;  4H5J A;  3EQ8 A;  4WK0 A;  3C9C A;  2PM9 B;  3DM0 A;  4J79 A;  2GC4 A;  3NVN A;  4BP8 A;  5H14 A;  4IMM A;  2BCJ B;  3PXT D;  1JOF A;  4J81 A;  5FLX g;  4JSP C;  3V4P A;  2GC7 A;  2W18 A;  3IKO A;  3I7O A;  5HDB A;  2PBI B;  4MMZ A;  4OZU A;  4E54 B;  4QRJ A;  5FKQ A;  3SWS D;  1VYH C;  4GGC A;  4O3T B;  4BCB A;  3K71 A;  4J0X A;  4GZ8 A;  3FGB A;  2B4E A;  4XYH A;  2P9N C;  3FM0 A;  4E5Z A;  4X60 B;  3RSE C;  3PVU B;  4NBM A;  4FA1 D;  2HKR A;  4PC0 A;  2H6N A;  3MKQ A;  5H17 A;  1GOF A;  4L1M A;  3J81 g;  5CYK A;  3EMH A;  4MMY A;  2PM7 B;  4A0B B;  4CI8 A;  2B5N A;  2B5L A;  3DXM C;  1U4C A;  3EI2 B;  3I7L A;  2IWK A;  3JZN A;  3K6S A;  4JD2 C;  1PEV A;  4L3G D;  4CC9 A;  5IJ8 E;  5IC7 A;  2H13 A;  4X61 B;  2XU7 A;  2P9I C;  2P9P C;  3I2N A;  1UOP A;  5GMK n;  5E6S A;  4JSN C;  4FB1 D;  1K32 A;  2QZP A;  2Z2N A;  1H2X A;  2I3S A;  4BUJ C;  1UOQ A;  2OK4 A;  3MMY A;  2J55 H;  3IJE A;  2I0T A;  5M5U A;  4E54 A;  5EM2 A;  1JMX B;  2UZY B;  4Y7R A;  5IT9 g;  2AGL A;  2BBK H;  3JAM g;  3ZE2 A;  4AMZ A;  3JZH A;  2IUV A;  4WK2 A;  4PBY A;  3PSC B;  2AQ5 A;  4AN1 A;  1A0R B;  3FCU A;  5IGQ A;  1SQJ A;  2Q7Q A; 
#chains in the Genus database with same CATH homology
 5FFO A;  4WJK A;  5E6S A;  3FCS A;  3ZDZ A;  3T3M A;  3ZE1 A;  3NIG A;  4MMY A;  1U8C A;  3IJE A;  4NEN A;  4O02 A;  3V4P A;  2VDO A;  3ZDX A;  5HDB A;  4MMX A;  2VDL A;  4MMZ A;  4UM8 A;  5E6R A;  3T3P A;  5FFG A;  3VI4 A;  4G1E A;  3ZE2 A;  3NIF A;  2VDN A;  4Z7O A;  2VDR A;  4Z7N A;  4Z7Q A;  2VDQ A;  1M1X A;  2VDM A;  4WK2 A;  3K71 A;  3K6S A;  3V4V A;  4WK0 A;  4IRZ A;  2VDP A;  1JV2 A;  2VDK A;  3VI3 A;  3FCU A;  3ZDY A;  3K72 A;  3NID A;  5E6U A;  1L5G A;  4G1M A;  4UM9 A;  3ZE0 A;  1TYE A;  4WK4 A;  2VC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...