2VDLB

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
456
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 129
structure length 456
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdlB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdlB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdlB03
5HDBB 1YVPA 5KYWA 3EGDA 3PPYA 1FNSA 1UEXC 3HXQA 1JEYA 4PN7A 5KYNA 2UZYB 3OKYB 4A0QA 1RS0A 3GXBA 4G1EA 3ZE2B 5E6RA 4F1JA 1IDN1 1MJNA 2XWJI 3EFOB 2ODQA 5HJ2A 3K6SA 3EH1A 3FCSA 4HQKA 5HGJA 3ZE1B 1CK4A 1RTKA 2NUTB 1IJKA 1JEQB 3K72A 3EOBI 3Q3GE 1JEYB 2XGGA 5ES4B 4CN9A 4G1MA 1Q0PA 5E6SA 3K71B 1L5GB 1ZOPA 2NUPA 3HI6A 3FCUB 2B2XA 4UM9D 4C2BA 1TYEB 1OLZA 3PPXA 2I91A 1OAKA 4HQNA 4WK0B 4MMYB 2VDMB 4G1EB 5E6RB 1AO3A 1PCXA 3IJEB 4CNBA 3ZDZB 1YUKA 3AL9A 3NVQA 4K3JB 1JEQA 4IGIA 3RAGA 4C2AA 4WK4B 3T3PB 1RD4A 3F78A 2VDOB 1M1UA 1T0PA 1N9ZA 1U8CA 4Z7NB 3TVYA 2NUTA 4O02B 5KYUA 2VDPB 1ZOOA 3TCXB 3TW0A 4FX5A 3K72B 1BHQ1 1M2VB 1RRKA 2ADFA 5KYYA 3AL8A 4O3TB 2ODPA 4F1KA 1SHYB 4Z7QB 1XDGA 4IHKA 3BN3A 3ZE0B 4G1MB 2XWBF 1V7PC 3VI4B 1NA5A 4MMXB 1QC5A 4WK2B 1N3YA 4HQFA 4JDUA 4O3UB 1T6BY 3BQNB 3EFOA 1JV2B 4CN8A 3QA3E 4HQOA 3K6SB 2VC2B 2M32A 3FCSB 1SQ0A 1U0NA 3EG9B 4Z7OB 1M1XB 2O7NA 3OL2B 1DZIA 3OKWA 4MMZB 1LFAA 1M2VA 1U0OC 3F74A 1ZONA 4NEHB 3AFCA 3AL8B 3BQMB 5KYXA 3NIFB 4C29A 1U8CB 4DMUB 4XW2A 1XDDA 1MQ8B 5KYWB 2IUEA 2P28A 1MF7A 3IBSA 2ICAA 3T3MB 4UM8B 3EGXB 4HQLA 3ZDXB 4GZ8A 4MMYA 4NENB 3E2MA 1DGQA 2I6SA 1MHPA 5LN1A 5E6UB 3IJEA 1IJBA 1AUQA 4BJ3A 1AOXA 1MQ9A 5KYXB 4WFQA 2VDNB 1IDOA 3M6FA 1SSLA 2VDKB 1CQPA 2X5NA 3EG9A 1QCYA 3OL2A 4WJKB 4O02A 2P26A 1M2OA 5KYUB 4MMZA 5BV8A 4IXDA 1XUOA 3ZQKA 3ZDYB 1YVRA 2NVOA 3EGDB 1ATZA 5KYYB 3PPWA 2NUPB 3TXAA 2VDQB 3V4VB 1BHO1 3N2NA 1L5GA 3HXOA 3NIDB 1SHTX 4MMXA 1QC5B 1PT6A 1PD1A 1JV2A 4JX0A 3VI3B 3EGXA 3V4PB 1FE8A 4NENA 1SHUX 2WINI 1JLMA 2WW8A 3EOAI 2QTVA 2VDLB 5E6UA 2VDRB 1M1XA 3NIGB 4UM9B 3PPVA 1PD0A 4M76B 1M10A 2I6QA 3EH2A 1MQAA 3K71A 4FWWA 5E6SB
chains in the Genus database with same CATH superfamily
2H48A 4QWWA 4D0CA 3UHOA 3AS3A 4ZC8A 4YFDB 4PWHA 4TVUA 1O8CA 1QH0A 2PSSA 1HYEA 4NZUL 4M5ZH 1S3KH 3IDJB 3DA8A 2PMWB 3C6ZA 2I9KA 2EP8A 4O8ZA 4WFJA 3SZ6A 3VB8A 1KGCE 3RSFA 5HQJA 2G9HB 3RC9A 3DWEX 4E2OA 1LI4A 5ALJA 1RIVL 3WY2A 1U9KA 3ONEA 2MQGA 3MTBA 5ALFA 1WMFA 2HDWA 5KBMA 3SKNA 2CNDA 1VKHA 1NHWA 3NPSB 4BO2A 3FQWA 1HEJC 4HA1A 1JDBB 2EZ9A 5KTMA 1KP3A 1QIFA 2VXVH 4F4JA 5KWSA 2BL4A 2WTMA 3EPPA 2XEDA 1S7QA 5EG6C 1YBVA 3K6KA 5LBVA 2OBGA 4LSRH 3GG2A 1E9PB 5E6IC 4ERXA 5I7SA 4Z3FA 5JD3A 1ND5A 5BOVA 1SA0B 1MPAH 5DC4B 3CRZA 1YECL 4FOPA 4J28A 1FYVA 1FG9C 2CV2A 2B8WA 3NDBB 4UVGA 4L4ZA 3GJTA 2EJ1A 3NJLA 3W8FA 2PT7A 5E24E 2H5EA 5DTFB 3LUGA 4NX2A 3I4FA 5J9FA 4N2CA 2C54A 3OETA 5DRZB 5LGJA 5SWSA 2C07A 3F12A 5FUVA 3VDNB 1MEEA 1T2CA 3IPCA 4YHZH 4KRFA 3UPAA 2OQVA 3LBIA 4G4SO 4IWYA 1IPFA 3HKBA 3E4DA 4IFEA 1YDGA 1K6JA 1TYRA 1B14A 3NV7A 4ZMZA 3WOHA 2Q2WA 4RQQB 2C5DC 3I9KA 3RBSA 4BHUI 3ZHVA 1RZUA 3WLHA 3AK4A 2VDKL 2ZK7A 2WZ0A 3MLYL 4WRRA 1MXDA 3VNSA 2P77A 3M86A 2QADC 3MINB 5DP1A 4OX9Y 5TF0A 2XB9A 4I0PA 4L8SB 1IAOB 2P4AB 4FFVC 2QMKA 4WD3A 1SRQA 1AF7A 1H85A 3OOSA 1D04A 2ZIVB 1NMQA 1GTZA 2GN6A 2CD7A 3LXAA 4CMGA 3BJLA 1QNZL 2OE2A 2JLQA 4LVNC 4AEHH 2PPVA 1T6YA 3TWYA 3CDFA 4CW1A 1GOHA 1MXHA 1GW0A 4XD7D 5CVTA 3HZVA 3NTCL 1BOFA 4O1IA 5IW6A 4FQJH 3CU1A 3PEUA 1XTZA 4MNQA 3F6YA 1I8LA 4M8VA 2IEDA 3QP3A 1X39A 4UOEA 3RS5A 1FQWA 2DOKA 3WFZA 4KE8A 3JQ8A 2Y05A 4YDVA 3DDZX 2OUKA 2I1LA 4LKRA 5DZJA 4LAQH 3P97A 4KU1A 4LHQB 5EIBD 4PJCB 4H31A 4XSHA 1KFBB 4UXIA 1CPUA 4PJBF 4LXTA 2Y1ZA 1KH1A 5SY6A 4RENA 4OZFA 4BVAA 4KMTH 3FN3A 3HJGA 3VAYA 3AROA 3G08A 2CXQA 4PJEA 2C0PA 4P23A 3HBPA 1I1YB 3EH1A 5DHRA 1NCBL 2G30A 4BDTA 1Z0NA 2CB0A 4GAGL 3E9UA 1LBQA 5CG1A 5E6ZA 4Q8BA 4B9AA 4IZIA 2FWSA 7CGTA 3MOBH 4LQ4A 3B1XA 4TSBH 3MWEB 3LY5A 4NBRA 4D9HA 3V1KA 3DOUA 1DG9A 1FL3B 4D9QD 3PTZA 3QZOA 4KBFA 2BTOA 1PS3A 1NEZB 4ZT4A 4FN4A 3K70C 1P8JA 1ZHBB 2ED9A 4M3NA 4JY6B 4F5EA 4YCCA 2MR5A 3E6HB 1OP5H 2H07A 4ALMA 1COBA 5GONB 3QYCA 5CGTA 3AYXB 3JTBA 4MHHG 5IIEB 3L5HA 4IXMA 3KDSE 3W9DA 2ZRNA 4YS4A 3IJEA 3N6VA 5AM5A 2MH4A 1E27B 3FLMA 4IOSA 5TE4H 3OPYI 5CJBA 4AY3A 4NIYE 1XTBA 5HDBE 4DMRA 4NYLA 4ZU1X 1S5IH 3WFDH 4YJ3B 2QT6A 1O0CA 5GM1A 3AONB 4DLLA 4RDCA 4REOA 1JG7A 2JEZA 3SHFA 3AMKA 2ZI6A 4JLMA 1EGAA 1DBJL 3GGCA 3MGKA 4EHKA 3AL3A 4WSKA 3K8KA 3R0VA 2Z5LA 1ORTA 4L3VA 2ID8A 4D56A 2VXSH 2VQ4A 4IOKA 4M9SA 1LNSA 4G37A 1KKUA 1GCFA 2DSNA 4PSPA 3VFSB 3RNKA 1NU8A 3ZEIA 3U26A 3RRMA 3P19A 4QTTB 4I50F 1U4SA 2ZJZA 4EDWH 1DAFA 4J6RL 2VDLL 3O3DB 3UB4A 3CEPB 5BRNA 1WPQA 3P9YA 5FYKH 2PA3A 3MOAL 4FEIA 5DJXA 4CETA 3CH1B 4FZEH 3IALA 5K59E 3AVVA 1HQDA 2ED8A 5T4FA 1FUKA 5LN4A 3EISA 3PHQA 1E6UA 3OT5A 4OP2A 3TBHA 1FZOB 4UE3S 5J3HD 3FPSA 4LDAA 1T5TA 3IA7A 1QMGA 3WNJA 1Z6ZA 2CGRH 4EATA 1K5WA 4HMOA 2ZJSL 1IB6A 3FU0A 2G8NA 3QCVL 4ZVLA 5M7EA 4GQ9L 1GAFL 1MOEA 1APBA 1SZPA 1MI5B 2Q7DA 4Y16C 5F9OL 3PDJA 3VI4E 3G2LA 4L4VD 1PZ3A 1PN3A 1SRRA 1BEXA 4GQAA 2Q4RA 2VK2A 4BV9A 2KYIA 2OX5A 1SHMA 2DWEB 4QJ3B 3WHXA 1MJJB 4HK3N 3R75A 3DF7A 5HHPB 1NVVR 3RRNA 4YHKH 1G1MA 4XN5A 1AKWA 1ZGLA 2J07A 4DY4A 3QG6B 5FL7A 1BD2D 1H05A 5HVNA 4R90L 2IK8A 1QRNE 4GRMB 4M1WA 2DN7A 4BFIB 5E1DA 4RS3A 2WABA 4M0MA 1Q14A 3QDME 5FO0A 3M1BB 5L0QB 2WO3B 4ZYYA 1PGQA 1SMOA 2AWNA 2B78A 3DZIA 1IC5H 3RL2A 1QHGA 3QMVA 2W0FB 2XYRA 1DBQA 3P0VH 2LABA 3VFOA 1LC0A 4WI8A 4N39A 2H0QA 4AM0B 2V3VA 1TVDA 1SKUA 3DLPX 4TMFA 3AVOA 1LMKA 2ICEA 4MHHI 1Y1SA 1Z28A 4B60A 4EENA 3WYBA 5JECA 1A7NH 1KY6A 2FUKA 2OUIA 4M8QB 4D94A 2OI9B 2XX3A 4K6KA 1NTRA 3S81A 3VH8A 4HS9A 4PY2A 3L5OA 2EL9A 4WECA 1H2XA 4Y5YB 1HLFA 2YYSA 1KDTA 4PXSA 2GB2A 2X2OA 4YRKA 5B8CB 3WMEA 3VUFA 3G5LA 1DAEA 4Y1AB 5SX4I 1EO8L 5AW4B 1PBYA 5DQ9A 4QO8A 4HDSA 4BNDB 2ZYSA 1MU0A 4R71A 1M2OA 1GSMA 3KLKA 4GO6B 2ITDA 3C6MA 3UAWA 1JPJA 3APMA 3EB9A 3VXRA 4U1GB 1WC7A 4RWEA 4JT8A 4LLDB 4LCBA 7MDHA 1XB3A 1TZOA 1DFXA 5DJ6B 3APDA 1PG5A 2IXFA 2NX5E 4QHLB 5JC1A 3E8SA 3E3LA 2X05A 3S3TA 2JHAA 4NCC2 1BVLA 3FONA 2PO5A 3ADCA 4NNPL 3TBCA 1TJ5A 3CK0H 1JB9A 1VJCA 4XIGS 1S2LA 2O07A 3UK7A 4YP6A 1ZMYA 4J2OA 1LNZA 1IY9A 4HWBL 3ARGB 3LUPA 1A8SA 1K8QA 3BORA 2FIKA 2H9GB 3GLQA 4ARZA 3R6LA 4M99A 4OH1A 2EXYC 4YREA 5EPMA 5LNEA 4YPGA 5K93A 4M38A 4V0LA 5M7QA 4N2GA 4GO8A 1QYIA 1N12A 4PY7A 4JY6A 4QPDA 2HPOA 3F90A 1Z29A 3LB6D 1DLJA 2RA1A 4ZARA 4LJSA 4ZC1A 3HR4A 3IELA 4GI9A 4UREA 3Q1SL 3RZCA 1NC2A 1AM4D 1OAJA 4UNRA 4FNPA 3H87A 3RM3A 4LW8A 3ZCXA 3G2PA 5AKIA 2ZCHL 1EX7A 4UKDA 4AO8A 3SYLA 2A67A 3MIZA 4GBMA 3E23A 1LVUA 5INTA 3KKEA 1WTAA 3OEYA 5L88H 3PXUA 4GW5B 5KVFH 5GY7A 1KCVH 1OTTC 3ESDA 3OP4A 2NRDA 1R5OA 3S3DB 1QRAA 2K9UA 1YVRA 1G9TA 1YAHA 3DMGA 1OWRM 3CFQA 2ZRAA 2ZB7A 3MRBB 2IWKA 2NR6D 2DE0X 5F3BB 2Q4BA 4J3SA 4RGNB 1TTRA 3I8SA 1N8SA 4RK6A 4DFDA 2EE0A 4W6WB 1OYWA 3A14A 2X4SB 2Q1TA 1IL1A 5ALLA 1PR9A 4A67A 2DLEA 2ACWA 2ID9A 3C5ZC 4AZSA 3GNQA 2NYUA 3LZOA 5AUPB 2VSYA 3DOFA 3HTLX 1SHSA 1I2DA 3AFIA 2ZJ2A 3K6IA 1I2ZA 3IEUA 1NI4A 1HDIA 1AK2A 3DAHA 4ZHQF 3KVYA 1NUQA 4YIQB 4U7KA 1JQLB 1XWFA 1I01A 4JIGA 2QVTA 4OQTL 3U0PB 3CVOA 4P1ZA 5BURA 5K05A 2UWEA 1JAZA 1D9KD 5BZZA 1VFMA 4LF5B 1QH1A 2Z8WC 1CYDA 4Y1AD 4CLEA 1F5NA 1XAJA 4F5CE 2HHCA 3BUQA 3BYZA 4CQMD 4R8LA 1TQVA 5EOTA 3NONA 1A72A 4E14A 2OMYA 3ZHYA 4XR8C 3TI9A 1NVFA 4ZKEA 4NB7A 5FIUA 1A3RL 4B4WA 3TE6A 3SHWA 2R1WA 2YD8A 3CPJB 2CXGA 2PYFA 5FO9A 5EHZA 3V79C 4OZIF 2VR5A 4NZPA 1OGTA 2W2MA 4TKZA 4EHLA 1FVCB 1AK9A 2JI7A 4EVSA 1XZLA 3LX8A 1ZN7A 1IBLB 3E80A 4LLQB 1BA2A 4RPJA 4PX9A 3ZS9A 5DRWA 4NGHH 3HDTA 2B59B 3EO9H 4KQXA 3VG9B 2QKIB 2ZCLH 4DETA 4BLOA 2HJWA 2X5PA 2H2DA 2CBQA 4TPRL 3I23A 4F0JA 4XBEL 4E5XA 4UW9A 2H2WA 2JKTM 4K9LA 2ICEC 3U0TA 1SOWA 4AJ1A 5CD9A 1QZUA 1XZWA 1N68A 3Q7JA 2FPIB 3AUYA 1WT5C 4YEFA 1W1IA 3JXAA 1JEYA 4IVRA 2BC4B 2YYAA 1RVV1 5CFHA 4RFOH 2W6QA 1VF5C 2NY4C 3EXG1 1BV8A 5EE0A 1RQLA 3LKOB 4NARA 4TLKA 1D2RA 4JQIL 3PQ5A 4EHNA 4UTCA 4JQIA 1G0YR 1NANH 4X54A 5B3JE 2J71A 2HH9A 4YSTA 4GUDA 2C9OA 3E35A 3M45A 2CMRH 5IFAH 3WHIA 2HCTA 4PAGA 4HJJL 3X13B 3QBDA 3T2PA 1M73E 3MPOA 3Q5OA 3SD5A 3X0DA 2CFTA 4AURA 3NHFA 4N3BA 1N2IA 4J3OF 4Z7WA 1F60A 1P1KA 1XL4A 4A2DA 2QN2A 2YJ6A 2YWFA 5FFMA 2DMGA 2X86A 3U0WL 1HBJA 1EINA 5G5DB 2XB8A 3IAS6 4LAFA 5IT9A 2WIGA 2WHPA 1NVGA 4X8JA 1W72A 2RCNA 3H05A 2WXFA 2YHGA 2Q2NA 4I9GA 2P9RA 2VRCA 1YDWA 3IP8A 4M9OA 2IHBA 1E5YA 1YDPB 2V97A 4XB8A 1LX6A 4L4TE 4TN9A 5KYXB 1FGVL 3V8MA 3A6CL 2I2WA 1E9BA 3P0JA 3U6RB 3OJ2C 3FZUD 4Z8FH 3MF4A 1MNQA 3PWPA 1YBHA 4S1NA 1R4XA 4WWNA 3H9SB 3OLXA 1C30A 4B9KC 4FFYL 3UT0A 1Q1BA 1EX6A 2H0JA 5LBSH 4MWGA 4PY7B 2IBBA 4LWQA 4D9CA 3K8OE 3NIGE 43C9A 1C14A 1WZIA 1KDPA 4U1KB 3WGMA 4HNAB 3RTQB 2CLRB 2PZAA 1T1ZB 3O3NB 4ZHQA 1XL1A 2GWRA 4P2QE 5T5NG 5GISL 1LVHA 4NKQB 4COKA 1IMHC 1JMXA 3DHPA 2HIGA 5DTJA 4RGNE 3F1KA 4BINA 4OUKX 4AK9A 2C9QA 4TUUA 1XHEA 1YN7B 4K3DH 3N9GH 2VYCA 5KTRA 3NATA 4QRUA 2C9MA 2BPOA 1YPZA 2IC5A 1E2WA 3B6JA 3PWPE 3DWFA 5DN9A 2BGTA 3JQDA 4QLAA 2VSXA 3FPYA 3GKWH 1U0GA 1DBAL 4O5AA 2V5UA 1IQWL 3BIKA 4HETA 1C16A 3IV9A 4B85A 4HCFA 1XLTC 5TJWK 5J56B 5DNAA 5EEYA 1SY6H 2C1OB 2GARA 3K1DA 2BM8A 1YJDC 5KNBD 4FJ2A 2AMLA 3MRDA 3DIFB 1WD8A 4L15A 1Y8QB 3I9FA 5HP4A 5KSZA 3F6LA 1URLA 2NYAA 4FDVA 3NYKA 5KVSA 1B0GB 5GRUH 5EXPA 4JN2A 3DZ8A 3K2EA 3DCJA 1RK7A 4GUOA 3L3GA 3P9QA 5BV7B 1VKRA 3R3UA 5CGBA 1V5GA 1M2FA 4L7QA 2ZUVA 1RKXA 3FULA 4P0TA 3DV6B 2HA6A 5DRZA 3B8EA 3B9PA 5HIMA 1JTVA 2DQYA 4NPYB 2CXRA 4PJ5E 1B00A 1GGVA 4HAVA 3SGEH 3O2DH 3LUHA 2EVGA 4RIGA 2O7VA 1L5NA 1VMIA 3TR6A 3NDYE 4KH9A 5CDUA 3RHSA 3US1A 2IPKA 4S1SL 5FDYA 1FVCA 1JJUA 4PB0H 4DCVA 1I2CA 2GVNA 4J3OD 1XDZA 3OH8A 1X74A 2IYXA 4MVXA 1Q0YL 3HFML 1PJAA 1UEJA 1UL1X 1SYSA 4L9WA 3DCYA 4IBUA 2QU8A 1T25A 4ANWA 4AJPA 5C0CD 3UTQB 2G8LA 3U4HA 1NLDH 3QX3A 2FN8A 3QJRB 4OFIA 4TPKA 2J1YA 4OD3L 5D3KA 1OGAD 3FOLA 5C9JB 3NCWA 4D8UA 5ALGA 2GABA 3BI9X 1DC7A 2XGSA 2YBRB 3NSXA 1ZIDA 3SFTA 3R5SA 1DVZA 3ZDYB 1UWCA 2O1WA 3Q1KA 4FHFA 1VDZA 3ZIUA 4ZKDA 1PT5A 1QF9A 1Q72L 5L2JA 2GEBA 3VPCA 4TLAA 1HDGO 1F90H 5BV2P 3NIFE 4NJ9H 3DECA 4BTEA 2MOGA 2ZR7A 4DO5A 2P80D 2VKWA 3CO0S 4NNOA 2BH0A 3AU9A 1SUSA 4BWTA 3QA3A 3NQ41 1QSZA 5F12A 5BN3B 3F5DA 1UXGA 4BIMA 3WBKA 3SQWA 5DHXB 3D5OF 4HC1H 1ROWA 5K4AA 1Q17A 3VZCA 3GOQA 4I87A 4XCNA 3O8XA 2BP8B 4EPRA 4IDGA 1QW9A 2YW2A 3L4CA 1JDTA 3STXA 5LL6P 4HJ0C 1TJ3A 3PXEA 4B33A 4HUWB 2ODAA 4BGUA 3MA7B 3WIHL 4ZZ2A 1TECE 3Q3JB 4BV2A 2YNMD 3JZFA 5FB8B 1SOMA 1N8ZB 1M2VB 3WGYA 3R1GH 2NR6A 4G7YL 1TUGA 1OAXH 1Q3TA 2PWGA 4MKTA 5AALA 2IEPA 1U28A 2A9PA 1QEWB 1VACA 3H9YA 3G1WA 1HXMB 3N58A 4X6BB 4OB6A 1IGYB 1B4JL 4J3NA 2I7VA 3DX3A 3BW9B 2OOKA 3D69B 4YHYC 1JTEA 1B2LA 1YMHB 5EHXA 3MROA 1NU6A 2ZWPA 2D7JA 3OKPA 5AOLA 3OQNA 1RVFH 3OOYA 2AANA 3JZDA 2AZUA 3V7FA 1H6UA 2G3ZA 5C46F 2RIPA 2Y7OA 5CX1A 4G0NA 4LDJA 3BC9A 3N8KA 3OQ1A 4KO8A 5ALTA 3SKMA 2KS6A 2CKBA 1Y3DE 5K0EA 4LSPL 4ZALA 2AWOA 3DXYA 1EAQA 4NENA 1I2AA 2XN0A 3C3YA 4LP4A 2QE7A 5EN2A 5D1QB 4WUUB 3GFSA 5MENB 1E3EA 1KDYA 1UINA 3W39B 2R8SL 1QMPA 1YPZB 4AGPA 1JF1A 3W2DL 4FFSA 5CS7A 2IJGX 5TQ2H 2VZSA 3PPEA 3JVUA 4P7FA 2Q86B 2DUJA 2CKBL 4CILA 1EJ0A 5F64A 3CZ5A 1WQ4A 2N75A 2OFFA 5J8OA 4Q52A 4J8QA 1IJKA 1HVXA 3S96A 2CVFA 2O8BB 4RMIA 1QGUB 1TTTA 2OAEA 1Q9LB 4ZUTA 1HYHA 2KLHA 2J25A 3TSOA 3RWHB 4YJ3A 5AUQA 3II6X 4ZQBA 2VWEE 2OJEB 2ZXWB 4PBRA 2B21A 4UDTB 1LI7A 3U4IA 2Y06H 3P5SA 4R2WA 3OE5A 4M0DA 2BBSA 4FKEA 4NBTA 4TQ9A 2VS1A 3G59A 4KO4S 1PVOA 2BGRA 3JYBA 1UPFA 3ON5A 3QWOA 4GI6A 4MA8H 1EHNA 3S2UA 2W42A 3VTFA 3CEMA 4KC0A 5GGQH 1T6BX 2ZNXA 2H32A 1ZIYA 1SHKA 1U6KA 4CWAA 5E8NA 5K1NA 5MP6H 2FFBA 3PV0A 1QZNA 4Q97A 4K8OA 3C2AH 3KDMA 5D1ZB 4I9FA 3NP7A 3SQBA 4GOSA 3QBEA 4QLWA 3B8HA 1KRXA 3I1IA 2IKQA 3G79A 4XCVA 4TL9A 4GH7B 4GMSH 4OM1L 4H59A 3CG0A 3EVEA 2DUNA 3GJ4A 2FMTA 2FFRA 3LPNA 5FWQA 1MH9A 3RVDA 5CFLA 2FF7A 4M54A 4URFA 1WB6A 2BSEA 3W56A 1MRDH 1B6SA 1NPNA 5LZ8A 3B8YA 5LXTF 3E3AA 2D0PB 1RU3A 4M7LL 1L5HB 3LRKA 4TL7A 1JZ6A 1GXSB 4OA5A 5FI5A 2OTCA 1CXIA 4F5YA 2R60A 1QGOA 4GQPH 4HUVA 1EO5A 3D50A 1ZPDA 4TWBA 5I8CB 4G5RA 1FFCA 4QJ3A 1ZOPA 3GGPA 3SHVA 3KVNA 2JKVA 3V1TC 1OP4A 4OCXL 2XHEA 2OHJA 3QU5A 1R3HA 3ZL4L 2VHTA 1K9TA 5D7IB 1NDQA 5KJCA 4BKTC 4OJFL 3FTYA 1RZVA 1WABA 2AXQA 3W5JA 3OJEA 4G9FD 5T1LA 1FNBA 3O47A 2INGX 3QWBA 1KENH 1RQXA 5AVXA 1OD7A 1YZTA 5B4TA 3TJMA 1OXKB 1ASOA 3B60A 3P0YL 3LY8A 2A6KA 3HYTA 5ADPL 4UHHA 1K3FA 2OPBA 4UAOB 4EK9A 4FGKA 2YRPA 5KKNB 4QTIL 3M6AA 3IBSA 1XFDA 1R1CA 1EXMA 3L95B 4D02A 4K94C 3FQ2A 4XWYA 1JFLA 1MQSA 3THYB 3L45A 2OB1A 3D4GA 1SYVB 1LGYA 1ZX1A 4P53A 1KEUA 2VDPL 1K5DA 3OPVA 3WL9A 4ZVQA 5MGNA 2E5EA 3L0YA 1IM8A 2CYBA 1FQ9C 3PFKA 4G23A 4L8GA 2OO5A 3BCUA 2AX3A 4C57C 5D70L 3RSGA 3BSZL 1XSJA 3DJYA 5JI2E 3B20A 5CJQL 3AIOA 4L95C 2A4MA 3L7KA 1GRRA 2FQ1A 3VA2C 3QO1B 3FTXA 3TLBA 5IVIA 1RJFA 1PWZA 1ZLVH 2D1SA 2JIZD 1MX1A 1Z34A 4IGAA 1IK4A 5B7NA 3DROA 4LLYB 1EAOA 1FVEA 1RXEA 3WIDA 2E46A 3KLBA 4LQFH 2PR9A 3UG5A 4W5OA 2O5YH 3PJDA 3UUFA 1QF7A 2GRAA 2NY0B 1D6MA 5I0VA 2ZRGA 4U6XB 2GPTA 2B2XL 2ESVB 2L69A 4DJMA 1V47A 1MELA 4B2IA 4GR9A 3DXAB 2IG2H 4X98B 4P6VF 3CC1A 4NUPA 1JQJC 4FI7A 3RWOA 1BMGA 1LL1A 2H0EA 4OGKA 3NIFF 1KC5L 1SMAA 4FCHA 5KG9B 5D1QA 4KR2A 3AUSA 3U6XS 1Z0FA 4Z9XA 2QS9A 3U1SH 4KB5A 2YN5A 1NC1A 5AW3A 1CUOA 4NUMA 2R79A 2VATA 4MLPA 2F9LA 4JLPA 4EF6A 2PXAA 2CKBB 1E3IA 3EMBA 1UBJS 3B2DC 1J42A 4J3OG 3T3OA 5JW3H 4YHLH 4JOSA 3IOEA 1PX3A 2NTSP 3F7VA 2OP1A 4EJ1C 4G65A 3ZQJA 4NFYA 2IDMA 1MJUH 4KTTE 3L7IA 3EVZA 5K45A 1MVLA 1CTQA 4IINA 4GBXB 2WPGA 4Q6IB 2ZR8A 4AO6A 1W76A 1OFGA 4G5QA 1TMQA 3JAWA 1T29A 5I26A 1ZD4A 4MQTB 5DURB 3O4LA 3Q6NA 3S28A 5T64A 3BP5B 3CU7A 1V7QA 3TTXA 3HPJA 4F1JA 4GKSA 2FPUA 5IH7A 4NFLA 3ZNQA 4FNAA 5ECDA 4Y19B 3J27A 2X4LA 1W88A 3TM4A 1VMDA 2AEPH 1I3GH 1PQPA 1L5MA 4FEAA 5IY5B 4OQNA 2R5NA 3MRKA 1MTZA 4MAYD 4IAOA 4IOMA 4EAQA 3IK2A 3QEAZ 2P42B 1JA0A 2AXJA 1RJGA 3D1JA 1E4JA 3CVBA 4EI5D 2UXCB 1T3SA 4P23B 5ALXA 1PJTA 5EWIL 1A5ZA 1KAGA 2H5JA 4BB5A 2QPDB 2IUFA 4PJFA 4P31A 3F49S 4X5PA 2FPSA 1ZLWK 1PIWA 1IJ9A 1SN2A 4KK5D 4BFTA 4G25A 5TE9A 3FO9A 5IUCA 2IYLD 4KGJA 1SU8A 3PXXA 3OMAB 4APXA 3AB0B 1G3RA 4AKGA 4DMUB 1YYLL 1EVZA 1R6VA 2JH3A 4TKVA 1UKSA 2GTZA 3KR1A 2AF2A 1YR6A 4KJQD 4LNAA 5FNVA 5IOKA 4G9EA 1FP1D 2FF5A 2BSSA 3U83A 1MXFA 3IMUA 2QGNA 1RD6A 3VX4A 4HHEA 1RQRA 2RGDA 1U5BA 3ZJ4A 4L9LA 4LDNA 3HVRA 3IKCA 1PL8A 2QL9A 4HH3C 4PLJD 1S6NA 3RRQA 2BFWA 2XN9E 3MJSA 4LSVH 2BERA 3DNPA 1GSKA 5D3MB 5DK6A 4TKMA 4AYFB 3KUUA 2X5JO 3WELA 2R51A 4G1MB 2V6GA 4H2DA 3CFUA 3JYNA 1EZVY 4OLUL 2VH1A 1JTPA 2UZYB 2C99A 4FWIB 2H1PL 1UBKS 3KR3H 1I1FA 3VXSB 4ND5A 3IERA 1CK4A 3GB7B 5BV7A 1TZIB 4N0YH 4PPNA 2BR5A 3ARBB 2BZ0A 3M3HA 3O6MH 3ZE2E 4RVOA 1VE3A 3DX0A 5DX0A 2HG5A 5JW6A 1KELH 2W0PA 3CD4A 1TT6A 2J6EL 2WWIA 1VJ5A 1MX5A 1RP7A 1D8AA 1IZ9A 2VL5B 4FI3F 2IPMA 3HG4A 1YD7A 1IVSA 1RCYA 3H2GA 5SZIA 1BJKA 1QC5A 1ULSA 3HA0A 2ADFL 1O9BA 4N8CL 4JHZA 3WDJA 3E6FA 1SD5A 2VT3A 2JLYA 3W81A 4PWYA 4B3IA 1CD5A 2OMWB 4PTUA 2AJLI 2W94A 2WD9A 2I7OA 4M8SA 3L01A 5TY0A 1OE3A 2WXJA 4Z2YA 3USZA 4BTLA 1KGYE 2ZT5A 3C4QA 2BVPB 3BCFA 4CKVX 3GJSA 5ID0A 2RQEA 4O33A 4LLYA 2OBLA 1BFTA 5AYTA 2DQJH 1PJ8A 3MRGA 4LBWA 2IGFL 2H63A 5F1OA 5KWIA 3E61A 2FEPA 4ZGBA 5ENWB 3RVVD 2Q7OE 3FQUA 4HS8L 5BW5A 4B7LA 4OBWA 4A82A 1VYUA 2Z6VA 2NGRA 5AXAA 5IAAA 3ENNA 1JNYA 1NN1A 1CY1A 1CK0L 2AJCA 2C88A 3G02A 3VXPA 1DS6A 4OD1H 4OZGA 3IQWA 3RH0A 2GC4C 2VAJA 4XE5A 2JZOA 4PV8A 4JNCA 4YECA 5C08A 4MJLA 1UWKA 1M67A 2FSEA 4Y0VA 4HQNA 4HIHA 2X0EA 5GRXG 1I7RB 3N0VA 4YL4A 2LKCA 2VDNL 3QIBC 1KXZA 3QWQB 1EEQA 4JEUA 3VZRA 3NEOA 3Q6MA 4G2NA 4OHPA 1JFQL 3AT9A 5BWBA 1A6ZA 2H3NA 2VK1A 3AHFA 4O4LF 3V7YA 4UM5A 3VJMA 1M7GA 5JW4N 1J87A 3LMJH 5CVJA 4OGXH 5KQRA 5FBKA 1YUKB 3CLFL 1FMLA 1OKKA 5A02A 3SN6A 2PKEA 4A2LA 4NP4L 4K1XA 3RC2A 4HC1A 1SB9A 4KQIA 2FDRA 1IE4A 5CFRA 1Z68A 4C29A 3WO4B 4K3GA 3OX3A 1OGAE 2AR7A 2H2GA 4PXAA 4L9DA 4D8PB 1SVUA 1LEIA 4KX7A 1JHDA 1UFVA 3E7PA 2DBLL 3LRSB 2BINA 2E9BA 2FLBT 2AKEA 2J0QA 3VRJA 1CFBA 1HXMA 2VRAA 3O2VL 1PNRA 3TPUB 1T2AA 3FZGA 1T4KB 4E9WA 4MQ5A 1CBUA 2P46B 1MT3A 1O87A 1TQCB 2Y7LA 3QORB 3TWOA 1ZUHA 5T1MB 3U2JA 4I1NB 4CHGA 5BVHB 3OKFA 3F4LA 3FSAA 3ES6A 1TFHA 5DUMH 4Z9AA 1HXYA 3NFNB 3U5TA 2FEDD 5AP9A 4CFYA 4DLVA 3GUVA 1L5LA 4GEJA 4EG3A 4XNDA 1JXAA 4N7RA 2JCVA 1B74A 2VAXA 1NUNB 4RA3A 1R0AL 3RTDA 3V32A 4LRUA 3OAWA 1FUEA 1BIHA 3S5JA 4X7SL 1R3KA 3NN8B 2OK0H 3IXQA 4U1HB 2XB2A 4A0RA 1MLCA 2ANBA 1KTDA 1RJ9B 2JDID 2CXSA 3DHJA 5SX5H 3U46A 3WXVL 1EUDA 2B4CH 2EFGA 4HJTA 4QHPA 4PWKA 2JGEA 4CKCB 3BE4A 4N1CA 4W6YB 2DLNA 4RVDA 2PT6A 2Z9CA 3RZCD 3L1JA 1ZIPA 1CLZH 2K6GA 4A2FA 5AVYA 3A28A 4L1LA 2QTGA 2B1IA 2JIZA 2VZEA 5LN1A 2F8VA 4WESA 2FCAA 2VZTA 3H5LA 4C88A 4LV8B 5AW7B 1X44A 3LGXA 4PRYA 1K5HA 5C09E 2N3ZA 4HXAH 1K6EA 4NJMA 2A5UA 5CW2A 2IEAA 1QG0A 1A9BA 1SM3L 3BPNB 2O2DA 2BO0A 2FMHA 5A4MS 2P5EA 3HG1D 4ZN6A 2YXVA 2I4OA 4HOYA 5FW6A 4RJJA 5B38A 3GLTA 3NT5A 1F2QA 3CX2A 5L2JB 3MIIA 3B6KA 2XIJA 5HGAB 1I7ZA 1QHSA 3WFJA 1JDUA 3GQBA 4YDMA 2RGNA 1CD8A 2DHDA 1RKQA 4W5NA 5F9AC 4ZXBB 1KZ1A 2XLCA 4JUFA 1EP9A 2P30A 4OYLA 4KXLA 1FC0A 1QABA 3TGXA 1XCOA 5J6GB 2FGZA 1XX9C 4QCIB 5AI4A 5F1KA 3S35X 3EYVA 4IRJB 3S1AB 1FDSA 1QSED 4P46A 2Y1WA 5C0GA 3OXSB 1GPOH 1KMCA 1N25A 2GZDA 4QKTA 4AYXA 1YEGH 5DD5H 4Q9CA 4FLEA 4IIXA 2PLAA 4I3RH 1RXYA 5HYJE 5CEYB 3K0KA 1KI8A 4QLOA 3KT3A 1P2TA 5CLTA 4CKYA 4QFCA 3KBHE 1NR7A 2BDTA 2QTLA 1T66C 3RHTA 4K9RA 1DKUA 2OMZB 3JWPA 3GGJA 3OR7A 4MGYR 1J0JA 3RRZA 1QBLL 1MVUA 3D3NA 5HBGA 3DM9B 4Q4LA 3UH8A 2W2KA 4GP4B 1UA7A 5TQ0B 1F4LA 1HOCB 1TQTA 3X2EA 3OI7A 4DEVA 3F7LA 3T4UA 3ML1A 1B9KA 1A6WH 2OBBA 1AGXA 2FSEB 1PQZB 3CF2A 5IF0A 2VLJA 3LN9A 1BHJA 4YC2B 3WAKA 5DBIA 3W5CA 5IBTL 5DBHX 1TX4B 5ICXA 4WUKH 4BASA 5CZVL 5K0CA 1OPGH 2XA8H 1U4OA 4DWJA 1Q7GA 1Y6MR 4LSQH 5I45A 1NIBA 5D7IF 2EW2A 4PYIA 3ESXA 2ZP9A 4HZ1A 3JTTB 3X11B 3SS8A 4ARUA 3MRPB 4X4ME 1KK2A 4PGCA 1BMFA 2H85A 1ZLXA 2YC2C 1ZJAA 3IJ9A 2GA8A 4OAQA 1KKMA 3VGAC 1RAEA 2D4FA 1ZNXA 5BCAA 3L8EA 1M3IA 3PD0A 1S9WA 5F77A 5F1PA 3TP4A 1N9ZA 1B2WH 1GU7A 5IHHA 1HAUA 2H5LA 3VACA 3P71T 3I05A 4ZI8A 1NVXQ 1C4XA 3A11A 2PVPA 4AIXA 4EI9A 1GMEA 1GIGL 4AEFA 4N0YL 3RLSA 3B1KA 1FAIL 4Q4CA 1ODAA 2FD6H 1PEKE 1BA3A 2AC2A 4RGYA 2AXNA 3T4YB 2JANA 3W79A 3HNRA 3KLPX 4N76A 2L17A 3RT1A 2P5WB 4BNZA 1T1WA 3GWZA 4TL4A 4LYYA 5DM4A 1M6OA 3CPSA 1SUDA 4H2CA 4LBVA 1O96A 4CM9A 2YCBA 3HYLA 3VD2A 1JNXX 3HI6L 3IVMA 3ZDBA 3CF6R 1EEUA 3M9XA 3GEHA 1T22B 3KPRD 2ZU6A 3KDMB 4ZYKB 1YDFA 2JI4A 3AC0A 3VFPB 2VYVA 5SYNA 3HXOA 1J2UA 4JX0A 4JASB 1D07A 2ZPTX 1IKNA 4F56A 3HR6A 1LBHA 4UV7L 3JWDC 5E0KB 5D51S 5AKRA 1U8QB 4AUJA 2DWPA 5HGBB 4X1OA 2OP4H 2FUTA 4KQ2A 1YL6A 3K5SA 3KE0A 1RPJA 3AQYA 3PLAE 1CLCA 3U13A 2YAQA 4P9NA 2J7LA 2VDMH 2IMMA 5E23A 1YB6A 3BWYA 1EVTC 1RZKL 2XCRB 4DR1B 1URIA 2C9BA 4ZFOB 2PKCA 4YHIA 2Z58A 4ZX6A 4ZTEA 2NADA 1TQBB 4JDTH 2W2XA 4B79A 1S8DA 1ZIBA 3ZLBA 4OZGF 4OQTH 5LLTA 4E70A 3DIDA 2ZS7A 5EHQA 4ARCA 4FZRA 4RPLA 5FR1A 5IVKA 1DQYA 3KL5A 2D54A 1LQSR 1E27A 4GXUM 2FVNA 4N2BA 5EEGA 3PXAA 1RPKA 3IC5A 3SX4A 5HRCA 3UKOA 5LQKA 1N75A 3TZ6A 3NPMA 1IEBB 1QZTA 5HQ3B 2IAND 2ZJ7A 3F3KA 1PL3A 1E8WA 3EJQA 2VN8A 5BPFA 1K3IA 4MTMA 1C9YA 1JQ5A 2ZIWB 3N6XA 2H3EA 2BRUA 2TRSB 2P6RA 2GXQA 3MJDA 1KI4A 3C3CA 3LYRA 4AX4A 4FWTA 4AGOA 2GCNA 2WLNA 4ANVA 3KPSB 2ZWOA 1MNUL 3KYDA 4L85A 3KSUA 4XBPB 2FECI 4LPSA 3AINA 4G09A 5F7NC 2Z08A 3CFIC 3LH5A 2ZIZA 3TRFA 1I75A 4A16A 1SD1A 3IMKA 4D9NA 2X0UA 3KZCA 1M34B 4CMMB 3RC1A 4UBDD 4L08A 2F8IA 5B7PA 1S3IA 5AVQB 3OKMB 2PZEA 1GSOA 2AAAA 3SCMC 3AG6A 5D3MA 3PXJA 4BZ1A 1CRWG 3DVAA 3PJFA 3OZTA 1ATIA 3CVHB 1HHGB 4MVJI 2EGGA 1L3IA 3PE3A 4GMGA 4R5TA 3V34A 5DMGD 1BKSB 1AHWB 1I7UA 2II6A 1RK1A 1XDBA 2P1DA 3AY0A 4X62B 1TQSA 5E1OA 1EDQA 5GJSL 2ST1A 2XF2A 4DC1A 4YLBA 1U1FA 1NSYA 1BG9A 5CJ5A 5CCKH 4A5OA 3NJNA 4H17A 2OHXA 1P0PA 5IB1A 4UTOA 5CCDA 3MUOA 3HDHA 1OLUB 5F5LA 2VTBA 3S7GA 3G5WA 3HQ4O 2YOGA 1RBMA 1EERB 2A35A 2QKYA 3V5KA 4P7GA 4W5RA 3U79A 1EVYA 3WSQL 3TQSA 5DX8A 1TUIA 3ABIA 2WXIA 3BVWA 3Q5EA 1JA1A 2EX4A 2XUOA 4DM7A 3QO1A 1SPDA 3QIWB 3FUNA 4YIQA 4KKAD 5EQTA 2R9VA 1WVGA 2DC1A 4DT2A 2V37A 3EC7A 1AO0A 1V95A 1OLXB 2DFPA 1ZYUA 3P9IA 1XNHA 4BE4A 2ZG1A 3CRNA 3CFNA 4XXWC 4YWJA 5KQPA 1NLBL 4Y1EA 4ALAL 5C5IA 3SIRA 2VSFA 3U0PA 3GNSA 4LOKA 1E32A 3MKGA 3IDQA 1ZSYA 4LEOA 4O4HF 4UIMB 1GXEA 3LO5A 2GPJA 1T1IA 2R0WH 3QLUC 5C52B 3SHSA 1IOWA 1ZD6A 2GUWA 3TOPA 3E15A 4JYCA 3BGMB 4J9VA 2W90A 1CFTA 2ETVA 1V1JA 4GR4A 9PCYA 3TZLA 2LDBA 2XY1A 4B84A 1MIEL 1BW9A 4S0HA 2Z91A 4E46A 1MV5A 4HJ0D 1ACMA 3I30X 1UBCA 1F4YL 3IIEA 2XLLA 2IHNA 5HX7A 5IWCA 5D5ME 1M2OB 1QFWL 1B0AA 1D2GA 5EU6A 5I8OH 1Z6XA 4BMYA 2ZUSA 4JK3A 5BT9A 4EGAA 1X4YA 2CBZA 2C8LA 2AS0A 1H3VA 4N85A 3NZEA 1YA6A 2C8NA 3PUYA 1Q1PA 4AENA 5CITA 3D6HA 1KTLB 4EJ0A 1IRIA 4IIGA 3RG1C 4HWZA 3LIPA 4JJZA 3PPIA 4KIJA 4L5AA 3WRYA 2HPVA 1HFWA 2D62A 3W9EB 5DYNA 1LK3L 1YDMA 2IAMB 2BFFA 3QUBA 2EO9A 1CQIA 3NZSA 2NWQA 4FFDA 3COJA 1QRUA 1IGJB 3BSFA 2XECA 5DWPA 2OL3H 1QG2A 1VI5A 4O4JF 4NN6C 4PX5A 1WBXA 2AI0H 1WOMA 2QGDA 1FZKB 3QEQA 4D8XA 3KP1A 3ZWKA 2WP3O 3R7NA 2UVEA 4Y5XA 5FHRA 1DDTA 2WK2A 2A78A 5DLQC 4MDIB 2AEEA 2EERA 2A83B 3QMPA 1PDVA 3R7FA 3KKQA 2EF1A 2OXHA 4GF5A 2BT4A 1QKZH 2VA9A 5I5GA 2JIXB 4HGMA 4BHUA 5DSXA 1FDTA 4B2LA 2BMKA 4WHYH 4X8JB 3ZKXB 2IYFA 2Q3LA 2C2YA 1IHPA 4AJOA 1QWOA 3X1WA 1GV0A 1SFRA 4XC3L 2FMIA 3QOYA 3NWBA 4UDTA 3TV3H 3OX2A 1M2JA 4GLOA 3EZ7A 4KQKA 2UUBB 3MR9B 3HAEB 2E85A 3OJWA 1CPYA 3UXMA 1QGDA 3OR6B 3AAZB 3KPMB 3O2DA 15C8H 1W16A 2RBLA 5EMHA 3DZHA 3QBTB 4KQ6A 3QWIA 4M1DH 1MEXL 5J11C 3HA2A 5GRZA 2WYUA 3T3GA 4CJ1A 3I8OA 4PRPE 1DBWA 1HRKA 2VNJA 3N76A 4OR1A 3TA3A 3JU3A 4AYEC 2AA3A 3ZGYA 4OBEA 4OU5A 3OHXB 2Q1SA 2Q0SA 4FFWA 4M48H 2W8CA 2DM4A 4PU2A 2ZSBA 5FBLB 2QVLA 1CJCA 1MV8A 4GBGA 1QIIA 7FABH 4RESA 2VKQA 5F1OB 3ZWOA 1OXVA 1KXVA 1RRCA 1IQDB 4DP0X 2CUMA 1B4JH 3PS6A 2A4CA 4E9QA 2HWKA 1T5DX 3NGLA 1PDKB 3FD8A 2PYED 5C1OA 4XGKA 4QTHA 5CTAA 5BS0E 4CN9A 1PD6A 1QEXA 3Q06A 3G8DA 4EYEA 1UAGA 2ZE5A 3T0IA 4CMEC 2G5RA 1J0YA 3RPEA 2DYPB 4EA9A 1ULZA 1C0LA 5IM7B 4MYWB 2OZVA 5B1DA 2X3AA 2JJ8A 4Q6IC 2QEJA 5F7LB 5CFZA 1BBDH 5A04A 1Q2UA 4FNUA 5C2BH 5IWLA 3MREB 1BAPA 1NNI1 1TU2A 4ZI7B 3WGUA 1RK0A 3EZ2A 5EJFA 4QCIA 1VADB 5L40A 2WMNB 5I18H 1BZOA 2B1GA 3S0JA 4G8AC 5JCOC 1R0CA 1K5GA 2PH3A 2OBFA 1JG9A 2VJYA 1DZ0A 4PVNA 2DQHH 3S4SB 2F3SA 5HZMA 4HYQA 2QJRA 4QR7A 5D4QA 4F97A 4NEQA 3R1IA 3IAGC 1O5DT 3CSGA 4U2KA 2QVMA 4C4AA 5JIBA 5EUOF 5L8LB 4U6QA 5D7JD 4H1WA 3JQBC 1EZ1A 1Y7HA 1JG6A 2ECOA 3VXKA 1U0EA 2QZ5A 2J8UE 3VFGH 2WWWA 4JNXA 3SBXA 3LMKA 4XP4H 1JGVH 2BXYA 1PFCA 1RMFH 3ZBUA 4DZBA 3UTCA 5C09D 1JLRA 1MZVA 2UUOA 3OJOA 2YWBA 4IUDS 3QQ3B 2Q4EA 2F64A 5JU6A 1T3LA 1VLMA 2CIKA 3LCVB 5KWYC 4JQXA 2QSCL 4N1EA 2PD6A 3POCA 2V9RA 3HY6A 1LO3H 4M1QA 3SKOB 3GEPA 3C74A 1MCWW 1VSTA 5BZWA 4UAJA 5LYJB 4GRIA 2FWOA 3UG6A 4UM9D 1BVHA 2W6OA 5I1DA 5B4MC 2CDBA 1R19A 2VDWB 3WWEA 4LI3X 1WA2X 4X6CE 1NXPA 5T3XH 5FBHA 3X11A 3IETB 5D1HA 2BVYA 3NM4A 4MJ2A 4PFSA 1S4MA 1R9GA 3GEIA 4DPLA 4Z0PA 1XNQB 1XZ8A 4OV5B 5HTSA 1QUFA 1O7JA 4OLWL 1DE4A 4KOCA 4OCLC 4AM0Q 1FCGA 3ZL2A 4JGUA 4RSHA 2ENQA 1PJLA 2I3GA 1V54B 4BC0A 2P24A 3MSCA 5IK2D 3UT6A 2JFOA 1ENZA 1NF9A 3K2MC 4PQEA 4DG5A 5E1AB 4J0KA 3NSFA 2ERCA 2B5WA 1X1AA 4KV5E 5DK4A 4CKXA 1E3MA 3B70A 3I6YA 2R62A 5E9DE 3PJSA 3NWOA 3AFGA 1B2YA 5E9QA 1VBNA 3FQXA 2NO1A 5CMLA 3LUAA 4PSKA 2DZDA 1FLRL 2XIBA 4Y4FB 1TJ4A 4EOGA 3C60D 1KSJA 3D12B 2BNQB 2DKOA 3VXUB 1RZ7L 4EJFA 4H7JA 4N7MA 3W4IA 2YQZA 1YCSA 4KHXH 2Q3JA 3MZGB 1SBBA 2JGIA 4PG2C 2C83A 1FFXA 3RBZA 1DEXA 1CGXA 1YQ2A 5KJ7E 3B5EA 1WV7T 5DEJA 3K35A 4RVGA 4BX9A 3TPZA 3JSAA 5J4YA 2DJSA 1UKTA 4XPGL 1G7CA 3U0VA 1F1AA 4BRVA 1IM9D 3ZDZF 4OXQA 1QFJA 3OQJA 2GCPA 3TZVD 1MZZA 4L1BA 2IZ5A 2KLSA 1QLEH 3GLIE 2HM7A 1ZCBA 2F1IA 1BWRA 2RHEA 2WSLA 4EPSA 1L9SA 3PT5A 5EN2B 4DMLA 1XZGA 4RHFA 5E51A 3MG9A 1KENL 3VWJC 1J0IA 5F9DC 1T2FA 1USZA 4C04A 3HKFA 1TZGH 1HNFA 2BMDA 5D1ZC 5HW0A 1SUFA 2ZPKL 5F5XA 4GMTL 2YVKA 5C9ZA 3DVNA 5SY4A 2ZP8A 3QPDA 5IABA 2PRKA 1UA3A 4FFZH 4OJMX 2BE7A 4HBQA 3WDMA 4N0QA 2CDGA 1EDEA 1L9QA 3PUWA 4YV7A 4PU0A 4XGQA 4WY2A 2PW1B 3FGNA 2OFXA 2Z5VA 4M98A 1WPRA 1T1RA 4XWGA 4M9QA 3FIUA 5EUOA 4WLUA 1MFDL 2WQSA 3EO0B 1WH0A 1FA4A 1A2OA 2WKRA 4GINA 1JJ7A 3KEMA 1JH8A 4YO8A 2O5EA 3PREA 1Z33A 2ZJ6A 5HHOD 1Y5MA 2Q1UA 1FFOB 3PDOB 3NEAA 3UZVB 4Y3UA 4LRWA 3R20A 4G5ZH 3QXXA 2JGMA 4FF9A 3BO8A 4BUCA 3BIJA 2ZJAA 4IOSD 1JK9B 3BE8A 4P5TA 3D4YA 4IW4C 3FFCB 1EFXD 5I23A 5GRJL 1PJ9A 1WZNA 1YY9C 3IOBA 4EI2A 5K0GA 4MV3A 5I8OL 2CEAA 4UCQA 3SZOA 1GGIL 3VKHA 2E7BA 3D08A 4W81A 3E81A 1GYQA 2DI8A 4MDYA 3FSJX 3BYYA 1HH4A 3KAJA 4MO9A 2QVFB 5JYLA 3RUDA 3ZIAA 2VMDA 1L4FA 2WTEA 3QEQD 4IDEA 4K5LA 1NY6A 2R2BB 3DBRB 4I5IA 2BOBA 3PYXA 3QVAA 1SDYA 3D85A 3DQZA 4IGBD 5IJBC 2GK3A 1F8GA 2WMOB 2DJIA 4XVCA 3M7FB 1RJLB 4LGMA 3WNDA 4NYIQ 5NLLA 2QIPA 4WQOA 4YK4C 3RFRA 3ZGOA 3N43F 1YL5A 3KCNA 2IDKA 4HYTB 4BBAA 2H2SC 5EZ6B 1J86A 1ZICA 2AMGA 2VSNA 1H5BB 4D4JA 3WLFA 4PJ5A 3KZOA 2WVHA 4UTRA 3VI3E 4ABYA 4YRNA 2MPAL 3ZWVA 1XEWY 2H45A 3CKKA 3UK6A 5LYJA 4WNCA 4UPDA 1YRQA 4BQEA 4D26A 3L4BC 4EQ3A 3FTNA 3QNXB 2TYSB 3CQ9A 1NSNL 3RDTD 4FM9A 2NU6A 1KFCB 4RGND 3AWFA 3DDGA 2G7ZA 3EDEA 5CD1A 3LWNA 4CUZA 3MJ7B 4XNYL 1S3GA 2AEPL 3U7HB 7FABL 4QRQA 2JZNA 1AS2A 2Y3NA 3CNBA 1FRFS 5IESH 2CDRA 4AXWA 4C4ZA 4TV9B 1UF9A 5IKEA 3FM9A 1I80A 2WYHA 3BEVB 1Z08A 2EEZA 5DXWA 2J1LA 4W7SA 4JHVA 4OPMA 1XL0A 3EHBB 3LRXA 3Q2IA 1BLNA 2O0MA 5SYAA 1L9KA 5FBWB 1I1RA 2ZXQA 3W3AD 4BNUA 7AT1A 4K5QA 5E94B 4QDUA 1TJGH 3VFPA 4GMFA 1W0YT 1T8YA 5FF9A 1R4AA 1YPZE 3W9YA 4B47A 3I9NA 4JHWH 4N1HB 1WCIB 3UZQB 3DEYX 3LV8A 3VRLE 1OJ7A 4QQ8A 5K3EA 4XCEA 1WX1A 1ACJA 1JK8B 2C03A 4JO5A 1LXCA 3C3DA 4UYPA 5TE6H 4Y9RA 1S7VA 1XPOA 4AXXA 1ZK9A 3H1PA 3QJZA 1N7MH 3TPCA 4UEWA 2BFVL 3FHTA 5D72L 1IG3A 3P73B 2ZCHH 1E1QD 3I6SA 3CPLB 3S6CA 2XGMA 3P2KA 3A06A 4GAEA 1HNYA 3LRTA 2MDTA 4Z7UF 4HBZA 3BZDA 4Z78B 1FGNH 5DGRA 5CZXC 4PM4A 4C6TA 5K6RA 1Z06A 2R59A 4JZJC 1FF5A 1RZJH 5IHBA 1ZEAL 3HC2A 2YTZA 3BP4B 2PM8A 3QWOB 4RK1A 2BY2A 1W8EA 4E94A 5HIJA 3VG0H 2P7IA 3DX8A 2R29A 3U39A 1QOQB 1WCQA 5AQEA 4B9EA 3RO7A 4DDKA 3OT4A 1C30B 2GFQA 5DZ9A 5J3HC 1GO2A 4Z18A 1UEIA 5AWFC 5H02A 4NZDA 2DUWA 4AS3A 4TLCA 5MI0C 2Z8XA 4BQFA 3HB7A 1HTYA 4QRFA 2WF8A 3NXKA 1AQYA 3QPCA 4EXPX 3HCFA 4IH9A 4IV5A 1Y9EA 1WEJH 3LK7A 4RV4A 1ZJYA 2YBGA 1Y3BE 3US9A 3RWFA 1ML3A 3QELB 4QYMA 2GJSA 1F18A 1S4QA 1KEML 1PSKH 1JAIA 4TMWA 3Q6GL 4A0GA 3K8QA 4PRAA 1U3HC 2VF7A 1AQKL 3PV7A 4FQJL 1ZITA 2HJSA 4UBIA 1CIPA 1XQXA 1N6UA 1SCUB 5F0JB 3I39X 4PNZA 3FU5A 1U2RA 3O91A 3E9EA 1TT7A 5EE9A 3TD2A 5JR3A 2VZVA 4CMEA 5A2BA 4M3KB 1KYAA 3V6LA 1JFQH 1Z75A 2FZCA 4P2OC 5JQGF 4K88A 5FA4A 2ZCKL 2XTNA 2ZOLB 3ZQXA 5F5NA 1J23A 4AP5A 4LN1A 4BN4A 1PKQB 1LEKA 4BMOB 1RKUA 5I8KH 1CEQA 2Z2YA 4D7AA 3A6JA 5FGBC 3IT3A 3PNSA 5I19L 1IAII 4DRXA 2WIKA 3D31A 1P69B 3BL5A 4ZJZA 4FERA 1H0DB 3MAWA 1SUHA 4GAGH 2KH2B 2H4ZA 1A9YA 3HUJA 2A6KB 1J8FA 3D39A 4JZJB 1NQWA 3P4NB 2JCSA 1O0BA 4K3VA 3N1QC 4KROD 3F5WA 4RGOH 1NL0H 2K78A 4OD0A 4M0LA 3VDAA 2UYOA 3VXOA 4JC4A 3UH1A 3ZTDC 1DBPA 5JMTA 4HFMA 3L8QA 4Z3OA 4HPYL 3T54A 1I85A 1SIBE 1I0LA 1NFRA 2GERA 3TT3H 5G3ZA 3GMDA 3D6TB 4OFDA 5DRXA 2RHGB 2BV3A 1VHJA 4HG4J 4ISCA 4QYIB 4W9NC 4OP3A 3LF2A 12E8L 5EHIA 2HA7A 3L82B 3Q15C 4QUKA 4XVOA 5HYSB 2ECFA 2GD6A 5E4FA 3PHOA 1MFZA 3GKZA 2PD3A 3FPKA 3DSFH 2EWVA 2QX6A 2X0IA 1Z2NX 3DX7B 4B34A 2VLME 2MJWA 1MJ5A 4M7JL 5AM4A 3AI3A 1FYTE 1DUZB 3WFIA 2RFLA 3FFDA 5BV0A 5JDCC 3AEUB 1NBZA 5ALUA 2UKDA 3DX2A 3O2VH 4FHKA 1XH3B 1G7TA 2R2CA 1W5EA 3G1TA 1OT4A 3U1VA 1EP2B 1G21E 1KERA 1OW0C 5I73C 2W0FA 3AT1A 3OTOB 3MELA 5DOVA 3JPWA 2F7SA 3IULA 1CD1A 1EJBA 3CWZA 4N6NA 3HJNA 3S68A 1LJMA 3C16C 1J33A 1N2RA 2UY6A 1Z62A 1M5TA 4JJKA 2G07A 3B9KD 3SQLA 2HA5A 4HVAA 2J44A 2Y93A 5KU7A 1IMOA 1LILA 1ZVVA 3GPSA 1GVNB 2XMGA 1GQYA 2VHXA 2WSMA 2XNJA 1FTSA 5I6LA 2HWYA 4ZI7F 2EIDA 1SPBS 2CSUA 5JD6A 2JDIA 4I4TA 4MDEA 1HZHL 4EEXA 1ND6A 1JEQA 3ABSB 2KLRA 3KPLA 3MRMB 2IGLA 3VWJB 1QR6A 1RABA 3VD4A 1H0HA 2C3VA 3D0LA 2WLTA 1UWXK 2QRKA 4CEIA 5LM3A 1CDHA 4YK4B 1K6IA 1MCNA 3PWUA 1MFBL 4U1SB 4DMHA 4O2CB 4LU5L 2BFEB 3MRFB 2W0SA 1IE5A 4V0QA 4E7PA 4MJ7A 1P7ZA 4PRNB 5JPCA 1Q1JH 2RAVA 1W35A 2OORC 3I3BA 5EU3B 3ZY5A 2J85A 1JOIA 3N9GL 1YQUA 2UY7A 3GJ3A 5F9OH 4YRPA 4BATA 4CFSA 5ALMA 2PP8A 4OVUA 4NFCA 1R4MA 3GTVA 5CCEA 3QBJA 1DXOA 2Q9BA 1D6VL 5EPMB 3MBKA 2X9VA 2QI9C 3IAXA 2HFEA 4I3FA 3ZJVA 3RIYA 4QGSA 5DEFA 2P5WD 2ADIB 3P3YA 1NOIA 2AGJL 3L4ZA 1GL6A 1MNAA 3IV7A 4JUCA 1A6ZB 3ROQA 1E8MA 2B36A 1UCFA 2PRSA 4BE9A 1CUJA 3PFGA 1DQTA 5MEOA 2B83A 2G9VA 1IC5L 3ARTA 4DWHA 1ECPA 3KQTA 2AFVA 3BSSA 2CFOA 5B1EA 3BD5A 2BS9A 2JVIA 2P5TB 4PLYA 4OF0A 4XPFL 5E03A 3WI7A 4JITA 2QD2A 5JMOA 3QS3A 4AMKH 2NNAB 1HQRB 4M1CD 5AVWB 2FPGB 1L8OA 3TS8A 1HA3A 4BKSC 2FIKB 1RZ3A 4IHKA 4XXCA 5AL8A 4JZOB 5CR9A 5EMMA 2I4LA 4JM2A 2VOJA 2PZJA 3TZVA 5E5MB 4FFYA 2M6RA 3RE1A 5FUMA 3E7JA 3FMOB 3IDJA 2J6EA 1E0KA 4ZRGA 5DHVB 3QENA 1RZGA 1YEFL 1UBFA 2PEYA 2OP0A 2YA0A 4Q4EA 3EOTH 2V54A 1XGZA 3TFBA 5IESL 3GLHE 2BHUA 1HO3A 1UWGH 1TF7A 1EFXB 3CPUA 2IY8A 2IX9A 1RY7B 5TR9A 3D25B 5D7JC 2YWCA 1ITBB 4FCWA 4TSFA 1PY9A 2VLJD 2UZYA 4I9WE 4KC3B 3CLKA 5GOZA 1YFJA 1V10A 1A9XB 2D3VA 1TVEA 4RISL 5E8NB 1RWPA 3T6VA 3LF1A 3QQDA 3IDAA 4YH1A 1IGCH 2PQ2A 3B2VL 1OCWH 4PREB 4UAUA 4KXAA 2F00A 1F7UA 4AMGA 3COZA 1M2EA 2WNWA 3IKKA 4XSGA 3WIHH 4BFBD 3A36A 4R7GA 3TEXA 4EB8A 1SF3A 2H6PA 3FHCB 4CR6A 3QE3A 4V0NA 1AGDB 4L8VA 3KV3O 4M88A 3RBAA 4LSQL 3KWWA 5HHXH 1HL4A 3TZEA 5CBAA 4P4TA 2YFOA 4OT1L 2C7FA 3VXSE 4BRWA 3JYOA 4DYHA 1AJEA 4O5LH 4LJ8A 3D3VD 3GCWA 2IBSA 2BONA 1EU1A 1IQRA 4R2IA 4PWJA 4M1KA 3NHSA 4Y4FC 4AEHL 1J7KA 5JHGB 4DPRA 2HTKD 2CLLB 4HQOA 4OM0H 4QYXA 3HC7A 1E1KA 4R1TA 5A5GA 4PGBA 5C1PA 2XEXA 3DCIA 3TZCA 4U7TB 1L7MA 3KAPA 2NY7H 3KHKA 2NXCA 4DZ8B 3QHQA 3UKJA 4ABUA 2FMKA 4MYHA 3SQNA 3ZYJA 1I7QB 5KBNC 5KJRL 4YUWA 1D2NA 5GSVB 5CXPA 1RQ7A 3VR3D 5KSBA 1M3JA 3L5WB 3H0KA 2NDFA 4YK7A 3K0CA 4PYNA 3EEYA 5ADHA 3CUVA 1CICB 5EBMB 3P0RA 1TI7A 4FUTA 4HAWA 2V8MA 4EFMA 1IBKB 4D98A 4HDMA 4OGWA 2YAOA 4FCCA 3PWLA 5ALPA 3RI5K 2D7TL 2KC0A 3LNGA 1KPRB 4XX0B 1R24A 3NTRA 4NO2B 4BVHA 2RH4A 3OOJA 3VWJA 1GTL1 3AEKA 4IXWA 3BZ4B 4PV8B 1WA1X 4AE1A 2ES4A 1V7ZA 4ZU6X 3OHMB 1P62B 2W60B 5E8EB 4QI3A 4YR6A 1ANKA 3WIOA 1GRVA 4RNCA 1NFIB 2XWBB 2FMFA 2XN9B 3BJ91 2FUQA 5T33L 5FECB 3D6NB 2PKWA 1T04B 3G9QA 1DU4A 2KMWA 3LT5A 5I7UA 4F11A 3HPRA 4HOXA 1VPLA 1Q7CA 2XUZA 5CA0F 3T3PF 5ALDA 5FA5A 3MCYA 4WFFD 1Q1QA 1JSCA 3UIYA 3RFFA 2DFVA 1N2BA 4TKUB 4UT9L 1YMUA 3SO3B 3EDRA 1DQDL 4E5KA 1JBQA 3QNMA 1DLFL 4G5GA 4FHZA 2VSOA 1KYOJ 2BP5M 1WFOA 1U8PA 4DP6X 3TDKA 4UEKA 2ZYTX 2YWZA 3MRNA 4ZCTA 1RYEA 3QQ4A 1E99A 1Z36A 1O6ZA 3OQOA 1UBTS 1UOVA 2Y0SA 3QXUA 5GSRB 4PN6A 1W34A 3QF4A 4IKIA 4O02L 5AOKA 2W4MA 4EX7A 5MDHA 3RTQA 2HQ1A 5CYOA 1E5TA 5GOTA 3SJCA 1QSEE 5IOPA 4PQFA 1N7HA 4HDAA 3MUNA 2YFQA 3SSMA 3CFDA 3V4UL 4R7DA 5AAMA 3RSSA 1BH6A 3TJPA 2CUTA 4C56D 2O54A 1JFTA 4DFIA 1VJTA 3E6HA 4WJG3 4Y19E 2YOFA 3IFOB 4NMXB 3VYWA 5JXIA 1GRQA 3IQZA 4PI2A 3MODL 3VZQA 3AJ8A 1ZD1A 3UDWC 4JYPA 2QQFA 5EI5A 4OZIE 3K6SA 4NQCE 3V4PA 3BJZA 1XF2B 5C0IB 3C3AA 1YEIL 2VYQA 1FBNA 3K72A 3K2IA 3CZCA 4LY0A 1L5GB 2BCJQ 2FZGA 1HHIA 2PZ8A 4NQEA 1QK4A 1RZFH 1KP9A 1PS0A 2YAEA 3W11C 3TCLA 2RHMA 4WFEE 3BPCA 3ZU2A 2O2JA 3P2YA 3UC2A 1CF1A 5DM1A 4G0OA 4F60A 2QQNH 2G09A 2JC3A 2W07A 1I6KA 1V1MA 3QFJE 3F5SA 5AW7A 1EDYA 4N8PA 4AJ4A 3DLBA 1XYGA 3GO1L 2QDXA 1P80A 5FLUA 2X70A 3ULSA 2EDWA 3EGXB 3APNA 3U44B 4Y2YA 3R24A 5AENA 5DLPA 4B53A 1WZ1H 4TN5A 3PGKA 4TS3A 5EZJA 1HKFA 2WCSA 2H1SA 3LM8A 1JAXA 3RWFB 5KYUB 1NT4A 1XDSA 3BIKB 2P62A 3FLBA 3HJTA 1OOAA 3MNDA 4Z8FL 3X3FH 3TEZA 1JXOA 1U8AA 4YRTA 4PHTA 1NN5A 4UHBA 3N3BC 1OE1A 1ODTC 5I75C 1ECBA 2XBUA 2V2WB 2YIJA 1OTSD 1YS1X 2F53A 4Z0HO 2VO1A 2EIMB 1Y0BA 1HQYE 3LKNA 4HDOB 5HY9B 1CGVA 3CSYB 1ZI6A 4ASUD 2BIHA 4QRRE 5B57C 1R27A 3M6DA 3W38A 4FHCA 4UUNA 2V65A 2E56A 3U3ZA 1U3ZA 3EGWA 4LXFA 3DEHA 4CU6A 6REQA 2XQVA 1RWVA 4YHBA 2FATH 3RREA 2CL7X 3FCUB 2L4OA 3R23A 4QHYA 5K8LA 4PJXB 4K6FA 2AD1A 3DZJA 1F1JA 2YGOA 2G75B 1AVAA 2GAAA 1K72A 4ZIRB 1FG2A 3HBGA 3E2HB 1GLGA 4WHCA 4RY2A 4BJ6A 2IAMC 4WF7A 1D6JA 2JFXA 4PZYA 3GRRA 1MHEB 4TYNA 1E4KC 3FWNA 1AGRA 3F6IA 1S46A 3WS6A 1MJUL 1PLJA 3C6QA 3IEIA 4F71A 3OHMA 3H56A 4K28A 2VJBA 1GRNA 2CUHA 3Q5DA 2XLBA 2EJVA 3QA3B 4RWZA 3TFQA 2RHCA 4HDMB 5DFWH 1ZJJA 4ENQA 3WK8A 3S36X 1BXXA 3Q0EA 4XNQA 4LQCA 1BQHG 2YW9A 5A7HA 1JNHA 3F6SA 1H0KA 3O90A 4JPWH 3DX4A 2CL5A 4X1YA 3D0OA 2FDXA 2BLLA 1DJXA 1GR0A 1HNZB 4LGVA 1B4TA 1I9IH 1PZNA 4NN7C 4GLLA 4WW2C 4M53A 1KYQA 1UZUA 4H7KA 2AF3C 2ZROA 1QQ6A 4FMPA 4L0QA 2YZKA 1GGMA 5DJAA 1DXHA 3HNSL 5I8EA 1YEEL 4PV9B 3AACA 1Z4QA 1WR8A 1NUGA 3MD0A 2BS71 1Z6AA 3R8CA 1ADWA 2PSJA 3CHYA 3H4TA 3P4MB 2WPDD 1IGYA 1NCAH 5ALCL 4PRID 3F0TA 3R7WB 1SXNA 2D2OA 1A9VA 1J0AA 2PWAA 5E56A 1T35A 4P05A 4N90E 3T4AB 3QV2A 5E94A 3KVOA 1U8JB 2HRGA 4P4KC 3M3DA 3IBOA 6GPBA 3LKQB 2X9ZA 2AJVH 3Q48A 3E8UL 4E2XA 1U8LB 4B76A 1CR9H 1W8DA 5CMAB 3A25A 1KDIA 2FX8L 3BE6A 1C9KA 2H2HA 3QPUA 3VU9A 4Z8YA 5AIBA 3OLQA 2G76A 5EJ8A 4RVBA 2OJZL 3KYIB 1Y33E 3LNDA 4BSJA 3WKCA 5B1YA 4GFXA 3OZCA 2FR4B 1Z0SA 3U25A 3EXHB 2OVFA 5C8YF 2XRZA 3O9WD 2OSWA 2F5BL 2EDXA 2XE8A 1CS6A 3MLBA 1YNTF 4LSRL 1JWBB 3STHA 3QJQB 5FUOL 4MJ5A 1X5YA 2ZWLT 4R96A 4FFZA 1LQUA 1KOAA 1V8ZA 3V5HB 2YY6A 2ZJ8A 3QWRD 3RIEA 3KWXA 4NXNB 2D8KA 4B27A 3IAS1 3KB2A 1CF8L 1ODLA 3A2LA 3I1YA 1JN6B 2PCPA 2Y92A 1CFSA 3WGVB 2GRUA 4TTAA 1DSFL 2BOVA 5JADA 4J3JA 1JBEA 5ESWA 1KB5H 1Y89A 4PD4K 3VR1A 4YLYA 2BCEA 3ZLTA 2C3PA 4YT4A 1IM3D 1Z3GL 4RPHA 1N2ZA 1OEZW 1VSQA 2RR3A 1EIZA 2A9BA 4BLQA 3I9JA 1XEXB 4NFSA 1C3EA 1VMEA 2BEWB 3JR3A 2QQGA 1AF4A 3IXTB 1RUKH 1B4LA 4XUDA 3II2A 3LE8A 5K9KA 4P8QA 2HCJB 1XSEA 3ZHUA 1XZQA 5F9WB 3CZFA 4QGGA 1DAGA 3FNEA 3Q5YA 3VWKA 3BA6A 5DVPA 4J12A 4JA2A 4EMZA 3QORD 4OLYL 2P52A 5KJRH 2Z64C 2ICAA 4H1VA 4G0VA 3GRBA 3VPSA 3HUJB 4V2CB 3G7TA 3GMOA 1WBZA 1QI5A 3UB3A 1B0PA 5G0SA 4Q7LA 4MMZA 1R4ZA 4PS4H 4Q3OA 2KMLA 4DNLA 1F00I 3KL0A 5CLXA 3VI3F 3VZPA 3OTQA 4CG1A 4GI2A 5ICGA 3DH0A 4CKCA 3UG3A 2G1AA 1L0YA 3MGTA 4A8PA 3I9V6 1SCAA 2OMBA 1YB4A 3TGLA 5J23A 4NBYB 2H1RA 4W1QA 4P3NA 2J6BA 3W3AH 3HZ3A 3GLGE 4DFHA 2YGNA 3EUEA 2G4EA 1RUPH 2V6JA 1GAWA 2WFAA 3MUFA 3UZEA 2WBXA 3C1AA 3MNVB 3OSVA 2XQYA 1R3HB 2A5GA 2HDNB 4R7NA 3Q3GE 3T3IA 2AYYA 1UDXA 1NUAA 2B8NA 1L1EA 2VHWA 1QPGA 1V8FA 3I5XA 4DIKA 4KMTL 3WFCL 1GQFA 4ZVMA 4E4RA 2ZX9A 1AYOA 3TVMA 2WXNA 2DFDA 3CSUA 2UYCA 5DLEA 4M1CC 5FO9B 1Z5ZA 4MAMA 4YDIH 2I2BA 1SDDB 2JK5B 3IM1A 5KDOA 3ERXA 2Q2EB 4Z0XA 2P5UA 1OH7A 5AVKA 3MTGA 3BEWA 2ZUUA 4PJ8D 4YB8A 2CPUA 2W2QA 5A1JA 3HLTA 3RRYA 1U1IA 4RAUA 5IT0A 1RPNA 3WJJA 3DX6B 3T0VA 2AC7A 3MN8A 3H5IA 1IKNC 4UWQB 1K2DA 4OQDA 5T1JA 3VDXA 2HAZA 4BNXA 1I4FB 5I8EB 4F85A 3S1AA 1O57A 1XCJA 5DZPA 3JRNA 2K7FA 5I8WA 1SXPA 1AP2A 4KXZI 4IU3A 1HTTA 1CUSA 2BXZA 3OZVA 3PX3A 5CT4A 3O3BA 4N2NA 3L95A 4NP4H 1VERA 3DURB 2QAGB 1XRJA 1ECYA 2Z8YM 4J0FA 3WU1A 4V0OA 4XHJC 1SUCA 3ULUD 3TBSB 3QWNA 2YCLA 4N3GA 3NDJA 1KE2A 4NU8X 4TTRA 1JTTA 3VE0B 1UPCA 4N2IA 2F59A 2BHSA 4NZMA 3ZHSA 1EM8B 1G8AA 1RZFL 1U8OB 3PJRA 3X44A 5J4LA 1K8ZB 1CZRA 1W94A 4PJ5B 1TZGL 4C2BA 3ASWA 4ZSOE 2CLRA 4AIIA 4V3BA 1FGVH 2Y3IA 1NV8A 1NBYA 4EPTA 2Q49A 3D06A 2EFEB 1YJXA 1QI3A 1P4SA 2CNWD 5H1YA 1YACA 3M8OL 3ZTTA 2Y68A 3CR7A 2YDYA 5B1SA 4ZW3A 5EDSA 2WN3A 2EDTA 1DIAA 2XWEA 1B73A 1W6LA 2Z98A 5L2KE 1PV2A 1CWUA 2PR4H 1LO0H 1A7QL 4Y2QA 3JTTA 2CGZA 5DQDL 5D84A 3CFEB 4EUKA 4YPJA 3ROXA 1ODUA 2Q20A 3MUGA 2VPQA 4L4TD 3N7AA 4N5MA 1DVFA 1W29A 1FVDA 2HRRA 5DTRA 2AF4C 2IH3A 2CD0A 3AHDA 5B1KA 4Z3DA 1UH2A 5EZYB 1TYBE 1KJJA 2DWCA 3G5ZB 4EJSB 4IMRA 4F9TA 1XB6A 2EDBA 4LYGA 4JKPL 2K9FB 1QSGA 2Q9UA 1TJYA 4G80A 4Z6AT 2GTHA 2BDNL 1FJGB 2QX7A 1P6XA 3CR8A 1NBMA 1G4AE 4TTJA 3EIEA 4Y1RA 1IN1A 3P4UA 4B6PA 4ZPTB 5L95A 4IKJA 4CDGA 4JLRB 4M8UA 3F00A 3VB9A 1FIGH 2GJ6A 3PNVA 4I2XA 1F8YA 4PGDA 1A98A 3N42F 4D81A 3SDDB 2IY9A 3BMOA 1VB3A 5MHSE 1SBHA 4G43B 3GPBA 2A9VA 4L73A 5EEUA 4OI0A 3VWKB 4DADA 4HAFA 5D2LF 1P5UA 1E3DA 2ZR0A 4WKPA 3M1LA 4Z4QA 4WI7A 4Z78A 2C4TA 1YEGL 5HE9A 1YFZA 2V7UA 2VJXA 2J8OA 3D3KA 3FUMA 2XNAB 4GOXA 2B8TA 1H8ED 2N0MA 1PGRB 4F7TA 1BEZA 1JWAB 3D8NA 1EMDA 4U1HA 5KYGA 3H19A 3U81A 4LK3A 3RYHA 2XTAA 5KI6A 3PE4A 1WW3A 1KF0A 2NSXA 2ZVDA 4I2VA 1P2GA 4X3PA 1NXOA 5REQA 3QLEA 1UB6B 3V4RA 4I18C 1BZ7B 1KRWA 2X5KO 2PGIA 2OKGA 1DQRA 5A06A 4G9DA 1TZBA 3T4AC 3WNPA 5JBIA 5I7WA 3UZEC 3RUHA 1C1DA 2O8NA 5JISA 1DBML 3M70A 1I1OA 5DI8A 2FKNA 5A6MA 4LV5B 1F38A 1C7TA 2XMRA 1QZ3A 1W25A 5JIMA 3HVHA 3RUIA 1UXMA 3SKVA 1P7VA 1A96A 1XZCA 4GH5A 4HZLA 3P54A 2HF9A 1QSVA 3GTNA 1JS4A 2H26A 5K2OA 3QVVA 3MQFA 1BVZA 1J5OL 4J2HA 3NGBB 2VAPA 5JZBA 1Z5NA 3UNXA 2XUQA 2I29A 3F98A 4F8QA 1GJUA 3C4VA 9ATCA 2E9JA 4IHOA 1YMQA 3DONA 4OQ4A 2HRLA 1I3NA 1WIWA 3BMNA 3JSXA 4L4XA 4UCWA 2VL5A 4ZW6A 2WLYA 4YGVB 1YCHA 1WVZA 1G5RA 2VWGA 3MWLA 1SC1A 1V71A 2JFCA 3DPSA 4MIOA 1OM3L 3O8XB 2X6VA 1U8EA 4KR7A 2K2QB 1J2EA 3KUCA 4ZPXA 1GPBA 1NFDA 3IDSA 1JKJA 4GWKA 2ZBFA 1FDWA 3I45A 4PRHB 3QJSB 3OPYB 4OCRH 1EA5A 2PX4A 3OSKA 1XTQA 2WQWA 3FN0L 8ADHA 3M17A 3WB0A 3PJNA 3HTXA 4DL9A 3OQRA 2XPCA 3U82B 2JFBA 3KOZA 3BDVA 1SN7A 3ABKB 2JCBA 4NC9A 1SJHB 1P1CA 1L5SA 5DNUA 1U91B 1T2VA 4F1SA 1CLOL 4BMPB 2ZE6A 2VR8A 3SS9X 2PUGA 1AHWA 2N7AA 5GHWL 3K80A 2MYUA 5JW4M 3DXZA 4AKEA 1NG1A 4R0LA 3ZGIA 3A2KA 1OBFO 2IW3A 3SCZA 3HO6A 2R7MA 5A9SA 3RDTB 4DPCX 1QG6A 3AGQA 4YRJA 3RIFK 5C0CA 3PF9A 3I6IA 1BQKA 4DV2B 2KHZA 3PDCA 1I5OA 3WLNA 2FWOB 3KQWA 1ZM3A 1KXTA 4INAA 1XH2A 3A3NA 4M1SA 2EBFX 2JK0A 4Z7VF 1P5VA 2XZCH 4BNMA 4NCAA 5IQ7L 4A1OA 2P2SA 4Z3IA 4WNAA 2H1IA 2HA0A 5AUOB 4K9OA 2PH7A 3RB5A 4AQ1C 2CHWA 2G7MC 3KBBA 4Y9TA 3SKMB 3HRPA 3B3GA 2AKAB 2WPDA 3N85H 1QI4A 4K05A 3QXDA 1XMEB 2GBCA 3OA2A 5JBNA 4B3CA 3QEOA 4CNBA 1NJ9B 3RP1A 5KNCA 3DUWA 1BWSA 2J6EH 1A64A 1H9CA 4X91A 3FOMB 1ZJBA 5T5FA 1R0XA 3DX1A 1HE5A 3TXXA 1TJMA 1QKJA 1QWUA 1E94E 3D2LA 1GA1A 2WC7A 3S98A 2HN7B 1NAKH 4OZHA 1M7DA 5HHMD 2YPLE 1I1HA 3RVOA 3A67L 3RWHA 3FCBA 2NLJB 2BEVB 3CMOL 1HMPA 4LOHA 2ZM6B 3KHQA 3BXFA 3WE1A 1K5NB 2OZ4H 3UJCA 2NX5B 5C08D 1R9JA 5IU6A 3CA8A 5G4KB 1Z07A 4LVEA 3LH2H 4Y2JA 2H8KA 2BFEA 4Y4KC 4TNVF 3RVVC 3LVFO 4M56A 3DETD 3AT0A 3LN5B 4UBOA 5IVZB 5AZ2L 2WG2A 1UCTA 5CK4A 1N0VC 1T1EA 4L5FL 3AGWA 3TLKA 1HK6A 2DR0A 3ASYA 5JATA 4JJGA 2QGBA 1NJ5A 1MWOA 3GZOA 1KNXA 4ILEA 3QCUL 5P21A 3JD3A 1XD0A 4YRMA 4KR6A 4GBXC 4IMLA 3IP5A 5C0FB 5GZNC 5IZCC 5ALRA 3G13A 4JYMA 1GZDA 1YNOA 2Q07A 4PJGE 5JTUA 2L8AA 3STYA 3OM8A 4PYOA 5KMGB 2V8BA 5IJKA 1OHHD 1R7RA 5TGBA 1PR4A 2IYVA 4RE5A 2YXLA 1E2QA 5F7DB 4JY4B 1XQ9A 1YCDA 1BCSA 3ME0B 4ENVA 1SEBA 5FXCH 3WOVA 3LNHA 5CHEA 2ZE8A 4F3FA 5DR5H 4AS1A 2W65A 3SDXB 3LC0A 1OLSA 2FN9A 2J3MA 5CBPA 2B08A 5D01A 1Q0HA 2XA1A 4WGGA 3P9WB 4M36A 4RFSB 5MERB 2KZKA 2OL3B 1KGJA 2X1LA 3QFDA 5ICZA 3QQPA 3QUMH 1N8OE 1F45A 4RGOL 3H9UA 4FZ8L 5C8YB 2OEPA 4JM2D 1E0SA 1I51A 5ELXA 2Z95A 4I4WB 3DXAE 2G0KA 4Z1OA 2NIPA 2DTXA 1U3VA 1A82A 4J4PC 1I9RH 3B9BA 5BSFA 1EZSA 2J9FB 3IP1A 4ZNEE 4E1AA 2PYEE 1GD1O 3A7EA 3EXEB 3HN8A 1H6BA 1K1EA 3NWJA 2CGRL 5DUBB 1DHTA 4XEHA 3ZX5A 1ATZA 4H0NA 4RGMC 5DHVA 3DQQA 2ORYA 3HE7A 1P4IL 4WNQA 1OBCA 4W8GA 1FYEA 2YVLA 1DFBL 1MHEA 3E6AA 2YN3A 4OD2B 4OJFH 4P46B 2Z7YA 2BIPA 1TR7A 3GWJA 5EGNA 1KQGA 2D5LA 4D0SA 5MN5A 1WISA 3WSQH 2NY1C 3BGAA 4PJ7A 2AVNA 4KWUA 5DUML 4EQ6B 1P0SE 3QJHA 2P49B 2VQ3A 4XVUA 4AKPA 4YHKL 4NO0B 3HIZA 5I82A 2KPOA 5T1LB 1CICC 4MWCA 2FZWA 1TA9A 3VKVA 5CN1A 4DIUA 3I0ZA 2VAWA 3FQRA 1WDAA 3T09A 4KTEH 3C5CA 3M81A 2QTZA 1N4XL 4ZVKA 4HIIA 1QFUH 1E4OA 3AETA 1JHXA 4IO0A 3JCZA 1YJDL 1M74A 1YQQA 4XAWL 5CPBA 2AGJH 4FXOA 3IKVA 5DLDA 5JQ6H 4MV9A 4YLCA 3F8TA 1TTBA 4UNUA 2IWHA 1T91A 4QHUB 4Q4JB 3ZZMA 3V6OE 1Y3IA 4IIYA 4YAUA 2JFYA 2Z2KA 4BH8A 2HVJA 2Q6KA 3RX7A 1SXAA 4RM3A 4EG6A 1OFVA 3BAZA 3UJ9A 4DAEA 2DIAA 3EVNA 4EDHA 4ZEWA 1XLWA 3HG2A 2DM3A 3FCGA 3MYYA 3TF7C 2W95A 3CM0A 1N8KA 2Y1KA 3FB8B 5J4VA 2AQPA 5ESVB 1EK2A 1IZZA 4RD0A 1W96A 3VBCA 2HX9A 4QDGA 5EOVA 1TZ8A 4L4TB 1GY2A 4IKKA 5I0ZA 4AM0A 2F4NA 2NP7A 3HRKA 2P1RA 3HC0B 1OTTD 7ADHA 1W72H 2VJOA 4HU8A 1U9YA 1BFSA 4O2RA 4X6DF 4PGCB 4Y6LA 2ODQA 2IE0A 2IHVA 3KL4A 1Z6PA 2Q8AL 4PJIE 1F8TH 3KTFA 1NQVA 3TLCA 3SDCD 5KSWB 1ZK5A 3LKQA 1KYOK 5DVLA 4OB8A 1XTIA 4X8XA 2ZKHL 3VQLA 1OIOA 4Q6BA 4BZ2H 1H3UA 3WIHA 4Y6OA 4EN3A 1CUHA 3WV4A 3ZHNA 1T3FA 2XYCA 3VV3A 1G5TA 2AJXH 1GFSA 1QIGA 2JIRA 3O4JA 2R6R1 1UBEA 5EVJA 3E3NA 4RKQA 1NQTA 3A4NA 1UZNA 4I1SA 4QNMA 3ORJA 4DKJA 3EADA 2P6PA 2C7RA 4R7VA 2AUMA 2RAFA 2V4LA 5SWQB 4PGEA 5TF1L 2WM9B 5F21B 3MCUA 4HUQA 2WV3A 2WY2D 4CVXA 4EA8A 1JZTA 2Q3CA 5K7SA 1E4HA 1MJGA 2FR1A 4HK3J 2EZTA 1XQ4A 3VXRB 3PHAA 1BF8A 4LDZA 1T6WA 2AN3A 2E0IA 3GZPA 1X80B 3L9RA 4Q01A 2SNIE 2VDQH 5A2FA 4LXUA 4AIZA 2WBWB 1JLLB 1UXSA 1VL6A 1FMJA 3MLUH 3H2SA 1TQHA 5AAMC