2VDLL

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdlL01
5J1AB 1WCBA 5D7SH 1UJ3C 3HZMB 4Y0GA 4YDVB 5HHPB 3N85H 3OB0K 3ZYJA 5GS0D 5J6GB 1F45A 3DV4B 5FKAA 3GRWL 4KQ3L 4JFDA 1BZ9B 3O3UN 4O02L 4X8JB 3KPRE 2CJUL 1DBKL 1NFDE 2C1PA 4RGNB 4U1KB 2DD8H 4BK4A 4URTB 1VGKB 4OCNC 2ZG2A 3WNKA 1PAMA 2J88H 4UILL 5DJDB 3F65A 3IFLH 1YQVH 3E8UL 3UTQA 1G6RH 3DGCR 5GIRB 2O5YL 1AXSA 5I1KH 3TBTB 1A6ZA 4HEME 1MIMH 1RIHL 1J88A 4YZFF 4K3JH 5CJQH 4QRPD 5DJ8A 3UBXI 2NW2B 3MLSL 2X05A 5ID1B 1Q1JH 4ODHL 3Q5OA 3WIHH 3N1PC 1NC4D 4XP6H 4YHPA 4WEMB 1ZOXA 1CDYA 2JB5L 4S1DC 2XZQH 4ONHB 2H8PA 4HIHB 1XGUB 2V5YA 1ZAGA 5IQ7H 1AXTH 4W4OA 2YD4A 1PVHA 4AIXA 3WFCL 4PJ9C 1RZJL 3RVUC 1IEBB 2FBOJ 3D39B 4MDIB 1NAKH 4PJEE 3BW9B 2FIKA 3TWCH 1U8KA 5F96H 5CD3A 1GCFA 4FZ8L 4WUUE 5AZ2L 5HGDA 3VGGA 1RU9L 3MNVB 3QPQD 1M4KA 5EDXA 4WW1B 1YNLL 5GRUH 4OZIE 5ADPL 1OAYL 5JOEA 1JZ3A 4FP8L 4JKWA 2DM3A 3ECBA 3VWKA 4HLZG 1BGXH 1JPGB 1P7QD 4K3JL 3KPTA 4L3EE 1X4XA 1MWAH 4L8BB 4Z7OE 1F4WH 1OF2B 3AU1A 1FL3B 4HC1H 3OKDB 1QFUH 5L2KE 5HI3D 3DECA 5FK9B 4OLEA 4DN4L 3EGSA 5CEZD 3MNVA 4WRLA 5JR1H 4P4KC 4NC0B 4LASH 1CDHA 3ECBB 4GG6F 2DQCH 3AROA 1IEAB 3VXNA 1HCFX 3SDCD 5CAYB 3PWNB 3VGDA 5GHWH 4RISL 3EHBC 3PWPE 5LKNA 3MBXL 4PRAB 1IM9B 1N7ML 4HBQA 4LEOA 3NPZB 2HFFB 4U0RC 1MI5B 2XNAA 5JNYA 3IFNL 1FE8H 3RUGF 4YHML 2VSCA 3DV6B 3U2SA 3UJIH 5E9DD 5I76A 2EKJA 2AJVH 1FZMB 2YUZA 2CRYA 4DN4H 4JGMA 5DYOB 3LKRB 2XACC 4K8RD 4FQ2H 4WGVB 4YHKL 3MRNA 3O2DA 4Y2DD 1HQ4B 4H5SB 3ALPA 1QSFD 4Y1AE 2AK4E 1DQLH 1WFNA 4ZAKC 2VIRB 3BZ4B 4P2OC 2X09A 5IFHH 4JPVL 2M8XA 4HWZB 4P2RB 4X9BA 2ARJQ 3TYGH 2GKIA 1DBMH 4LIQH 3QQ9D 3JVGA 1I75A 4YQXL 4MAUH 1GIGH 3WIIH 5BS0A 1D5MB 5BV7H 1NUGA 3ULUC 3HUJA 2BSTA 4Z9KB 4HK3J 2Q86A 3ZSTA 4N1CA 4QNPE 2VN7A 3NCBB 3WNLA 3SDAA 1PJ9A 1F4YH 1A7NL 3OJVC 4OJFL 5F88A 5CSZB 4XHJC 1WWCA 4YGAB 3O11B 2JB5H 1W0VB 3QFJA 5F9JB 4ZO8A 5IMKA 5DURD 3AAZA 3SY0B 3C6LA 3ROLA 4LDEB 1Q1JL 1VEMA 2MHAA 4HIIA 5GSRA 5CJXA 1IQDB 2IC2A 4PGCB 4DGIH 3TWCL 3UTOA 1MFBL 1KCUH 3LRHA 5DT1H 3DX6A 3JV4A 1AKJD 5KVEL 5L6YH 2XN9D 1UJ3B 2OLDA 5TF1L 1QVOB 4G7VH 3MBEC 1AGBB 32C2B 4ZTOH 3B9EA 3FFCA 3REVA 3SE3C 1Q0YL 3KHOA 4XI5C 5JPMA 2J2ZA 5SWZA 1Z0MA 3O8XA 1N0XH 2BVUA 3JWOC 1OP3H 3K46A 2OP4L 2IAMB 5IIEA 5EN2B 3IDXH 4JB9H 1PSKL 1RZFH 4RDQG 2GSIB 5E7FA 3GK8H 4J4PC 2F8OA 1WWWX 4CVZB 1RVFH 3GMQA 1NH6A 1P4BH 5AAMA 4HUUB 3CXHJ 3NVQA 5IBUG 2R4RL 1OLLA 2CSPA 2DF3A 1EO8L 3UROR 4WU7B 3CNKA 1BVLB 4AT6A 2EDNA 4Q6IB 3H9YA 1QBBA 2JK5A 3PGCB 1R6VA 3MCKA 5FGCB 1S7UA 1MAJA 3DTXB 1DEEA 4G6MH 5C0DB 5FO7B 4PUBL 1Y6KR 1UGNA 3HFML 5IFJB 4F9PA 1IAIL 1NSNL 1BX2B 5DMGD 4C83A 4Y16C 1WBZA 5GGTL 4CVZA 4U1HA 1NCCL 5L88H 5GJSH 3LSOA 3GGWA 4HIXH 3QRGH 1M71A 2HFEB 3SDAC 3H3BC 4K7PY 3BH9B 3D25A 3MZGB 3PWJB 3ZDXE 1X7QA 2WWMD 3WJJC 4E41A 3RVWC 5BJTA 1SYVB 4Y4FA 2F5AH 5HYSG 2C1OA 3RL2B 5SV4A 1WIPA 5SWZD 3LS4H 3LKOB 3NACL 2BSSA 4ZMAT 3SDDB 4GBXA 3HZVB 3U46B 5FUOL 4NM4H 3NZHL 5L9DL 1F02I 4GXVH 3QCUH 1BZ7A 3MJ7A 2FHFA 2FL5B 4HXBH 1ZVHA 3ZTNL 3I6LD 1OAKL 1X7QB 3QUYB 2VDQH 1DEDA 4OZHA 3U79A 1R0AH 2KZWA 5KS9E 5ITBH 3KGRA 6FABL 3SCMB 2CKNA 3PGFH 4OZFB 3C6LD 4WJ5B 4J6RL 4CMHC 3NFSH 3VD9A 3Q1SL 3QFJD 2ZUQC 3DX7B 5D7IE 5CBEA 2Y07H 3FN9A 2CDEA 2E7HA 1R3JA 4EN3B 4HLJA 3O6FB 4P46C 2DQFB 3U0WL 4C59B 5DMKB 5I9QB 4TSCL 1BZ7B 3QRFM 3OKEA 4JHAH 1I8LC 4MJIB 3PP4L 1PYWB 1MHHA 1QBAA 4FQ1H 3LIZH 3P9LA 1ED3B 1J1OH 5D2LB 1MCIA 4L8SB 4J3UA 5BS0D 4WI2A 5CS7A 3W11C 4LCYA 3VXUA 3SDDD 2NY2C 1I9JH 3S37L 4GRWF 4JFOA 3EZ8A 4PRDB 2R56L 2A6IB 1TPXB 2N7AA 1L7IL 3WLWC 5CGYD 4OFYD 1DDHB 5GGRB 3GSOA 5D1XA 4HUNB 3MV9E 5GS0C 4DK6A 4H0HB 1ZVYA 2QQLH 3CXDH 1UYWL 5DUBB 4YEFA 2VKWA 4J1UB 1A6TA 1CK0H 4E0RA 4QXUH 4NO3A 4OQTL 2UV3A 2YD7A 1WICA 4LNRB 4XPBH 1R3HB 3INUH 3SGEH 4XMPH 1OP5K 2BRRL 3L3JA 3VXSE 2SEBB 4X5XB 2ERJC 4XRCB 1T7ZA 2P42B 2H26B 1OCWH 1FZOA 1YEFL 3EO9L 2EE2A 5E8NB 3O6KL 1QD0A 2J12B 2FO1A 2BJML 1Y6NR 2NY0B 2AEWA 5DK2B 4XXCA 3RA7H 3UZVB 4BZ1H 1ORQA 3HZYB 1U8PA 3NFNA 4KPHH 2HJFA 2DQGH 2XWTB 2CKBL 3IU3A 3WNMA 2A0LD 1Y18A 3FO0H 3PJSB 5CFHA 1K2DA 2GJ6B 5GJTH 1NGZA 4GKNA 4IRZH 2EDYA 2D0HA 4MXQD 3KNBB 3MJ9H 1YPZA 5FEBA 3WE6A 2G2RA 4NRXB 4WHYG 1URLA 3G6JA 1BFSA 3DSFL 1KXVC 3UPRB 1KB5H 2COQA 3ZYZA 4OGAD 4X6CE 1L7IH 4OZGE 3DARA 3LD8C 1C5CH 1T4KB 3S5LG 5FA4A 1IE5A 3LEXB 4OT1L 3S9DB 1Q9WA 3R0MA 1E4WL 5JXED 4QHNB 5I8OL 1A7PH 1HH6A 3QIWA 3ARQA 1U6AH 4Q9RL 1FVDB 1MFNA 2JCCB 1U8IB 4Y19B 1OAQL 1ZXQA 5HPMA 3MLWH 4QKXB 3KPPB 3P73B 4I1NB 1DANU 3WKNA 4N0FA 4OUUB 4N0CD 3VFPB 5EOCL 4D8PA 4PJ5B 3G6JB 3O41B 3DVNB 4RCAA 1C5BL 3BMVA 2A9NH 5EU5B 1KJ3H 4ZYKA 5BQ7A 1IRAY 3WUZA 1L9NA 2FH6A 2OL3H 3SDCC 3BE1H 3U0PA 4PJGE 5T3ZE 3SCMD 4GAFB 3VFGH 1KF9B 4JFZL 5CZXD 3I50L 3ILPB 3E3QE 3BUYA 5CJQL 2NY7L 5KSBB 1H3TA 1HSBA 1NC4A 3FB8A 3GSWB 1I1AD 5KANG 4X83A 3SKOB 3BP5B 3IYLW 1WT5C 4FFYH 5J1AA 3UAJD 3VFPA 4NM4L 4D8PB 4PJXA 2XQYK 4XXCC 3F62A 3DBXA 3NZ8B 2Y9RT 4IMLB 4UIMB 1UH4A 3KXFA 4HIEA 2B0SH 4NKOB 3SBWC 1B6UA 2GAZA 1VACB 1SBSH 4LHUD 4U2ZA 4M8QA 2P5WE 4KQ3H 4KY1H 1Q9LA 1IC1A 1MFEH 3VRLF 3KPSB 4QT5B 1TFHA 4LP4A 2X4SA 3SDDC 2YMXH 4D9RD 4GKSB 3K8LA 1LK2A 2X4PB 1OGAD 3UTQB 4ELMB 4XC1H 1HZHL 3VFMA 3EYUL 3PABA 3MRKA 2KUTA 4S1QH 3SN6N 3NZ8A 3ULUH 4LSVL 3HAEG 3KR3L 4F7CA 4H26A 1I4FA 4WHTB 3FJTA 1CFTA 5D2NB 5DR5H 4JPKH 4OGAC 3U7AA 1JHLH 2HVKA 4JM2F 4OGYL 1CDBA 3MA9L 5C2BH 1PQZB 1CGTA 4PJ8B 2NTFB 3S3JA 3RWFB 3BGMA 4GKSA 4EN3C 4KKBC 1FVEB 1G9NL 3VXSD 1INQA 3ARXA 5D72H 1VPOL 3WDJA 1G1CA 4PJ7A 4BQ6A 2CR6A 4WHDA 3LDBB 3FCTB 3VWJC 4TYUA 2XZZA 4Y5VA 4FQXC 2PO6B 3P4OA 3DRQA 5ALBL 4UBDC 5JO5B 3QEUB 4PRPE 4TVPE 4NQEE 1TIUA 4FQXD 3DROB 1T6VN 1U8JA 4ISVA 4PRIA 1TZHB 3EBAA 1LHZA 4Y4FD 1ZT7B 2VXSL 3O9WD 1X5IA 3EDFA 4UU9B 3BRGC 4WFFD 4X6EA 4JDZA 5FUCC 3S35X 5FOBB 4JRXD 4N9OB 4OIIH 2JJVA 5EIIA 2FJGA 1ACYL 4PRIE 3SE8H 1INQB 4X0KB 1SVCP 5DVNA 1FO0L 2VITA 3MLVL 3WS3B 4ZODA 4OLZL 3TCLB 4OCYH 5EOCJ 3QCVL 3LPGA 3MNZA 4KRPC 2QADB 5D7JD 4YXKH 4OCYL 3WD5L 2OM5A 2NXYD 4AENA 2EDJA 1MHEA 1YQ2A 5F6HI 3VRIB 2GJ6D 4GUPA 4BSWB 3QFJE 1IAMA 1KLUB 2C7UB 4TTDC 1RZIB 4WY7L 2FEDC 1KJMB 3UPAA 2OXGA 4N0UA 4IS6B 4NT6A 5EIIB 5FXCH 4JFEE 5TE4H 3OAYH 3PQYD 5EBMB 1L9MA 2XQBH 4KJQC 3AMKA 3CDGA 5EZJB 3CSPA 4X80H 1PZ5B 3AREC 3JV0A 1RK1A 2B2XL 3TJHD 2CKBH 3EO0A 2ADJB 1FGVL 2R1YA 2F19H 3G9AB 3O2VH 5TDPB 5ID0A 5SWZE 5HD8D 1MJ8H 3BKYL 5HI5D 2C3GA 5K33A 3KYNA 2NZIA 1A3RH 3QFDB 1VGKA 4EOWH 5CP7A 3K7UA 1OCWL 5DJDA 2R2HA 2MNUA 4DVRH 1JHLL 5DMYA 4XVUD 3BWAB 3RWJA 3SGJA 2ZUYA 1RY7B 2EE9A 3MRRA 1SBSL 2P5EE 3SDXF 4YHMH 3KYOA 3FB5A 1ZEAH 4UBDD 3KDMA 4R0LB 3HRZA 5FM8A 3U7YH 2FD6H 1B0GA 1HZHH 5EOQH 1WV7T 3EYQD 2EXYD 1KIRA 5C08E 4OLVH 1A4KA 5DRZB 1T0MB 1HILA 2Z35B 3MRPA 3MBXH 2Y72A 2Y6SC 4DW2H 2Q87A 4NN6B 2B1HL 3DVGA 4CDHA 2B5IC 2DQCL 5JQHC 3UDWA 1W0WA 4QLRA 2CLRA 1J5OH 1B88A 1MRCL 3LIZL 5B8CC 1KPUB 2OL3L 3GSXB 4M6AA 2XWBB 2A73B 4I4WA 3MYZA 3HNVH 5IK3B 4AM0B 4CMMB 3PWPA 1I7UA 2EDKA 2PR4H 3RGVA 2J8HA 1NMAH 4JO4L 4YJZL 1LNUA 3HZKA 3MNWA 3OKKB 1S3KH 5I6XB 3V8CA 5I17B 1OAQH 2EDLA 2ZSVA 4J6RH 4JY4A 4QGTA 3SDYL 3SJVD 5B38G 3ZDXF 2EEAA 2XZCL 5A3ID 4NO5B 5C0JB 5AZEH 4P5MB 2XN9E 4QWWC 5DSCA 1KTDB 2HLAA 2X70B 4FN0A 4OKVB 4WV1A 1YEEL 2A83A 2PYEB 5ENWA 3GJFA 5F1NA 5IQ9A 4PBVC 3DVIA 1IEAA 3P40A 3VXNB 2X89D 3PGDA 5EBWA 1VGEH 3TBYB 4HKJB 1P7KB 1CFSA 3PP3H 5TE6L 4NO5A 3V4VL 1XCQB 5GGUB 3MA7A 1IAKA 4JQIH 2NY0D 3RZCB 1WC7A 1J8HE 1IFHL 1MLBB 4PTUA 5GGRY 3L3OA 4EBQH 4WW2F 1B2WH 1LEGB 2BSRA 1RZKL 3NCJH 1U42A 2WQ8A 5E5RB 2BJMH 3OHXB 4NN7C 5IM7B 2IADA 4X5WA 1NCAH 2AXJA 2I24N 2VQ1A 3C2AL 3IJYB 5EU3A 4DZ8A 3T0EC 3D2UD 5EBGA 1U41A 3W81A 1II4E 1TQBC 4MWFB 1UZ8A 2E6PA 1UM5L 4XMPL 1C12B 4JY5L 1CLZL 2OR9H 3EFFA 5I1EL 2KQMA 4XPTH 3QDGE 1BPVA 3V0WL 3VW3H 3MOBL 4M1CD 4OM0L 3BKMH 1DL7L 1KN2H 1BD2A 1ZMYA 5E9DE 4P59H 4PJFB 5C6WH 3OAZK 1X44A 4ELKB 2I26N 4XAKD 4TVSa 3RY4A 4YBQC 3GO1H 1YZZA 4H88L 2VQ1B 4YPJA 1B0RB 4X5LA 5E6IC 4XWOC 4WU5A 4TNWK 3MODL 1EEQA 1VFAA 4Q2ZB 3CFKB 3UTTB 1QBMH 4JANB 3PNWA 2OI9C 4ODUA 1UQSB 5IV2B 3JWDH 4LSSL 1JWUB 4KMLB 5K93A 2QQLL 3CXDL 5IVXB 3RAJL 3BX7C 4PJBA 4HJGA 2AEPL 5GRWA 1AR2A 3O0RL 4HBCH 4IOSD 1A8JH 2ICWA 2PTVA 3JWOH 2YD2A 5EO1B 4E9LA 3KYKL 3AS0A 1OT2A 3GJFH 5L7XL 1JWMB 1XF5B 5CEZE 1FL5A 1A6PA 2ZNWA 4ODXB 4JCLA 4K71B 1U95A 1AGEA 5FYLE 5F7FA 2PCPA 3RKDC 1LDPL 1OAKH 2A6KB 1V5JA 2EYSA 1JWSB 1JPST 3QEQD 2FECI 3GKZA 5D1XB 3D0LA 1G7IB 4L4TD 4Z7UB 4YR6A 3RUGA 1EX0A 4WI4A 4OI9A 4HKZA 4OF7A 4EXKA 3ESVF 4OLYL 2ZUUA 3RX8A 2XI9A 3QWOB 3TBVA 4OLWL 3T0EA 4PTTA 1BLNA 2OR7A 3QG6A 4GG8A 3QUML 4ZTPH 3SQOH 4ORGA 3RUGE 2VLLA 2EECA 3MLXH 1I7TB 3VGHA 1XGYH 2P5ED 2QSQA 2UY7A 3ARBC 2VZ3A 3MUY1 3ZTNH 1A14H 5EU7E 2D7QA 1ZLUH 4LQFL 5E4EC 4F2MA 4R0LC 5IR1B 1OB1A 4ESKA 5T1DL 4W4NA 4HIXL 4JHZA 3NABL 3V6FB 3U9UA 3UTSA 1KEML 3U1SL 4BFIB 3MLYL 2YPVH 4JQVA 4HUWA 5CHNB 1P5VA 2W60A 4DVBA 3C8KB 2AERT 4ALAH 3MGOA 3ARYA 2W07A 4FG6D 2ATPA 4IHOA 1Q9OB 1CTOA 4YIQB 1S7RB 4KKCD 1S7QA 1ZSDB 2I07B 5DI8A 3QWRA 5TQ2L 4Z7OF 3VMPA 4KZEH 5A40E 1VEOA 4JFED 4P57A 3LN5A 1PW3A 5F7DB 5FCUH 5D7LB 4O4YH 3K4DA 4P4KD 2AXFA 1CD1A 3HNSH 2NTSP 1WITA 2NYYD 3I02A 5T1LA 4MJ4A 4CU7A 4QHNA 4OGXL 3CFEA 2HRPL 4NSKB 4HC1A 5J11B 1AD0A 1AHWC 1OHQA 1P4IL 3DHMA 1Q0YH 4PJEF 4BQCA 4RWYL 4WHCA 4G9FA 3W9DB 1HHHA 1J0YA 2APWA 2I60L 1WTLA 3KPPA 1J10A 1CE6A 3SEPA 1DQJB 4P3CH 2Q6WA 3MV7D 4K94C 3VW3L 2Z8SA 4V1DA 1BQSA 4M5YH 3RU8H 1QSVA 1KENH 4XWGL 1QNZL 4QHLA 3F12A 4HCRL 4JRYD 4Y4KC 5MP6H 4ETQB 4KK6C 5F1SA 3ZKMC 2YOCA 3GMRB 2L7JA 4X98A 1OAYH 3ARBA 1ZA3B 2B7DT 4PRPD 3TYFA 1F2QA 2EC9U 4XBGB 4LRNL 3I6KA 4MX7B 4QEGA 4POZD 1X5JA 1IGYA 2DLHA 1UWEL 4NQEA 1MCDA 4YX2L 3KWWB 1F6AB 4WFEE 5J06A 3Q48A 3FB7A 1HYSC 1TXKA 3MRIA 3QEGL 4JFOB 4JFYA 4DGYL 1M7IA 2AP2A 5HHME 1R5IB 1A1MB 3QUYC 2XZQL 2GAZB 2EYRB 1MFDL 2H32H 2X1QA 5IEHB 3TA3B 3U36A 5E2UL 1U93A 5HGBA 1CLYL 1FC1A 4E41D 3ULUD 3SGDH 2VDLL 4LCWA 4NPYA 1ITBB 2BVPA 3G5VA 4LOUD 4MX7A 4O58H 1QSEA 4MA3A 4S1RH 1GRWA 4JO1H 3IDMA 2D9CA 1GH7A 2FCBA 3FB7B 4Q0XH 4LPCA 4EUPG 3T0DA 3SGKA 3TIDB 5F7MC 1EFXD 4U1LA 4RIRB 1I1CA 5H94A 3V5KA 4NKIL 5CD5C 3X12A 3SPVB 3OKYA 4G9DB 3E6FB 1J5OL 4XPFL 1LE5B 4BYHA 3QDJD 3ZHLA 1KIPB 3G6AB 3ARUA 1S7TB 3C5ZB 3NIFE 2BY3A 4HWNA 1Y18B 5MEQB 3ETBF 4HZAA 2BOCB 2ICCA 1Z9LA 4FFWC 1KCRH 3G08A 1D5XB 2P24A 5IFAL 3U4AA 3RY5A 2G2RB 1OTUC 4JHWL 2PO6A 5C09B 1KIQB 1CGVA 1XF4B 1YNKL 3M1BA 2GT9A 1IGIH 1G7PB 3A6OA 3LB6C 4M93C 2R0ZL 2DQUH 2R2EA 3G04A 5TF0A 2FX8H 3MRLB 3QIBC 2DQDH 1K6QH 4JFXB 3VU2A 2DWDB 4JG1L 5B4MC 2FBJL 2LABA 5I1CH 1IGJA 4WTZG 3HMWL 3IU4H 5D1XC 2IH1A 1ONQA 2Z91B 4PJ9D 3ZKSD 5F3BB 5I8CA 5IWLC 1JK8A 4K23H 5I8KL 1MVUA 3ARGB 4XP9H 4PGBB 3P77A 4YNYB 2BHYA 5AUMB 3GHBL 4ZOCA 1N3NA 1QUNA 1F3DJ 4L29B 4L3EA 4Y16D 2Z4QA 3DV4A 5FKAB 3ULSA 5IW3A 3BGFB 4OKDA 12E8L 4ZPVA 1YC7A 2VXVH 3K8KA 3SDAD 5E94B 5IT2L 4L4VB 4N1EA 2Y5TB 5F96L 5J7CC 4JDVB 3QIBD 4M62L 3O6LL 1RZIA 1ZS8A 3FO9B 5J12C 5F3BA 4NZRL 3VH8A 5JXEA 4IIQB 5TGBA 2BRQA 1HSBB 1NC4B 4YFLI 5DTFA 3GSVB 1I8MB 1C08A 3LPWA 4ODSL 5F7EL 3QHFH 3VFUA 4G9FD 3MRJA 3KPOA 3DBXB 3UC0H 1DLHB 1RIHH 3PWUB 2QHRH 1H8SA 4ODTL 1GC1L 4FABH 3CZFA 1QRNA 3DRTA 4OQTA 3CIQA 1I1AB 2W0PA 1ZS8B 4ZUSA 4ZUVB 4HS6A 1HXMA 1NBYB 3GSRA 4LLMB 4R6UA 3DYPA 3MR9B 4P2OB 2YHGA 1ADQH 3SDCB 1KG0B 5I30H 1QRNE 1FC2D 4P9ML 2DDQL 2Y6SD 5F89A 1UVQB 1U8OA 3MJ9A 4RAUB 4LCCB 2I9TB 1QNZH 2GITB 2FYYB 4U1NA 4MJ6A 2UWEF 1FAIL 1IGTB 3BP6A 4OB5L 1MJJA 4YBQD 4HK0B 2I5YH 1HN1A 2O5ZL 4GKOA 2MJWA 4AMKH 3VGFA 4UZGA 1QLRA 5DRZA 4U1SB 1UADC 4NWTL 3B83A 3VXME 1IJ9A 1CGUA 5SWSD 1A9EA 2ZCHH 3MCLL 5FM5O 4Z77B 4NJ9L 1FIGL 2DMBA 5ANMB 5ICZB 3B9AA 1FGNL 4GW1A 3TT3L 3D85B 4XVSL 3GRWH 5BS0E 4OFYA 2VNCA 5FK9A 1NFIB 4TOYL 3PHQB 5I16B 4LVOB 2YSSA 1ZLWK 1OTSD 4NQDD 1KXQE 4XAWL 3DLQR 4RX4D 1OP3K 3GSQA 3VFRA 5E99L 1HKLH 3KPRA 4DQOH 2VE6B 5IW6B 4ISVB 4U0QB 4HH9B 2Q7YA 4HEPG 3QI9D 4PP2A 1I8KB 4IRSB 4XVTL 3OKOA 2AJ3A 3F5WB 3E1F1 1P69B 2WW8A 2APXA 4CU8A 1A3LH 1HEZA 4UT7H 3D69B 4M61B 3TT1L 2X4QB 5EULV 5D1QA 4PJ8C 2CIKA 1I1YB 5TFSH 2CIIB 2AK1H 4XCFL 1J11A 4PJFF 1YN7B 2D7TH 4HX1A 5T1DH 3PIQA 1AC0A 4TNVF 2UZIH 2XG4A 3QT2A 1MRFH 3L3KB 4GRWE 1CD0A 2WBJC 1PG7X 1BWMA 3BD4A 4GBXD 4K9EC 3EDKA 1BFVL 1G7HB 2F5BL 1HI6B 1H5BA 1YEDB 3ARPA 2HTLD 2UVFA 3DSNA 3T8XA 5E2JA 1Q9KB 2LTQB 3H9HA 5CP3A 3CK0L 1DQQA 2CK0L 2E9IA 2EDRA 4KJYA 5IB5B 3TNNB 5ITFA 1T6WA 3LEVL 5EUKB 4HULB 1WZKA 5D7IF 4KRPB 1OAUL 2EDTA 2YPLD 3FFDA 4MWFA 5D93C 3H7BA 5FM5M 5I0DA 4PJDB 1EAJA 5FYKH 3QI9A 4JZNB 3IGAA 4JFDD 3TJEH 3T4YA 1A5FH 2V2TA 1XIWD 4DW2L 3JTTA 1N64L 4WUUB 3DMMA 5T5FL 2R69H 3AFLA 3GB7B 3ZKNC 5CJ8A 3HG1A 4KTDL 1BD2B 4NQDA 2BVOB 2GCYB 3IXAA 5GSRB 4KJPD 1K8IA 3WKML 1UZ6F 1U8QB 2FATL 3FB5B 1QZ1A 1QBML 3LKSA 3I75B 3RI5F 3X3FL 1Z3GH 3PWVB 4GSDL 5HVWA 4JKPH 5E2TH 3U4EB 3RVXC 3H7BB 1G9MH 4Y4FC 5M7QA 1JGVL 3H9SD 1T5XB 3UTTA 2OSLA 1T0MA 3OR6B 4PD4K 5L2KB 3LHPH 5DRNA 4KPHL 2ZUQB 4OZ4A 4IMKA 3FFCB 4O9HH 1IKNC 4MNHA 2AJYH 1X9QA 4TULL 1JL8A 4FQPA 3RL1B 5ICYA 2QQQA 3MOBH 4GMSL 4MA8H 1JMZA 2CLRB 4UT9H 3TZVD 1AP2B 3OF6D 4J4PD 1S7SB 5JW5B 2F54B 4Z7VF 2PTTA 2OK0H 4YHNA 2UWEB 3BP7A 1Y0LA 3EDEA 3WFZA 5KOVC 1QO3B 3VDAA 1AI1H 2WBJA 2OK0L 4FXGB 2X4NA 4D9QE 1S5HA 4OCMC 3UX9B 5F6HJ 3BPCB 4MLSA 2JE8A 1J12A 1LO0H 5DLML 4G43B 3R1GL 1E28B 4KTEL 4Z7VB 5AYUL 4LEOB 1H0DB 1RK0A 2XNAB 4WTWA 2MWCA 3IFPB 2XYCA 5ERWB 5MENA 2JIXA 3OXSA 3NCYS 2BHZA 4EI5A 4MQXC 1ZLWH 1T80A 1JTOA 4YXKL 4XPBL 1X6NA 3OGOE 5ECJE 4PGEA 3BO8B 3QI9C 4QOKB 3NIGF 1CFQB 1Y6MR 2ADFL 4Z7WF 3G5ZA 3DMMC 2HT3C 3U9PH 1ACYH 4KVCL 2NY0C 4WI8A 3V7MA 2AK4D 4X7FC 3IF1A 5IBTH 5I1IL 3DXAD 1E4KC 1WF5A 4LLUA 3HI1A 2VLKA 4BM7A 1MJUL 3BQUA 2GTZB 3CCHB 5KVFL 5F9OL 3PG2A 2YEZA 3DGGA 3T4AB 3TBSB 4Y5YC 5GXBB 4MNQB 5CUSH 2FL5A 1GZPB 1NCDH 3JZ7A 3CLEL 1T2QH 3IJYA 4DZ8B 4M6NH 3CH1A 1TZIB 5F71A 2F74B 2CMRL 1MHCA 4HV8A 2P8PB 4RFNC 5HPOA 2AXGA 3ORJA 1CL7H 1F4XH 2YUXA 2YA1A 3NFSL 2XG5A 5DGQA 4Z18A 3ARDC 3GIZH 4F57L 3PHSA 1KTRL 3QDMD 3G5XB 4M48L 3UBXB 5C0AA 2OXHA 2WUCL 5DHYA 1KJ2L 5EUOE 5IMKB 4C54A 3BP4A 4DCQB 5EPMB 4RGOH 1KIUA 1EERB 2ARJA 3SDXA 3D85D 5T1KD 3OKEB 3RJQB 4GXVL 1SEBB 4P2QE 2FHCA 5JHLH 2C3XA 1J0ZA 3C5JA 4V1DB 1I9RL 3HFMH 3T3PE 5KG9B 3DI2B 3FOMA 2Y06H 4PRDA 5CINH 5CILH 1PG7W 4FQJH 3T08A 4WW2B 3C5SA 3RWGA 5IESL 5A2KH 4RZCB 5KSUA 5DJZA 3TYFB 4U3HA 3AY4C 3B5HA 5D7JA 2DQIH 5D6DA 4G5ZH 3RVXD 4LLDB 4Y4KA 1T1YB 1K4DB 4N0YH 1NCCH 5L88L 1QLEH 1T89A 4GRLB 5FA3B 4S2SA 1RVFL 4EXPX 8CGTA 3OL2A 5B38B 5B8CA 1U95B 1IVLA 2BHUA 3AVEA 5DS8B 3FKUS 3EYOB 4WFHE 1L7TH 2J6EH 3OWEA 3MJ8A 5F7HA 2YBRA 3BQUC 2YD5A 3QG7H 4WCYL 2V2WA 1FGNH 4JM2B 4I0PA 4ZXBD 4FS0A 3U36B 3IFOB 4P9MH 5CZXC 1MCKA 5CIPH 4R3SB 8FABA 3BOVA 5C09D 1IM9D 2D03L 3TZVA 2A74A 3OSKA 4GRLA 4LPTA 4PBWD 4C83B 3F58H 4XX1G 4CVXB 4PV8B 2CD0A 5I19H 5CJXC 2ZUVA 3FRPG 4HD9A 4MQ7B 3HB3C 1G9EA 1DSFL 3JBG7 1T04A 4QF1A 3CC5A 1OW0C 3V9FA 2M1KA 2FR4B 4G8GD 5H94B 1YJDL 1X5GA 3D0VB 1NGXA 3WBDA 1FZJA 2OBGA 5LGHH 1KT2B 4P3DA 2KBGA 2OTUA 1T03H 4M43L 4OZIF 4OJFH 4U1GC 4DJMA 3ES6B 4KDWA 3LH2L 1NAMH 3MV7A 1NBQA 5MEQA 2NW3A 1MPAL 2F8XC 3O4LD 4WFGD 3EOTH 1KTKE 1AGCB 2VDRH 4G6AD 1T22A 3RPIB 5DVKA 1H9VA 5I1HH 1E27B 4ZDHB 1REIA 3S36L 3VCLB 3P73A 1RZ7L 2AV1A 4IRZL 2FO4B 5C0NC 2VISA 3GMNA 2XKNB 3OAZH 5EU4B 4D3CH 5T3ZL 5FYKE 1WGOA 4NCDA 3VRJB 1P6FA 1CDJA 2IMNA 5E4EB 3BD3A 1O7SA 4YFEA 2IFFH 5E08H 2AXFB 4OZFH 4MJIE 1CR9L 1RSFA 4HJ0D 1PGRB 2PXYC 3VDBA 1H3PL 4I9WE 3T04D 4G7YL 1GGYA 2IQ9L 4AEFA 1SJEB 4JJ5B 1E0OB 1FNLA 5FYJE 1N8ZB 3WJLC 4D0DB 1D9KA 4M7JH 4Q97A 5JXAH 1NFDF 5HGGS 3JSSA 2RQ8A 3BAEL 3RQ3A 3K2UL 4FTVD 5IKCA 4BSVA 2AKRA 3GI9H 4R96A 3OAYK 2YMXL 3QISA 2M26A 3JV5A 2DQDL 1VHPA 2WK2A 1T5WA 4QTIH 5E6ZA 3KPSA 1GAFL 3HI5L 1T20A 3WCYA 1CGXA 3W0WB 4G42B 3BZEB 3IETB 4BZ2L 1XR8B 2GJZB 1ORSB 3DO3A 4R90L 3VXTA 4KC3B 5C0FA 3AXLB 1D9KB 5JIKA 3MROB 2RBLA 4LCWE 1M7DA 2W9DL 2DKSA 3BGFC 4HIJB 4OFVA 1RJYB 2J4WL 2NX5E 4RGMB 2V17H 1NFDA 4TPRL 4D94A 1MFAL 1EPFA 1DBAH 3A67H 4ZUVA 3MXVH 5E95B 3RIFK 1CGSH 4X7SL 5BW7C 1G7QA 3TPUA 2IF7A 3IETA 4UT6L 4LAJH 5T3ZH 3HR5A 3KPSD 3WL9A 5I1LA 5GPRA 2GFBA 3MV8B 1WIOA 5FM4A 3N50A 2E8YA 3CFJA 4UINL 4RMVA 3WFBH 3PL6D 1MSPA 5CEYA 3WSQL 4OZGB 4MJ5B 1DN0A 2P8MA 5EZOH 1YY8B 3FRUB 2C9AA 5F3HB 2DQHH 1AXTL 4CNIA 3GUTB 3T2PA 2VXTH 1ZT7A 2JCCE 2R9HD 3NACH 2P43B 4M43H 4X6FA 1X4ZA 2VUOA 4Z76B 5C0IB 4MZ3A 3LEXA 3WFHA 1EEZB 4W4OC 4FZEH 2F5AL 2R9HC 5IW1B 3WL9B 4NP4L 1Z5LA 1KULA 3RWDA 4L8CB 4K2UH 3MV8A 4PYGA 5A1AA 5GS0H 3BPLB 3A6CH 5EBLA 3WS3A 4DKDC 4KZDH 4DK3A 1ZKAA 1NAKL 4KRLB 3N1FC 3V52H 1QR1A 4GMTL 3EUUA 1WCBB 4PJGB 3GSQB 1G7MB 3VFRB 4P3CL 2XPGB 1ZGLB 1JRHI 3KPRB 3EOBA 5IQ7L 1G1YA 5D1XD 2D03H 5EC1B 2FJHB 4LLQA 3P3YA 4EI6A 4ZSOE 3A6BL 1HYRC 3MLSH 1X5LA 3J8F7 3TN0D 1B0WA 3L5XL 4UUJA 1TZGL 4JG0L 2EDHA 3HA0A 4LHJB 2DYPB 3ARSA 3DX8B 2M2DA 4IOIA 3GK8L 1G9MC 2EDFA 2XPGA 1K5NB 3RGVC 3ROOB 3VI4F 4CJ1A 4GLRH 3VFOA 1WAAF 1UXWA 3QUXC 3PXJA 3BWUC 1N0XL 1DBKH 4JRYB 4KH2A 5B3JF 3AC0A 2QHLA 2NY5L 2GK0B 1UA6H 4TVPH 2GIYA 3JWNC 4PJEB 1D5IH 1CL7I 4M8VA 1ND0B 4HPYL 2NY5C 4LSUL 1D5BB 3KYMA 3QJFA 1HYSD 3VI3F 4PJ9A 3W39B 5C92A 3U0TA 2Y5EA 4LSPL 1IEBA 2DMCA 4OZIB 3NABH 5IB2B 1K9TA 5D2NE 4EUPH 2Z9TA 2W9LA 2EYTA 4I0PD 2A1WL 3R0NA 4NZJA 5DEFB 3G6JF 1LWRA 2D3VA 3DV6A 1GYAA 2XZAH 1AC6A 1IZJA 5D2NA 2O61A 1NLDL 4HS6B 1XF3B 4JHAL 1V3KA 1XFPA 3MLYH 1EXUB 3C6SA 2FGZA 3L7FB 4XC3L 5FHAH 2OZ4H 1N6QL 2HJLA 5T1KB 1C1EH 2VDKL 2CMRH 5HHNB 4PLKC 3BJLA 1B4RA 4LF3A 1EAPA 3PE9A 1OAZL 3OX8B 1VSCA 4MAUL 1FH5L 3KHQA 2QQKL 2KQNA 3BDYH 3KS0H 1S9VA 4G6JL 3PWPB 4AG4L 3QEUA 4H0IA 2DTMH 3QXAB 5IGXL 3SKUD 4PRIB 1MI5E 4I3SH 5A16A 3QDGA 3U6RA 2A1WH 3VMOA 5AG8A 1RIVH 3GRWA 4QHKJ 4DKFH 3KYKH 4BA8A 5TDNA 2ZCKL 4J3XA 2HJLB 5T1KA 4NOBA 3O0RH 5H35B 2QR0B 3HS0A 4S11A 3O6FD 1NFIA 4B7LA 1K8DA 5DQDH 2IMMA 4U05A 1CG9A 4N1HB 2HTKC 4OD3H 1RZKC 4P4KB 1LD9B 3EHBD 3QFJB 3CUPA 4L9DA 2ADIB 1P6AB 3H42H 2UYLA 3AS1A 4Y1AB 3NN8B 5E6ID 3ZDYF 1UENA 4G6FD 5HI5C 4WUKL 4LEXH 4X9IA 5DQ9B 2QKIB 2C4XA 3SE3A 2HLFC 4GAYB 4QXWA 5E2WL 1K3IA 1UKTA 3B2UC 4P2RE 5EOTB 5CZKA 4WWKD 3KVQA 1X5HA 2X4QA 1IKFH 5T3XL 1GVIA 3TPKA 3UXFA 3L5XH 1J8KA 4A6YH 2QTEA 3ALXA 3HCVB 3L5IA 3A6BH 5SWZB 3MUGA 4NYLA 4LVHC 1HOCB 1NJ9B 3BD5A 4W6WB 1P84K 3FT3B 2IADB 5L0QB 3E0GA 3C2AH 5I1DB 1ZLVH 3EYQC 3LRSA 5JIHA 5DJ8B 4U1IA 1WT5A 3FQNB 4CN4A 1T83C 1LILA 4EIGB 4AQOA 2Z93B 4O2CA 4TUOB 1Q72H 5DEGB 1JZ4A 1P1ZA 3QCTH 3MZTA 3DX9B 4U6VH 1UJTA 2P5EB 4JZJC 4KRPD 3FO1B 1IGCH 4A6YA 1BGXL 5BRZD 3R06B 2VXQL 1I7ZB 4ZD3H 3NCYP 2JK5B 3IXTB 2LU4A 2YEZB 5JXEC 5E5UB 3V0AC 1TQCB 3BW9A 1NCAL 1QHOA 3OJDA 5E0QA 5IB5A 2FJFB 3Q2CA 2IALA 5DK0A 1DZBA 1MHCB 3H2WA 1CWVA 3MBEA 1YEEH 5CIPB 4Y2DA 4LFHD 4UTBL 4PRNB 3LQAL 1OPGH 1ZT4A 4QXTB 3V4VH 2IEPA 5IF0B 1KGCE 2ATKB 4XP6L 1JE6A 5JPMB 2ZUSA 1OOAA 1I7ZA 1U3HD 1HHJB 2XZCH 2AV7B 5J11C 4Y5YB 1AHWB 5HBBA 2ENSA 4X7SH 3L7EA 1LO4H 3QXVA 5BOZG 3MXVL 1UM6L 3S8WA 5HSFA 3U46A 4PJAB 3MXWH 5E2VH 2MSPA 4LDLB 3MBEB 2GTWB 3L3DB 1YNTA 2V2XA 5FGCE 3B8SA 2V9TA 3PDOA 1KFAH 4M1DL 2XTJD 4OIBA 3GMOB 4UT6H 1KPRB 5ACMA 2PYEE 4OCXL 4IDLA 4Z7UA 4YR6B 3GM0A 4GRWH 3EKCA 4FRWA 5IG7B 4BZ2H 4NWUL 2B1HH 4XTRD 1TJGH 1FORL 3ZDZF 1DBAL 4C4KT 2W65B 3FO2B 5FA3A 1TVHA 4JZOB 3DUSB 4L3CA 3K4ZA 5JDSA 2ZOKA 3EDDA 5A2JH 2PETA 4PP1D 3MC0A 1S5HB 1MRCH 2IAND 1EEYA 4YGVB 1CQYA 1T21A 4Q6IC 4DUXA 1J8HB 4Y4FB 1P7KA 1QYGH 1CFSB 4O51A 1EGJH 3IFOA 1A9BA 3NTCH 4ODWA 3LMJH 1G7JB 1UKSA 1VB9A 4OLUH 4PTUB 2H32A 3WMSA 2WUBL 4XCEA 2FD6L 4J23A 5E99H 3UTPD 2BVEA 2Q3ZA 2OJZH 5E6YA 3DUSA 4L3CB 3HMXL 4LK4A 5KS9B 2K7QA 3KJ6L 1YY9C 2ZJSH 3TH4T 3OKMA 2O5XL 3M17B 2J8OA 3AREA 1E4XL 1VFUA 1ZE3C 4U6YB 1GGCL 5CJOH 1LDSA 3SCMA 2DI8A 4KJQD 1BJ8A 4PY8I 2SEBA 3MQIA 4C58B 5F44A 2IQ9H 1X6LA 3AUVA 3DOSA 1MREH 4RMWA 5F7DA 1HHIA 1LGVA 5DMJB 2JELH 3P2TA 4OAWA 1VKXB 3DPBA 5JW3L 3ES6A 2CDEB 3C60A 4R4BA 5MERA 5D1QD 5TPWH 1XGPB 3HPJB 2HJKB 1BJ1H 3L3IB 3CXHK 3EYVA 5BV7B 4KI1A 2VAAA 2VR5A 5J6HB 4X9GA 1CE6B 4TRPH 1LMKA 2YD9A 4UB0L 3FHQA 3PJSA 4M7ZB 1MWAB 1KB9J 3MV9B 4B7IA 3D2UA 2ILLA 4ZUWB 1NMBL 3QIBB 2JJTA 1ADQL 1KB9K 4ZS6D 2WM0A 3GSNB 4H1LA 5GGRA 1KV3A 3OJMB 1UB6B 1GC1H 2EIZB 5I1GH 4M5ZH 4WI9A 3V5DA 3GSUB 1JPFB 5DC4B 4P2OD 3QIWB 4MB3A 2PXYA 1NL0H 3QR2A 1I7RB 5TE7L 5ALBH 3KPNA 3GDBA 1NGYB 4RMRA 5JIPA 3VXOA 4KHTL 3SKJL 1YECH 5DVOA 3VFSB 5IKCB 3E2HC 4CKVX 4NFCA 3Q5TA 3D0LB 2A6JB 3RUGB 1T1ZB 5C9JA 1HXYA 3O41A 4K7PH 5DO2C 5D7JB 3D39D 1ZANL 1D5ZB 3RWHA 5SWQB 3DTXA 3MTRA 2VC2H 3FRPA 2OS7A 4J3WA 4GG8B 1ZHBB 2WWKT 1IBGL 1WBZB 4JN2A 1TQCC 4U1KA 3RWIB 1KOAA 3LSOB 3MROA 2E7CA 4N0CC 2VH5H 3QXWA 4W6XB 1VFBB 3P0GB 4HPOL 4X6CB 3ULUL 4G3YL 1L0YA 1NDMA 3HMXH 2FH8A 3VGAC 4NQSB 5C0GB 5DZLA 1T1XB 3RL2A 1JGDB 3NTCL 4AL8L 2P8LA 3G9VA 2X10A 1MCOL 3OAUL 4BFGA 3RBGA 3SDDA 4RGOL 1FFOB 4FOMA 1FVCB 1MIEH 4OCSL 3EJZC 3EJYC 3PHOB 1YUHB 3QZWB 4PJ5E 2XXMB 2Y06L 3B5TA 4RGND 1C7SA 5IVZB 3VD4A 4NN5C 4DQOL 1KCRL 2V9QA 1RJZB 3B2VH 1CFVH 4PJ8D 1RZ8B 3TVMA 3X13A 2F58L 5DEZA 4G3YH 2IH3B 5E00B 4XCYA 4F7TA 3WIFA 3G6DL 1VEPA 1LEKA 5KSBE 3JV6A 3MRFB 4KI5F 2HKFL 4KY1L 4XP1L 2DS4A 5E8DH 3IDIA 4I0CC 3VGEA 5KVGL 2X42A 1MELA 4YHZH 3RWDB 3VD7A 5IHBA 4I48A 3RPIA 4R97B 2AAVA 35C8L 1NBVH 4WI6A 3GBMH 5C07B 4X4XA 3EOAA 5D5MF 4LBEA 3FHAA 3AU1B 2I5YL 5ACLA 1G7MA 1KSRA 3KPLB 4F33B 1G6RB 4EVNB 4RAVA 2FX9L 5E6IA 4KMTL 4PJCA 1MNUL 3BIBX 2MCG1 1SJXA 3BUTA 3ZSSA 4ELME 4X98B 1J05A 4PJIB 2QEJA 4IIQA 5TGBB 4LSRH 5CCKL 3QO1B 4JM2D 4E0RB 1QFWH 3Q6FA 4NUJB 5IBTL 3IRZA 4MA1B 1KBGL 2G60H 1OQXA 5HHMB 2J5LC 2DQEH 3IDGB 1IGYB 3GNML 1GZQA 2FJGB 1JGLL 4GAJL 2FEEI 4HFUH 2VL5A 1RMFH 3NH7H 4NJAH 5E8NA 3V95A 5ELIA 1KLGB 5LWYH 4I18B 2V9RA 4P5TC 1CGWA 4ZUSB 4NHUB 3CFBB 5MEOA 1H3VA 2YZ8A 5E8OB 4XCCL 4PJ5D 4WFGE 5FGBC 1A6VL 5D6CA 5DHVB 3W0WA 1U58B 1UCBH 5KBNC 2PW2A 2C7UA 1QSEB 4MA3B 3SHSA 4BFEA 2CGRL 3VXPB 3T2OA 3BT2H 2EXWC 4Y2OA 1F8TH 2I9TA 4JFPB 5L2JB 1JTTA 2VXUL 4FQXA 3QUXB 3GHBH 3DRQB 4FMKA 5D93B 1PZ5A 1I3UA 3BEVA 3OR7A 3B6SB 1IGMH 5TQ0L 1G7QB 1T7WA 3MLTB 5GSVB 4ZXBA 3VXSA 4LGSB 3BGAA 3OQ3B 4XNMB 5C09E 3VXPA 5JOFA 4YHPB 1YEFH 1BOGA 2RCSL 3B9KB 4EKXA 3WLWD 4JY6B 4KU1A 5EUOF 1NC2D 3CVHB 2DM2A 3QQ4B 4LEXL 5HPMB 4JVUA 1EGJL 1QFWM 4WI7A 3RVTC 5FDYA 2IQAB 5C08A 3RWJB 4KV5F 1FPTL 1M6OB 1PY4A 4MNQD 3C6LB 1WBXB 1D9KC 5C86A 1JUFB 1SEQL 1UWXK 3GI8L 4PJCF 1IKFL 1D3CA 5GS2D 2BFVL 5CKGA 1B9ZA 4JFEB 1CLOL 2D2OA 5JORA 3DURB 3VXRE 5D1ZA 1OQOA 3DXAB 2DWEB 4Y19D 1UJ3A 1KIRB 3LOWA 1QFWL 2ZCKH 1P7HL 4IEFB 5D5MA 1A1NA 1IAOB 3MLRH 4OTXH 4RFEA 4HDIB 5IMLB 5F9DC 3RKPA 1NMCC 5C6PB 2IANB 4Z95L 5HHQA 2QBWA 5KJRH 1LD9A 4G6FB 4L4VE 4LHUA 4KKLC 1FDLL 4WEBH 1TJIL 4L29A 3ULVH 1FH5H 5INDB 3HE7A 4XP5L 5E2VL 2X1XR 1UKQA 4HIEB 3X17A 4KKAD 1EHLH 4Z7WE 1LEIA 3QWRD 3L6FB 5DRXA 3J7HA 3NIGE 5IVOA 4H0GA 1ZHLB 1HIMH 5DC0A 3VFNB 1H8NA 5FDWB 2CR3A 2D7PA 5DXWA 2VZVA 3H8NA 3T1WA 4XVJL 1CYGA 2MKLC 1IAIM 2B20A 4FFVD 3MRBA 3MREA 5KVGH 3O45B 1MFDH 4UQ2A 3UJTL 4DTGH 4JAMB 43CAB 3SKMA 3BIKA 4PLJC 1UB5A 4KVNL 5FGSA 3BKJH 3CX5J 2VABB 4HZLA 3HRZB 4QCIA 4X6DB 5I75C 2F54D 1UWEH 1QRNB 4O2CB 3ABZA 3LV3B 2VLKD 3VWKB 4LRIC 2HVKB 4J3VA 5MENE 3IDYC 5GZND 1AD9A 5HYJB 3LQAC 3HE6B 3UTPE 4PJXE 2DKUA 4ZFOA 3R06A 1DCLA 2FSEB 4YDIH 2VIRA 3EYFB 4LU5H 5AYQA 4R97C 2EYTB 4EEEA 3I84A 4PV9B 5JOPD 4MNGE 1HKLL 2R29L 3I3DA 2LQRA 4HK0A 5DK0B 1PKQB 1FFRA 2K3TA 4EI5D 3RGVB 5IOPA 3MOAL 1BVKB 4IBLT 2JIXD 1F3RB 4L9LA 4RFNB 4DZBB 4M4PA 3V0WH 2XN9B 5LAXA 1BBDL 1MCLA 25C8H 5DRNB 1AD9B 3K4AA 5I1EH 2VLRD 1NGWA 4UU9A 4NO0A 4ZUTA 2X4RA 1UEYA 1BFTA 5EU6D 5FF6B 3I3BA 3IDNA 5BW7A 1GSMA 4OLXL 1E6JH 4ODBD 5JW5A 2V5TA 1FP5A 2IPTH 3DX7A 2J5LB 4XX1E 3EO1B 5ENWB 5DUPL 4NQXB 1YEIH 2VQTA 3QXAA 5SX4I 1TCRA 4HKXB 1Z0NA 3I2CL 2DYPD 1I9IH 2X4NB 3L3GB 2RJMA 5D4QA 4WW2C 3BPNB 5KW9L 2AJ3B 4HJJL 4CADA 1H0DA 1XCQA 1HWGB 4YE4L 3C9NB 5CEZL 3D18B 3ZE1E 3UZEA 2R1WA 2C3VB 1TJHH 5ISZA 3WUWG 3H9SA 1EH9A 1LO2L 1N6UA 5D7KD 5ICXB 4HJGB 2F53A 1E4XI 1ZLUK 1TVHB 4HWUA 1HHGA 2P1YA 1BREA 4FTVB 2AJUL 5IMMB 4HFWB 3TO4D 2XKSA 2IG2H 3QUZA 2B1AL 1A3QA 5BV7L 1VADB 4YC2B 1DBML 4LIQL 2AEQL 3CSYA 3VXUD 5HHOD 1PG7L 4EZMA 2IPUG 5F7EH 3FQUA 5DJXB 4HG4J 1BIHA 3IVKA 5IJVA 1C12A 3ZDYE 4X4YA 1OAZH 3SDYH 1ETZB 4PB9L 3HTLX 4PJFE 4BQBA 2E5EA 3RZCC 1HI6A 3O3EA 5TPWL 3RVVD 3FT4A 1T7YA 2NXZB 2BY1A 4XNYL 5ALCH 3TO2A 1MFAH 1Q9KA 1HHGB 2W9EH 5DHXB 5GISH 3EJZD 5DD0H 3JUZA 3T0EB 3TBVB 5EZIL 5FO7A 3FN0L 1S9XB 3IU3B 4YFDB 3CH1B 5B39G 2YPLE 3CSYB 4A2LA 1ZV5A 2XZAL 4GO6B 1I7TA 5FYJL 4ZPTB 3FQUB 2X89A 1UWGL 3C6LC 3MRCA 4QRUA 2H2SD 4K23L 4JZNA 4NBZB 5GQBA 1O5DT 1LE9B 1UH3A 1GAFH 3HI5H 4P5KA 5FV1L 4OAWB 3TZVC 1K4CB 1BECA 4NHCL 4OLVL 2MMXA 4XWOD 3RAJH 3VJ6A 3RWEB 4P2RD 4H25B 3GMPA 1T7VA 1LO5A 3C8KA 2VLJA 1MVFA 2X4TB 3NFPA 4UDTA 4QHMB 4HWBA 3IJSB 2NY2B 5BVJB 3IJHB 4Z7UE 1MRDH 4DVRL 1NUDA 5AEAA 2CDGA 2VXUH 3EJJX 4XBEL 2ZSVB 5EU6A 5EA0L 2QSTA 1NCBH 5E56A 4B53A 5I71B 3NOIA 5I8EA 2CGRH 2UWEE 4P57B 4JE4B 4D0BB 2OTWA 4XPTL 5DD1H 3AGVA 5DUML 1AHWA 3QJHA 3RHWF 1DEEB 1T1YA 1N6VA 5F7YC 4OFKA 3CPLA 3STLB 5C0EB 4RBPH 4XMKL 3BH8B 2NY3D 1QO3A 4HLZH 1KLFA 1M71B 5B3JE 1HCVA 2Q1EA 3QEGH 5GS1A 4QHUB 1T83A 4JFQA 3EOTL 2GI7A 2Q20A 1QQDB 5HDLA 3V52L 1CICB 1WAAE 4O58L 3SKNA 2Q6WB 2DQEL 3C8DA 2ZUTA 3VI4E 2VDLH 4M6OH 3LKOA 4PJHF 4R3SA 4K7FB 4D3CL 3UYOD 2CLVA 1RUML 4OD2A 4LPXA 4Q9QL 3S36H 3TM6A 1YJDH 2HLFD 4GT7A 3QDHA 2FWOB 2VXTL 4MQ7A 3TGXA 4NNPH 5KVDH 4JREC 2XRAH 3V4UH 4J3SA 3X11A 3KG5A 1W72A 4LRNH 2N7BA 4MQSB 2MFNA 1G6RL 4NRYA 2QADD 1M7XA 4M7KL 4K7FA 1FYTB 2BNQB 3VG9C 5KW9H 3IAQA 2RFXB 3WDHA 4OD2B 2RAMA 5F93C 3QZWA 2ESVD 4P23C 1I9IL 3DUHA 5JMRA 1U8PB 4CVWA 4ZDHA 1AGDB 2R1XB 2ZG3A 3ILQC 2AJSL 1WISA 4NNXB 1MAML 5J13B 1MCEA 3E8UH 4UOW0 2NYYC 4AYFA 4JANA 2X4OA 3G5YA 5EUOB 3ZTJH 4U1MB 4I2XA 1CFBA 4HUXB 3Q5YA 1NLBH 3R4DA 1KELH 4IRJC 5HDQH 4JM4H 3UBXA 5C0AB 5D96B 4EJ1C 1MCSA 3ET9F 4CBPA 1L7TL 2J6EL 4MQTB 5ESQB 1XGPA 3DYMA 4HF5L 4NN5B 3HC3L 3L5JA 5AAWA 1QSFA 5DMIH 1YC8A 4HQQL 1XGRB 4ZS6C 4XC1L 4JO2L 4GW4A 3FAXA 5IROC 4OSUH 4LQFH 4LVEA 3C87A 4M7JL 4S1DD 4JVPA 1R5IA 5AD0A 1A14L 4KJWC 1SY6A 5FYJH 3UJTH 4OD3L 1KJ2H 2VWEC 3WO3B 1YYML 2BK8A 4FQIH 1RZGB 4K8RL 3WXWH 2WIMA 1ZANH 1K4DA 2NXZC 4LGPB 4K7PL 1OSZA 1EJOL 4OF0A 5CWSA 4HIIB 1NGPL 2AI0L 4I3SL 3KNBA 3C09B 3KPNB 3LPFA 3GSWA 5DDHA 4XNZC 5IR1A 4U1LB 4P9HH 4HIJA 5DA4A 3SKOA 3QQNA 3CDGB 4XTRC 2I27N 1E4JA 2N1KA 4FXKB 1N3NB 2KH2B 2D9QB 3VFVA 1CVSC 3UTSB 3W11D 1U2HA 4OFIA 3DO7B 4Y5XA 2VZTA 2VDKH 1D5ZA 3QXDB 2R1YB 2BXYA 2NW2A 3RPKA 3TZVB 1C5BH 5IUSA 1EHLL 5I2IB 3OKLB 4CGTA 4PV8A 3K2MC 5F7WC 1NGQH 4RSVA 1TJIH 3JXAA 1S7RA 4YBHA 1NLDH 4R9HA 5EN2A 3WYRA 3ULVL 3S3PA 4HJJH 4KUZH 3VWKD 1HH9A 4UV4L 5KVFH 1A2YA 1QEWA 4I18C 4JQXA 4RWHA 3SO5A 4ZO7A 2P7TA 1S7WA 4LCWD 3BJ91 1Q0XH 1OY3B 4CNIB 3C2SA 4Q6YA 4XHQA 3GUTA 1FO0H 2ZP0T 3FMGL 1KUMA 1CD1B 2RCSH 1EVTC 5I71C 5F7UA 4KVCH 1IGJB 3QO0B 5BVPL 2H9GA 2IPTL 1I1AA 1L0XA 3MCKB 3V7AG 5DLMH 3ZKXB 3CFDA 2IGFL 5JOFB 3AY4A 5D7JC 4E41E 5KSBA 3AS2A 1QFOA 3VA2C 3BEWB 2NY5H 5FYLL 4ZXBC 5DD3L 1HH9B 4C55A 4FA8A 3O3BA 4FQHA 1OTTD 5F89B 4L1HA 2XKNA 2P7TB 3TV3H 2CUIA 4QRPA 1OSPH 1JHKH 3BH9A 3MO1B 3PWJA 4MLIA 1KPVA 4OBRA 1LEKB 3CVIL 2J8UA 3JV6B 5ESAA 3V4PL 2ZCLH 1DBBH 4Y5VB 1P53A 3ARBD 1FG2B 1GL4B 4N8CH 2ICWJ 2DIBA 3BVNA 3FO9A 3EIFA 3V5HA 2ZSWA 2V7NA 4KAQH 2YD8A 4P46D 1KTLB 1A6UH 2BSSB 3I3EA 4UUJB 2W91A 1A7RH 4NIKB 4DKEL 4MJID 4PRAA 5ICZA 4MCZB 4GW1B 1N5YH 5F6IB 3WUWB 2BOBA 2HFFA 4MHHG 1KEGL 3KPMA 4EN3D 1S7VB 5BMFL 1U3ZA 1RMFL 3MV7E 4S1QL 4GW5B 1OW0A 4UT9L 1QR4A 4GAJH 2VDMH 3VE0A 1EZVY 3RTQA 3L6FA 5IBLD 1ZHLA 2WSKA 1FNSL 4L4TB 4YBLB 1ND0A 5DF0A 3LKRA 2YRPA 4LCWB 3MRNB 1BZ9A 1J1PL 3D87B 2R4SL 3EZJB 3GMMB 3ZL4L 3O45A 4MCZA 3IDMB 3OG6B 2NLJB 4JAMA 4P23B 43CAA 4QRRB 4LVHB 5F8QC 4R2GD 3HC0A 3SE4A 1JGUH 4AH2B 1JGLH 4TUKL 2VABA 1MHHB 1XF2A 1QHPA 3GNMH 1MEXH 5E5MB 2R69L 1I1AC 1WWAX 4NGHH 3PV7A 3PL6B 1MCPL 4MXWL 5CUSL 5BS0B 2A6IA 1U8MB 5JUEH 5HGHB 4KRMB 5D96C 3HR5B 4F37F 5I1LB 5DUBA 3ARFB 2VDNL 1J1PH 3ZL4H 4DFHA 1RJLA 4W6YB 1XAUA 5IMOA 5HJ3A 4M1GL 1WIUA 3OX8A 1A0QH 3QHZL 5HYFA 3U9PL 4F9PC 2Y4SA 1YMMA 2DBLH 4J8RB 5E5MA 1CT8B 1CLOH 1RFDH 5I73B 2H26A 3S36X 5K9KB 15C8H 3MFGB 4PGCA 1SJHA 4JFHD 1TVBB 2DIAA 3TT1H 2JF1A 5IP4A 1A7PL 4F37K 4PP1C 1MIEL 4OCSH 3QEQA 2B4CL 3U7WH 5FHBH 5H35A 1MCRA 5FB8A 2GJJA 3HMXA 2NX5A 3LN4B 4JO3L 4JJHA 2B4CC 4U1JA 3RRQA 4EOWL 2AS5M 3OTTA 3IS1X 3MLPA 5I74C 4PJBB 5D7KE 3D1MC 3GB7A 3QEQE 2IAMD 2ITDA 1H15A 3EO1A 1C5DA 2WQRA 1MQKH 1CT8A 4TTDD 2IPUK 4LSTH 3QNZB 5JXAL 5H2BA 1XH3B 1KYOJ 3OXRA 2B2XH 4LKXB 4K55A 3N9GH 2FZ3B 1T0PB 2ENYA 1BM3L 2WANA 4JM4L 1T5XA 1FFPA 3SE9H 3T77A 1U8HA 4C56B 3VWJA 5KANI 1QFHA 4HK3N 1G7LA 2DAVA 1WCQA 2NZ9C 5ICXA 1IM9A 2G75A 3F7VA 3MYJB 4AEHL 3DUUB 3B9KC 4PJDE 3O9WC 4HHAA 5I18H 5HY9B 3SQBA 1MHPH 2RGSA 3NCCB 3P9MA 3PWUA 4KHTH 1FAIH 3SKJH 4OCRH 1WEJL 1JGVH 4U2YA 3U4BL 1TQBB 3FQNA 5E03A 3QQ3A 3QULB 1I85A 5DJXA 2WBJB 4U1HB 3X3FH 1XR9A 5J6GA 1HXMB 2G5BA 1H3GA 2HFEA 3QUZC 1H3UA 2X9YA 4M5ZL 4ZTOL 4M1CC 3W2DH 4HCRA 4GKZB 4MNGA 5KSAC 4WENB 2NY6D 3KJ4C 1FSKB 2VZ1A 3QDGD 4GG6B 3KAAA 4OIIL 2XRAL 4OZIA 3LAFA 3UJJL 5GGUA 3FONA 1UB5B 4ODTH 2DI7A 5MI0B 3QDJA 1I9JL 3S37H 3RZCA 2BCKA 2EO9A 3S4SA 3BI9X 1IAII 2A6DB 3TBTA 4G8GB 4YXHL 3QHFL 2O61B 3BDXA 4Y2DB 4UIMA 1AKJB 5I17A 4M6OL 1TTFA 4FNLH 1IKNA 3FQXB 2YWZA 4NQCE 4A2MA 1HDMB 2F54E 1UZ6E 3OKNB 4HMDA 4GG6A 3OB0H 4AIOA 3O6LH 2JB6A 4YHIB 3ZHDA 1FFNA 4MD4B 1AP2A 5FGBA 2UZYB 3EYFA 4YDJB 3EFFB 2X4SB 2CDFB 3QDJB 4TSAL 1G84A 3CVHL 4P4RB 2EH8L 2HP4A 5F9JA 1TLKA 4KKCC 2X4TA 1RJCA 3ULUF 1PY9A 3AAZB 4K71C 2PW1B 5LQBL 4JPVH 2ZJSL 4UQ3B 5J0BA 4MXVE 1U92A 4BQ9A 4F3FA 2XN9A 4MA7H 4RQQB 2PTUA 1U3HA 3WXVL 4K9EL 1CFVL 1YDPA 2XFXB 1QLEL 3SDXE 1EZVX 1FFNB 2P4AB 3DHJA 4XNQA 4QOKE 3MBED 1M1SA 2HAZA 4P2QA 1BM3H 1I1YA 2DQUL 3C08H 3DYOA 1DDHA 1I3RA 1UA6L 4TVPL 1GC1C 2EH7L 3SJVE 5C0EA 3CFIC 3LY6A 5I1AA 3QIWC 1ZA3A 4HX1B 4S1SH 2HN7A 5L8JB 1A6TB 3VFTB 5IM7A 1I9RH 5E70A 1MQKL 3MX0A 3P4LA 1DUZB 1F6FB 4OCLC 4GAYA 4IOFC 1P7QB 2DBLL 1QQDA 4JFHE 4PB0H 3NPSC 2FBJH 3EOYG 4X5XA 5F1KC 4QHKI 4JHBA 2A9ML 1MFEL 1AO7A 3ARWA 1FORH 2XWJA 4MNQE 4JG0H 4AEEA 1T7XA 3NCMA 5ABDE 4LKCA 3TIEA 1I3RB 4G8IA 2A38A 4KUCF 2APTA 5IEHA 5I1AB 3PDGA 4X0KA 2ID5A 1W8OA 3GSNH 4PJFA 15C8L 2FWOA 3RI5K 1DLFH 2ORBH 3F7PC 5J9PA 3VGBA 2O5ZH 4M6NL 5IJKA 1MAKA 1JTPA 1IL1A 2EDEA 3CJJA 1FZMA 4S1RL 1MHEB 2Y7QB 1OP5H 4GQPH 4HJ0C 3FQRB 3MCG1 4WWKA 2NY7H 5LG1A 4YAQA 5F9OH 3F8UB 2YBRB 4J7RA 3MFFA 2DDQH 4Q9RH 4G9DA 2APVA 3H3PL 3B2UD 4HWEL 4Z0XA 1IARB 1EBAA 4OM1H 3S88L 4WNQB 5CHNA 3U82B 1JF5A 1S9WB 1JNNH 4H8WC 3HUJF 1QA9A 3IRPX 4CRPA 3MRDB 2HYMA 5EZOL 2EZ0D 5CEXA 1S8DB 2WP3O 4NNPL 1Q9OA 2ADJA 4ZOBA 1KEGH 4N5UA 5EIQA 1WLHA 4NC1E 2R4SH 3M1BB 4QGYA 3O2DH 1GGTA 1NGXB 1HHJA 4POZC 4C4KO 5C0RL 4NM8L 4OZFA 5K9JH 1KT2A 3T0ED 2CRMA 4PJAE 5CP7B 1I1FA 4LPYA 5BQ7B 3HG1D 1DQTA 3GMPB 4U6VL 4PRBA 4NRZA 4XBPB 4BZ1L 4YPGB 4ZQKB 2ZKHL 1LO0L 3LKQA 4ENEC 4EN3A 1ONQB 1F13A 4IOFD 3MRDA 1AD0B 2V17L 1J18A 5L8LB 5DS8A 3IJHA 1UXSA 1MCQA 4H20H 5IB4A 3HG1E 3ULVC 3CMGA 1GGCH 4CU6A 4KTYA 4NQDE 1B0GB 1L4IA 1JV5B 1TETH 2QSCH 5EU4A 4M9OA 5AWNL 5MP6L 4D0BA 1PEWA 1CTNA 5DZOA 4UDUA 4PRID 1F3DH 3RWCA 1PD6A 1C16A 2GUOB 2WUBH 1WSST 2ICEA 4O2EA 4FQ2L 5HDBE 5F72S 2AABL 1BFOB 1ZA6A 3NA9L 1OSPL 5TQ2H 4GAGH 4KGJA 2B4CH 3U7WL 3N1QC 4U31A 2HH0H 1JYVA 1KB5B 1RUQL 5FCUL 4KKNA 5DQDL 3BISA 2H6PA 1BVLA 3S34L 2CO6B 3UO1L 5F8RC 3OB8A 1CQKA 3KLDA 3V0VB 2ICEB 4O2EB 2Y07L 4DKFL 4OQ1A 1JFQH 1PQZA 2J6EA 4KXZH 4XPHL 2X4UB 5BZDB 5K9QG 3BGMB 3OKMB 5ITBL 1NCWH 5HDOA 2HFGL 3FQTA 3Q6GL 2VLRB 3QUMH 4XCYB 4F7TB 3D25B 3F7YA 5I66A 4PREB 4NGHL 4QHLB 2JJSA 4EQ2A 5A43C 1OAXH 3TESA 4NRXA 2NY1D 5ALCL 2YXFA 2VRAA 5F1OB 3P0YH 5BO1H 2C1OB 4PB9H 1TZHA 5ETUA 2P5WD 4N8VB 4QRRD 4APQB 1RUAH 2HKHH 4HWZA 1EFXB 2R2BB 5FYKU 1TNMA 3O3BB 1DTUA 4FQHB 4OZGF 4Z7QF 4EUPA 3MOQA 4X6CF 3RFZC 3KPLA 4ZO9A 4EVNA 4MAYD 2AJUH 3IAGC 1BIIA 4QOKD 5ESAB 1A1MA 4UIKH 5I19L 1AIFA 4JGJA 5DQJB 1F90L 4BSVB 1YY8A 3FRUA 2XIDA 4NNYB 4RRPA 2EICA 1JNHB 5F3HA 3TA3A 5INCA 2MPAL 4D2NA 3WXWL 1R5VB 4U4BA 3MRLA 5DD5L 3NCEB 3GJEB 3THMH 1EEZA 1MJ7L 1XR8A 3MV11 4N5EC 1RULL 1A7RL 2C1PB 5HGAB 2ZZUT 1XZ0B 3BZFB 4KKLD 4GW4B 4P5TD 1BBDH 25C8L 3B9KD 4NO0D 4Y89A 2HG5B 3V5KB 1NSNH 2D7OA 4R2GC 2GK2A 5IVNA 1DBBL 1N5AB 1CXKA 4MB5A 4NNYA 4APQD 2I60H 3IFLL 1YMHA 1EEUA 4OCWH 1KIPA 2FIRT 1FZKA 3EJYD 2NXYC 4LU5L 2E3VA 1Z2KA 4LLQB 2EDOA 3KLAA 5JW4Q 3ESUF 3HNSL 2BOCA 4P23A 4M4RA 4RMQA 1Q9LB 1FNGA 4IDJL 4FMFA 4MMXC 5DD6B 5HVHB 5DTFB 1JYNA 1F8TL 4AMKL 1GGIL 1AFVL 1AR1D 3BSZH 4C57C 5BCAA 3V4UL 3FMGH 5JHLL 1B2WL 2W0FA 2PCPB 5SX4H 1UACH 1JHTA 2K7PA 1CLZH 2OR9L 3B6SA 1ZVSB 3MSPA 4DOHB 4XCCH 4L8DA 3QXDA 1U8MA 3A6CL 3UZQA 4Q6IA 5GSVA 4D9LL 3QPQC 4WHTA 5C0IA 3PGCA 1YEKL 5HGHA 4PJDA 4L5FH 3VDCA 4L8CA 1R5WA 3RHWK 1AGCA 1ZWIA 2VKXA 3NFNB 3CVHA 2G9HA 4WTXA 2WLYA 1D9KD 4CAGA 4M9PA 1MLCB 5BO1L 4JEGB 1RJZA 4KDTC 1HWHB 3SGEI 1FL3A 5HHMD 5DO2D 4EBQL 2YD1A 4ZSOB 4R4FL 3VXMA 4JN1H 3C09C 5KS9F 3IDJA 1EVUA 2BVYA 2PUQT 4LSRL 1RUMH 4I8DA 4BZYA 5C07E 5JO5A 5EC2A 1J86A 3HZKB 3MNWB 2NQCA 1A1NB 1CF8H 3DNKA 1WWBX 3CX2A 4NZRH 1CGSL 3T1FA 3TN0B 1EHNA 4OZ4B 1JGEA 4OTXL 4M02A 1YEHL 5C07A 3H0TB 1V7NL 4WO4D 4P0DA 3A67L 4M62H 4GXUN 3P0VH 2G5RA 5FOBA 2IWGA 4JCMA 3DX8A 2R23B 5DJCA 4JRYE 1OT1A 4CN1A 3KPOB 4AEIH 1GIGL 4Y19A 3WIIL 4XH2B 4PJIE 5D1ZD 2R0LL 35C8H 2C3HA 5C0BB 1INDH 3HE7B 1FDLH 4WEBL 3JWDC 2VL4A 4KK9D 3BP7B 3U2SB 3BPNC 2WINB 4OF8A 5F1NB 5A2FA 5IQ9B 2GK0A 3V5HB 1X5ZA 4FXGA 2VLMD 3PGDB 3QJFB 4JPIA 4PJ9B 3NBNA 4TPRH 2WV3A 2K1MA 4G8EA 4LMQE 1MUJA 3ZKXC 4KMQA 1HINL 2GITA 3ZYIA 3LD8B 3IB4A 2ICWI 3GM8A 1CXHA 1KCLA 3NGBB 5GHWL 3X14B 2CIKB 3S96B 5FIEA 2CIIA 1BP3B 3QEHA 4HUMB 1KELL 5GZNC 5D2NC 4P2RA 4BUGA 3RJDA 4Q7DA 2EH7H 1VFOA 5GRXG 5IWLA 5MEOB 4QTIL 1JF1B 2O26U 3F12B 1CGYA 4H20L 5EO9A 3T2NH 1NEUA 4NKOA 4Y5VC 1UH2A 2QKIA 1MAMH 3ZLQC 3JUYA 2PW2B 1N7MH 5ANMA 1YA5A 2H3NB 4HC1L 2Q86B 4EDWL 5GGQL 2DBJA 5JQ6H 3HAEH 4HGWB 2H8PB 4HIHA 3I6KB 5I16A 3X14A 1YEDA 4FQXB 3S37X 5LQBH 1IQWL 1CE1H 3O2DL 5C0RH 4RGNC 4QY8B 5HYQA 5EZLA 2AGJL 3WHE1 1DVFA 2XTJC 3IAPA 4PGDB 2XQBL 5T33H 1BVKA 4CW1A 3K74B 3VFWA 4G80B 4R0LA 5EUKA 4LCIL 2MOVA 1CXFA 1JI1A 3FFDB 3I6GB 2F74A 4LFHG 4XZUA 4MHHI 5C3TA 4CVUA 1A6VH 1AGBA 4Z78A 5EG6C 1CLYH 5FO8B 5MI0C 2NCMA 2N56A 4YXLL 4FZEL 4MCYB 4LVNB 4P4KA 5DHYB 4Z7WA 3O8XB 4WDIA 5EZLB 4QNPF 2HTLC 3MRQA 1RV6X 5EO1A 5TE4L 1I8LA 1JWMA 1NEZG 3HKFA 4Q9CA 1D7FA 4G80A 5IK3A 1S7XA 3O8XD 4NQVB 2H2SC 1A21A 4M3JA 5C6TH 4PRHD 3TNMA 5FKPB 5C8JB 4ZAKB 4HUUA 3MLZH 3W2DL 4HWEH 2A6KA 1L6ZA 2R1WB 1NCNA 5LBSL 5ISZB 2NMSA 2YS4A 3GSNL 1YEKH 2X9XA 4ODHH 1CXLA 2XV6B 4MCYA 2ATKA 3RWGB 1B4JH 5JA9A 4LIQE 4O02H 3G08B 2HKFH 5EU6E 1MHPL 5GRJH 5B39B 2OCFD 4KXZI 1NMAL 3QP3A 1NCBL 4LSQL 5KZCB 2Z93A 1LEIB 4PLOB 1Q94B 4AENB 3TNMB 3FOLB 3GBNL 4KROD 3HNVL 4G8FA 4ZAKA 5JW3H 4F15B 2R29H 3WNPA 4JRXB 2XA8L 2DWDA 3W9EB 3LDBC 3M8OL 5TDOB 5C1MB 4HKJA 5SWSB 2V2WB 1A22B 4TNWF 4XP1H 4CL7A 4FQJL 1CZ8H 3N85L 5MENB 3S7GA 3I75A 4PGBA 4HZLB 4ZFOL 3M07A 4K3EL 2CUMA 3CDCA 3EYSH 1LO3H 3FO2A 4PJXB 1DE4B 4N0YL 3FOLA 4XP4L 2EDBA 4QRUB 5KOMC 5JDSB 1JN6A 2FLRT 3BKJL 2VLKE 3HNTH 3C6SB 5ID0B 2Y5TA 4YGVA 1QPXA 2BSTB 2QADC 1MJ7H 4P5TA 4QTHA 4ZFOB 2DLIA 3MFFB 5SWSA 3D0VA 5C0CA 4MD5B 4NDMA 3KYNB 2KKQA 5FGRA 1PKQE 3CVHH 5A3IC 4AQ1B 3TN0C 1QBLL 3ELAT 4H25A 2F54A 4PV9A 1CVRA 2ESVB 2WBJD 1J0IA 1W2KT 4RMTA 1MCFA 5CSBA 1S9WA 1VERA 1DFBL 2NW3B 1U8KB 2DQFA 1FYTD 3CLFH 3KYOB 1IQDA 4HT1L 2AJZB 4G9FB 3W9DA 4M1GH 2CDGB 4GFTB 2E7LC 3IKKA 1CFTB 3CZFB 1BF2A 1ED3A 5D2LA 1B4JL 4H1LH 4L8SA 4P99A 3UYRH 3AREB 4OCXH 1SM3L 2VC2L 1VFAB 1Q8MA 2X5PA 4Q2ZA 5HHOB 2JB6B 3MRPB 4OLYH 1MJUH 3MR9A 4P2OA 4ZS7L 3SDCA 5ERWA 4RBPK 3VMNA 5KSAB 2ICES 3RGHA 3OKDA 1KCSL 4Y16B 4IM8A 2HWZH 3ZMRA 2ARJB 4I2XE 5E8EA 5CBAA 4UQ3A 2A73A 3K8MA 1FQ9C 1ODAA 5LGHL 1F97A 3P4OB 2JJUA 5GS1B 5D9SA 3UDWC 3VXRD 5JZ7D 4JLRA 2XOTA 4ODXA 3ARZA 3GEWB 3KWWA 4O51B 3DROA 4MQXD 4YXLH 2R0WL 1XIWA 5E8PA 3C9NA 3WNOA 1T1WB 3FTGB 3RKDD 3RVUD 1HE7A 2C3VA 4X99A 1UT9A 4FQQB 2H32B 2AEPH 2C4FT 4JFFA 4X9FA 2L0DA 2XICA 5AYUH 2YPLA 5DK2A 4L3ED 4Y16A 2EKSB 4FFVC 5HGBB 1U9KA 4MNQA 2HN7B 1X5XA 1NAMB 3OGCB 4IMKC 4LLDA 5C08D 4XNZB 3MGTA 3KLHD 2BVPB 2NNAB 3G5VB 3MMEA 5D9SB 2AGJH 3H9ZA 5CJOL 5DEGA 5IJVB 3SCMC 2XTJB 1BBJB 2VJXA 5B8CB 4F7EA 2O93L 1C5CL 4DKEH 3TIDA 3MOAH 2X40A 4CN6A 4LHUG 4EIZC 4A6YB 1KN2L 3G5XA 4HW6A 4X8JA 4FQQA 4JFFB 1VESA 2L4OA 4R4BB 1F58H 5EPMA 2AJYL 4OF3A 4K94L 4N5ED 1KC5L 5I0ZA 2FX8L 5FA4B 1S7TA 1SEBA 3MGTB 2X4UA 1E4XH 1A64A 5FHBL 2R0ZH 4L8SC 4FXLA 4FQLH 1BWWA 1JPSH 3MRCB 3FZUC 1HSAB 4PD4J 3QUMA 5EU3B 2FATH 1BQUA 3FQRA 5MEPB 4EDXB 4F9LA 5DI8B 2BC4B 3BT2L 3OPZL 3AM8C 3QZWG 4OUUA 1DN0B 1QACA 1K4CA 1OLZA 4OFDA 4PJ5A 1GGBL 5CMAA 1UB6A 4XNXH 1I3GL 2W92A 1EHAA 1P4LA 3LMJL 3MGAA 3PXHA 2D31B 4XGZB 4X4ME 1G7HA 4U6TA 5ESVB 4JFXA 3BZDA 3KPRD 1T2XA 2WUCH 4J2XA 7FABH 1CD9B 1FVCA 3BXNA 5IW1A 3NFPB 4UDTB 4NJAL 5CD3B 1R3IL 3MJ6A 3VG0H 4XVJH 1E4KA 4NKIH 5JUEL 3CSGA 3MRHB 1FV1B 1HIML 3WJJA 2HRLA 3VCLA 4QYOA 1JNNL 1F11A 3ZE0F 1QR1B 1RZ8A 3VD3A 1A4KB 1YEGH 2P45B 5T5FH 4K3DH 2PYED 3PNWB 3P0VL 3QHZH 3JTSA 1T2QL 3EOBB 5IV2A 1P4LB 1C7TA 3BN9D 1RZGA 2E6JA 1LO4L 3ZTJG 5CCKH 8FABB 4ZS7H 3UAJC 3TO4B 1U91A 3I50H 1S9YB 4WFFE 4OF6A 5F6IC 3BH8A 3VRLE 2BVOA 5JPNA 4N90D 1CBVL 4PRHE 5B4MD 1MH5B 3RZWA 5C2UB 2E9BA 4J1UA 1OARH 3SGDI 4JR9L 3ARDA 2J8UE 4AZ8A 4NQED 5JW4R 3EGSB 4NO3B 4OZHE 4BKLA 4QF1B 2GSIA 1UFUA 2X4PA 4NQUA 4ELMA 1NDGB 1SYSB 4NUGL 3LKNA 3LEYL 1NBVL 1B3JA 2AK1L 2OZ4L 4XCFH 4N68A 5FYKD 1CXEA 3DO7A 4YBLC 5E6IB 4YHZL 1G7JA 5I8OH 1IM3A 1D6EB 2CLVB 3KLAB 2C4FU 4XVTH 1YUHA 3LQAH 3V6OA 4MS8C 5DJ2B 3GSRB 2UZIL 3D48R 3O4LE 5BRZA 1TPXC 5L9DH 1F3JB 2YA2A 1JNJA 4PJGF 1IC7L 3RWFA 3DSFH 1F58L 5T5NG 1BX2A 4GS7C 1AO7D 4PR5A 3IDGA 2ZWLT 1FVEA 1Q72L 2BNQE 1ITCA 1CXIA 1IGML 2ZCLL 3HC3H 4HPOH 1KB5A 3VXQB 3GIVB 4WO4A 3QUKA 4LSUH 4LLYB 4UT7L 4S1SL 3MRFA 3RIAK 1JPSL 3S5LA 4YHYB 4MD0A 2BNQA 3CFCL 2NY4B 4U6HB 2VXQH 2HRPH 4YK4C 3S35L 3UPRA 1LE5A 1NLBL 4R26L 4MJ2A 2ZPKH 1AGDA 1P84J 1QLFA 1IAIH 5FECA 5KN5B 4LSQH 4PR5B 3O2VL 1JZ8A 5DJYA 5E2WH 5IB3B 5B3NA 2XY2A 4X5WB 2JCCA 5HYJD 2DLTA 2IBGA 1G0DA 3PUCA 1ADQA 5E9DA 4PJCB 1UZ8B 5TE7H 3MNZB 3INUL 3DIFB 3RX7A 4LPUA 1NKOA 2GT9B 1JRHH 2BSED 3NH7L 1EO8H 5HHPA 3WLBA 4BH8B 2CPCA 1G0XA 5F88B 1OVZA 1H3WM 1UYWH 3K1KC 5CBEB 4NFBA 1JGEB 2VDPH 4XNMA 2MHAB 1J7VR 4PG9B 3RNQA 1BMGA 3D69A 1NGYA 5IBLC 3DVFA 3W5MA 4F8QA 1WBYA 1CG9B 1A7BA 3PWLB 2OZ4A 3UYRL 1QSEE 1U2CA 4LARH 4MSWA 4NFDA 4L4TA 3MLVH 2GW5A 3MRGB 5SWQA 3WFDH 1DFBH 1EJOH 4LCIH 2JELL 3O9WB 3CDFA 1NANI 4KI5C 4APQC 1SM3H 4OZGA 3QEHB 3BWAA 4S0TD 3U4BH 1BF8A 3HI6L 2QQKH 3MUGB 4NYLB 4MZ2A 3C5ZD 3S98A 5IFHL 4X6DF 4XPHH 1EJ6A 3C60D 3LRGA 2KPNA 5L7XH 3NZHH 4U3XA 5JQ6L 4OZFG 3TFKD 2ADGA 3E6HB 1KCKA 3KJ4B 3QNYA 4HKZB 2AW2A 4D0CA 1JPGA 4OV5B 4PJEA 4XBEH 4Y4KB 2NTFA 1MRDL 2AJVL 3GMLA 1EUUA 4MAYA 5DJAA 1ULVA 4PJIF 3UJIL 3VXRB 1VCAA 3IXTA 1FRGH 5HDQL 3DXAE 4LCCA 3IKCB 2WZPD 3LQMA 4XNUL 5C0ND 3BRDA 43C9B 2XA8H 1FL6A 3F6LA 5BJTB 3SBWA 2P5WA 2IALB 2EXWD 3I6GA 3EYSL 4WGWB 2IANE 5KSAD 4L1DA 1CDGA 1WZMA 1OGAB 5HYSA 3ZYOA 5FFLA 4QRSA 1CZ8L 1EDQA 1D5IL 1JBJA 2LFGA 4ONGH 4V1DD 1DBJH 2KZ1B 4X4XB 2IANA 3MGOB 2QSCL 2OJEB 5AWNH 4QXGH 1EA9C 3VXRA 5HHXL 4Z7WB 3MJ7B 2X7LB 4NKDB 5JNYB 4LF3B 2R0LH 2MCPH 3N0PB 5H2BB 3CC5B 3GBNH 3BKCL 4M7LH 3TCLA 4NQVA 4HKBB 3WS6C 4JO1L 4D9QD 1J05B 4PJIA 2R2EB 5I76B 1TZGH 2JLLA 5A16B 2B8OT 2PO6C 4NQTA 3I02B 5T1LB 3MV7B 1NGWB 2ITCA 4RNRA 2E27H 3T0XA 4X6DE 5HI4C 5IHLB 5I30L 2X4RB 5DMKA 3B5GA 1Z6JT 4TUJA 1HEZB 2Z92B 4OF5A 1RU9H 1K8DB 1P2CA 1SVZA 5DEFA 4GW5A 3L3OB 5HYJE 5KVEH 5L6YL 1DQJA 3BN3B 3FAWA 4TUKH 3NPSB 2ED9A 3N1GC 3OHXA 1RK1B 5F7KC 2CK2A 2W1NA 1INEH 1W72H 4QRRE 1D5MA 3TFKC 5GZOD 5D6CB 5HYJA 1WFUA 2Q76A 5TDPA 5JW4N 4I0KA 4MNGB 3GMMA 2ITCB 3TBWA 5IHUH 2Z8VC 3HRPA 5DJ0B 4LCCC 1U3YA 1QFWI 3H6JA 1KENL 2R2HB 3QNXA 2PNDA 2ZOLA 5DD1L 4KROB 5GGQH 1XF2B 3VFMB 4KFZC 2F53B 3T8XB 1ZGLP 5MHSE 2VOTA 2BNQD 1AO7E 4ZFGL 4DZBA 3MPCA 4JFDE 3IDYB 3RTQD 5JZ7C 2XKUA 1MCNA 1V3JA 4N0UE 4U1IB 1RQ5A 1G0YR 2Q76B 4PGJA 1I9EA 3TBWB 3T0AA 2YN5A 5C0CB 3UMTA 1DBJL 1U8LB 2P47B 4JY6A 2XWTA 1ZTXH 4EDWH 4LLVB 4L3AA 2OJZL 4ZAKD 2X1WL 3HMWH 5TH2B 4P46A 2J4WH 4JG1H 4N8PA 1YQVL 5KTEL 2FYYA 3WDIA 3NAAH 4Z7QE 3WE6B 3NGBC 4WUKH 2EZ0C 2XWBA 4I4WB 5DQ9A 1TVBA 3H42L 5HHXH 3PQYB 4AM0A 4CMMA 5DA0B 2Q8BL 1WUNT 4PJBE 4JHWH 4N90E 1MFCH 4KK5D 3FN0H 1CFNA 5D5MB 5T3XH 5FB8B 1A9EB 4FTVE 4NO2B 4MNHB 5GISL 2GY7B 2BXZA 1PLGL