2VDMA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdmA00
3NIFA 2VDOA 4WK4A 1TYEA 3K71A 1M1XA 4UM9A 5FFOA 4IRZA 3NIDA 5E6SA 3FCSA 3VI3A 3VI4A 4G1EA 5FFGA 4WK0A 3NIGA 3ZE2A 3V4VA 3IJEA 1JV2A 2VDKA 4UM8A 3T3MA 4Z7OA 4MMXA 2VDNA 2VDPA 4G1MA 3V4PA 5E6RA 3ZDZA 4WJKA 4MMYA 2VC2A 4WK2A 3K6SA 1U8CA 4Z7QA 3ZDYA 3FCUA 3T3PA 3K72A 5HDBA 2VDRA 1L5GA 2VDQA 3ZDXA 4NENA 4O02A 5E6UA 4MMZA 2VDMA 4Z7NA 3ZE1A 2VDLA 3ZE0A
chains in the Genus database with same CATH superfamily
3J80g 1XIPA 4J0XA 4WK4A 3RFGA 1UTCA 2CE9A 3I7KA 1VE6A 2Z2OA 3EI2A 5IGQA 5CXBA 3I8CA 4WK0A 4L1MA 4Y5RD 3ZWLB 4K3JB 4BUJC 1H2WA 2P9NC 3PXWD 4JSNC 3C99A 4UI9R 2YNNA 3I2NA 1OLZA 2VDPA 4G1MA 3UVNA 3OW8A 2QZPA 1NEXB 1JMXB 3GD1I 2VC2A 5CYKA 4E5ZA 4XYIA 4A0BB 4LG9A 5GXIA 5I5IA 2G99A 2YNOA 5IGOA 3PXSD 4CZVA 4AN1A 4PSXB 2HESX 2H14A 2OJYA 2Z2NA 4BL0A 3SVWD 2Q7QA 1U2VC 3W15A 4BCBA 4D6VA 4A09A 1GOGA 5TF2A 3EI4B 2HU8A 3IUJA 3SBQA 3SBRA 3E0CA 5EARA 2CN2A 1BPOA 2G9AA 3DSMA 4FHLA 4G55A 4IA9A 3DM0A 3I7NA 4FA9D 2JKXA 3BG0A 2VDOA 3GC3B 5FFOA 2EIEA 4YVDA 2H9PA 3I8EA 1PEVA 4A0AA 4J82A 2P9KC 1C9LA 2UZXB 5HE1B 4AMYA 1E8MA 3F3FA 4CY2A 3IJCA 3IJ1A 1H2XA 4R7AB 2HJ4A 4A08A 4O3TB 4RE6A 4JSPC 5M61A 5M5TA 1L0QA 2I3TA 4NC4A 3MKQA 4JT6C 2AGYA 3JRPA 2CNXA 4QQEA 5B4WA 3IVMA 3OL2B 4O45A 2VZ1A 3V5WB 2H9LA 2QC5A 4J78A 4A11A 1H2YA 4E54B 5GSAA 3V4VA 4JHNA 4UM8A 5IT9g 2VDNA 3I89A 3GFCA 3OKTA 2B5LA 3O4JA 3ZDZA 5M5RA 5C86A 4AOWA 1VZ3A 4JSXC 3IIWA 3UKUC 4E54A 1JMZB 4CI3A 2H9NA 2VDMA 1QFSA 1XKSA 4GGAA 5IJ8E 5CXCB 3F3PA 4J8BA 4ERQA 5AMSA 1JOFA 2QR5A 5C92A 2HXCA 1T2XA 3AL8B 4GM9A 3T3MA 4JD2C 3JROA 5EALA 5E6RA 4BP8A 3AFCA 3MMYA 2GC7A 3SCYA 3SLED 4X63B 4PSWB 3SFZA 5KDOB 5HDBA 3EI1A 2EICA 3UR4A 5THAA 2PM7B 5FKRA 4D9SA 4XYHA 3UVMA 2P9SC 3I7LA 4ZN4A 3JZHA 4KFMB 3O4HA 4U7AA 5K19A 1M1XA 3PVUB 3SN6B 4CY3A 1SQJA 4ZOVA 4Z7OA 5K1CC 4GGCA 4H5IA 1B9XA 5FLXg 3PE7A 4ERYA 5FKSA 3RLMD 3K6SA 3EQ9A 3ODTA 2J55H 3SBPA 1N6EA 2I0TA 2H6NA 4PXWA 1UOOA 1VE7A 4IMMA 1U4CA 2P9UC 4NBMA 5E6SA 1YFQA 4G56B 2AH1A 4L1QD 3CIKB 2H47A 4J77A 4A0BA 4X60B 3EQ8A 4ZOYA 5HQGA 5EM2B 4FAND 3UVKA 2W18A 2O9KA 4J8GA 4O9DA 4QL1A 3T3PA 5HE3B 5HYNB 1I2MB 4N14A 3OTTA 4GZ8A 4LG8A 4O3UB 1B9YA 4AX4A 1JJUB 2CO0C 5E6UA 4MMZA 3PVWB 5FA5B 4AEZA 3NIFA 2OVPB 3GREA 3SXTD 3K71A 3FCSA 1GOFA 3O4IA 2H3XA 3FM0A 5FFGA 3OKYB 2IURA 3EI4A 3JZGA 5H1MA 3RFHA 3ZE2A 1GXRA 4J81A 3N0EA 2HU5A 2IUPA 3RN1D 2PM6B 4CI8A 2EIBA 2PM9B 5IJ7E 5EMKB 5A2Qg 3OF7A 4I79A 2YNPA 4JXMA 2IUQA 2CE8A 2J56H 4AN0A 1L5GA 3OKWA 4AMZA 4DNVA 1SQ9A 3C5MA 3QI0A 3VGZA 5EMJB 4QAMA 4O02A 4PBZA 2CO0A 2H9MA 4GQBB 3ULEC 2AH0A 4IRZA 3A0FA 4NAAA 3CFVA 3L4MD 5H14A 4J84A 2XYIA 2AGXA 5EAMA 4FA4D 2IWFA 2XDWA 2IAAA 3O4GA 5SXMA 3MVDK 4GQ2P 4WJKA 3C9CA 2B5MA 3OL2A 2UZYB 2H68A 3RRMC 1TBGA 2B4EA 3NVNA 3FGBA 4NENA 4Z7NA 3MZKA 4LGNA 4NSXA 3UKRC 4K3ID 5FKQA 1N6FA 5FQDA 1E5TA 3B7FA 3JB9L 4BCCA 4FAVD 1JV2A 2VDKA 5C2VB 2I0RA 5AFU3 5FXYA 3MXXA 3K27A 4L3GD 3I7PA 4GMBA 3F3GA 3MUOA 4DNWA 3EWEA 1NR0A 2BCJB 2H6KA 2QXVA 5CXCA 4A2LA 2OVRB 3BWSA 3SWSD 4OWRA 3AL8A 5M5VA 4GGDA 1Q47A 2HKMA 5TEFA 3CFSB 4FB1D 3QHYB 2GNQA 3VI4A 2P9IC 2TRCB 2YB8B 1QFMA 2HYEA 4CZXA 4ZOZA 1R5MA 1XHMA 4A2MA 3IJ0A 3EI2B 3IIYA 3V4PA 1O6GA 1JTDB 4A7JA 4ERZA 4O1QD 5TEEA 3JZNA 4J73A 5AJAA 1ERJA 4FWWA 4Z7QA 2YMUA 3RN0D 1QNIA 3PSLA 4D0KA 4H5JA 3N0DA 5IC7A 3DXMC 4CY5A 4E5ZB 3BG1A 5CYKB 3SJLD 3V7DB 2GC4A 1K3IA 1E8NA 3V9FA 4TZ4A 1UOPA 3VI3A 1A12A 1H2ZA 3NIGA 4X3EA 1YR2A 4U1EI 2H13A 4ESGA 2VZ3A 2XZGA 1MG2A 4J86A 4MMYA 4XEIC 5I5JA 4A09B 1K8KC 4WK2A 4CC9A 2OK6A 3DWLC 3K72A 3KRWB 1GG2B 2I3SA 3L4OD 3ORVD 2VDQA 4L3HD 2I0SA 3EQ7A 4PNKB 4GM3A 3PSCB 4Y7RA 3JAMg 5JWZA 3MZLA 3I7HA 4J79A 5EM2A 5GXHA 5TDHB 4JT5C 4GQ1A 2HJBA 2AGLA 1PI6A 3KRXB 3AL9A 3IKOA 4A0AB 2HU7A 3DXKC 1VZ2A 2XU7A 4OZUA 3NVQA 3ZDYA 5EMMB 2OVQB 4PC0A 2BBKH 2VDRA 3KCIA 3P4FA 4L9OA 3OKYA 4CY1A 4J87A 3SMRA 1MG3A 4A08B 4BCDA 5HE2B 1GOHA 4UM9A 5EMLB 2PM9A 5FKTA 3RMZD 4FA5D 3IJEA 1N6DA 3IUNA 2AGWA 1GP2B 2WQ8A 3I7OA 2B5NA 3RSEC 4A11B 5C9ZB 4J0WA 3SHFA 5C2WB 4GM8A 1FWXA 2IUVA 4BH6A 4CI2A 1OMWB 5GMKn 4RE5A 4O2WA 5HE0B 1O6FA 4MK0B 1U8CA 3K26A 3NVXA 3IUMA 4Z8LA 3VA6A 3IULA 3IURA 3EG6A 3EI3B 3ZDXA 5M5UA 4CZYA 3C75H 2VDLA 3HFQA 2P9LC 1TYEA 2Z2PA 2HKRA 3J81g 2IWKA 3AH8B 1A0RB 3NIDA 5EAPA 4G1EA 1SHYB 1K32A 2CN3A 3EU7A 4X61B 3EMHA 1MDAH 2H6QA 5M5SA 3FRXA 3MKSB 3IUQA 4JHPC 3PXTD 4DNUA 2AQ5A 3U4YA 2EIDA 4CI1A 3EI3A 4QT8A 1PBYB 5H17A 1PGUA 3VH0A 4ES0A 1VYHC 4BP9A 5I5MA 3UVOA 1TYQC 4JSVC 1UOQA 1S4UX 2EBSA 2AGZA 2XL3A 3EI1B 4HDJA 3JPXA 3UVLA 2BKLA 2XE4A 4ZOXA 2OIZA 4MMXA 4FA1D 5CXBB 2J57G 3MUNA 2MTAH 2PBIB 1GOTB 4QRJA 3FCUA 2P9PC 2YBAA 1C9IA 4EWRA 1RI6A 3DDUA 4PBYA 2XL2A 2OK4A 1P22A 3ZE1A 3ZE0A
chains in the Genus database with same CATH topology
3NIFA 2VDOA 4WK4A 1TYEA 3K71A 1M1XA 4UM9A 5FFOA 4IRZA 3NIDA 5E6SA 3FCSA 3VI3A 3VI4A 4G1EA 5FFGA 4WK0A 3NIGA 3ZE2A 3V4VA 3IJEA 1JV2A 2VDKA 4UM8A 3T3MA 4Z7OA 4MMXA 2VDNA 2VDPA 4G1MA 3V4PA 5E6RA 3ZDZA 4WJKA 4MMYA 2VC2A 4WK2A 3K6SA 1U8CA 4Z7QA 3ZDYA 3FCUA 3T3PA 3K72A 5HDBA 2VDRA 1L5GA 2VDQA 3ZDXA 4NENA 4O02A 5E6UA 4MMZA 2VDMA 4Z7NA 3ZE1A 2VDLA 3ZE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIF A;  2VDO A;  4WK4 A;  1TYE A;  3K71 A;  1M1X A;  4UM9 A;  5FFO A;  4IRZ A;  3NID A;  5E6S A;  3FCS A;  3VI3 A;  3VI4 A;  4G1E A;  5FFG A;  4WK0 A;  3NIG A;  3ZE2 A;  3V4V A;  3IJE A;  1JV2 A;  2VDK A;  4UM8 A;  3T3M A;  4Z7O A;  4MMX A;  2VDN A;  2VDP A;  4G1M A;  3V4P A;  5E6R A;  3ZDZ A;  4WJK A;  4MMY A;  2VC2 A;  4WK2 A;  3K6S A;  1U8C A;  4Z7Q A;  3ZDY A;  3FCU A;  3T3P A;  3K72 A;  5HDB A;  2VDR A;  1L5G A;  2VDQ A;  3ZDX A;  4NEN A;  4O02 A;  5E6U A;  4MMZ A;  2VDM A;  4Z7N A;  3ZE1 A;  2VDL A;  3ZE0 A; 
#chains in the Genus database with same CATH topology
 3J80 g;  1XIP A;  4J0X A;  4WK4 A;  3RFG A;  1UTC A;  2CE9 A;  3I7K A;  1VE6 A;  2Z2O A;  3EI2 A;  5IGQ A;  5CXB A;  3I8C A;  4WK0 A;  4L1M A;  4Y5R D;  3ZWL B;  4K3J B;  4BUJ C;  1H2W A;  2P9N C;  3PXW D;  4JSN C;  3C99 A;  4UI9 R;  2YNN A;  3I2N A;  1OLZ A;  2VDP A;  4G1M A;  3UVN A;  3OW8 A;  2QZP A;  1NEX B;  1JMX B;  3GD1 I;  2VC2 A;  5CYK A;  4E5Z A;  4XYI A;  4A0B B;  4LG9 A;  5GXI A;  5I5I A;  2G99 A;  2YNO A;  5IGO A;  3PXS D;  4CZV A;  4AN1 A;  4PSX B;  2HES X;  2H14 A;  2OJY A;  2Z2N A;  4BL0 A;  3SVW D;  2Q7Q A;  1U2V C;  3W15 A;  4BCB A;  4D6V A;  4A09 A;  1GOG A;  5TF2 A;  3EI4 B;  2HU8 A;  3IUJ A;  3SBQ A;  3SBR A;  3E0C A;  5EAR A;  2CN2 A;  1BPO A;  2G9A A;  3DSM A;  4FHL A;  4G55 A;  4IA9 A;  3DM0 A;  3I7N A;  4FA9 D;  2JKX A;  3BG0 A;  2VDO A;  3GC3 B;  5FFO A;  2EIE A;  4YVD A;  2H9P A;  3I8E A;  1PEV A;  4A0A A;  4J82 A;  2P9K C;  1C9L A;  2UZX B;  5HE1 B;  4AMY A;  1E8M A;  3F3F A;  4CY2 A;  3IJC A;  3IJ1 A;  1H2X A;  4R7A B;  2HJ4 A;  4A08 A;  4O3T B;  4RE6 A;  4JSP C;  5M61 A;  5M5T A;  1L0Q A;  2I3T A;  4NC4 A;  3MKQ A;  4JT6 C;  2AGY A;  3JRP A;  2CNX A;  4QQE A;  5B4W A;  3IVM A;  3OL2 B;  4O45 A;  2VZ1 A;  3V5W B;  2H9L A;  2QC5 A;  4J78 A;  4A11 A;  1H2Y A;  4E54 B;  5GSA A;  3V4V A;  4JHN A;  4UM8 A;  5IT9 g;  2VDN A;  3I89 A;  3GFC A;  3OKT A;  2B5L A;  3O4J A;  3ZDZ A;  5M5R A;  5C86 A;  4AOW A;  1VZ3 A;  4JSX C;  3IIW A;  3UKU C;  4E54 A;  1JMZ B;  4CI3 A;  2H9N A;  2VDM A;  1QFS A;  1XKS A;  4GGA A;  5IJ8 E;  5CXC B;  3F3P A;  4J8B A;  4ERQ A;  5AMS A;  1JOF A;  2QR5 A;  5C92 A;  2HXC A;  1T2X A;  3AL8 B;  4GM9 A;  3T3M A;  4JD2 C;  3JRO A;  5EAL A;  5E6R A;  4BP8 A;  3AFC A;  3MMY A;  2GC7 A;  3SCY A;  3SLE D;  4X63 B;  4PSW B;  3SFZ A;  5KDO B;  5HDB A;  3EI1 A;  2EIC A;  3UR4 A;  5THA A;  2PM7 B;  5FKR A;  4D9S A;  4XYH A;  3UVM A;  2P9S C;  3I7L A;  4ZN4 A;  3JZH A;  4KFM B;  3O4H A;  4U7A A;  5K19 A;  1M1X A;  3PVU B;  3SN6 B;  4CY3 A;  1SQJ A;  4ZOV A;  4Z7O A;  5K1C C;  4GGC A;  4H5I A;  1B9X A;  5FLX g;  3PE7 A;  4ERY A;  5FKS A;  3RLM D;  3K6S A;  3EQ9 A;  3ODT A;  2J55 H;  3SBP A;  1N6E A;  2I0T A;  2H6N A;  4PXW A;  1UOO A;  1VE7 A;  4IMM A;  1U4C A;  2P9U C;  4NBM A;  5E6S A;  1YFQ A;  4G56 B;  2AH1 A;  4L1Q D;  3CIK B;  2H47 A;  4J77 A;  4A0B A;  4X60 B;  3EQ8 A;  4ZOY A;  5HQG A;  5EM2 B;  4FAN D;  3UVK A;  2W18 A;  2O9K A;  4J8G A;  4O9D A;  4QL1 A;  3T3P A;  5HE3 B;  5HYN B;  1I2M B;  4N14 A;  3OTT A;  4GZ8 A;  4LG8 A;  4O3U B;  1B9Y A;  4AX4 A;  1JJU B;  2CO0 C;  5E6U A;  4MMZ A;  3PVW B;  5FA5 B;  4AEZ A;  3NIF A;  2OVP B;  3GRE A;  3SXT D;  3K71 A;  3FCS A;  1GOF A;  3O4I A;  2H3X A;  3FM0 A;  5FFG A;  3OKY B;  2IUR A;  3EI4 A;  3JZG A;  5H1M A;  3RFH A;  3ZE2 A;  1GXR A;  4J81 A;  3N0E A;  2HU5 A;  2IUP A;  3RN1 D;  2PM6 B;  4CI8 A;  2EIB A;  2PM9 B;  5IJ7 E;  5EMK B;  5A2Q g;  3OF7 A;  4I79 A;  2YNP A;  4JXM A;  2IUQ A;  2CE8 A;  2J56 H;  4AN0 A;  1L5G A;  3OKW A;  4AMZ A;  4DNV A;  1SQ9 A;  3C5M A;  3QI0 A;  3VGZ A;  5EMJ B;  4QAM A;  4O02 A;  4PBZ A;  2CO0 A;  2H9M A;  4GQB B;  3ULE C;  2AH0 A;  4IRZ A;  3A0F A;  4NAA A;  3CFV A;  3L4M D;  5H14 A;  4J84 A;  2XYI A;  2AGX A;  5EAM A;  4FA4 D;  2IWF A;  2XDW A;  2IAA A;  3O4G A;  5SXM A;  3MVD K;  4GQ2 P;  4WJK A;  3C9C A;  2B5M A;  3OL2 A;  2UZY B;  2H68 A;  3RRM C;  1TBG A;  2B4E A;  3NVN A;  3FGB A;  4NEN A;  4Z7N A;  3MZK A;  4LGN A;  4NSX A;  3UKR C;  4K3I D;  5FKQ A;  1N6F A;  5FQD A;  1E5T A;  3B7F A;  3JB9 L;  4BCC A;  4FAV D;  1JV2 A;  2VDK A;  5C2V B;  2I0R A;  5AFU 3;  5FXY A;  3MXX A;  3K27 A;  4L3G D;  3I7P A;  4GMB A;  3F3G A;  3MUO A;  4DNW A;  3EWE A;  1NR0 A;  2BCJ B;  2H6K A;  2QXV A;  5CXC A;  4A2L A;  2OVR B;  3BWS A;  3SWS D;  4OWR A;  3AL8 A;  5M5V A;  4GGD A;  1Q47 A;  2HKM A;  5TEF A;  3CFS B;  4FB1 D;  3QHY B;  2GNQ A;  3VI4 A;  2P9I C;  2TRC B;  2YB8 B;  1QFM A;  2HYE A;  4CZX A;  4ZOZ A;  1R5M A;  1XHM A;  4A2M A;  3IJ0 A;  3EI2 B;  3IIY A;  3V4P A;  1O6G A;  1JTD B;  4A7J A;  4ERZ A;  4O1Q D;  5TEE A;  3JZN A;  4J73 A;  5AJA A;  1ERJ A;  4FWW A;  4Z7Q A;  2YMU A;  3RN0 D;  1QNI A;  3PSL A;  4D0K A;  4H5J A;  3N0D A;  5IC7 A;  3DXM C;  4CY5 A;  4E5Z B;  3BG1 A;  5CYK B;  3SJL D;  3V7D B;  2GC4 A;  1K3I A;  1E8N A;  3V9F A;  4TZ4 A;  1UOP A;  3VI3 A;  1A12 A;  1H2Z A;  3NIG A;  4X3E A;  1YR2 A;  4U1E I;  2H13 A;  4ESG A;  2VZ3 A;  2XZG A;  1MG2 A;  4J86 A;  4MMY A;  4XEI C;  5I5J A;  4A09 B;  1K8K C;  4WK2 A;  4CC9 A;  2OK6 A;  3DWL C;  3K72 A;  3KRW B;  1GG2 B;  2I3S A;  3L4O D;  3ORV D;  2VDQ A;  4L3H D;  2I0S A;  3EQ7 A;  4PNK B;  4GM3 A;  3PSC B;  4Y7R A;  3JAM g;  5JWZ A;  3MZL A;  3I7H A;  4J79 A;  5EM2 A;  5GXH A;  5TDH B;  4JT5 C;  4GQ1 A;  2HJB A;  2AGL A;  1PI6 A;  3KRX B;  3AL9 A;  3IKO A;  4A0A B;  2HU7 A;  3DXK C;  1VZ2 A;  2XU7 A;  4OZU A;  3NVQ A;  3ZDY A;  5EMM B;  2OVQ B;  4PC0 A;  2BBK H;  2VDR A;  3KCI A;  3P4F A;  4L9O A;  3OKY A;  4CY1 A;  4J87 A;  3SMR A;  1MG3 A;  4A08 B;  4BCD A;  5HE2 B;  1GOH A;  4UM9 A;  5EML B;  2PM9 A;  5FKT A;  3RMZ D;  4FA5 D;  3IJE A;  1N6D A;  3IUN A;  2AGW A;  1GP2 B;  2WQ8 A;  3I7O A;  2B5N A;  3RSE C;  4A11 B;  5C9Z B;  4J0W A;  3SHF A;  5C2W B;  4GM8 A;  1FWX A;  2IUV A;  4BH6 A;  4CI2 A;  1OMW B;  5GMK n;  4RE5 A;  4O2W A;  5HE0 B;  1O6F A;  4MK0 B;  1U8C A;  3K26 A;  3NVX A;  3IUM A;  4Z8L A;  3VA6 A;  3IUL A;  3IUR A;  3EG6 A;  3EI3 B;  3ZDX A;  5M5U A;  4CZY A;  3C75 H;  2VDL A;  3HFQ A;  2P9L C;  1TYE A;  2Z2P A;  2HKR A;  3J81 g;  2IWK A;  3AH8 B;  1A0R B;  3NID A;  5EAP A;  4G1E A;  1SHY B;  1K32 A;  2CN3 A;  3EU7 A;  4X61 B;  3EMH A;  1MDA H;  2H6Q A;  5M5S A;  3FRX A;  3MKS B;  3IUQ A;  4JHP C;  3PXT D;  4DNU A;  2AQ5 A;  3U4Y A;  2EID A;  4CI1 A;  3EI3 A;  4QT8 A;  1PBY B;  5H17 A;  1PGU A;  3VH0 A;  4ES0 A;  1VYH C;  4BP9 A;  5I5M A;  3UVO A;  1TYQ C;  4JSV C;  1UOQ A;  1S4U X;  2EBS A;  2AGZ A;  2XL3 A;  3EI1 B;  4HDJ A;  3JPX A;  3UVL A;  2BKL A;  2XE4 A;  4ZOX A;  2OIZ A;  4MMX A;  4FA1 D;  5CXB B;  2J57 G;  3MUN A;  2MTA H;  2PBI B;  1GOT B;  4QRJ A;  3FCU A;  2P9P C;  2YBA A;  1C9I A;  4EWR A;  1RI6 A;  3DDU A;  4PBY A;  2XL2 A;  2OK4 A;  1P22 A;  3ZE1 A;  3ZE0 A; 
#chains in the Genus database with same CATH homology
 3NIF A;  2VDO A;  4WK4 A;  1TYE A;  3K71 A;  1M1X A;  4UM9 A;  5FFO A;  4IRZ A;  3NID A;  5E6S A;  3FCS A;  3VI3 A;  3VI4 A;  4G1E A;  5FFG A;  4WK0 A;  3NIG A;  3ZE2 A;  3V4V A;  3IJE A;  1JV2 A;  2VDK A;  4UM8 A;  3T3M A;  4Z7O A;  4MMX A;  2VDN A;  2VDP A;  4G1M A;  3V4P A;  5E6R A;  3ZDZ A;  4WJK A;  4MMY A;  2VC2 A;  4WK2 A;  3K6S A;  1U8C A;  4Z7Q A;  3ZDY A;  3FCU A;  3T3P A;  3K72 A;  5HDB A;  2VDR A;  1L5G A;  2VDQ A;  3ZDX A;  4NEN A;  4O02 A;  5E6U A;  4MMZ A;  2VDM A;  4Z7N A;  3ZE1 A;  2VDL A;  3ZE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...