2VDMA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdmA00
2VDMA 3FCSA 4O02A 3ZE2A 3IJEA 1TYEA 2VDRA 2VDKA 5HDBA 3VI3A 5E6RA 3NIFA 4MMYA 2VDLA 1L5GA 4G1MA 3K72A 1U8CA 3NIDA 4WK4A 4UM9A 3T3PA 3NIGA 3ZE0A 3ZE1A 2VC2A 4Z7QA 1M1XA 4Z7NA 3V4PA 5FFGA 4NENA 5E6SA 3K71A 2VDNA 5E6UA 3FCUA 4WJKA 1JV2A 4Z7OA 3K6SA 4IRZA 4WK2A 3VI4A 2VDOA 3ZDYA 2VDQA 4G1EA 4UM8A 4WK0A 2VDPA 3V4VA 3ZDXA 4MMZA 3ZDZA 3T3MA 5FFOA 4MMXA
chains in the Genus database with same CATH superfamily
5GMKn 4Z8LA 2AH0A 2CN3A 3IUQA 3PVWB 3K72A 5CXCB 1JOFA 3MVDK 4J0XA 4J81A 3RMZD 1A12A 4PBYA 2O9KA 2YBAA 1JV2A 4IMMA 5FA5B 1RI6A 4O1QD 3A0FA 1E8NA 3IJ0A 4FB1D 3ZDXA 1E5TA 2H6QA 1QFSA 5TEEA 2AGYA 4ZOVA 1E8MA 1TYEA 2P9SC 3NVQA 4J79A 3RSEC 3SXTD 4CY3A 5TEFA 3MKSB 1SQ9A 2AH1A 2HJBA 1GOGA 3OW8A 4ERQA 3KCIA 4KFMB 3EQ8A 3IIYA 5M5TA 3W15A 4QRJA 5CXCA 1UTCA 4G56B 2WQ8A 3IJCA 3JPXA 4UI9R 2B5LA 2VDQA 3O4IA 4JSNC 3VGZA 1I2MB 5M61A 5M5VA 3FM0A 3SN6B 5HYNB 1QFMA 3RRMC 3OL2B 3RLMD 4MMXA 5EAMA 2VDRA 2VDKA 2I0RA 1UOQA 4A7JA 4A2MA 1Q47A 2PM6B 1ERJA 4K3JB 4EWRA 3PVUB 3K71A 2HJ4A 3DSMA 1H2WA 3EWEA 2HU8A 1TBGA 2XU7A 4QQEA 1UOOA 2J56H 2IAAA 3PXSD 1C9LA 4U1EI 2J57G 3F3FA 1GOTB 3RN0D 4AX4A 2P9KC 4J73A 3I7PA 4G55A 2VZ1A 1MG2A 3O4JA 2H9MA 4QT8A 5EM2B 5M5UA 4XEIC 2OVQB 1GG2B 1VZ2A 2YNNA 2YNOA 3FRXA 4Y5RD 3ZWLB 2AGZA 1JJUB 4RE5A 2IUVA 2Z2OA 3HFQA 2I0SA 3CFVA 5FKSA 5KDOB 3EI1B 3FCUA 4OZUA 5EALA 2XYIA 4NSXA 4DNUA 3U4YA 5K19A 3EI3A 3F3GA 2H9PA 4L9OA 4BCDA 3UVMA 5HE3B 2H6KA 4PNKB 4BUJC 4L1QD 5IJ7E 5E6RA 2CO0A 3PSLA 3NIFA 4J82A 4QL1A 3O4HA 1YFQA 4J86A 4N14A 4X60B 1T2XA 4A09A 2IWFA 3DDUA 3DXMC 5HE1B 3AFCA 4AOWA 4J8GA 5CYKB 5IGOA 2XDWA 4AEZA 1R5MA 4BL0A 4PSXB 3DM0A 2I0TA 5AMSA 4NC4A 1K8KC 2IUQA 4E5ZA 3I7OA 2BCJB 3I8CA 1OMWB 4LGNA 5HQGA 3MUNA 2PM9B 4ZOZA 3J80g 4ZOYA 3KRXB 3P4FA 4JHNA 4A0BB 1VE7A 3B7FA 3C75H 3SWSD 2CE9A 1K32A 2Z2PA 4DNVA 2H3XA 3ORVD 4A2LA 5M5SA 4X3EA 1VZ3A 4D9SA 3JB9L 2VDOA 4E54B 4X61B 2HKMA 3UVKA 1N6FA 2UZYB 4BP9A 3AL9A 2H14A 4MMZA 4O2WA 3SBQA 2HU7A 3K27A 5C9ZB 5JWZA 5AJAA 5IGQA 3MZKA 2P9UC 1UOPA 1H2ZA 3UR4A 2PM9A 2YNPA 5C86A 2EIDA 1H2XA 4JT6C 2CO0C 4H5JA 4Z7NA 4PBZA 4GM3A 4H5IA 4U7AA 4NAAA 5GXIA 3CFSB 4A0BA 5EMLB 4WK2A 5I5IA 5B4WA 5IC7A 1XIPA 3IUNA 4GM9A 3EI4B 3EG6A 3GC3B 3GREA 3BG1A 3N0EA 4JSVC 1PI6A 2J55H 3IUMA 3SCYA 4L3GD 5HDBA 1GP2B 5FQDA 4OWRA 2CN2A 1BPOA 1XHMA 3IVMA 3RFHA 2B5NA 1SHYB 3PXWD 2PM7B 3EI2B 4Z7QA 3MUOA 3I7HA 2VDNA 3ULEC 5TDHB 4IRZA 2QC5A 2H9LA 5EMKB 3VH0A 4GMBA 1VYHC 3SVWD 4IA9A 2YB8B 2EIBA 5C2VB 4J77A 5EARA 4X63B 1PBYB 4O02A 3O4GA 3EU7A 3EI4A 2EICA 4JHPC 4PXWA 3K26A 4JD2C 4BCBA 3NIGA 3OL2A 4A0AB 4A11B 3QHYB 4CC9A 2OJYA 3GFCA 1JTDB 4NBMA 1TYQC 1MDAH 2OVPB 4JT5C 1A0RB 3KRWB 3EI2A 4LG9A 3SMRA 1O6FA 1S4UX 2Q7QA 4CI3A 3IIWA 1PGUA 4YVDA 4CY2A 4J8BA 3SBRA 5FKQA 3AL8B 4FWWA 4J84A 4FHLA 4BCCA 3L4OD 3ZDZA 3C5MA 1PEVA 4ERZA 5HE2B 5IT9g 5H14A 2HXCA 2JKXA 3DWLC 3BG0A 3IKOA 3JZGA 4MMYA 1XKSA 4UM9A 1B9YA 2UZXB 3I2NA 3UVOA 3EMHA 2YMUA 2GNQA 5EM2A 2G9AA 2QR5A 4ESGA 4PC0A 4A0AA 2H9NA 3MZLA 4GQ2P 4A11A 3FGBA 3VI4A 3GD1I 3EI1A 2AGLA 4DNWA 5FKTA 1OLZA 2H6NA 4JSXC 4BH6A 4FAVD 3T3MA 4D6VA 3V9FA 4FA1D 2HKRA 3JROA 4J87A 2P9IC 3QI0A 1C9IA 4HDJA 3F3PA 4G1MA 2IWKA 1NEXB 1N6DA 3V7DB 2GC7A 5TF2A 2I3TA 4J0WA 3SHFA 2MTAH 2XZGA 3ZDYA 3JZHA 2XL3A 4RE6A 4WK0A 5SXMA 3SJLD 2BBKH 3DXKC 3V4VA 5CYKA 4FA9D 2CNXA 5H17A 3BWSA 3IJEA 2QZPA 3EQ7A 3I7NA 3C9CA 3EQ9A 2G99A 2VZ3A 3ZE0A 2P9LC 3PE7A 2XL2A 3V4PA 2XE4A 2OIZA 4FA4D 4FA5D 3OKYB 4CY1A 2QXVA 3MKQA 2AGXA 3NVXA 3J81g 4J78A 2EIEA 5HE0B 2TRCB 4AMZA 2VDPA 3PXTD 5GSAA 2P9NC 2HYEA 3C99A 3OF7A 1GOFA 3SFZA 1K3IA 4O3UB 3UKUC 4E54A 5EAPA 2EBSA 4O3TB 5I5JA 4GGDA 4PSWB 1L5GA 1U8CA 5AFU3 3OTTA 1P22A 5IJ8E 3UKRC 4LG8A 4NENA 5CXBB 5E6SA 2P9PC 3IURA 3K6SA 5C2WB 4GQ1A 3MXXA 4CI8A 3RN1D 1O6GA 4O45A 4L3HD 3OKYA 2BKLA 4CZYA 3IULA 1L0QA 4ERYA 5K1CC 2H47A 1JMXB 2AGWA 3RFGA 2I3SA 2H68A 2Z2NA 4AMYA 5FKRA 3VI3A 1MG3A 2VDLA 3T3PA 2B5MA 1U4CA 3ZE1A 1N6EA 4Y7RA 3I7LA 3N0DA 4JSPC 2VC2A 4TZ4A 2IURA 5M5RA 4GM8A 4CY5A 1QNIA 1B9XA 5FFGA 3EI3B 5FLXg 4A08B 2W18A 3IJ1A 3MMYA 4WJKA 3JAMg 5CXBA 5A2Qg 4G1EA 4ZN4A 4UM8A 5I5MA 1NR0A 3CIKB 2HU5A 2B4EA 4R7AB 2OK4A 2VDMA 3FCSA 3I7KA 4GQBB 4A09B 4QAMA 2CE8A 2PBIB 3E0CA 4FAND 5EMJB 4WK4A 3NIDA 4CZXA 5FXYA 5GXHA 3I89A 4D0KA 3UVLA 4XYIA 3IUJA 3NVNA 3OKTA 3JRPA 4E5ZB 4Z7OA 3SLED 1FWXA 4A08A 1JMZB 4JXMA 4K3ID 4XYHA 4ES0A 1YR2A 1GXRA 4GZ8A 1GOHA 3PSCB 3ODTA 5H1MA 4AN0A 3VA6A 3SBPA 4GGCA 3ZE2A 5C92A 4AN1A 2IUPA 2AQ5A 3AL8A 4L1MA 4CI2A 4GGAA 1H2YA 2GC4A 4MK0B 4BP8A 1M1XA 5EMMB 4CI1A 1SQJA 5E6UA 1U2VC 3OKWA 3V5WB 3JZNA 3L4MD 3UVNA 4ZOXA 2H13A 3I8EA 2OK6A 3AH8B 2HESX 1VE6A 2OVRB 4I79A 5THAA 4CZVA 4O9DA 5FFOA
chains in the Genus database with same CATH topology
2VDMA 3FCSA 4O02A 3ZE2A 3IJEA 1TYEA 2VDRA 2VDKA 5HDBA 3VI3A 5E6RA 3NIFA 4MMYA 2VDLA 1L5GA 4G1MA 3K72A 1U8CA 3NIDA 4WK4A 4UM9A 3T3PA 3NIGA 3ZE0A 3ZE1A 2VC2A 4Z7QA 1M1XA 4Z7NA 3V4PA 5FFGA 4NENA 5E6SA 3K71A 2VDNA 5E6UA 3FCUA 4WJKA 1JV2A 4Z7OA 3K6SA 4IRZA 4WK2A 3VI4A 2VDOA 3ZDYA 2VDQA 4G1EA 4UM8A 4WK0A 2VDPA 3V4VA 3ZDXA 4MMZA 3ZDZA 3T3MA 5FFOA 4MMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDM A;  3FCS A;  4O02 A;  3ZE2 A;  3IJE A;  1TYE A;  2VDR A;  2VDK A;  5HDB A;  3VI3 A;  5E6R A;  3NIF A;  4MMY A;  2VDL A;  1L5G A;  4G1M A;  3K72 A;  1U8C A;  3NID A;  4WK4 A;  4UM9 A;  3T3P A;  3NIG A;  3ZE0 A;  3ZE1 A;  2VC2 A;  4Z7Q A;  1M1X A;  4Z7N A;  3V4P A;  5FFG A;  4NEN A;  5E6S A;  3K71 A;  2VDN A;  5E6U A;  3FCU A;  4WJK A;  1JV2 A;  4Z7O A;  3K6S A;  4IRZ A;  4WK2 A;  3VI4 A;  2VDO A;  3ZDY A;  2VDQ A;  4G1E A;  4UM8 A;  4WK0 A;  2VDP A;  3V4V A;  3ZDX A;  4MMZ A;  3ZDZ A;  3T3M A;  5FFO A;  4MMX A; 
#chains in the Genus database with same CATH topology
 5GMK n;  4Z8L A;  2AH0 A;  2CN3 A;  3IUQ A;  3PVW B;  3K72 A;  5CXC B;  1JOF A;  3MVD K;  4J0X A;  4J81 A;  3RMZ D;  1A12 A;  4PBY A;  2O9K A;  2YBA A;  1JV2 A;  4IMM A;  5FA5 B;  1RI6 A;  4O1Q D;  3A0F A;  1E8N A;  3IJ0 A;  4FB1 D;  3ZDX A;  1E5T A;  2H6Q A;  1QFS A;  5TEE A;  2AGY A;  4ZOV A;  1E8M A;  1TYE A;  2P9S C;  3NVQ A;  4J79 A;  3RSE C;  3SXT D;  4CY3 A;  5TEF A;  3MKS B;  1SQ9 A;  2AH1 A;  2HJB A;  1GOG A;  3OW8 A;  4ERQ A;  3KCI A;  4KFM B;  3EQ8 A;  3IIY A;  5M5T A;  3W15 A;  4QRJ A;  5CXC A;  1UTC A;  4G56 B;  2WQ8 A;  3IJC A;  3JPX A;  4UI9 R;  2B5L A;  2VDQ A;  3O4I A;  4JSN C;  3VGZ A;  1I2M B;  5M61 A;  5M5V A;  3FM0 A;  3SN6 B;  5HYN B;  1QFM A;  3RRM C;  3OL2 B;  3RLM D;  4MMX A;  5EAM A;  2VDR A;  2VDK A;  2I0R A;  1UOQ A;  4A7J A;  4A2M A;  1Q47 A;  2PM6 B;  1ERJ A;  4K3J B;  4EWR A;  3PVU B;  3K71 A;  2HJ4 A;  3DSM A;  1H2W A;  3EWE A;  2HU8 A;  1TBG A;  2XU7 A;  4QQE A;  1UOO A;  2J56 H;  2IAA A;  3PXS D;  1C9L A;  4U1E I;  2J57 G;  3F3F A;  1GOT B;  3RN0 D;  4AX4 A;  2P9K C;  4J73 A;  3I7P A;  4G55 A;  2VZ1 A;  1MG2 A;  3O4J A;  2H9M A;  4QT8 A;  5EM2 B;  5M5U A;  4XEI C;  2OVQ B;  1GG2 B;  1VZ2 A;  2YNN A;  2YNO A;  3FRX A;  4Y5R D;  3ZWL B;  2AGZ A;  1JJU B;  4RE5 A;  2IUV A;  2Z2O A;  3HFQ A;  2I0S A;  3CFV A;  5FKS A;  5KDO B;  3EI1 B;  3FCU A;  4OZU A;  5EAL A;  2XYI A;  4NSX A;  4DNU A;  3U4Y A;  5K19 A;  3EI3 A;  3F3G A;  2H9P A;  4L9O A;  4BCD A;  3UVM A;  5HE3 B;  2H6K A;  4PNK B;  4BUJ C;  4L1Q D;  5IJ7 E;  5E6R A;  2CO0 A;  3PSL A;  3NIF A;  4J82 A;  4QL1 A;  3O4H A;  1YFQ A;  4J86 A;  4N14 A;  4X60 B;  1T2X A;  4A09 A;  2IWF A;  3DDU A;  3DXM C;  5HE1 B;  3AFC A;  4AOW A;  4J8G A;  5CYK B;  5IGO A;  2XDW A;  4AEZ A;  1R5M A;  4BL0 A;  4PSX B;  3DM0 A;  2I0T A;  5AMS A;  4NC4 A;  1K8K C;  2IUQ A;  4E5Z A;  3I7O A;  2BCJ B;  3I8C A;  1OMW B;  4LGN A;  5HQG A;  3MUN A;  2PM9 B;  4ZOZ A;  3J80 g;  4ZOY A;  3KRX B;  3P4F A;  4JHN A;  4A0B B;  1VE7 A;  3B7F A;  3C75 H;  3SWS D;  2CE9 A;  1K32 A;  2Z2P A;  4DNV A;  2H3X A;  3ORV D;  4A2L A;  5M5S A;  4X3E A;  1VZ3 A;  4D9S A;  3JB9 L;  2VDO A;  4E54 B;  4X61 B;  2HKM A;  3UVK A;  1N6F A;  2UZY B;  4BP9 A;  3AL9 A;  2H14 A;  4MMZ A;  4O2W A;  3SBQ A;  2HU7 A;  3K27 A;  5C9Z B;  5JWZ A;  5AJA A;  5IGQ A;  3MZK A;  2P9U C;  1UOP A;  1H2Z A;  3UR4 A;  2PM9 A;  2YNP A;  5C86 A;  2EID A;  1H2X A;  4JT6 C;  2CO0 C;  4H5J A;  4Z7N A;  4PBZ A;  4GM3 A;  4H5I A;  4U7A A;  4NAA A;  5GXI A;  3CFS B;  4A0B A;  5EML B;  4WK2 A;  5I5I A;  5B4W A;  5IC7 A;  1XIP A;  3IUN A;  4GM9 A;  3EI4 B;  3EG6 A;  3GC3 B;  3GRE A;  3BG1 A;  3N0E A;  4JSV C;  1PI6 A;  2J55 H;  3IUM A;  3SCY A;  4L3G D;  5HDB A;  1GP2 B;  5FQD A;  4OWR A;  2CN2 A;  1BPO A;  1XHM A;  3IVM A;  3RFH A;  2B5N A;  1SHY B;  3PXW D;  2PM7 B;  3EI2 B;  4Z7Q A;  3MUO A;  3I7H A;  2VDN A;  3ULE C;  5TDH B;  4IRZ A;  2QC5 A;  2H9L A;  5EMK B;  3VH0 A;  4GMB A;  1VYH C;  3SVW D;  4IA9 A;  2YB8 B;  2EIB A;  5C2V B;  4J77 A;  5EAR A;  4X63 B;  1PBY B;  4O02 A;  3O4G A;  3EU7 A;  3EI4 A;  2EIC A;  4JHP C;  4PXW A;  3K26 A;  4JD2 C;  4BCB A;  3NIG A;  3OL2 A;  4A0A B;  4A11 B;  3QHY B;  4CC9 A;  2OJY A;  3GFC A;  1JTD B;  4NBM A;  1TYQ C;  1MDA H;  2OVP B;  4JT5 C;  1A0R B;  3KRW B;  3EI2 A;  4LG9 A;  3SMR A;  1O6F A;  1S4U X;  2Q7Q A;  4CI3 A;  3IIW A;  1PGU A;  4YVD A;  4CY2 A;  4J8B A;  3SBR A;  5FKQ A;  3AL8 B;  4FWW A;  4J84 A;  4FHL A;  4BCC A;  3L4O D;  3ZDZ A;  3C5M A;  1PEV A;  4ERZ A;  5HE2 B;  5IT9 g;  5H14 A;  2HXC A;  2JKX A;  3DWL C;  3BG0 A;  3IKO A;  3JZG A;  4MMY A;  1XKS A;  4UM9 A;  1B9Y A;  2UZX B;  3I2N A;  3UVO A;  3EMH A;  2YMU A;  2GNQ A;  5EM2 A;  2G9A A;  2QR5 A;  4ESG A;  4PC0 A;  4A0A A;  2H9N A;  3MZL A;  4GQ2 P;  4A11 A;  3FGB A;  3VI4 A;  3GD1 I;  3EI1 A;  2AGL A;  4DNW A;  5FKT A;  1OLZ A;  2H6N A;  4JSX C;  4BH6 A;  4FAV D;  3T3M A;  4D6V A;  3V9F A;  4FA1 D;  2HKR A;  3JRO A;  4J87 A;  2P9I C;  3QI0 A;  1C9I A;  4HDJ A;  3F3P A;  4G1M A;  2IWK A;  1NEX B;  1N6D A;  3V7D B;  2GC7 A;  5TF2 A;  2I3T A;  4J0W A;  3SHF A;  2MTA H;  2XZG A;  3ZDY A;  3JZH A;  2XL3 A;  4RE6 A;  4WK0 A;  5SXM A;  3SJL D;  2BBK H;  3DXK C;  3V4V A;  5CYK A;  4FA9 D;  2CNX A;  5H17 A;  3BWS A;  3IJE A;  2QZP A;  3EQ7 A;  3I7N A;  3C9C A;  3EQ9 A;  2G99 A;  2VZ3 A;  3ZE0 A;  2P9L C;  3PE7 A;  2XL2 A;  3V4P A;  2XE4 A;  2OIZ A;  4FA4 D;  4FA5 D;  3OKY B;  4CY1 A;  2QXV A;  3MKQ A;  2AGX A;  3NVX A;  3J81 g;  4J78 A;  2EIE A;  5HE0 B;  2TRC B;  4AMZ A;  2VDP A;  3PXT D;  5GSA A;  2P9N C;  2HYE A;  3C99 A;  3OF7 A;  1GOF A;  3SFZ A;  1K3I A;  4O3U B;  3UKU C;  4E54 A;  5EAP A;  2EBS A;  4O3T B;  5I5J A;  4GGD A;  4PSW B;  1L5G A;  1U8C A;  5AFU 3;  3OTT A;  1P22 A;  5IJ8 E;  3UKR C;  4LG8 A;  4NEN A;  5CXB B;  5E6S A;  2P9P C;  3IUR A;  3K6S A;  5C2W B;  4GQ1 A;  3MXX A;  4CI8 A;  3RN1 D;  1O6G A;  4O45 A;  4L3H D;  3OKY A;  2BKL A;  4CZY A;  3IUL A;  1L0Q A;  4ERY A;  5K1C C;  2H47 A;  1JMX B;  2AGW A;  3RFG A;  2I3S A;  2H68 A;  2Z2N A;  4AMY A;  5FKR A;  3VI3 A;  1MG3 A;  2VDL A;  3T3P A;  2B5M A;  1U4C A;  3ZE1 A;  1N6E A;  4Y7R A;  3I7L A;  3N0D A;  4JSP C;  2VC2 A;  4TZ4 A;  2IUR A;  5M5R A;  4GM8 A;  4CY5 A;  1QNI A;  1B9X A;  5FFG A;  3EI3 B;  5FLX g;  4A08 B;  2W18 A;  3IJ1 A;  3MMY A;  4WJK A;  3JAM g;  5CXB A;  5A2Q g;  4G1E A;  4ZN4 A;  4UM8 A;  5I5M A;  1NR0 A;  3CIK B;  2HU5 A;  2B4E A;  4R7A B;  2OK4 A;  2VDM A;  3FCS A;  3I7K A;  4GQB B;  4A09 B;  4QAM A;  2CE8 A;  2PBI B;  3E0C A;  4FAN D;  5EMJ B;  4WK4 A;  3NID A;  4CZX A;  5FXY A;  5GXH A;  3I89 A;  4D0K A;  3UVL A;  4XYI A;  3IUJ A;  3NVN A;  3OKT A;  3JRP A;  4E5Z B;  4Z7O A;  3SLE D;  1FWX A;  4A08 A;  1JMZ B;  4JXM A;  4K3I D;  4XYH A;  4ES0 A;  1YR2 A;  1GXR A;  4GZ8 A;  1GOH A;  3PSC B;  3ODT A;  5H1M A;  4AN0 A;  3VA6 A;  3SBP A;  4GGC A;  3ZE2 A;  5C92 A;  4AN1 A;  2IUP A;  2AQ5 A;  3AL8 A;  4L1M A;  4CI2 A;  4GGA A;  1H2Y A;  2GC4 A;  4MK0 B;  4BP8 A;  1M1X A;  5EMM B;  4CI1 A;  1SQJ A;  5E6U A;  1U2V C;  3OKW A;  3V5W B;  3JZN A;  3L4M D;  3UVN A;  4ZOX A;  2H13 A;  3I8E A;  2OK6 A;  3AH8 B;  2HES X;  1VE6 A;  2OVR B;  4I79 A;  5THA A;  4CZV A;  4O9D A;  5FFO A; 
#chains in the Genus database with same CATH homology
 2VDM A;  3FCS A;  4O02 A;  3ZE2 A;  3IJE A;  1TYE A;  2VDR A;  2VDK A;  5HDB A;  3VI3 A;  5E6R A;  3NIF A;  4MMY A;  2VDL A;  1L5G A;  4G1M A;  3K72 A;  1U8C A;  3NID A;  4WK4 A;  4UM9 A;  3T3P A;  3NIG A;  3ZE0 A;  3ZE1 A;  2VC2 A;  4Z7Q A;  1M1X A;  4Z7N A;  3V4P A;  5FFG A;  4NEN A;  5E6S A;  3K71 A;  2VDN A;  5E6U A;  3FCU A;  4WJK A;  1JV2 A;  4Z7O A;  3K6S A;  4IRZ A;  4WK2 A;  3VI4 A;  2VDO A;  3ZDY A;  2VDQ A;  4G1E A;  4UM8 A;  4WK0 A;  2VDP A;  3V4V A;  3ZDX A;  4MMZ A;  3ZDZ A;  3T3M A;  5FFO A;  4MMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...