2VDMA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdmA00
5FFGA 3T3PA 4G1MA 3ZE2A 4UM8A 2VDMA 3ZDYA 3ZDZA 3ZE1A 4Z7NA 4O02A 4IRZA 3V4PA 3FCSA 4WK2A 3VI4A 4MMYA 3T3MA 5E6RA 3ZDXA 4Z7OA 3K72A 3K6SA 1M1XA 2VDPA 2VDKA 5E6SA 2VDNA 4G1EA 4WJKA 2VDOA 4MMXA 4WK0A 3NIFA 3NIGA 5E6UA 2VC2A 5HDBA 1U8CA 4WK4A 3V4VA 3VI3A 4MMZA 2VDQA 4Z7QA 4NENA 3ZE0A 1TYEA 2VDRA 3NIDA 1JV2A 4UM9A 3K71A 2VDLA 1L5GA 3IJEA 3FCUA 5FFOA
chains in the Genus database with same CATH superfamily
1O6GA 2AH1A 4A08A 1K32A 3ZDZA 2IWFA 2YNOA 2AGLA 4GQ2P 4JHNA 5E6RA 2QZPA 4NC4A 4Z7OA 4X61B 2VDPA 1UOQA 3MZLA 3IURA 4CY2A 3UVOA 5FLXg 2AGZA 5HE1B 2HESX 3JPXA 1U8CA 3OKWA 3EI1B 4Z7QA 3ULEC 2HYEA 2OJYA 3N0DA 3KRWB 2B5LA 3NIDA 2IWKA 1XKSA 4IA9A 4KFMB 3V5WB 2VDLA 4A0AA 3IJEA 1QNIA 5FFOA 3T3PA 4BH6A 4ZOXA 2B5MA 4MK0B 3V7DB 4D0KA 2AGYA 3ZE1A 2YNPA 5H1MA 1A0RB 4L9OA 2I3SA 5I5IA 4GZ8A 2AQ5A 3V9FA 5M5TA 3NVXA 3DXMC 4G1EA 3IVMA 2H68A 2H9MA 3EI2B 4NAAA 2HU5A 4X63B 4FA4D 3EI2A 5EAPA 1B9XA 2EIBA 3MVDK 2B4EA 4L1MA 4PXWA 2OK4A 1MG3A 4ZOVA 3J80g 5I5MA 4IMMA 4O2WA 3CFVA 3W15A 3DXKC 1NEXB 4CI1A 2G99A 2XYIA 3FRXA 5GXHA 4PNKB 3K72A 4UI9R 4QAMA 1M1XA 2VDKA 3O4JA 2XZGA 4GQBB 3J81g 4ERZA 3I8CA 4X60B 5K19A 2IURA 4JSNC 4JT5C 4J8BA 4ERQA 5EAMA 2UZXB 2I0SA 4GGCA 4BP8A 4DNUA 3IUMA 1GG2B 5GXIA 1OLZA 4Z7NA 3O4GA 3MXXA 3ODTA 4ZOYA 3I7HA 5C2VB 3MZKA 3SWSD 4GM9A 5IGQA 4OWRA 5HE0B 2IUVA 2H14A 3I7PA 2UZYB 4FWWA 4J87A 2G9AA 1N6FA 2O9KA 2P9LC 4CZVA 5C9ZB 5FKTA 4AX4A 4E5ZB 1R5MA 3BWSA 4O45A 3FM0A 3I7KA 3GFCA 2Q7QA 2P9UC 3FCUA 1JTDB 4DNVA 4JSXC 3SHFA 3MMYA 3RRMC 3VA6A 3SBRA 3OKTA 4AOWA 4WK2A 2HKRA 1PI6A 4XEIC 4A09A 3JB9L 2CN2A 2HU8A 3BG1A 3ZDXA 2BKLA 4I79A 4AN1A 4A7JA 2J55H 3K27A 3UVMA 2WQ8A 3CFSB 3EQ7A 4FAND 4MMXA 5M5UA 4FA9D 1YFQA 4GGAA 5EARA 3IJ1A 5IC7A 1C9LA 2VDQA 5IT9g 4O3TB 3SMRA 5EM2A 2OVRB 2P9PC 3IIWA 1A12A 4QL1A 1UOOA 4J0WA 2AH0A 2P9IC 5C2WB 3SBPA 3OL2A 3ZE2A 1P22A 1PBYB 2YB8B 5H14A 4GGDA 4X3EA 5EALA 3QI0A 2W18A 2I0TA 4GQ1A 2EIDA 3SBQA 1N6DA 4R7AB 5IGOA 3IUQA 1MG2A 4Y7RA 1RI6A 3IJ0A 5EMJB 3UKRC 3PSLA 2CE9A 3EU7A 1U2VC 4N14A 4PC0A 1TYEA 1H2YA 2VZ3A 1C9IA 1VE7A 2GC4A 4QT8A 1Q47A 3RFHA 1L5GA 2XL3A 4JHPC 4FA5D 4J86A 3MUNA 3KCIA 5TDHB 1NR0A 3VI4A 1VZ2A 2B5NA 3DWLC 3F3GA 3NVNA 1YR2A 5SXMA 1O6FA 5KDOB 4FB1D 5HYNB 3PXTD 5E6SA 4CY3A 1B9YA 3I7OA 2VDNA 2XE4A 5IJ8E 2H6KA 3C5MA 3F3FA 5TEFA 5HDBA 3RLMD 3VH0A 4MMZA 5CXCB 4NBMA 4J81A 4ESGA 4CI8A 1H2XA 5M5RA 1K3IA 2AGWA 3IULA 5IJ7E 3IKOA 3L4MD 4A0BA 5A2Qg 4JT6C 4O9DA 3JROA 4J79A 3RSEC 4JSPC 3I7LA 4TZ4A 1JJUB 2OIZA 5HQGA 4Y5RD 4JD2C 3AL9A 5FXYA 4BUJC 1U4CA 2BCJB 4CY1A 4DNWA 4XYIA 3JZGA 4J0XA 2VC2A 3GREA 3V4VA 5GSAA 3NVQA 2OVQB 4GMBA 2CNXA 3RN1D 2XU7A 2HJBA 1QFMA 4NENA 4A2MA 5C92A 3I89A 2J57G 1JV2A 3AL8B 3PXSD 4OZUA 3P4FA 2TRCB 3OW8A 3RMZD 4NSXA 2Z2OA 3DDUA 3EI4B 4O02A 4PBZA 1MDAH 5FA5B 3CIKB 3JZHA 1E5TA 5K1CC 1JMZB 2EIEA 3EQ8A 3I2NA 3PXWD 5EMLB 1JOFA 3RFGA 3IJCA 3VI3A 3UVLA 1UTCA 4ZOZA 4A08B 2H9LA 3AH8B 4UM8A 3AFCA 1TBGA 4IRZA 2PM7B 4A2LA 5CYKA 3IIYA 4AEZA 4J78A 1GOFA 1UOPA 4ZN4A 4A11A 4RE6A 3I8EA 1BPOA 3EI1A 2AGXA 4A11B 1L0QA 3IUNA 3AL8A 4J84A 4WJKA 2PM9B 3L4OD 4LGNA 1GOGA 5FQDA 3UVKA 2XDWA 4L3HD 4A0AB 3EWEA 3UVNA 3O4IA 4D9SA 3EMHA 4J77A 3MKSB 3A0FA 3GD1I 4PSWB 3PVWB 1JMXB 3JRPA 3DM0A 2H3XA 3SJLD 2VZ1A 2CO0A 1ERJA 5AMSA 4LG8A 4YVDA 4G56B 2I0RA 3N0EA 3UR4A 1I2MB 5FKQA 1VZ3A 3EI3A 2QR5A 3RN0D 1T2XA 2I3TA 2CN3A 2CE8A 5TF2A 4O1QD 4J73A 4BCBA 2VDMA 3ZDYA 3JZNA 1GOTB 2Z2NA 3UKUC 4H5IA 4CI3A 1FWXA 4J8GA 4A09B 2H6NA 2EBSA 4CI2A 4Z8LA 4AMYA 2GNQA 3MKQA 4EWRA 3NIFA 1OMWB 2H6QA 4BCCA 4RE5A 3OKYA 3PVUB 2JKXA 1PEVA 5M5SA 1K8KC 2OVPB 4D6VA 4UM9A 3OF7A 4BCDA 1SHYB 5CXBA 5HE3B 5C86A 3PSCB 5GMKn 2PBIB 2IAAA 1E8MA 2YBAA 4PSXB 3SN6B 2XL2A 3MUOA 4JSVC 2CO0C 2H9PA 5FKRA 5CYKB 4E5ZA 2VDOA 4WK0A 2BBKH 4K3ID 2IUQA 1H2ZA 4BL0A 5JWZA 4L3GD 3E0CA 1SQJA 3KRXB 4QQEA 4CY5A 2GC7A 3ORVD 5EMKB 3SXTD 3IUJA 3EI4A 3FCSA 3C75H 3F3PA 5FFGA 3SVWD 4H5JA 5FKSA 3T3MA 1VYHC 3B7FA 2QXVA 1S4UX 1E8NA 3K6SA 4QRJA 2P9KC 5M5VA 4J82A 4BP9A 2PM9A 4ES0A 3NIGA 2QC5A 1PGUA 3BG0A 4HDJA 4FA1D 4WK4A 5HE2B 3OL2B 3JAMg 4FAVD 4ERYA 3I7NA 4PBYA 2VDRA 2HKMA 1XIPA 1GOHA 4G55A 4K3JB 4L1QD 4G1MA 5CXCA 3U4YA 2PM6B 3VGZA 2P9NC 4O3UB 3V4PA 3EG6A 2HJ4A 3QHYB 1N6EA 4MMYA 5AJAA 3HFQA 5B4WA 4A0BB 3SFZA 3FGBA 4AN0A 3EQ9A 1H2WA 3GC3B 4CZYA 2H13A 1VE6A 4E54A 3K26A 3SCYA 3ZWLB 2YMUA 2H9NA 4E54B 4GM8A 3PE7A 1TYQC 5M61A 4GM3A 5H17A 4U1EI 3C9CA 2HU7A 4FHLA 4AMZA 4CZXA 1GXRA 3K71A 2P9SC 2H47A 1XHMA 2HXCA 2OK6A 5I5JA 4LG9A 2IUPA 2J56H 3C99A 1GP2B 2EICA 3EI3B 2Z2PA 3OTTA 3DSMA 3OKYB 3O4HA 4U7AA 5E6UA 5THAA 4CC9A 5EMMB 2YNNA 5TEEA 2MTAH 3ZE0A 4XYHA 1QFSA 1SQ9A 5AFU3 5EM2B 3SLED 4JXMA 5CXBB
chains in the Genus database with same CATH topology
5FFGA 3T3PA 4G1MA 3ZE2A 4UM8A 2VDMA 3ZDYA 3ZDZA 3ZE1A 4Z7NA 4O02A 4IRZA 3V4PA 3FCSA 4WK2A 3VI4A 4MMYA 3T3MA 5E6RA 3ZDXA 4Z7OA 3K72A 3K6SA 1M1XA 2VDPA 2VDKA 5E6SA 2VDNA 4G1EA 4WJKA 2VDOA 4MMXA 4WK0A 3NIFA 3NIGA 5E6UA 2VC2A 5HDBA 1U8CA 4WK4A 3V4VA 3VI3A 4MMZA 2VDQA 4Z7QA 4NENA 3ZE0A 1TYEA 2VDRA 3NIDA 1JV2A 4UM9A 3K71A 2VDLA 1L5GA 3IJEA 3FCUA 5FFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFG A;  3T3P A;  4G1M A;  3ZE2 A;  4UM8 A;  2VDM A;  3ZDY A;  3ZDZ A;  3ZE1 A;  4Z7N A;  4O02 A;  4IRZ A;  3V4P A;  3FCS A;  4WK2 A;  3VI4 A;  4MMY A;  3T3M A;  5E6R A;  3ZDX A;  4Z7O A;  3K72 A;  3K6S A;  1M1X A;  2VDP A;  2VDK A;  5E6S A;  2VDN A;  4G1E A;  4WJK A;  2VDO A;  4MMX A;  4WK0 A;  3NIF A;  3NIG A;  5E6U A;  2VC2 A;  5HDB A;  1U8C A;  4WK4 A;  3V4V A;  3VI3 A;  4MMZ A;  2VDQ A;  4Z7Q A;  4NEN A;  3ZE0 A;  1TYE A;  2VDR A;  3NID A;  1JV2 A;  4UM9 A;  3K71 A;  2VDL A;  1L5G A;  3IJE A;  3FCU A;  5FFO A; 
#chains in the Genus database with same CATH topology
 1O6G A;  2AH1 A;  4A08 A;  1K32 A;  3ZDZ A;  2IWF A;  2YNO A;  2AGL A;  4GQ2 P;  4JHN A;  5E6R A;  2QZP A;  4NC4 A;  4Z7O A;  4X61 B;  2VDP A;  1UOQ A;  3MZL A;  3IUR A;  4CY2 A;  3UVO A;  5FLX g;  2AGZ A;  5HE1 B;  2HES X;  3JPX A;  1U8C A;  3OKW A;  3EI1 B;  4Z7Q A;  3ULE C;  2HYE A;  2OJY A;  3N0D A;  3KRW B;  2B5L A;  3NID A;  2IWK A;  1XKS A;  4IA9 A;  4KFM B;  3V5W B;  2VDL A;  4A0A A;  3IJE A;  1QNI A;  5FFO A;  3T3P A;  4BH6 A;  4ZOX A;  2B5M A;  4MK0 B;  3V7D B;  4D0K A;  2AGY A;  3ZE1 A;  2YNP A;  5H1M A;  1A0R B;  4L9O A;  2I3S A;  5I5I A;  4GZ8 A;  2AQ5 A;  3V9F A;  5M5T A;  3NVX A;  3DXM C;  4G1E A;  3IVM A;  2H68 A;  2H9M A;  3EI2 B;  4NAA A;  2HU5 A;  4X63 B;  4FA4 D;  3EI2 A;  5EAP A;  1B9X A;  2EIB A;  3MVD K;  2B4E A;  4L1M A;  4PXW A;  2OK4 A;  1MG3 A;  4ZOV A;  3J80 g;  5I5M A;  4IMM A;  4O2W A;  3CFV A;  3W15 A;  3DXK C;  1NEX B;  4CI1 A;  2G99 A;  2XYI A;  3FRX A;  5GXH A;  4PNK B;  3K72 A;  4UI9 R;  4QAM A;  1M1X A;  2VDK A;  3O4J A;  2XZG A;  4GQB B;  3J81 g;  4ERZ A;  3I8C A;  4X60 B;  5K19 A;  2IUR A;  4JSN C;  4JT5 C;  4J8B A;  4ERQ A;  5EAM A;  2UZX B;  2I0S A;  4GGC A;  4BP8 A;  4DNU A;  3IUM A;  1GG2 B;  5GXI A;  1OLZ A;  4Z7N A;  3O4G A;  3MXX A;  3ODT A;  4ZOY A;  3I7H A;  5C2V B;  3MZK A;  3SWS D;  4GM9 A;  5IGQ A;  4OWR A;  5HE0 B;  2IUV A;  2H14 A;  3I7P A;  2UZY B;  4FWW A;  4J87 A;  2G9A A;  1N6F A;  2O9K A;  2P9L C;  4CZV A;  5C9Z B;  5FKT A;  4AX4 A;  4E5Z B;  1R5M A;  3BWS A;  4O45 A;  3FM0 A;  3I7K A;  3GFC A;  2Q7Q A;  2P9U C;  3FCU A;  1JTD B;  4DNV A;  4JSX C;  3SHF A;  3MMY A;  3RRM C;  3VA6 A;  3SBR A;  3OKT A;  4AOW A;  4WK2 A;  2HKR A;  1PI6 A;  4XEI C;  4A09 A;  3JB9 L;  2CN2 A;  2HU8 A;  3BG1 A;  3ZDX A;  2BKL A;  4I79 A;  4AN1 A;  4A7J A;  2J55 H;  3K27 A;  3UVM A;  2WQ8 A;  3CFS B;  3EQ7 A;  4FAN D;  4MMX A;  5M5U A;  4FA9 D;  1YFQ A;  4GGA A;  5EAR A;  3IJ1 A;  5IC7 A;  1C9L A;  2VDQ A;  5IT9 g;  4O3T B;  3SMR A;  5EM2 A;  2OVR B;  2P9P C;  3IIW A;  1A12 A;  4QL1 A;  1UOO A;  4J0W A;  2AH0 A;  2P9I C;  5C2W B;  3SBP A;  3OL2 A;  3ZE2 A;  1P22 A;  1PBY B;  2YB8 B;  5H14 A;  4GGD A;  4X3E A;  5EAL A;  3QI0 A;  2W18 A;  2I0T A;  4GQ1 A;  2EID A;  3SBQ A;  1N6D A;  4R7A B;  5IGO A;  3IUQ A;  1MG2 A;  4Y7R A;  1RI6 A;  3IJ0 A;  5EMJ B;  3UKR C;  3PSL A;  2CE9 A;  3EU7 A;  1U2V C;  4N14 A;  4PC0 A;  1TYE A;  1H2Y A;  2VZ3 A;  1C9I A;  1VE7 A;  2GC4 A;  4QT8 A;  1Q47 A;  3RFH A;  1L5G A;  2XL3 A;  4JHP C;  4FA5 D;  4J86 A;  3MUN A;  3KCI A;  5TDH B;  1NR0 A;  3VI4 A;  1VZ2 A;  2B5N A;  3DWL C;  3F3G A;  3NVN A;  1YR2 A;  5SXM A;  1O6F A;  5KDO B;  4FB1 D;  5HYN B;  3PXT D;  5E6S A;  4CY3 A;  1B9Y A;  3I7O A;  2VDN A;  2XE4 A;  5IJ8 E;  2H6K A;  3C5M A;  3F3F A;  5TEF A;  5HDB A;  3RLM D;  3VH0 A;  4MMZ A;  5CXC B;  4NBM A;  4J81 A;  4ESG A;  4CI8 A;  1H2X A;  5M5R A;  1K3I A;  2AGW A;  3IUL A;  5IJ7 E;  3IKO A;  3L4M D;  4A0B A;  5A2Q g;  4JT6 C;  4O9D A;  3JRO A;  4J79 A;  3RSE C;  4JSP C;  3I7L A;  4TZ4 A;  1JJU B;  2OIZ A;  5HQG A;  4Y5R D;  4JD2 C;  3AL9 A;  5FXY A;  4BUJ C;  1U4C A;  2BCJ B;  4CY1 A;  4DNW A;  4XYI A;  3JZG A;  4J0X A;  2VC2 A;  3GRE A;  3V4V A;  5GSA A;  3NVQ A;  2OVQ B;  4GMB A;  2CNX A;  3RN1 D;  2XU7 A;  2HJB A;  1QFM A;  4NEN A;  4A2M A;  5C92 A;  3I89 A;  2J57 G;  1JV2 A;  3AL8 B;  3PXS D;  4OZU A;  3P4F A;  2TRC B;  3OW8 A;  3RMZ D;  4NSX A;  2Z2O A;  3DDU A;  3EI4 B;  4O02 A;  4PBZ A;  1MDA H;  5FA5 B;  3CIK B;  3JZH A;  1E5T A;  5K1C C;  1JMZ B;  2EIE A;  3EQ8 A;  3I2N A;  3PXW D;  5EML B;  1JOF A;  3RFG A;  3IJC A;  3VI3 A;  3UVL A;  1UTC A;  4ZOZ A;  4A08 B;  2H9L A;  3AH8 B;  4UM8 A;  3AFC A;  1TBG A;  4IRZ A;  2PM7 B;  4A2L A;  5CYK A;  3IIY A;  4AEZ A;  4J78 A;  1GOF A;  1UOP A;  4ZN4 A;  4A11 A;  4RE6 A;  3I8E A;  1BPO A;  3EI1 A;  2AGX A;  4A11 B;  1L0Q A;  3IUN A;  3AL8 A;  4J84 A;  4WJK A;  2PM9 B;  3L4O D;  4LGN A;  1GOG A;  5FQD A;  3UVK A;  2XDW A;  4L3H D;  4A0A B;  3EWE A;  3UVN A;  3O4I A;  4D9S A;  3EMH A;  4J77 A;  3MKS B;  3A0F A;  3GD1 I;  4PSW B;  3PVW B;  1JMX B;  3JRP A;  3DM0 A;  2H3X A;  3SJL D;  2VZ1 A;  2CO0 A;  1ERJ A;  5AMS A;  4LG8 A;  4YVD A;  4G56 B;  2I0R A;  3N0E A;  3UR4 A;  1I2M B;  5FKQ A;  1VZ3 A;  3EI3 A;  2QR5 A;  3RN0 D;  1T2X A;  2I3T A;  2CN3 A;  2CE8 A;  5TF2 A;  4O1Q D;  4J73 A;  4BCB A;  2VDM A;  3ZDY A;  3JZN A;  1GOT B;  2Z2N A;  3UKU C;  4H5I A;  4CI3 A;  1FWX A;  4J8G A;  4A09 B;  2H6N A;  2EBS A;  4CI2 A;  4Z8L A;  4AMY A;  2GNQ A;  3MKQ A;  4EWR A;  3NIF A;  1OMW B;  2H6Q A;  4BCC A;  4RE5 A;  3OKY A;  3PVU B;  2JKX A;  1PEV A;  5M5S A;  1K8K C;  2OVP B;  4D6V A;  4UM9 A;  3OF7 A;  4BCD A;  1SHY B;  5CXB A;  5HE3 B;  5C86 A;  3PSC B;  5GMK n;  2PBI B;  2IAA A;  1E8M A;  2YBA A;  4PSX B;  3SN6 B;  2XL2 A;  3MUO A;  4JSV C;  2CO0 C;  2H9P A;  5FKR A;  5CYK B;  4E5Z A;  2VDO A;  4WK0 A;  2BBK H;  4K3I D;  2IUQ A;  1H2Z A;  4BL0 A;  5JWZ A;  4L3G D;  3E0C A;  1SQJ A;  3KRX B;  4QQE A;  4CY5 A;  2GC7 A;  3ORV D;  5EMK B;  3SXT D;  3IUJ A;  3EI4 A;  3FCS A;  3C75 H;  3F3P A;  5FFG A;  3SVW D;  4H5J A;  5FKS A;  3T3M A;  1VYH C;  3B7F A;  2QXV A;  1S4U X;  1E8N A;  3K6S A;  4QRJ A;  2P9K C;  5M5V A;  4J82 A;  4BP9 A;  2PM9 A;  4ES0 A;  3NIG A;  2QC5 A;  1PGU A;  3BG0 A;  4HDJ A;  4FA1 D;  4WK4 A;  5HE2 B;  3OL2 B;  3JAM g;  4FAV D;  4ERY A;  3I7N A;  4PBY A;  2VDR A;  2HKM A;  1XIP A;  1GOH A;  4G55 A;  4K3J B;  4L1Q D;  4G1M A;  5CXC A;  3U4Y A;  2PM6 B;  3VGZ A;  2P9N C;  4O3U B;  3V4P A;  3EG6 A;  2HJ4 A;  3QHY B;  1N6E A;  4MMY A;  5AJA A;  3HFQ A;  5B4W A;  4A0B B;  3SFZ A;  3FGB A;  4AN0 A;  3EQ9 A;  1H2W A;  3GC3 B;  4CZY A;  2H13 A;  1VE6 A;  4E54 A;  3K26 A;  3SCY A;  3ZWL B;  2YMU A;  2H9N A;  4E54 B;  4GM8 A;  3PE7 A;  1TYQ C;  5M61 A;  4GM3 A;  5H17 A;  4U1E I;  3C9C A;  2HU7 A;  4FHL A;  4AMZ A;  4CZX A;  1GXR A;  3K71 A;  2P9S C;  2H47 A;  1XHM A;  2HXC A;  2OK6 A;  5I5J A;  4LG9 A;  2IUP A;  2J56 H;  3C99 A;  1GP2 B;  2EIC A;  3EI3 B;  2Z2P A;  3OTT A;  3DSM A;  3OKY B;  3O4H A;  4U7A A;  5E6U A;  5THA A;  4CC9 A;  5EMM B;  2YNN A;  5TEE A;  2MTA H;  3ZE0 A;  4XYH A;  1QFS A;  1SQ9 A;  5AFU 3;  5EM2 B;  3SLE D;  4JXM A;  5CXB B; 
#chains in the Genus database with same CATH homology
 5FFG A;  3T3P A;  4G1M A;  3ZE2 A;  4UM8 A;  2VDM A;  3ZDY A;  3ZDZ A;  3ZE1 A;  4Z7N A;  4O02 A;  4IRZ A;  3V4P A;  3FCS A;  4WK2 A;  3VI4 A;  4MMY A;  3T3M A;  5E6R A;  3ZDX A;  4Z7O A;  3K72 A;  3K6S A;  1M1X A;  2VDP A;  2VDK A;  5E6S A;  2VDN A;  4G1E A;  4WJK A;  2VDO A;  4MMX A;  4WK0 A;  3NIF A;  3NIG A;  5E6U A;  2VC2 A;  5HDB A;  1U8C A;  4WK4 A;  3V4V A;  3VI3 A;  4MMZ A;  2VDQ A;  4Z7Q A;  4NEN A;  3ZE0 A;  1TYE A;  2VDR A;  3NID A;  1JV2 A;  4UM9 A;  3K71 A;  2VDL A;  1L5G A;  3IJE A;  3FCU A;  5FFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...