2VDMA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdmA00
4G1MA 2VDNA 4WK0A 4UM9A 3V4PA 4NENA 3VI3A 1U8CA 3ZDYA 3ZDXA 2VDKA 2VDRA 3VI4A 3K72A 4O02A 2VDLA 1M1XA 4UM8A 5HDBA 3T3MA 3ZE0A 4MMXA 2VDQA 3ZE1A 5E6SA 3NIFA 5E6RA 4Z7OA 4Z7NA 3FCUA 4Z7QA 4WK4A 5E6UA 3ZDZA 4WK2A 1L5GA 4G1EA 3T3PA 3IJEA 2VDPA 5FFGA 3K71A 3FCSA 1JV2A 3V4VA 3NIDA 2VDMA 3NIGA 2VC2A 4MMYA 4WJKA 5FFOA 3ZE2A 2VDOA 3K6SA 1TYEA 4MMZA 4IRZA
chains in the Genus database with same CATH superfamily
4TZ4A 4FAND 4E5ZB 2XE4A 5I5IA 5EMJB 1C9IA 3W15A 4DNWA 2VDRA 4DNVA 3EQ8A 2OVQB 2VDLA 4A0AA 1VE6A 3O4IA 4L1MA 2AGLA 4A0BB 2I3TA 4CC9A 2I0TA 3MUOA 4A09B 3IUQA 3I7LA 3SBQA 3MKSB 5JWZA 1B9XA 4CI2A 1A0RB 3UKRC 4GQ1A 4QAMA 3UVOA 3EI4B 5C9ZB 2XYIA 5C2VB 5M5TA 2CO0C 3EQ9A 4J81A 3NVXA 4GM8A 1GOGA 4NC4A 4A2LA 5AFU3 4GM9A 4IRZA 3I8EA 4GQBB 4G55A 5M5SA 2I3SA 3RN1D 5IT9g 3EQ7A 5GXHA 5IGOA 3A0FA 5I5JA 2QR5A 5TEFA 3DXMC 3RMZD 2AGZA 3RLMD 3JZNA 2B5MA 3MVDK 3IJ1A 5CYKB 3NIDA 1BPOA 4JSVC 3V7DB 4BUJC 4FA9D 4QQEA 5B4WA 3J80g 3SCYA 2J56H 2YMUA 1H2XA 4J77A 3VI4A 2HKMA 1GOHA 3OW8A 1UTCA 5FXYA 2YNPA 3IULA 3ZE1A 3EMHA 1JMZB 3DXKC 3ZDZA 3I8CA 4JT6C 1K3IA 5IGQA 1GXRA 4AX4A 3AH8B 3JZHA 4MMYA 4ERZA 1PI6A 3DWLC 3UVNA 1JMXB 4BCCA 1L0QA 1N6DA 4CZYA 1P22A 3UKUC 3CFSB 3ZDXA 1E5TA 4KFMB 4JSXC 3SWSD 3RSEC 3F3GA 2EBSA 3DDUA 4IMMA 1XHMA 3ZE0A 4AN1A 2UZXB 3SN6B 2EIDA 2CN2A 4ZN4A 3O4HA 3ULEC 1JJUB 2XL3A 4K3JB 2H6QA 1JV2A 3FCSA 2IUPA 4NBMA 5M61A 3OL2A 3IVMA 2YB8B 3NIGA 1OLZA 2OJYA 5FFOA 3ZE2A 4AMZA 2H6KA 2CNXA 4MK0B 1C9LA 1TYEA 2QXVA 1QFSA 2EICA 4GQ2P 4FAVD 2XU7A 1YFQA 3V4PA 4E54A 1U8CA 4J87A 5HQGA 4LG9A 4A08B 3PXTD 2YNOA 1M1XA 3N0EA 5EMMB 1N6EA 5E6RA 1VE7A 4XEIC 1H2ZA 3RFGA 4ES0A 4X60B 2AGYA 3C5MA 4X3EA 5IJ8E 4A0BA 5EMKB 3EU7A 3SJLD 3SBRA 5A2Qg 5FKTA 4PC0A 1UOQA 3JPXA 3OL2B 3PSCB 4PXWA 4UI9R 3SLED 3UVKA 5GXIA 3ODTA 5C2WB 4JHNA 2OVPB 3F3FA 1SHYB 3T3MA 4BP8A 1GOTB 2IURA 2HU8A 3SBPA 5FQDA 1E8MA 4BP9A 2BKLA 2HJ4A 4O9DA 4Y7RA 4WK4A 2TRCB 4JT5C 5EM2A 3P4FA 3BWSA 2CO0A 2VDPA 5IC7A 4O1QD 1JOFA 5HE0B 3KRXB 5FKRA 2P9PC 3C9CA 4GMBA 3T3PA 4JSNC 3NVNA 1UOOA 2CE9A 1XIPA 2JKXA 3KRWB 2VZ3A 3UVMA 1U4CA 3AL8B 4R7AB 2AGWA 3PXSD 4AMYA 4J73A 3V5WB 2YNNA 3L4MD 4J82A 4L1QD 1MG2A 3EI1A 3F3PA 3AL8A 3N0DA 2OVRB 4CZXA 4X61B 3V9FA 4PBYA 3CIKB 3I7KA 3IJCA 3CFVA 4G1MA 4O3TB 2BCJB 2VDNA 2PM6B 3BG1A 3VI3A 5KDOB 2B5NA 2VDKA 4XYHA 3EI2B 3OKYB 5SXMA 5EMLB 4U7AA 2IAAA 5HE3B 1TYQC 3EI4A 1PEVA 2BBKH 3EI2A 5THAA 2HYEA 3DSMA 1L5GA 4A7JA 4FHLA 2H9PA 2B5LA 3QI0A 2HXCA 1VZ2A 5H14A 4O45A 4LG8A 2VC2A 4AN0A 2QZPA 3RFHA 5AMSA 4ESGA 3FGBA 5AJAA 4FA4D 2PBIB 2HU7A 1N6FA 4L3HD 4CI1A 2G9AA 4ZOVA 2MTAH 4GGAA 4O02A 3PVUB 4ZOZA 5EAMA 3JB9L 2GNQA 5E6SA 3C99A 4CY5A 3SFZA 1QNIA 5HE1B 2AH0A 3I7PA 5FKQA 3ZWLB 2H13A 3OKWA 5EAPA 4CY2A 2CN3A 3IUJA 2CE8A 2IUQA 4A09A 5CXCB 4X63B 2YBAA 3SXTD 1R5MA 3VH0A 4H5IA 5TEEA 4G56B 4JD2C 5FLXg 2GC4A 4HDJA 4J86A 3GFCA 1OMWB 2P9SC 4D6VA 3SMRA 5C86A 5FKSA 4RE5A 2P9LC 3O4GA 3OKTA 3SVWD 2QC5A 3NIFA 4CI3A 5K19A 4Z7NA 2HJBA 4Z7QA 4A0AB 2WQ8A 5GSAA 4BH6A 4G1EA 4JXMA 3OTTA 3HFQA 3V4VA 2Q7QA 3I7OA 2J57G 3ORVD 1U2VC 5TF2A 4J0XA 4OZUA 4J84A 5EM2B 2GC7A 2PM7B 1YR2A 1JTDB 2H9MA 4MMZA 3JZGA 5CXCA 3E0CA 2Z2NA 4CZVA 3AFCA 4PBZA 4NAAA 1K32A 4YVDA 4BCBA 2VDQA 5FA5B 4QT8A 4OWRA 4FA5D 4FA1D 1XKSA 1QFMA 3FCUA 3NVQA 5HYNB 3O4JA 1GP2B 5GMKn 5HE2B 3UR4A 4ZOXA 3DM0A 3I89A 2H9LA 2P9UC 4PNKB 5CYKA 4A08A 2H68A 3U4YA 5H1MA 4WK0A 4CY3A 3EG6A 3FM0A 4IA9A 2EIBA 3K27A 4J0WA 4J8BA 1MDAH 3IUNA 2PM9B 2HKRA 4MMXA 3VGZA 2IUVA 2XDWA 3EWEA 1PGUA 3I7NA 4DNUA 2G99A 5EARA 2P9NC 4E5ZA 5CXBA 2XZGA 2VDMA 3IJ0A 4PSWB 4BL0A 2VZ1A 4K3ID 4ERQA 1I2MB 1T2XA 5C92A 3RRMC 4CY1A 3PVWB 3PSLA 2HU5A 4RE6A 3I7HA 4NENA 3ZDYA 4D0KA 4GGCA 3B7FA 4I79A 2EIEA 4U1EI 1SQJA 4NSXA 3OKYA 1H2WA 2PM9A 4Y5RD 2O9KA 4XYIA 5IJ7E 5FFGA 2H14A 2HESX 5TDHB 1GOFA 2P9KC 4J8GA 1VYHC 4WJKA 3IIYA 5CXBB 4FB1D 3C75H 3MKQA 2I0RA 2AGXA 4BCDA 1B9YA 2AQ5A 3GREA 3IURA 3MZKA 5HDBA 2AH1A 5I5MA 4QRJA 4GM3A 3BG0A 1E8NA 1O6GA 5E6UA 2UZYB 3FRXA 4A11B 5K1CC 1VZ3A 2Z2OA 3IIWA 1NR0A 3QHYB 4L9OA 3KCIA 2P9IC 2OK6A 2H47A 4J78A 3EI3B 3PE7A 4QL1A 1NEXB 3JRPA 4FWWA 1FWXA 4LGNA 2IWFA 2H6NA 3SHFA 5M5VA 3MZLA 4UM8A 2I0SA 4D9SA 3EI3A 3JROA 1H2YA 3AL9A 2IWKA 1Q47A 1PBYB 2B4EA 3VA6A 4AOWA 4AEZA 4Z8LA 3L4OD 2OIZA 3PXWD 4J79A 3IJEA 4GZ8A 4JHPC 1A12A 3K71A 2H9NA 4L3GD 4A11A 5M5UA 4JSPC 2OK4A 4N14A 4A2MA 4ERYA 3J81g 4E54B 1O6FA 3I2NA 4CI8A 1MG3A 2J55H 4PSXB 5H17A 3UVLA 1ERJA 3MMYA 4O3UB 3OF7A 2Z2PA 4UM9A 5M5RA 1GG2B 3RN0D 1S4UX 4ZOYA 1SQ9A 3K72A 3MUNA 4O2WA 1RI6A 3IUMA 2H3XA 5EALA 4EWRA 4Z7OA 1UOPA 3IKOA 3JAMg 1K8KC 4WK2A 3GC3B 1TBGA 3EI1B 2XL2A 4GGDA 3GD1I 4H5JA 2VDOA 3MXXA 2W18A 3K26A 3K6SA
chains in the Genus database with same CATH topology
4G1MA 2VDNA 4WK0A 4UM9A 3V4PA 4NENA 3VI3A 1U8CA 3ZDYA 3ZDXA 2VDKA 2VDRA 3VI4A 3K72A 4O02A 2VDLA 1M1XA 4UM8A 5HDBA 3T3MA 3ZE0A 4MMXA 2VDQA 3ZE1A 5E6SA 3NIFA 5E6RA 4Z7OA 4Z7NA 3FCUA 4Z7QA 4WK4A 5E6UA 3ZDZA 4WK2A 1L5GA 4G1EA 3T3PA 3IJEA 2VDPA 5FFGA 3K71A 3FCSA 1JV2A 3V4VA 3NIDA 2VDMA 3NIGA 2VC2A 4MMYA 4WJKA 5FFOA 3ZE2A 2VDOA 3K6SA 1TYEA 4MMZA 4IRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1M A;  2VDN A;  4WK0 A;  4UM9 A;  3V4P A;  4NEN A;  3VI3 A;  1U8C A;  3ZDY A;  3ZDX A;  2VDK A;  2VDR A;  3VI4 A;  3K72 A;  4O02 A;  2VDL A;  1M1X A;  4UM8 A;  5HDB A;  3T3M A;  3ZE0 A;  4MMX A;  2VDQ A;  3ZE1 A;  5E6S A;  3NIF A;  5E6R A;  4Z7O A;  4Z7N A;  3FCU A;  4Z7Q A;  4WK4 A;  5E6U A;  3ZDZ A;  4WK2 A;  1L5G A;  4G1E A;  3T3P A;  3IJE A;  2VDP A;  5FFG A;  3K71 A;  3FCS A;  1JV2 A;  3V4V A;  3NID A;  2VDM A;  3NIG A;  2VC2 A;  4MMY A;  4WJK A;  5FFO A;  3ZE2 A;  2VDO A;  3K6S A;  1TYE A;  4MMZ A;  4IRZ A; 
#chains in the Genus database with same CATH topology
 4TZ4 A;  4FAN D;  4E5Z B;  2XE4 A;  5I5I A;  5EMJ B;  1C9I A;  3W15 A;  4DNW A;  2VDR A;  4DNV A;  3EQ8 A;  2OVQ B;  2VDL A;  4A0A A;  1VE6 A;  3O4I A;  4L1M A;  2AGL A;  4A0B B;  2I3T A;  4CC9 A;  2I0T A;  3MUO A;  4A09 B;  3IUQ A;  3I7L A;  3SBQ A;  3MKS B;  5JWZ A;  1B9X A;  4CI2 A;  1A0R B;  3UKR C;  4GQ1 A;  4QAM A;  3UVO A;  3EI4 B;  5C9Z B;  2XYI A;  5C2V B;  5M5T A;  2CO0 C;  3EQ9 A;  4J81 A;  3NVX A;  4GM8 A;  1GOG A;  4NC4 A;  4A2L A;  5AFU 3;  4GM9 A;  4IRZ A;  3I8E A;  4GQB B;  4G55 A;  5M5S A;  2I3S A;  3RN1 D;  5IT9 g;  3EQ7 A;  5GXH A;  5IGO A;  3A0F A;  5I5J A;  2QR5 A;  5TEF A;  3DXM C;  3RMZ D;  2AGZ A;  3RLM D;  3JZN A;  2B5M A;  3MVD K;  3IJ1 A;  5CYK B;  3NID A;  1BPO A;  4JSV C;  3V7D B;  4BUJ C;  4FA9 D;  4QQE A;  5B4W A;  3J80 g;  3SCY A;  2J56 H;  2YMU A;  1H2X A;  4J77 A;  3VI4 A;  2HKM A;  1GOH A;  3OW8 A;  1UTC A;  5FXY A;  2YNP A;  3IUL A;  3ZE1 A;  3EMH A;  1JMZ B;  3DXK C;  3ZDZ A;  3I8C A;  4JT6 C;  1K3I A;  5IGQ A;  1GXR A;  4AX4 A;  3AH8 B;  3JZH A;  4MMY A;  4ERZ A;  1PI6 A;  3DWL C;  3UVN A;  1JMX B;  4BCC A;  1L0Q A;  1N6D A;  4CZY A;  1P22 A;  3UKU C;  3CFS B;  3ZDX A;  1E5T A;  4KFM B;  4JSX C;  3SWS D;  3RSE C;  3F3G A;  2EBS A;  3DDU A;  4IMM A;  1XHM A;  3ZE0 A;  4AN1 A;  2UZX B;  3SN6 B;  2EID A;  2CN2 A;  4ZN4 A;  3O4H A;  3ULE C;  1JJU B;  2XL3 A;  4K3J B;  2H6Q A;  1JV2 A;  3FCS A;  2IUP A;  4NBM A;  5M61 A;  3OL2 A;  3IVM A;  2YB8 B;  3NIG A;  1OLZ A;  2OJY A;  5FFO A;  3ZE2 A;  4AMZ A;  2H6K A;  2CNX A;  4MK0 B;  1C9L A;  1TYE A;  2QXV A;  1QFS A;  2EIC A;  4GQ2 P;  4FAV D;  2XU7 A;  1YFQ A;  3V4P A;  4E54 A;  1U8C A;  4J87 A;  5HQG A;  4LG9 A;  4A08 B;  3PXT D;  2YNO A;  1M1X A;  3N0E A;  5EMM B;  1N6E A;  5E6R A;  1VE7 A;  4XEI C;  1H2Z A;  3RFG A;  4ES0 A;  4X60 B;  2AGY A;  3C5M A;  4X3E A;  5IJ8 E;  4A0B A;  5EMK B;  3EU7 A;  3SJL D;  3SBR A;  5A2Q g;  5FKT A;  4PC0 A;  1UOQ A;  3JPX A;  3OL2 B;  3PSC B;  4PXW A;  4UI9 R;  3SLE D;  3UVK A;  5GXI A;  3ODT A;  5C2W B;  4JHN A;  2OVP B;  3F3F A;  1SHY B;  3T3M A;  4BP8 A;  1GOT B;  2IUR A;  2HU8 A;  3SBP A;  5FQD A;  1E8M A;  4BP9 A;  2BKL A;  2HJ4 A;  4O9D A;  4Y7R A;  4WK4 A;  2TRC B;  4JT5 C;  5EM2 A;  3P4F A;  3BWS A;  2CO0 A;  2VDP A;  5IC7 A;  4O1Q D;  1JOF A;  5HE0 B;  3KRX B;  5FKR A;  2P9P C;  3C9C A;  4GMB A;  3T3P A;  4JSN C;  3NVN A;  1UOO A;  2CE9 A;  1XIP A;  2JKX A;  3KRW B;  2VZ3 A;  3UVM A;  1U4C A;  3AL8 B;  4R7A B;  2AGW A;  3PXS D;  4AMY A;  4J73 A;  3V5W B;  2YNN A;  3L4M D;  4J82 A;  4L1Q D;  1MG2 A;  3EI1 A;  3F3P A;  3AL8 A;  3N0D A;  2OVR B;  4CZX A;  4X61 B;  3V9F A;  4PBY A;  3CIK B;  3I7K A;  3IJC A;  3CFV A;  4G1M A;  4O3T B;  2BCJ B;  2VDN A;  2PM6 B;  3BG1 A;  3VI3 A;  5KDO B;  2B5N A;  2VDK A;  4XYH A;  3EI2 B;  3OKY B;  5SXM A;  5EML B;  4U7A A;  2IAA A;  5HE3 B;  1TYQ C;  3EI4 A;  1PEV A;  2BBK H;  3EI2 A;  5THA A;  2HYE A;  3DSM A;  1L5G A;  4A7J A;  4FHL A;  2H9P A;  2B5L A;  3QI0 A;  2HXC A;  1VZ2 A;  5H14 A;  4O45 A;  4LG8 A;  2VC2 A;  4AN0 A;  2QZP A;  3RFH A;  5AMS A;  4ESG A;  3FGB A;  5AJA A;  4FA4 D;  2PBI B;  2HU7 A;  1N6F A;  4L3H D;  4CI1 A;  2G9A A;  4ZOV A;  2MTA H;  4GGA A;  4O02 A;  3PVU B;  4ZOZ A;  5EAM A;  3JB9 L;  2GNQ A;  5E6S A;  3C99 A;  4CY5 A;  3SFZ A;  1QNI A;  5HE1 B;  2AH0 A;  3I7P A;  5FKQ A;  3ZWL B;  2H13 A;  3OKW A;  5EAP A;  4CY2 A;  2CN3 A;  3IUJ A;  2CE8 A;  2IUQ A;  4A09 A;  5CXC B;  4X63 B;  2YBA A;  3SXT D;  1R5M A;  3VH0 A;  4H5I A;  5TEE A;  4G56 B;  4JD2 C;  5FLX g;  2GC4 A;  4HDJ A;  4J86 A;  3GFC A;  1OMW B;  2P9S C;  4D6V A;  3SMR A;  5C86 A;  5FKS A;  4RE5 A;  2P9L C;  3O4G A;  3OKT A;  3SVW D;  2QC5 A;  3NIF A;  4CI3 A;  5K19 A;  4Z7N A;  2HJB A;  4Z7Q A;  4A0A B;  2WQ8 A;  5GSA A;  4BH6 A;  4G1E A;  4JXM A;  3OTT A;  3HFQ A;  3V4V A;  2Q7Q A;  3I7O A;  2J57 G;  3ORV D;  1U2V C;  5TF2 A;  4J0X A;  4OZU A;  4J84 A;  5EM2 B;  2GC7 A;  2PM7 B;  1YR2 A;  1JTD B;  2H9M A;  4MMZ A;  3JZG A;  5CXC A;  3E0C A;  2Z2N A;  4CZV A;  3AFC A;  4PBZ A;  4NAA A;  1K32 A;  4YVD A;  4BCB A;  2VDQ A;  5FA5 B;  4QT8 A;  4OWR A;  4FA5 D;  4FA1 D;  1XKS A;  1QFM A;  3FCU A;  3NVQ A;  5HYN B;  3O4J A;  1GP2 B;  5GMK n;  5HE2 B;  3UR4 A;  4ZOX A;  3DM0 A;  3I89 A;  2H9L A;  2P9U C;  4PNK B;  5CYK A;  4A08 A;  2H68 A;  3U4Y A;  5H1M A;  4WK0 A;  4CY3 A;  3EG6 A;  3FM0 A;  4IA9 A;  2EIB A;  3K27 A;  4J0W A;  4J8B A;  1MDA H;  3IUN A;  2PM9 B;  2HKR A;  4MMX A;  3VGZ A;  2IUV A;  2XDW A;  3EWE A;  1PGU A;  3I7N A;  4DNU A;  2G99 A;  5EAR A;  2P9N C;  4E5Z A;  5CXB A;  2XZG A;  2VDM A;  3IJ0 A;  4PSW B;  4BL0 A;  2VZ1 A;  4K3I D;  4ERQ A;  1I2M B;  1T2X A;  5C92 A;  3RRM C;  4CY1 A;  3PVW B;  3PSL A;  2HU5 A;  4RE6 A;  3I7H A;  4NEN A;  3ZDY A;  4D0K A;  4GGC A;  3B7F A;  4I79 A;  2EIE A;  4U1E I;  1SQJ A;  4NSX A;  3OKY A;  1H2W A;  2PM9 A;  4Y5R D;  2O9K A;  4XYI A;  5IJ7 E;  5FFG A;  2H14 A;  2HES X;  5TDH B;  1GOF A;  2P9K C;  4J8G A;  1VYH C;  4WJK A;  3IIY A;  5CXB B;  4FB1 D;  3C75 H;  3MKQ A;  2I0R A;  2AGX A;  4BCD A;  1B9Y A;  2AQ5 A;  3GRE A;  3IUR A;  3MZK A;  5HDB A;  2AH1 A;  5I5M A;  4QRJ A;  4GM3 A;  3BG0 A;  1E8N A;  1O6G A;  5E6U A;  2UZY B;  3FRX A;  4A11 B;  5K1C C;  1VZ3 A;  2Z2O A;  3IIW A;  1NR0 A;  3QHY B;  4L9O A;  3KCI A;  2P9I C;  2OK6 A;  2H47 A;  4J78 A;  3EI3 B;  3PE7 A;  4QL1 A;  1NEX B;  3JRP A;  4FWW A;  1FWX A;  4LGN A;  2IWF A;  2H6N A;  3SHF A;  5M5V A;  3MZL A;  4UM8 A;  2I0S A;  4D9S A;  3EI3 A;  3JRO A;  1H2Y A;  3AL9 A;  2IWK A;  1Q47 A;  1PBY B;  2B4E A;  3VA6 A;  4AOW A;  4AEZ A;  4Z8L A;  3L4O D;  2OIZ A;  3PXW D;  4J79 A;  3IJE A;  4GZ8 A;  4JHP C;  1A12 A;  3K71 A;  2H9N A;  4L3G D;  4A11 A;  5M5U A;  4JSP C;  2OK4 A;  4N14 A;  4A2M A;  4ERY A;  3J81 g;  4E54 B;  1O6F A;  3I2N A;  4CI8 A;  1MG3 A;  2J55 H;  4PSX B;  5H17 A;  3UVL A;  1ERJ A;  3MMY A;  4O3U B;  3OF7 A;  2Z2P A;  4UM9 A;  5M5R A;  1GG2 B;  3RN0 D;  1S4U X;  4ZOY A;  1SQ9 A;  3K72 A;  3MUN A;  4O2W A;  1RI6 A;  3IUM A;  2H3X A;  5EAL A;  4EWR A;  4Z7O A;  1UOP A;  3IKO A;  3JAM g;  1K8K C;  4WK2 A;  3GC3 B;  1TBG A;  3EI1 B;  2XL2 A;  4GGD A;  3GD1 I;  4H5J A;  2VDO A;  3MXX A;  2W18 A;  3K26 A;  3K6S A; 
#chains in the Genus database with same CATH homology
 4G1M A;  2VDN A;  4WK0 A;  4UM9 A;  3V4P A;  4NEN A;  3VI3 A;  1U8C A;  3ZDY A;  3ZDX A;  2VDK A;  2VDR A;  3VI4 A;  3K72 A;  4O02 A;  2VDL A;  1M1X A;  4UM8 A;  5HDB A;  3T3M A;  3ZE0 A;  4MMX A;  2VDQ A;  3ZE1 A;  5E6S A;  3NIF A;  5E6R A;  4Z7O A;  4Z7N A;  3FCU A;  4Z7Q A;  4WK4 A;  5E6U A;  3ZDZ A;  4WK2 A;  1L5G A;  4G1E A;  3T3P A;  3IJE A;  2VDP A;  5FFG A;  3K71 A;  3FCS A;  1JV2 A;  3V4V A;  3NID A;  2VDM A;  3NIG A;  2VC2 A;  4MMY A;  4WJK A;  5FFO A;  3ZE2 A;  2VDO A;  3K6S A;  1TYE A;  4MMZ A;  4IRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...