2VDMA

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdmA00
3V4PA 3ZE1A 4G1MA 4G1EA 2VDOA 3FCUA 4IRZA 4Z7QA 3ZDXA 3T3MA 5HDBA 1L5GA 5FFOA 1JV2A 2VDQA 2VDNA 3NIFA 4WK2A 3K72A 5E6SA 4NENA 3T3PA 3VI3A 3V4VA 4WJKA 4Z7NA 3NIDA 2VDLA 5E6RA 1U8CA 2VDPA 4MMXA 3ZDZA 2VC2A 4UM9A 3NIGA 4UM8A 4O02A 3K71A 4MMYA 3IJEA 4MMZA 3VI4A 2VDKA 3FCSA 5E6UA 1TYEA 2VDRA 4Z7OA 3ZDYA 2VDMA 4WK4A 1M1XA 4WK0A 5FFGA 3K6SA 3ZE0A 3ZE2A
chains in the Genus database with same CATH superfamily
5HQGA 4IRZA 4U1EI 3JRPA 5H1MA 4J8GA 4BP9A 4A0AB 4JT5C 5EMJB 1T2XA 3O4HA 4Y7RA 4X63B 3NIDA 3EQ9A 3IUNA 1VYHC 1O6GA 2VDLA 4D9SA 1MG2A 4IA9A 3DSMA 3I7LA 3IJEA 3PSLA 2AGLA 4FHLA 4A2MA 3B7FA 3MZLA 5SXMA 3UR4A 1OMWB 2H68A 3SWSD 1MDAH 3RLMD 5FFGA 2EIEA 3ZE0A 4O9DA 4G56B 4A08B 3J80g 2G99A 3EWEA 2PM9B 5M5UA 1UOPA 1E5TA 2GC4A 3IURA 3C5MA 3RRMC 4FB1D 3I7NA 3JPXA 3MUOA 4FAND 5IJ7E 4A11A 4CY3A 5M5VA 4J82A 4O1QD 5FXYA 2AGWA 1B9YA 1XIPA 2B5MA 1N6FA 1E8MA 3J81g 4PXWA 4PNKB 3RFHA 1UOQA 5EMLB 2OJYA 4AX4A 3GFCA 2XE4A 4ERZA 3JROA 1R5MA 2H47A 2XYIA 4J78A 4CI3A 2IUQA 2VZ3A 5M61A 4GGDA 4WK2A 1QNIA 2HU7A 4DNUA 5AJAA 4D0KA 5HE1B 4AMZA 4PBYA 3QHYB 2Z2OA 3GD1I 1MG3A 3I7PA 5FKTA 4FA9D 3EU7A 3K71A 3OKYA 2HKRA 4AOWA 3OF7A 1TYEA 2XL2A 2Z2NA 1VE7A 2CO0A 4WK4A 4J77A 5M5SA 4BH6A 2HU8A 4CI2A 4G1EA 4ZOXA 4CZXA 5K1CC 3I8CA 4GGAA 5EAPA 3NIFA 2IWKA 1JJUB 2UZYB 5HE0B 3DXKC 1H2ZA 5E6RA 3EMHA 1GOGA 4JT6C 5GXHA 2CN3A 2HXCA 1XHMA 3JZNA 5CYKA 2HU5A 2P9SC 2HJBA 4QL1A 4NAAA 4CY1A 3RN0D 4ZOVA 4DNVA 1VE6A 1Q47A 4FA4D 3OKWA 2AGYA 2AH1A 5C2WB 1U4CA 2OK6A 3PXTD 4QRJA 4ZN4A 4U7AA 5FFOA 3CFSB 3OKYB 2YMUA 3SFZA 4BCDA 3MXXA 4L3HD 3KCIA 2B5NA 2P9LC 3OKTA 1TBGA 4NBMA 2W18A 3IUQA 1ERJA 2QXVA 3BWSA 2P9KC 4O2WA 4XEIC 4LGNA 1BPOA 1A12A 5IT9g 2H9LA 3DXMC 2HYEA 4O3UB 5H14A 3UVLA 2PBIB 4BP8A 3PE7A 2XL3A 4RE5A 4J79A 2UZXB 4NENA 1VZ2A 3MMYA 4BL0A 5C2VB 5C92A 4J84A 4PSWB 2O9KA 4E54A 1H2YA 2WQ8A 3I7HA 1K3IA 3SHFA 1I2MB 3DM0A 4FA5D 4A7JA 1SQJA 3NIGA 5FKRA 2VDKA 3FCSA 5EMKB 2J56H 2YB8B 4J86A 3IJ0A 4JSVC 5FA5B 2JKXA 2OVRB 3ZE2A 2MTAH 2VDOA 4K3JB 2OVQB 5FQDA 4OZUA 4NC4A 3ZDXA 3SJLD 3N0EA 5I5JA 3UKRC 3I89A 3E0CA 3SBPA 5JWZA 4A09B 2H9PA 2IAAA 2HJ4A 4CI1A 3C75H 4J0WA 3JZGA 3AL8B 2Q7QA 2AQ5A 3I2NA 3I7KA 4O02A 5AFU3 4H5JA 2IUPA 3VI4A 2YNPA 2QC5A 1OLZA 1YR2A 4QT8A 4E5ZA 3EI4A 1PI6A 3VGZA 1JOFA 2H9NA 4MK0B 2AGZA 3I7OA 2YNNA 3EI3A 4G1MA 4LG8A 3BG0A 4E54B 4Z8LA 3T3MA 1JMXB 4QAMA 2J55H 1UOOA 5FKQA 2P9NC 3MVDK 4AMYA 5E6SA 3VI3A 3RSEC 4CY2A 3RMZD 3N0DA 3O4JA 2CN2A 2HESX 2VC2A 3SBRA 4ZOYA 1K32A 3CIKB 4A2LA 3NVQA 4IMMA 1PEVA 4GQ2P 2OK4A 4QQEA 2H6QA 4YVDA 5EMMB 3KRXB 2EIBA 4O3TB 5H17A 4FAVD 3IKOA 3EI1A 5CXCA 5EALA 4A11B 4GM8A 3ZWLB 1JV2A 4GQBB 3IUMA 3P4FA 3F3FA 5A2Qg 2HKMA 4E5ZB 3EI4B 4BUJC 4PC0A 4K3ID 4I79A 4OWRA 3GREA 3DDUA 4JSPC 3EI3B 3PXWD 2EIDA 1P22A 1GOFA 4L3GD 2VDMA 3U4YA 3OL2A 2B4EA 2AH0A 2IWFA 3DWLC 3ZE1A 3HFQA 4FA1D 4BCCA 3UKUC 1A0RB 1L0QA 2H3XA 3MZKA 4ESGA 1B9XA 4NSXA 5AMSA 1L5GA 3OW8A 4ES0A 4PBZA 3BG1A 4GQ1A 1N6DA 3V4VA 1GOTB 5HYNB 5KDOB 5IC7A 4CZVA 4A0AA 3FGBA 3RN1D 3V9FA 5GXIA 1FWXA 5GMKn 4FWWA 1RI6A 3SXTD 2Z2PA 3IIYA 4ZOZA 3SCYA 4L9OA 3EI1B 5CXCB 5EAMA 3RFGA 3SBQA 3IUJA 3I8EA 2BCJB 4L1MA 1SQ9A 3SVWD 2J57G 2I3SA 5HDBA 3UVMA 1E8NA 2AGXA 2H6KA 5CYKB 1VZ3A 5TEFA 3UVNA 4Z7NA 4N14A 3PSCB 4D6VA 3OL2B 2I0RA 5IGQA 4UM8A 1JTDB 3JAMg 2EBSA 3L4MD 3ZDYA 5M5TA 4R7AB 3K26A 4KFMB 1O6FA 5HE2B 2H14A 4X3EA 5HE3B 4ERYA 3PVUB 4J87A 1NR0A 2YNOA 3AL9A 2H13A 4J8BA 2B5LA 3IIWA 4H5IA 1H2WA 1U8CA 3MKQA 1C9LA 4UI9R 5TF2A 3V5WB 4UM9A 1PGUA 1YFQA 5E6UA 5K19A 2H6NA 4J0XA 5C86A 2VZ1A 3K6SA 3V4PA 5CXBA 2PM6B 1N6EA 1PBYB 4LG9A 4JSXC 2CE8A 1C9IA 4Y5RD 5I5IA 1GG2B 2GNQA 3VA6A 2CNXA 3V7DB 2IUVA 4AN0A 2OIZA 3CFVA 4GMBA 4J81A 2IURA 3NVNA 5B4WA 4EWRA 2PM7B 3IVMA 2VDPA 4MMXA 1XKSA 2CO0C 2XZGA 4GZ8A 2QR5A 4XYIA 3L4OD 5EM2A 3NVXA 1UTCA 5M5RA 3GC3B 4L1QD 2P9IC 1GXRA 4XYHA 2XDWA 3UVKA 1S4UX 3C99A 3SN6B 1M1XA 4WK0A 4BCBA 5EARA 2EICA 4JHNA 3SMRA 1SHYB 4DNWA 1TYQC 4TZ4A 2P9UC 4A0BA 5FKSA 4ERQA 3UVOA 3KRWB 1K8KC 3JZHA 5FLXg 2QZPA 3W15A 4J73A 3SLED 3MUNA 4RE6A 2TRCB 3AH8B 5IJ8E 1H2XA 3FRXA 3K27A 3EI2A 3EQ7A 5THAA 2I0TA 5CXBB 1NEXB 2GC7A 5I5MA 3PXSD 3O4GA 2VDRA 3MKSB 5C9ZB 5TDHB 3JB9L 2XU7A 3FM0A 5TEEA 3FCUA 4AEZA 3C9CA 3ULEC 2VDQA 2VDNA 4JHPC 3K72A 4GM3A 5EM2B 3O4IA 2YBAA 3VH0A 3IJ1A 4HDJA 4CI8A 4X61B 3PVWB 3ORVD 4O45A 4A0BB 3AFCA 4CZYA 3IJCA 4Z7OA 2BBKH 4G55A 2CE9A 3QI0A 4JD2C 4GM9A 2G9AA 5IGOA 4Z7QA 5GSAA 3A0FA 1QFSA 3EI2B 2I0SA 1U2VC 2P9PC 4X60B 4JXMA 3T3PA 4CY5A 3EG6A 3EQ8A 4WJKA 3ODTA 2I3TA 4A08A 4PSXB 3F3GA 4AN1A 3OTTA 2PM9A 4CC9A 3ZDZA 4GGCA 4A09A 3F3PA 4MMYA 4MMZA 1JMZB 2BKLA 1GP2B 3AL8A 4JSNC 3IULA 1QFMA 2OVPB 2H9MA 1GOHA
chains in the Genus database with same CATH topology
3V4PA 3ZE1A 4G1MA 4G1EA 2VDOA 3FCUA 4IRZA 4Z7QA 3ZDXA 3T3MA 5HDBA 1L5GA 5FFOA 1JV2A 2VDQA 2VDNA 3NIFA 4WK2A 3K72A 5E6SA 4NENA 3T3PA 3VI3A 3V4VA 4WJKA 4Z7NA 3NIDA 2VDLA 5E6RA 1U8CA 2VDPA 4MMXA 3ZDZA 2VC2A 4UM9A 3NIGA 4UM8A 4O02A 3K71A 4MMYA 3IJEA 4MMZA 3VI4A 2VDKA 3FCSA 5E6UA 1TYEA 2VDRA 4Z7OA 3ZDYA 2VDMA 4WK4A 1M1XA 4WK0A 5FFGA 3K6SA 3ZE0A 3ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4P A;  3ZE1 A;  4G1M A;  4G1E A;  2VDO A;  3FCU A;  4IRZ A;  4Z7Q A;  3ZDX A;  3T3M A;  5HDB A;  1L5G A;  5FFO A;  1JV2 A;  2VDQ A;  2VDN A;  3NIF A;  4WK2 A;  3K72 A;  5E6S A;  4NEN A;  3T3P A;  3VI3 A;  3V4V A;  4WJK A;  4Z7N A;  3NID A;  2VDL A;  5E6R A;  1U8C A;  2VDP A;  4MMX A;  3ZDZ A;  2VC2 A;  4UM9 A;  3NIG A;  4UM8 A;  4O02 A;  3K71 A;  4MMY A;  3IJE A;  4MMZ A;  3VI4 A;  2VDK A;  3FCS A;  5E6U A;  1TYE A;  2VDR A;  4Z7O A;  3ZDY A;  2VDM A;  4WK4 A;  1M1X A;  4WK0 A;  5FFG A;  3K6S A;  3ZE0 A;  3ZE2 A; 
#chains in the Genus database with same CATH topology
 5HQG A;  4IRZ A;  4U1E I;  3JRP A;  5H1M A;  4J8G A;  4BP9 A;  4A0A B;  4JT5 C;  5EMJ B;  1T2X A;  3O4H A;  4Y7R A;  4X63 B;  3NID A;  3EQ9 A;  3IUN A;  1VYH C;  1O6G A;  2VDL A;  4D9S A;  1MG2 A;  4IA9 A;  3DSM A;  3I7L A;  3IJE A;  3PSL A;  2AGL A;  4FHL A;  4A2M A;  3B7F A;  3MZL A;  5SXM A;  3UR4 A;  1OMW B;  2H68 A;  3SWS D;  1MDA H;  3RLM D;  5FFG A;  2EIE A;  3ZE0 A;  4O9D A;  4G56 B;  4A08 B;  3J80 g;  2G99 A;  3EWE A;  2PM9 B;  5M5U A;  1UOP A;  1E5T A;  2GC4 A;  3IUR A;  3C5M A;  3RRM C;  4FB1 D;  3I7N A;  3JPX A;  3MUO A;  4FAN D;  5IJ7 E;  4A11 A;  4CY3 A;  5M5V A;  4J82 A;  4O1Q D;  5FXY A;  2AGW A;  1B9Y A;  1XIP A;  2B5M A;  1N6F A;  1E8M A;  3J81 g;  4PXW A;  4PNK B;  3RFH A;  1UOQ A;  5EML B;  2OJY A;  4AX4 A;  3GFC A;  2XE4 A;  4ERZ A;  3JRO A;  1R5M A;  2H47 A;  2XYI A;  4J78 A;  4CI3 A;  2IUQ A;  2VZ3 A;  5M61 A;  4GGD A;  4WK2 A;  1QNI A;  2HU7 A;  4DNU A;  5AJA A;  4D0K A;  5HE1 B;  4AMZ A;  4PBY A;  3QHY B;  2Z2O A;  3GD1 I;  1MG3 A;  3I7P A;  5FKT A;  4FA9 D;  3EU7 A;  3K71 A;  3OKY A;  2HKR A;  4AOW A;  3OF7 A;  1TYE A;  2XL2 A;  2Z2N A;  1VE7 A;  2CO0 A;  4WK4 A;  4J77 A;  5M5S A;  4BH6 A;  2HU8 A;  4CI2 A;  4G1E A;  4ZOX A;  4CZX A;  5K1C C;  3I8C A;  4GGA A;  5EAP A;  3NIF A;  2IWK A;  1JJU B;  2UZY B;  5HE0 B;  3DXK C;  1H2Z A;  5E6R A;  3EMH A;  1GOG A;  4JT6 C;  5GXH A;  2CN3 A;  2HXC A;  1XHM A;  3JZN A;  5CYK A;  2HU5 A;  2P9S C;  2HJB A;  4QL1 A;  4NAA A;  4CY1 A;  3RN0 D;  4ZOV A;  4DNV A;  1VE6 A;  1Q47 A;  4FA4 D;  3OKW A;  2AGY A;  2AH1 A;  5C2W B;  1U4C A;  2OK6 A;  3PXT D;  4QRJ A;  4ZN4 A;  4U7A A;  5FFO A;  3CFS B;  3OKY B;  2YMU A;  3SFZ A;  4BCD A;  3MXX A;  4L3H D;  3KCI A;  2B5N A;  2P9L C;  3OKT A;  1TBG A;  4NBM A;  2W18 A;  3IUQ A;  1ERJ A;  2QXV A;  3BWS A;  2P9K C;  4O2W A;  4XEI C;  4LGN A;  1BPO A;  1A12 A;  5IT9 g;  2H9L A;  3DXM C;  2HYE A;  4O3U B;  5H14 A;  3UVL A;  2PBI B;  4BP8 A;  3PE7 A;  2XL3 A;  4RE5 A;  4J79 A;  2UZX B;  4NEN A;  1VZ2 A;  3MMY A;  4BL0 A;  5C2V B;  5C92 A;  4J84 A;  4PSW B;  2O9K A;  4E54 A;  1H2Y A;  2WQ8 A;  3I7H A;  1K3I A;  3SHF A;  1I2M B;  3DM0 A;  4FA5 D;  4A7J A;  1SQJ A;  3NIG A;  5FKR A;  2VDK A;  3FCS A;  5EMK B;  2J56 H;  2YB8 B;  4J86 A;  3IJ0 A;  4JSV C;  5FA5 B;  2JKX A;  2OVR B;  3ZE2 A;  2MTA H;  2VDO A;  4K3J B;  2OVQ B;  5FQD A;  4OZU A;  4NC4 A;  3ZDX A;  3SJL D;  3N0E A;  5I5J A;  3UKR C;  3I89 A;  3E0C A;  3SBP A;  5JWZ A;  4A09 B;  2H9P A;  2IAA A;  2HJ4 A;  4CI1 A;  3C75 H;  4J0W A;  3JZG A;  3AL8 B;  2Q7Q A;  2AQ5 A;  3I2N A;  3I7K A;  4O02 A;  5AFU 3;  4H5J A;  2IUP A;  3VI4 A;  2YNP A;  2QC5 A;  1OLZ A;  1YR2 A;  4QT8 A;  4E5Z A;  3EI4 A;  1PI6 A;  3VGZ A;  1JOF A;  2H9N A;  4MK0 B;  2AGZ A;  3I7O A;  2YNN A;  3EI3 A;  4G1M A;  4LG8 A;  3BG0 A;  4E54 B;  4Z8L A;  3T3M A;  1JMX B;  4QAM A;  2J55 H;  1UOO A;  5FKQ A;  2P9N C;  3MVD K;  4AMY A;  5E6S A;  3VI3 A;  3RSE C;  4CY2 A;  3RMZ D;  3N0D A;  3O4J A;  2CN2 A;  2HES X;  2VC2 A;  3SBR A;  4ZOY A;  1K32 A;  3CIK B;  4A2L A;  3NVQ A;  4IMM A;  1PEV A;  4GQ2 P;  2OK4 A;  4QQE A;  2H6Q A;  4YVD A;  5EMM B;  3KRX B;  2EIB A;  4O3T B;  5H17 A;  4FAV D;  3IKO A;  3EI1 A;  5CXC A;  5EAL A;  4A11 B;  4GM8 A;  3ZWL B;  1JV2 A;  4GQB B;  3IUM A;  3P4F A;  3F3F A;  5A2Q g;  2HKM A;  4E5Z B;  3EI4 B;  4BUJ C;  4PC0 A;  4K3I D;  4I79 A;  4OWR A;  3GRE A;  3DDU A;  4JSP C;  3EI3 B;  3PXW D;  2EID A;  1P22 A;  1GOF A;  4L3G D;  2VDM A;  3U4Y A;  3OL2 A;  2B4E A;  2AH0 A;  2IWF A;  3DWL C;  3ZE1 A;  3HFQ A;  4FA1 D;  4BCC A;  3UKU C;  1A0R B;  1L0Q A;  2H3X A;  3MZK A;  4ESG A;  1B9X A;  4NSX A;  5AMS A;  1L5G A;  3OW8 A;  4ES0 A;  4PBZ A;  3BG1 A;  4GQ1 A;  1N6D A;  3V4V A;  1GOT B;  5HYN B;  5KDO B;  5IC7 A;  4CZV A;  4A0A A;  3FGB A;  3RN1 D;  3V9F A;  5GXI A;  1FWX A;  5GMK n;  4FWW A;  1RI6 A;  3SXT D;  2Z2P A;  3IIY A;  4ZOZ A;  3SCY A;  4L9O A;  3EI1 B;  5CXC B;  5EAM A;  3RFG A;  3SBQ A;  3IUJ A;  3I8E A;  2BCJ B;  4L1M A;  1SQ9 A;  3SVW D;  2J57 G;  2I3S A;  5HDB A;  3UVM A;  1E8N A;  2AGX A;  2H6K A;  5CYK B;  1VZ3 A;  5TEF A;  3UVN A;  4Z7N A;  4N14 A;  3PSC B;  4D6V A;  3OL2 B;  2I0R A;  5IGQ A;  4UM8 A;  1JTD B;  3JAM g;  2EBS A;  3L4M D;  3ZDY A;  5M5T A;  4R7A B;  3K26 A;  4KFM B;  1O6F A;  5HE2 B;  2H14 A;  4X3E A;  5HE3 B;  4ERY A;  3PVU B;  4J87 A;  1NR0 A;  2YNO A;  3AL9 A;  2H13 A;  4J8B A;  2B5L A;  3IIW A;  4H5I A;  1H2W A;  1U8C A;  3MKQ A;  1C9L A;  4UI9 R;  5TF2 A;  3V5W B;  4UM9 A;  1PGU A;  1YFQ A;  5E6U A;  5K19 A;  2H6N A;  4J0X A;  5C86 A;  2VZ1 A;  3K6S A;  3V4P A;  5CXB A;  2PM6 B;  1N6E A;  1PBY B;  4LG9 A;  4JSX C;  2CE8 A;  1C9I A;  4Y5R D;  5I5I A;  1GG2 B;  2GNQ A;  3VA6 A;  2CNX A;  3V7D B;  2IUV A;  4AN0 A;  2OIZ A;  3CFV A;  4GMB A;  4J81 A;  2IUR A;  3NVN A;  5B4W A;  4EWR A;  2PM7 B;  3IVM A;  2VDP A;  4MMX A;  1XKS A;  2CO0 C;  2XZG A;  4GZ8 A;  2QR5 A;  4XYI A;  3L4O D;  5EM2 A;  3NVX A;  1UTC A;  5M5R A;  3GC3 B;  4L1Q D;  2P9I C;  1GXR A;  4XYH A;  2XDW A;  3UVK A;  1S4U X;  3C99 A;  3SN6 B;  1M1X A;  4WK0 A;  4BCB A;  5EAR A;  2EIC A;  4JHN A;  3SMR A;  1SHY B;  4DNW A;  1TYQ C;  4TZ4 A;  2P9U C;  4A0B A;  5FKS A;  4ERQ A;  3UVO A;  3KRW B;  1K8K C;  3JZH A;  5FLX g;  2QZP A;  3W15 A;  4J73 A;  3SLE D;  3MUN A;  4RE6 A;  2TRC B;  3AH8 B;  5IJ8 E;  1H2X A;  3FRX A;  3K27 A;  3EI2 A;  3EQ7 A;  5THA A;  2I0T A;  5CXB B;  1NEX B;  2GC7 A;  5I5M A;  3PXS D;  3O4G A;  2VDR A;  3MKS B;  5C9Z B;  5TDH B;  3JB9 L;  2XU7 A;  3FM0 A;  5TEE A;  3FCU A;  4AEZ A;  3C9C A;  3ULE C;  2VDQ A;  2VDN A;  4JHP C;  3K72 A;  4GM3 A;  5EM2 B;  3O4I A;  2YBA A;  3VH0 A;  3IJ1 A;  4HDJ A;  4CI8 A;  4X61 B;  3PVW B;  3ORV D;  4O45 A;  4A0B B;  3AFC A;  4CZY A;  3IJC A;  4Z7O A;  2BBK H;  4G55 A;  2CE9 A;  3QI0 A;  4JD2 C;  4GM9 A;  2G9A A;  5IGO A;  4Z7Q A;  5GSA A;  3A0F A;  1QFS A;  3EI2 B;  2I0S A;  1U2V C;  2P9P C;  4X60 B;  4JXM A;  3T3P A;  4CY5 A;  3EG6 A;  3EQ8 A;  4WJK A;  3ODT A;  2I3T A;  4A08 A;  4PSX B;  3F3G A;  4AN1 A;  3OTT A;  2PM9 A;  4CC9 A;  3ZDZ A;  4GGC A;  4A09 A;  3F3P A;  4MMY A;  4MMZ A;  1JMZ B;  2BKL A;  1GP2 B;  3AL8 A;  4JSN C;  3IUL A;  1QFM A;  2OVP B;  2H9M A;  1GOH A; 
#chains in the Genus database with same CATH homology
 3V4P A;  3ZE1 A;  4G1M A;  4G1E A;  2VDO A;  3FCU A;  4IRZ A;  4Z7Q A;  3ZDX A;  3T3M A;  5HDB A;  1L5G A;  5FFO A;  1JV2 A;  2VDQ A;  2VDN A;  3NIF A;  4WK2 A;  3K72 A;  5E6S A;  4NEN A;  3T3P A;  3VI3 A;  3V4V A;  4WJK A;  4Z7N A;  3NID A;  2VDL A;  5E6R A;  1U8C A;  2VDP A;  4MMX A;  3ZDZ A;  2VC2 A;  4UM9 A;  3NIG A;  4UM8 A;  4O02 A;  3K71 A;  4MMY A;  3IJE A;  4MMZ A;  3VI4 A;  2VDK A;  3FCS A;  5E6U A;  1TYE A;  2VDR A;  4Z7O A;  3ZDY A;  2VDM A;  4WK4 A;  1M1X A;  4WK0 A;  5FFG A;  3K6S A;  3ZE0 A;  3ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...