2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
5KYUB 3FCUB 3FCSA 2I91A 4DMUB 3Q3GE 3EG9B 1U0NA 2I6SA 4HQKA 3M6FA 3NIGB 3RAGA 3QA3E 4WK0B 4MMXB 3TXAA 4NENA 1U8CB 3ZDYB 1M1XA 4FWWA 4MMZB 1RRKA 1ZOOA 3PPVA 3IJEA 4C2BA 1YUKA 2I6QA 4K3JB 1FE8A 4G1EA 2UZYB 1JEQB 3BQMB 5KYWB 1ZOPA 3NVQA 5LN1A 4WFQA 1SSLA 2NVOA 4CN9A 4IXDA 5BV8A 1SHUX 5KYUA 1JEYB 4JX0A 4G1MA 2VDNB 4M76B 5HDBB 3EFOB 1M10A 1AOXA 1IDOA 1N3YA 4MMYB 1RD4A 4O3TB 1QC5B 4GZ8A 1M2OA 2VDMB 1M2VB 4MMXA 3EGXB 2ADFA 3VI4B 1BHO1 4UM9D 1MHPA 4NEHB 1V7PC 3TCXB 4MMZA 1XDGA 4WK4B 2X5NA 3ZE2B 3BQNB 4HQOA 3OL2B 2P28A 3F78A 4UM9B 4XW2A 5KYWA 3AL9A 1AUQA 1LFAA 2B2XA 2VDQB 5HGJA 1JEYA 5E6SB 4HQNA 2M32A 2VDKB 1JLMA 5E6UA 4BJ3A 4C2AA 3EFOA 3HXQA 2QTVA 4MMYA 2XGGA 3EGDB 5E6RA 1QC5A 1OAKA 3GXBA 1AO3A 3T3PB 1CK4A 3TW0A 1OLZA 3EOBI 1YVPA 2VDRB 2XWBF 2NUPB 3ZDZB 1MQ9A 3K71B 4F1JA 3EG9A 1MQAA 4CNBA 4WJKB 4O3UB 4HQFA 1FNSA 1SQ0A 5HJ2A 3N2NA 2ICAA 4C29A 5KYNA 3ZE0B 3BN3A 4O02B 3K72B 1U8CA 2VC2B 3ZE1B 1ZONA 3EGDA 4HQLA 3T3MB 1YVRA 4Z7OB 4UM8B 1N9ZA 1JEQA 1DGQA 1L5GB 2NUTB 5KYXB 1RTKA 1Q0PA 3AL8B 2NUPA 4JDUA 3K71A 3V4PB 4F1KA 2P26A 1TYEB 3HXOA 3ZDXB 3OKYB 2IUEA 3HI6A 1MQ8B 1PT6A 1T6BY 1M2VA 3EGXA 3ZQKA 1SHYB 4O02A 3K72A 3PPXA 1PD1A 3VI3B 1MF7A 2WINI 1M1XB 3IJEB 3NIDB 3OL2A 4WK2B 1XDDA 4G1EB 2ODPA 3NIFB 5KYYB 1XUOA 2NUTA 5KYXA 4Z7QB 1PCXA 3AL8A 4G1MB 1IJKA 1M1UA 5E6SA 3PPWA 2O7NA 4IGIA 1QCYA 3IBSA 2VDLB 3K6SB 1CQPA 1JV2B 3EOAI 1BHQ1 3EH2A 3EH1A 4IHKA 3FCSB 4FX5A 1NA5A 1RS0A 2VDPB 5ES4B 1MJNA 1SHTX 1T0PA 1IDN1 1U0OC 2WW8A 4A0QA 5KYYA 3E2MA 1DZIA 3OKWA 5E6UB 4PN7A 4Z7NB 3PPYA 1ATZA 3F74A 4NENB 3AFCA 5E6RB 3V4VB 3K6SA 3TVYA 2ODQA 1UEXC 1JV2A 1PD0A 2VDOB 1IJBA 1L5GA 4CN8A 2XWJI
chains in the Genus database with same CATH superfamily
3LY5A 9LDBA 4JA2A 3IQHX 2A6KA 4ZREA 5ILQA 3A5VA 3D3JA 2OCPA 2V58A 5K6AC 1P5RA 4N3AA 4YHOL 2G28A 4XZUA 4LLMA 4RX4A 3U6XS 3DV0A 2QJWA 1GQSA 1T2EA 1NGWA 2XB4A 4NBXB 4JJFA 2OSBA 3KJ6L 4Y16A 4CKWB 2P9EA 2WJWA 1ZESA 1VA9A 4GG8B 3U4KA 1ETJA 2VNJA 4EABA 5LWHA 2AIRA 4QX6A 4W93A 2ZXEA 4MKRA 3KJQA 1C8KA 4ZMOA 1R50A 3OLCX 2YXMA 3CFBA 5LP6C 1QQBA 5JZ7C 3KWLA 2XWXA 4LI3X 3RFZC 1AXGA 1I75A 3LJ3A 1SK8A 1M2WA 1M3IA 2OZ4L 1QX1A 3Q7SA 2NDGA 3C4JA 3NUGA 4HQFA 4Q6YA 5CX4A 3L4TA 1BJ1H 4MDJB 3I23A 5DZLA 3FJYA 5IB2A 3NFPB 2WKQA 3WCYA 3ZRCC 3WEXA 3GSVA 2CF6A 3C1AA 3A11A 3V4PB 4XN2A 1D3AA 4U0QB 4AITA 4GW3A 5J4LA 1ML0A 4TF4A 2XRFA 1HEIA 2ZVPX 4N5UA 3SKUD 2WWOA 3QNYB 3HGTA 2IJGX 3U2IA 4OI4A 4BVKA 5E4OA 3GZNB 4NFCA 1H4QA 2G1KA 1Q9WB 3EPPA 2JJVA 2PKQP 2Y6VA 2X6AA 4AYGA 4YDQA 5J12B 4NYLA 3L3KA 3QUYA 1VECA 3FKSA 2R97A 3BKML 4UPDA 3MC0A 2FNWA 3S8MA 1WBXA 2VWEE 2OK0L 3KSBC 4XB6B 3QG7H 4C0KA 2YHIA 3OZCA 1MFVA 1N8OE 2MHCA 5EOTA 1TO6A 2Q4OA 1QP8A 5HGDB 2O2CA 1ZOXA 1R33A 5C09A 4ZEOA 3FUEA 5HI5C 2NX5A 2WT9A 4YDVA 4WDIA 3FU8A 5CH5A 4C4TA 1ISIA 3R7LA 2KLSA 1Z2OX 3VGPA 2Z8WC 4EAEA 1G64A 4KNYA 4R0LA 2IEDA 4C4YA 3NGLA 3WMFA 4XP4L 1XGUB 3KJ4C 2FGZA 1F8FA 2E7CA 4DQDA 1J5DA 4IOFD 1BS1A 1YEJH 1SM4A 3IUSA 3JV6B 4B44A 4AMVA 4KTTE 4B6OA 4H35A 4Q3AA 2Z91B 3KG5A 2CO1A 1OGAA 1GC1C 3R2JA 2LGJA 5C0AD 1VL5A 4II3A 4PD4J 1IIKA 3AUAA 2J41A 4ARSA 2N0SA 1FYTE 5AM0A 5LLTA 4I18B 2QLLA 4BH7A 2MEJB 4AQ1A 2G1AA 3W2EA 5CXXA 4M60A 4U33A 4OIAA 3B1WA 2ZOKA 2ECQA 2P0EA 1NFDA 3PPWA 4JKWA 3B2PA 2GIYA 1MHHA 1CC3A 1L0QA 4WK6A 5L8KB 5E1AB 1DRJA 3BDIA 5T3ZL 4XMKL 3P9KA 5G02A 4PBSA 4X7PA 1LLUA 5AIAA 2ZSIA 4D9IA 1TJIL 2OMXB 3WYNA 2ZI6A 4REOA 3GGJA 5DO2D 1ZA3B 3DJTA 3PXGA 1W0KA 1SOXA 4C4KO 2XGSA 5CJ2A 2RQEA 3LD8B 1SU8A 2JDID 4FQ7A 2C1EA 2W4MA 3MRTA 2VF2A 1SC3A 2KE5A 1L0YA 1LK3L 1YA8A 2VWQA 3JWOH 1TW2A 3CLHA 3U9WA 1ZKAA 3KE8A 2X3UA 2PWZA 4BECA 4FB4A 2CCKA 3AREC 4P0DA 2JCYA 3HJFA 1NPTO 3M81A 4KITB 3CSSA 3CO0S 3BWUC 4PICA 1O58A 5FYJE 1KXQA 5T1LD 4G8GB 3NH6A 4HBQA 5HI3D 2DM2A 2ZXGA 3M7FB 1XU9A 3L5JA 4CT0A 3ZCSA 2ABWA 4JVSB 4YRGA 4JLMA 2R0WL 4UHBA 1W34A 2C3VA 3BKJH 3BH6A 5EIFA 4GUOA 2XMSA 1PV2A 2AOUB 1UD3A 2FSDA 4GRAA 1WDMA 2ITCB 1F4XH 3OD1A 2ID5A 4N47A 4ODUB 4BFRA 5IVXA 3ER9A 4YMSA 1IVLA 4YHLL 1PY4A 2E0IA 1AQDB 1TLFA 2CDFB 4EMBA 2AS5M 1Q44A 4QAQA 3WYFA 3K3PA 4F7PA 5B38B 5MP6L 1T3ZA 5F33A 3QNFA 3M33A 1FLVA 3GPDG 4TTAA 4C7BA 1H2EA 3II1A 3STZB 4XUCA 2RAUA 3KD4A 3VM7A 2VF7A 1JXGA 3E58A 3KBOA 4R40A 3LFUA 2QD2A 5IF3A 3UJTL 2FWRA 1CJMA 3DDZX 2YIVX 5GGXA 3V4PH 1CS4C 4UQEA 2WCGA 2XVXA 4B9AA 1IY0A 2AUNA 2PIAA 4GLFA 3AM8A 2WI8A 1YMME 5DW0A 1JXKA 4AJVA 2QG6A 5J3JA 3P2YA 3W2DL 1M7HA 4W4OA 1T43A 1T1GA 1G60A 1D2MA 4GZ5A 4LY6A 4A10A 2XDAA 4AL8H 1E7MA 2F3UA 4P4KA 4TULL 5LDSA 2GTHA 4B48A 3M9LA 2J3QA 1B90A 3BP7A 2PUBA 4G2NA 1R5VA 5IKCB 3IKJA 3CF2A 5E9AA 1RU9H 3NBXX 5K0CA 1KQPA 2AXNA 3PREA 2GJSA 2ZIZA 2MQ3A 3CZPA 3INOA 3DMMC 3SR4A 1H2BA 2GF2A 3M6VA 1T0HB 1T36A 4XN1A 5CM1A 1RIHH 4F57L 1XF2B 3TIEB 1LK0A 2YWEA 2JVIA 4XPTL 4G8FA 1EQ2A 4LHWA 4NFHA 4BP3A 4MMXC 1A9BB 2JVUA 3U31A 2XOTA 3GI9L 5FB3A 3SCZA 4X6DE 2RIKA 4I1VA 3AQZA 4UD2A 4MCZB 3HZ3A 3OPZH 1XD1A 1ULVA 4JT4A 4D6YA 5B4MD 2HOQA 3NWOA 5LQRA 5JA9A 1J86A 2ED6A 1JS1X 4UCQA 2NY1C 3VG0H 3RAJL 1C3OB 4BV9A 1P1ZA 2ZKHL 4FYMA 5CNJA 5L45A 2X4UA 3OTTA 3SEAA 4LECA 3NEJA 3V8OA 4MXVE 4IMPA 1LWJA 4RK5A 3FAZA 4PJGA 1RRGA 1U8CB 2PJRA 3FA2A 4JS0A 2JIRA 4CNIB 1VM6A 2CLVA 1B0GB 5C31A 2WYOA 1N2JA 3ANSA 4UMDA 1Y34E 5LQNA 5F0MB 2ZAIA 4G3YL 2DH5A 1HOEA 4W1SA 3EO0A 3W8FA 1CIJA 3DMYA 1LLAA 4GMTH 1J0YA 5KW9H 3EEIA 4HQQL 4LHJB 4L8DB 3M49A 3DO8A 3H8WA 2C3YA 1SUDA 5H70A 2ZYVX 2MWCA 4BMDA 4ZVMA 3B9PA 4LSVH 5AQEA 3ZDZB 1LLFA 4COOA 1G55A 2XE7A 4IOIB 3ADKA 4JRLA 3MN8A 1OTSC 3F0TA 1LF0A 3QELA 4Z7OB 1VIVA 2R96A 3WFBH 5C0JA 2GFIA 4A36A 3UTQA 3I09A 1A7OL 5DEFB 2VXUH 5JPMA 5FA3A 2J6IA 3L4SO 1US8A 1QZUA 2VMFA 1S02A 1IL1A 1HPLA 4XNMB 2XKJE 1SH7A 1EFCA 3DHWC 1Y3DE 4RBPH 4K3HA 4HO1X 3X1KA 2OCAA 5AW9A 2BJWA 1LTQA 2YJTD 4PG9B 1BEXA 4JC4A 3QOWA 2ZD0A 2J5XA 2B83A 1PFKA 4KO3S 1DQTA 1JGVL 1H15B 3ARBC 4L22A 5I30L 2JB5H 3NIDF 1HQYE 4BEVA 1ASQA 1KEPA 5TJWK 3F7RA 1FN4B 1L7BA 5F35A 2PSHA 1QS0A 1T03L 5ALDA 2EIHA 3HB3B 1X1BA 3NVQA 3FPCA 3HCRA 3M3DA 1OY3B 2E4ZA 3ECSA 3NH7H 4CRWB 2YGVA 4PBTA 1IB0A 2WD8A 4U1IB 1F3JA 1NKGA 1N5AA 1UEIA 1UAGA 4KX7A 4MVJD 4LE0A 2M26A 3AEXA 4TLTA 2BDNL 1LKZA 3NHBA 2E6PA 5CEFA 2WK1A 1OAOC 4UPEA 4LL1A 5I4CA 1I2CA 4GSDL 3NWBA 1NC3A 1RK1B 3RX9A 1CCWA 4D9EA 4Q4HB 1GCFA 2V74B 3K53A 2EG9A 1QRND 4ODSH 2OBNA 4RVBA 3MV7B 5DBOA 2Z6AA 3LX6A 4OFWA 3UGTA 1DP0A 2JH8A 4EO9A 4ZTBA 3HFRA 3BP4A 2TAAA 1YWGO 1IC7H 1D6SA 2XUWA 1WB5A 4JFQB 3A6BL 1AZNA 4J4PC 3AOEC 1PKQB 3AFLA 4YXHL 2DY1A 4EECA 2OK8A 4P2OA 4PI2A 2HF9A 1GZHA 4BVLA 1B8PA 4U8HA 3CX8A 4OI2A 3TLEA 3GLKA 1XEAA 1DIBA 5HSFA 1UZUA 2CZQA 4N2EA 4A7UA 4F2PA 4WJLA 4JC5A 2Y7MA 3WXWH 3VYPA 3FO9B 1VIDA 3PG5A 3SDAD 4FCCA 5JS2A 4DQ0A 1ICEA 1NBIA 1K6EA 3LQFA 1GU0A 3N8GA 1PWXA 1IEWA 4FQXD 3COVA 2PUVA 4NCC2 4H15A 3EBAA 3LZCA 3IJHB 4XH9B 3MFGB 1CY1A 3GHPA 2OGZA 5E5MB 3DX6B 4C7KA 1Y18B 1NRXA 1KGYE 3DHPA 3T2NL 3HU5A 3VM6A 4HCRL 3AP2A 5CINH 3RA7L 3BEWB 1QQAA 4S1QL 3RAEC 3RX7A 1PDOA 1USUA 4JHAH 2FATH 3KZ8A 4JB3A 4IBYA 1N34B 4Z8YA 4MMYA 2R47A 4ODWA 2FYVA 3CU5A 2NO1A 1BIIB 3OJMB 2EJTA 2VHTA 5EA0H 4YO7A 2C7GA 1AGYA 1RQ2A 3IDGA 1IG3A 5SY6A 4QYIB 3ZZNA 4E5PA 5D7BA 3FNKA 5ALLA 4PJBB 3UGXA 1MWAA 5F0JB 4KR7A 1W7AA 1FRZA 3LMJH 4H1LG 1ZMTA 2FWJA 5LU8A 3VXMD 4R4BB 3CX5J 2QVFB 1GL3A 5LQKA 4A8HA 3U13A 4M9CA 3LKOB 4E6EA 2HO4A 3PL6C 1XTJA 5MDHA 1SD1A 1KZYA 1AGXA 5KSAA 2Q0QA 4PNEA 2IYUA 2H7XA 1T1YA 4AMXA 2C96A 1DIOB 1FBTA 5J59A 3E3AA 3R7BA 4H5SA 4M1MA 3GK8H 1FFNB 4NS4A 1GZUA 2GEJA 2GN9A 2HJRA 2RCNA 1YONA 4YDMA 3V4UL 1I5OA 2DM3A 4LGPB 5AUMB 4DILA 1WZKA 4OF0A 4N40A 1ZQ9A 1QAMA 5CCGE 2CB9A 4NC1E 1OVZA 4MNQE 1J33A 4Q7LA 4S24A 3MJ9H 1A8IA 3EIEA 5BN4A 3BKXA 2V54A 3R0XA 2OXHA 4NFYA 2FQFA 2YKLH 1VLHA 3RIKA 1N4AA 4ZUSA 1AQNA 1TF2A 3D18A 4HD8A 1ND6A 1N36B 3RNLA 3OR6A 1UP7A 2WJJA 1SU7A 2X3CA 3ENKA 3Q9LA 4WBNA 3HS3A 1FNDA 2GW5A 2G7ZA 3AUFA 1I4WA 1DQQA 2IAMB 1RJFA 3BZFB 1INDH 5JMRA 1JQ5A 4XVOA 4F86A 4BEBA 5ISZE 5KVDE 3OUTA 3OQIB 3LU1A 2G5GX 3FCXA 3QLTA 1FLRH 5D7LE 3RADC 3C8ZA 3OLVA 4RF4A 2C2WA 5EJ8A 4EZLA 3VR1A 1D7CA 2XMPA 4B96A 5GGYA 4LKXA 1CFTB 3OHMB 1V9CA 4W82A 5CFHA 2VDQH 4HGYA 5G4OA 1P0FA 3EDEA 1V9SA 4XHJC 4NMHA 5F1IA 4S04A 5HHVL 4R6XA 3OE1A 4Y0VA 1QZ1A 2OO3A 3ITDA 2ZXAA 1Y7TA 1ZK2A 3T6WA 1U8ZA 3ULUF 3LUKA 3UMCA 3ZCUA 5DI8B 2R0LH 4HOWA 2VNSA 2FZ4A 2DLFH 1SPBS 4YAGA 3GD5A 3PDUA 1BZ9B 2AFIB 5KDLA 2F55A 3J8F7 2A6JB 3MC1A 3QFSA 4JO2H 2VRWA 5JIHA 3ZE2E 4NT6A 2XE8A 1YLBB 3L4XA 5JUWA 1P74A 1G9EA 4L6AA 1OARH 4D8PB 2WU4A 5FA4A 4IOFC 1WMDA 1FJ1B 4JFFA 4FCTA 4EJ6A 3Q2NA 5D3MB 1W85A 3FZQA 4HT1H 1TXKA 2ZKIA 1E9AA 3BPOC 1JEYB 1OQAA 5HEKA 4YVFA 4LHVA 4KXYA 1C8QA 2OGTA 2L7EA 1X8KA 1DVFC 2P4QA 5FCUH 5ITVA 1QRNE 2YBGA 3SFTA 5C7ZA 1YZHA 3HZYB 5AVZB 1PYDA 4PNZA 2MTPA 4GG1A 2XWBB 1CSEE 2CHNA 1Q7RA 3I45A 1KETA 4CL7A 3E3QC 1HY3A 3T4YA 3MX0A 4U63A 2RG7A 3M4ZA 5EE0A 1CDGA 3GGSA 3NGBB 3CZLA 3I75B 4EITA 2EDYA 3UH8A 4G9EA 1N1MA 4LJLA 2BM0A 1CD5A 5ALUA 2FECI 2WWIA 2UXTA 4ZMAT 4E12A 2NZ9C 4N6OA 2EUZA 1C9SA 3QWHA 5DO2C 4FB5A 3D1LA 4JCCA 1IUKA 4Z4EA 3I9AA 4P4RB 2FYYB 3VXSB 1XCOA 2IC5A 3WLLA 3QWQB 1OGPA 1E77A 3CUTA 4EA6A 5BQ7A 1XSEA 5KAQG 3AX6A 1SJEA 3D5OF 4ABUA 4UHEA 4UTAA 4M6MH 4JB2A 3PEVA 4FOSA 2XCUA 1EP1B 2E9SA 4KVAA 4F9PA 3NA4A 4BQ9A 4DYVA 5K0NA 4UPVA 1UK7A 4NZUH 2NNAA 3RVTD 2VLLA 3OF6D 2OILA 4AUUA 2IXEA 4DIMA 3EXAA 4KGJA 4JPKL 4OXKA 4XUDA 3AG4B 5L2KA 1QI5A 3QHTC 4WGGA 1P7KB 2ZZUT 3NCMA 1YYML 5ENWB 1AQLA 3MHPA 4NBTA 1ODLA 1NZFA 4QHKJ 1KEML 3D12B 4M7ZB 1LD9A 3D4BA 2D0GA 3RYFA 5E0QA 3MLRL 4QNPE 3R3HA 4GKSA 1G1YA 5E2AA 3PAUA 5KSWB 1ZI8A 4BRZA 3AGPA 5E0FA 3TT3L 4DTGL 2B20A 5JHLL 3WV0A 2ORYA 3MSPA 1A4JA 3EVDA 3NETA 2C2YA 3OPMA 5I7WA 3TTSA 3KZMA 5CW1A 3ZDQA 2C9RA 4GS7B 4R3SA 4GW5A 4P8RA 3MOBH 4G97A 4K26A 2J9GA 3VPDA 4O51B 2A0YA 2ED9A 3BZBA 2V5RA 3QUMB 3EJ6A 4HGQA 4LIQH 2JCCF 4L4TB 3T1NA 2E6QA 3B6JA 4HEPG 4OI9A 4AZ3B 3G9TA 1N2SA 3PI6A 3AH8A 4MCJA 1MG0A 1HE7A 3VWJA 4J39A 2VSFA 1HG1A 3EGWA 4JVMA 5IQOA 1QM5A 3NIFB 4P2RD 3QQXA 2H1IA 4R90H 3N40P 4U4AA 5COBA 3U1PA 1ID8A 3FQUB 1O6CA 2G1PA 4OD2B 1VACA 2BN4A 4FEAA 1UDXA 2NZJA 3V4LA 3U1SH 4AQ8A 3QZWB 3ESQA 4PTLA 4ZYZA 1U6IA 4U6HB 8FABB 5C0BD 1XKLA 1GUZA 1CHDA 3I9JA 2JQMA 4YWGH 2WIKA 3DGGB 4QULA 3ZHDA 5GSRA 4IZIA 4TLMB 5EU5B 3C6KA 1NIAA 1OKEA 3N8IA 5AOCA 3PP4L 3RG8A 1CN4A 2BAGA 4X7BA 1NMBH 2BJML 2Q9CA 1MRDL 1SEQH 5E5UB 2ZIEA 5IJAA 3KYDA 2ICEB 1A6TA 4MD0B 4IXTA 4K15A 3QV1A 1Q50A 3EVBA 4BLTA 1AVAA 4WCFA 2O5ZH 4HF5L 2LV4A 2H8PA 2FJHA 1Z07A 4WGVB 3IT3A 3V6LA 5DDIP 4G4JA 3S8GB 3QXUA 5B4MC 3RPKA 4FLMA 2ILTA 4BNDA 2D0HA 5AYVA 3KB2A 2H2DA 3REVB 2YQBA 3GA0A 3O6LL 3UICA 5E1IA 4KW7A 2OBYA 1BFOB 5JTWA 4CTNA 1DQLL 3CZFB 4JQIH 4LDOB 5K05A 4JL6A 1G21B 1HDMB 3KLAA 2O07A 4KQGA 3KTDA 4YJ3F 3VR6D 2AVFA 1I8LA 4S0HA 4UHCA 1NVXQ 3VOAA 1XLVA 2Z5VA 4N26A 2PWBA 4X0KB 1PJCA 3I9MA 3IUYA 2BGTA 3RVSA 4KMMA 3EH2A 5JARA 5ADPL 3L6CA 4GBXC 3GBEA 3KHSA 4M1QA 1NGSA 3ANMA 5TQVA 1YY8B 4C4BA 2W6QA 1YVLA 3B9RA 2D9QB 1WGVA 4JZKA 3ZHRA 4YUWA 3L7EA 4C83A 1UANA 3U7WH 4N5MA 3LZ6A 4RMRA 3AUWB 3AU1B 4Q03A 5GRVK 3DB2A 3KPQB 1AMUA 1JR4A 3Q9NA 3FMGA 5EU7C 4YLYA 4YXKL 1XLWA 4Q02A 4NFSA 5BSTA 3HTXA 1SRQA 2OE2A 1QHQA 3QYAA 4I1OA 1Y33E 3A06A 4AMBA 4AUJA 1OFUX 4GQ9L 4IKNA 1RZVA 1STOA 5SV2A 3SQBA 2Q76B 2GLTA 3CTPA 3V2IA 2FPGA 2RAPA 5CLLA 1FDIA 1NYLA 3D25B 5EORH 2X1VA 2OCIA 3CRVA 1U6JA 2R51A 4B82A 3W9BA 3N85L 2C1OB 1QSFB 2JJ8A 3M8KA 5BYKA 3C16C 1RZ7H 3ECCA 2VR8A 2RA1A 2M83A 4S2UA 1TQ2A 2GUOA 4HXAL 3TQOA 4URVR 3K0CC 1MLDA 1OTTD 3NHLA 4X24A 2F7OA 1TA9A 1SVKA 1VI5A 1UZMA 4DIOA 4E5UA 2VJLA 2GZDA 2PMZA 1JHTB 4NYIR 4N2AA 3I34X 4URHA 3WGKA 4AU1A 1XMXA 2DYRB 1DJPA 4LCUB 1BWSA 2WTXA 4Z7QB 4KSYA 2XWZA 5SYMA 2R7LA 1CDOA 4LWQA 4IQ0A 2F54B 2PBRA 4OT1L 2I87A 2XSZD 4OYHA 4LV6A 1NFFA 4JQOA 1TUPA 2ZP1A 3WIFA 3CX7A 4G71B 3INUH 4TMFA 4P3YA 2CHQA 1YOBA 3AJDA 1KG0B 1ZUNA 3LPPA 5MGBA 4NAVA 3M6FA 1Q20A 3RM3A 3QBJA 3ZXIA 3H3XA 3COOA 4PG5A 2CMRH 2AV1A 2FHCA 4Y5VC 1E9DA 3KX2A 2QQEA 4WKOA 1MAMH 4FQHB 5F1SA 1OXUA 1GS7A 1XSJA 1SVLA 2BPOA 3HZRA 5THKA 4C0WA 1XIWD 1A69A 4U2GA 3QFDB 4I1PA 4P2RE 5DMKB 3GDOA 2CGEA 4M88A 2JJ2A 1ZUD1 4O2LA 4UDOA 3JQFA 1AQ8A 1ONQA 2XDHA 4TYPA 5TQ0B 1R5OA 5BV1A 1T9CA 3TBVB 3L4ZA 4J3SA 3OKOB 1F1BA 4DNFA 4OHWA 3CFCH 3R41A 5JXGA 1OQXA 3QPXL 2X5KO 3SYMA 2HPHA 2Q6KA 1VXOA 4JHXA 5I71C 3UFXA 5JXEC 4EF4A 1OWLA 3B5JA 4G11A 3KQMA 4W9HC 4TUYF 3OCZA 3OG4B 1MF7A 3FMVA 1IHOA 5C0BE 1S78C 4OY9A 1IX2A 1FORH 5D2LA 5DRNA 4F2MA 2WQ7A 4OKIA 1AD9A 4UZEA 3EUUA 1OC2A 3C8MA 4YAEA 1PLGL 3C87A 4EUPG 5BOZG 3FLMA 4KAQH 3KZXA 1G7LB 4BIIA 3E2MA 5KVGL 1WXWA 2CD0A 2ODIA 5CR1A 1Q22A 4XCCH 2C03A 2BS9A 5D5MA 2QQKH 2AFNA 1CNMA 2HK9A 1EFKA 4PM1A 2PMKA 2C9YA 3ZV5A 3AB7A 5I19L 5DLQC 2VJNA 2FEXA 2GYSA 4IH9A 1ULSA 2ARJB 3KVDD 5KYUA 2ZCHL 3C3PA 5D7JB 1W0WA 4BNYA 2W2MA 5KAPA 4RDQG 3O9WD 1J5CA 4KJWC 3IO5A 2I4IA 4BMXA 1GS8A 5L4MA 1ZKDA 1VJCA 3OKEA 3FSGD 2IA5A 3KYMA 3DIVA 2EXTA 2QAGB 1Z6JT 2C9UA 3P3YA 4QTUB 5LYJA 2BW5A 1EK2A 4OD1H 4CKXA 2PUHA 2BC4B 2BEWB 2HWYA 2BNRB 2EG5A 1IQDA 1RAFA 3LUJA 2YYAA 4A2HA 2LZ0A 3IIEA 1ZVMA 4PEEA 1UKSA 2H5LA 4LOIA 1ZSHA 3MINA 1E2VA 5I76A 5FAAA 2Y71A 1F42A 4A6XA 4MZRA 5I8ZA 2QD3A 3UCRA 2UZ1B 5EP1A 3ZI0A 5I24A 5IUJC 4PU2A 1VSTA 1CZ8L 3F7NA 2A83B 2EP8A 3WTCA 2ZAMA 4HNSA 4EDFA 2DI7A 3H4HA 9LDTA 4R5HA 2D1YA 1UBOS 2VT0A 4Y2GA 5CF3A 2B0CA 4DB4A 4RAOA 5FXCH 3K9LA 3OSKA 3HJGA 4NQDD 2VP0A 4NO2B 1CG9A 3TO2A 4KO2S 2PVPA 2WWWA 3QYMA 4NI3A 1WCIB 2N7SA 5KN5B 4JHWH 3QKSA 3QVSA 3ZC3A 3I32A 2EYTA 3EOBA 3SJCA 4HNGA 3W8NA 3O75A 1DBBL 2VDLL 1IL0A 4H13C 4YYEA 3TFOA 1FVXA 1T5XB 4G37A 3D3WB 3VAAA 4GVPA 5HRAA 5B1DA 1P1IA 1S9YA 2JIQA 4D57A 1ZM4A 2X3FA 3UH0A 3ER8A 1JP7A 5AVQA 1SJHB 2HXAA 2AZUA 3PQDA 2BGNA 5DBIA 3R4DA 4YROA 4NAQA 4C22A 3QIWC 1U8JA 2F1EA 4PJHE 3FYEB 1JJVA 2P6OA 5JAIA 1IARB 3H55A 1NMQA 1Z2AA 2RGBA 4HAKA 3R7WA 1WFMA 4KZDH 2VMCA 1KEEA 4YNBA 2GZSA 4QWMA 5D84A 4OF6A 5A4JA 3EDQA 4L75A 3QE3A 1SCUB 3QPQD 4A8JC 3NKVA 4ZV7A 4XCFL 2CXSA 4W9DC 2VO5A 5IVZB 4XVUD 3QPVA 5HBGA 2JASA 4JO1L 3DHJA 3BA1A 5E08L 4D4MA 5EOCH 3UJCA 4IQ8A 1JZJA 2QN1A 3A4AA 3IDAA 3ZTJH 1JJFA 2BSQA 1DAPA 1R6UA 2ADIB 4HH9A 1HU8A 1YB7A 1KLFB 1L1EA 1M6EX 3IHLA 3NR2A 4MV0A 1CD1B 5DLPA 3D52A 4FQCL 5F5LA 2W9EL 4NUQA 3Q3GE 3U0WH 3BIXA 3FH7A 3ELAT 4PPQA 3JAKA 3ZE0E 1K4YA 4DM4A 3LM8A 5HIAA 2RB8A 4D02A 5AW4B 4EI5D 3QM1A 3P9XA 3BAKA 3MUUA 1YNLL 4HS6B 3D33A 4HCRA 4R1SA 4BNWA 1CXZA 1UBJS 1Q8MA 1YR7A 5ALOA 3OKDB 4IIQC 3KXPA 4R51A 4W63A 3ROPA 1DVYA 2B2XH 2HT4D 1T2FA 3MRCA 3HB1A 3PFFA 3OFJA 1P4RA 4KH0A 5DHVH 2R1XB 5HD8C 4CDGC 3J27A 4OAWA 4JDZB 4KK8C 4C8XA 3OU6A 2W65B 1NJ8A 3SYPA 4U1HB 4A39A 3RVTC 1K7YA 3EGVA 1XRNA 2AQQA 2AI3A 5A3ID 3LSYA 1XD2B 3DBHB 4GXVH 1GKYA 3FPAA 4LXYA 3UJJL 4HXGA 3GUFA 2FPLA 1G7PA 1YVUA 4MAZA 3MODL 1HE8A 3VFRB 5DB4A 4PMEA 4WCVA 1HIMH 4FX5A 3WXVL 1LQ2A 1U7OA 3IQIX 5HJBA 4CIAA 4MLDA 4N28A 1IAIH 3P0IA 3UG6A 1QIJA 2AA3A 1BZQK 5IP5A 3ZK8A 4MJJA 1RXIA 1IQWH 4AG4H 2DIEA 4AN1A 1JRHH 1G7CA 4YNYB 2OMYB 4GSKA 1ISFA 3BGAA 2RI0A 2QRNA 3TNJA 3QKWA 2JI9A 4UASA 1JE0A 2Q9BA 1CRPA 3QQPA 5IFAL 1DFGA 3AJ9A 2NVUA 2F19H 2AEPH 521PA 3BIAX 2A59A 2F58H 1CDHA 3QZLA 2CLCX 2CMGA 1RYNA 1GEEA 4CWAA 3GRAA 2NACA 2HBQA 3WS7A 4XPFL 3BXHA 2X8BA 3L4JA 4HW6A 1JWUA 4KXVA 3VOSA 1JBJA 4AEFA 3GLRA 3VU0A 3AWDA 3RAFC 3H2PA 1YNSA 3ARFB 4YQYA 4IDDA 5CDYA 3EQ6A 2CLEB 1V3JA 2A92A 2BI7A 4JFDE 2LT9A 4LMRA 3GCXA 3PQ4A 1TF7A 4L8VA 1IEBA 1MZPA 1Y1UA 4HS8H 1OCEA 1XDSA 1ASPA 4TMKA 3OQHA 3KHOA 2FWOA 2C5FA 1EVKA 3QCUL 4NQDE 2VR3A 3RV4A 2D5IA 2OV2A 4HZLB 2C3MA 3OAUL 1NZDA 5IBTL 1KS2A 3EMDA 2MPAH 1JG7A 3IEMA 3B3GA 5DCYA 1KJVA 1ODAA 2OXCA 1GCOA 2P43B 4TV8F 4A2PA 2JLAA 2XWEA 3ILPA 4YFLI 2JKYA 3M6LA 2FN8A 3EK2A 4UU9B 4UC0A 1ETA1 4M7PA 5AHWA 1SVUA 4LDQA 5ES4B 3CLEL 5CJPA 3IFOB 2ONKA 2XMGA 2O6FA 2O5YL 2QADD 3OY2A 5GTDA 3KPSD 3GMIA 1QR1A 3AY3A 3VR5A 1ZRHA 2A4KA 2I65A 5F9JB 3H7BA 1ND5A 4LCBA 3IBFA 2OW7A 2HGZA 3IEVA 1RC0A 4EVIA 3WEAA 2ZITA 1NMEA 1UXSA 5ICYB 1I7UA 4I6GA 3Q3IA 1NNI1 3LEXB 2ZT5A 1T20A 4ER7A 4ZOCA 4JR0A 1ACMA 3QVLA 5F8QC 3C6SA 2BMFA 2BVPA 1VHJA 5D2NB 4XEUA 2A0XA 4FJ1A 3GSRA 4PIMA 3CURA 3RDTD 2GMWA 2W6ID 4EQ6A 3LGAA 4C2UA 3MJRA 5FGCE 4CIVA 1LSOA 3ZL4L 1JUFB 4DSUA 1TPYA 1X5JA 1J2JA 4B83A 1MC4A 5F1KA 2O6HA 1G1OA 3UMTA 1E6JH 4DPLA 4W9EC 2XBLA 3D6FA 3GLSA 4QOKB 2KUTA 4DPRA 2DPHA 4WKPA 4WZBB 1P4BL 5SWSA 1QNZH 4ISCA 4BS9A 4NWUL 2VYRE 3JQ9C 5C08D 1SZDA 4PIVA 2E86A 2HB0A 2BHFA 3MACL 3DOJA 5FGBA 5T5NF 2GM9A 3M1IA 2DRIA 4YHNB 4BO1A 2OMZB 4PGMA 3WY9A 4L4YA 4RQQB 3GMNB 4GPD1 4MB3A 3OIVA 4TQ8A 1OX6A 4V1DA 3D05A 3OT4A 4XCQA 1DLJA 4O2AB 4C4SA 4E3WA 1S7UB 2QQNH 4R96B 1MG5A 4O6VA 1NBMD 4IYJA 2OHFA 3UWSA 2ETVA 2R56H 1NW5A 4K3JB 4BWYA 2PIDA 3L0CA 2VAWA 4AWBA 3SDYH 1HEHC 5AB0A 5CDSA 4UIMA 3KCPA 5C0CB 3KXFD 3HBAA 2ZWSA 2FFRA 2PW1B 5I28A 1D7OA 1ADBA 3AVTA 1FUUA 4Q8BA 5JHLA 4X97A 2W6CX 5CK4A 1OCZB 3SDXB 1Y7IA 4FTWA 2GX6A 2ZF8A 2YJ6A 2YBDA 1WPRA 1JMYA 3PQFA 3OAWA 3H11B 1OZAA 4GGPA 3G2PA 5C6WH 2HWZL 1T4CB 1QK4A 4XMUA 2NT3A 3G5UA 4UWQB 2X23A 4EUKA 2OD7A 1C5CL 1LX7A 3PHBE 2QVMA 1JWAB 3MERA 2VK8A 4LVOA 3L7FA 4TNWF 5IX8A 3MUGA 4QXMA 4NF2A 2YCLA 3VGJA 4GKVA 3RUIA 4P46A 1XUOA 2XBMA 1MJFA 1GRQA 5HK8A 1SD2A 4MVJG 4MYHA 1RZIB 4KQJA 2Z65C 2ZBUA 4O2BF 1JT9A 5JDCC 1I3RA 2MH4A 5HF8A 3ILXA 4MW9A 3U7RA 1VLQA 4LJ8A 1EWRA 4D42A 4DV2B 1RR6A 1AH1A 2DP4E 4ZNCD 4TTJA 1FNMA 1KPUA 5GV7A 5CJJA 4KNUA 3A04A 3MWLA 1XIWC 3KQHA 4J7UA 3DMNA 1KN4H 4LGCA 4N2MA 3GO1L 3N6YA 1U98A 5F96H 1JDDA 1ILUA 4YBRA 3IR7A 4ZVRA 1O95A 3IPBA 3QXCA 2DQSA 3RYCB 4E9XA 3T5PA 2MYUA 4OXXA 2FR8A 5DBEX 2ZX6A 1QFWH 2GN8A 2IX9A 2VRCD 4DETA 3IDQA 2W6JA 4M0EA 3LC0A 1GVHA 1J0KA 4QFCA 3KKPA 4AIRA 3AVQA 2AN9A 1J20A 3LS4L 4XAWH 1DT5A 4AULA 4MP3A 4TPRH 3S3SA 4DV6B 4NJMB 5F5NA 2YIDA 1SLWA 4N0CD 1BHGA 1E0DA 4GKAA 5I7VA 2NZWA 1EJOH 3AIIA 5C8JB 2GAOA 2GK6A 3VO0A 4AYID 1ZNYA 2K7PA 1BBJB 3IGKA 5KANI 4GQAA 3FCOA 1J1XH 4OIMA 4TV8A 1QYGH 1NBHA 5FQNA 3S81A 4EEKA 4OFYD 2CKNA 1TYAE 3WDMA 2ASVA 2QBYA 4F5ZA 4OQTL 3KPSE 3PGA1 1JRLA 4C88A 4XJTA 3H8VA 1XEFA 3SDZA 2G9HA 1DG9A 3RKRA 2IWFA 3PABB 2OLKA 5ICZA 4ADIA 3MRPA 4ZT6A 3HHPA 1XZCA 3NBYC 5BCAA 1QLFA 4K9NA 3L82B 4AQZA 5BS0D 3MBED 4D0RA 2QGBA 3KJNA 1RMFH 4AY3A 4BX3A 3HS8A 3HP1A 2H2PC 4PRHA 2OCJA 1MRZA 4L74A 3UX9B 1K5NA 1DAOA 3V8QA 4HNAA 1MJHA 1X1DA 3WBBA 4RGOL 4YRSA 2GN6A 2CD7A 4CDMA 1KGSA 4MW6A 6TAAA 3W05A 1CR9H 2QT6A 1T2CA 4L4VA 4P5MB 5LYYA 2XA8L 3GXMA 1M2HA 1Z4IA 2XQGA 3GPEA 2WQUA 1NDHA 2CUZA 8MHTA 2NQ8A 4W8OA 3CF6R 3OX4A 4L37B 5E9QA 1T9AA 5I1HH 2ORVA 5D87A 1Z0IA 4DCUA 5GXBB 1V05A 2YMXH 1DVXA 2H85A 1Y1TA 4BFLA 4H0NA 2AEOA 5FI3A 3FT9A 3ZYOA 1X7DA 4N0FB 5DIFA 421PA 5CZRA 1SD5A 4POOA 3N2EA 1E6KA 1E30A 1RJLA 3BQUB 1JD9A 1F12A 3JQRA 4DQLA 1EUDA 4UDTA 1UDBA 2HRGA 4XVTL 2VXBA 3ITKA 5F78A 4R3UC 2NXNA 2ZQZA 5FJIA 4V0OA 3EYOB 1VLLA 5B1SA 4ILDA 3SD2A 3PQ3A 4FINA 1JZDC 3VHXB 3GGDA 3T94A 3NP3A 4M8NE 5CDHA 2V3FA 1J05A 4NM4L 5BRZB 2NSHA 1IU1A 2WCPA 2XNAB 3VC3A 2X9XA 4MI3A 4DRXA 1T5WB 3NTQA 2F43A 3N43F 3VJRA 2QVKA 5FHQA 2FI1A 1ETHA 3A4DA 5TGTA 2ZIDA 3DE4X 1DZBA 1PFQA 2YQ2A 2YAFA 5HVHB 1UOVA 1CW2B 1G20B 4WKNA 2R2BB 2WP3O 4UOEA 4RGNB 3KHKA 1MRFL 2A9NL 5AKJA 4TTDC 2JTYA 2E9IA 3UYPA 2ZVJA 2Z08A 4UVIA 3V1MA 5AWNL 1TLTA 2YPLB 5TE6H 1V48A 5F21A 3RHFA 4JRYB 1A6WL 4B7LA 1MJJB 3VNYA 4NO0B 3ISYA 3GMQA 2OC9A 3UCFA 4UTVA 4NPKA 2FO1A 1LY1A 2QPAA 3CVOA 1C7FA 3MUEA 1ERNA 1MIHA 5BV8A 1SHUX 4CSZA 1Z56C 1U8PA 2Z1PA 3L5XH 4R26H 1WC7B 1JHLH 4DUYB 3VI4B 1VB9A 4L48A 5BZZA 1IHDA 1KO8A 2G36A 1XF5A 3V8VA 1SXJB 1WWBX 1CJUC 1T35A 2VOTA 3F7MA 4BIMA 4EH1A 1R5NA 4NWIA 5K3CA 5E6RA 4PRAB 1SUAA 2ITFA 2AG8A 2O06A 2BEKA 4Y19B 5JHAA 15C8L 2OO5A 1JVKA 2YD7A 5JNUA 4RZCB 3O6KL 3A9WA 1QO0D 4NQTA 1XDUA 4Z7VF 2EFEB 3ETTA 5HDBF 3D9AL 2QM0A 1J8SA 2DU8A 3REOA 1ZM3A 3K94A 2B69A 1NNLA 3ZLQC 3P9ZA 4X6CF 4W5WA 4O2BA 5BUCA 3QGVA 3REQA 4PPYA 2FSSA 1DZ3A 3I84A 3JQAB 5EWJB 5HCIA 4DC0A 5D6CB 3MT9A 4KV5E 2YZGA 3W0LB 2H4YA 5JO0A 4JQZA 2P9YA 3M6DA 2B5VA 3BMNB 3GJ5A 4ZT5A 5K39A 4YZFF 2ZTUA 1Y7VA 2EVHA 1BHQ1 1V27A 2EILB 3D4ZA 2AK2A 1IEVA 3MRBA 4WI5A 3U30C 1K86A 2ZM6B 1Q1JL 1KCSL 1XD0A 2WYWA 3P1VA 2JGNA 5FUOH 3MTIA 1GZPB 1WEJH 4X6BA 1P7QB 1G8SA 3H1BA 2YUVA 4PS4L 1P4LA 2Q5JA 5C4IA 1X7ZA 4E6PA 3W3AD 5F77A 5IZ4A 2QMKA 3WE7A 2CO6B 4ZJUA 1A3LL 3GNQA 4M4RA 4ZMVA 1ZLUK 2YXDA 3CVUA 3NX4A 3VXUA 3O6FA 2Q2VA 3KKQA 4JJKA 4UJ5A 3F6RA 1B7GO 3FUCA 3ENZA 2I2BA 3QUXA 3P45A 4ZDHA 1OAKL 2AJZB 5A3IC 1JPST 5ERYA 5TF1L 5CT8A 5LAXB 4YSTA 5H81A 1LUAA 4AO7A 5ICSA 2BWQA 3K0EA 4RFSB 1ZGLA 1HHIB 1BW9A 3PFHA 3WLKX 1JLSA 4DMKA 2YWZA 4JB0A 1CYXA 1NVTA 4E7PA 1QACA 5BSKA 5EP2A 5BZWB 2EYRA 2DQUL 4GLBA 3E35A 5FHRA 2Y3IA 3WKCA 1U0BB 3BAFA 1TTTA 1VLMA 5CIQA 1ZJYA 4YDKH 2DZDA 2ODBA 3ODPA 3VI3B 3A4IA 3SEZA 1BCRA 5LQJA 1NGQH 4JM2F 4Q24A 1DSFH 5E4EC 1RJYB 4JDEB 4F60A 4NICA 2ATPA 2MINA 2IQIA 4HWNA 1XSKA 3QDJB 7MDHA 1FSFA 2R11A 4ARBA 4X8OA 1S7SA 1BFSA 1ZO8A 3ME0B 2NQTA 4GIAA 4NYIQ 3DXAD 3FOLA 1OAQL 4GRWH 3SZRA 1T0BA 1MX5A 5DLYA 2D0OB 2BHLA 4GT1A 1GR7A 2Y2VA 4PIPA 1JR6A 4EPTA 4ELKA 1TSHA 1HVXA 4EBBA 1THZA 3IUJA 1FXWF 1U2RA 2HQ1A 4XPIA 3ME5A 2VLKE 1P0CA 3ACBA 4PJCA 3VO8A 2O7SA 3F62A 5CVVA 4FKEA 2WHPA 4NZMA 5G4LA 1YEGL 5IQNA 1ZIOA 1AV7A 4HSAC 4AZ0B 3MV01 3QV2A 4QYOA 1FYVA 2YNMD 4ODHL 2AI2A 4UEJA 2BTEA 2GCPA 1NXTA 2WC1A 1SKBA 1QGDA 1Z62A 4X4XA 4HV8B 1IK6A 1ZLDA 3ECWA 4PJXF 5EPMA 1XEXA 1TJ5A 1II8A 4J3WA 1P9OA 4L2LA 2G25A 4OGQC 2O1EA 4JFAA 2D73A 4MA3A 4GAEA 3VFSA 2XCLA 1GGTA 3PWTA 4QWWA 3CN9A 2JFYA 1UADA 3HCAA 4ABTA 1L5FA 3SYCA 1E42A 2P48B 4MGZR 1KJIA 1TVBB 2QADC 1A02N 5JQHC 3HB0A 1NWPA 4EUEA 3FWKA 5F9WC 4OB6A 3T35A 4JI7B 1J88A 1NEZA 4ZT1A 1UKZA 1U1CA 1MABB 1JQKA 3BGDA 4Z4CA 3HLKA 1N8TA 3NANA 4R31A 5HKKD 4QRTA 1L5WA 1JHAA 5C2BL 4LTNA 4U0RB 3GJSA 2EIMB 3LX4A 4A0SA 3I3BA 2ODNA 1R3HB 4WIAA 3MGTB 3ZO9A 3V0FA 1BKSB 1JFHA 3GCWA 3UBTA 5G2NA 3BMCA 1WFUA 1LJLA 1QE0A 1W5BA 1HT6A 3WKYA 1E1KA 4B3TB 4F6RB 3RANA 4LPKA 1MFDH 1E4OA 3SXPA 2HJLB 2DKFA 4KMSA 1HZZC 2EKZA 3ST7A 4XFJA 3V5HB 3IR5A 4Y1AD 5GV8A 1TQCC 1VAHA 3GGCA 1I5RA 4NP6A 1L7RA 1LK7A 1WNFA 2B61A 1S0UA 2ZJOA 1Z5WA 3JALA 1H8NA 5BO0D 4U1JB 3LVEA 3BWCA 3UC0H 3UUFA 1NBZB 1HHGA 1QLEH 1AKVA 5ALGA 3I6KA 4HIEA 4MYUA 1K8DB 1SXHA 2BELA 1HFEL 4KDTA 4TLLB 1ZW1A 3VHQA 2SCUB 4QBHA 3IP6A 4RA6A 3EIOA 1LSSA 2GBAA 3EFFB 1CT9A 3FB8A 3BHBA 1OTSD 4MDFA 3FVVA 5G4KA 4DIKA 3A28A 3DX7B 4WV1B 4RNRA 3NBZC 3NCBB 2AW3A 1LE5A 1MH1A 3CX2A 4IRZH 1W1UA 2NU7B 4QRUA 4WDRA 2XTNA 3F6IA 1Z0AA 5F6IB 4CMJA 3CHYA 1C1EH 2COEA 2FD6H 4MVBD 1SQFA 1MORA 3V4OA 5C7OO 2LTAA 5A02A 3VUEA 1G8PA 4FHCA 1GZ6A 4DQOH 4X0NA 4HB0A 2E37A 2Y07L 1TETH 4I1UA 5IPFA 3V8EA 2JIMA 2REXB 2WM9B 3KYIB 2D7NA 4QQFA 1ELOA 3ESPA 1IU9A 1PZFA 4QOHA 1B2RA 2VRKA 1XMEB 1IBYA 3ARBD 4JBNA 4RGYA 5GGVL 4BOYA 1Z0UA 4BY9E 4D1YA 3D0OA 1BVLA 3UDWC 2CLIB 4HKJB 2X4DA 5GS0L 5AT1A 2XFGB 5J06A 1M2OA 4UMEA 5ADHA 1YRHA 4F4JA 2QGDA 1O9GA 4ATTA 3NZEA 1OLXB 1WWKA 3V0EA 4YT8A 4BJ3A 4NCHA 3M9XA 4KTEL 2X88A 3O1LA 3FUUA 3IULA 5ESAA 4KODA 4MA7H 2B37A 2QVLA 2OMTB 4X5XA 2YXVA 1P73A 2B8EA 1W88A 4ALIA 4AF8A 4Y4HA 5TD4A 2B1QA 4X64B 2CVZA 3I2YX 3WB9A 3KUUA 3B1TA 1FV1B 5REQA 5E2BA 2MR5A 4Z0BH 3DXAE 3QUAA 3OC8A 4OM0H 1Q77A 1PU0A 5HYSA 3H5AA 1RC1A 2Q9OA 4QYAA 4F7MB 4NZJA 1F3RB 1QRUA 4A7QA 4M54A 1V3UA 4BQCA 2WWKT 3UTZA 4XOUA 4U05A 4J4PD 4RF5A 5LBVA 4HXEB 5FUQA 4HA1A 1UMCB 5IJVA 1SJ9A 2Q9AA 2QTWB 1K5PA 4LF3B 1SQ5A 3VWKD 3AFCA 1V5EA 4I4TF 2XY1A 1XX9C 3KYKH 4UILH 4BZ2H 4HZGA 2WXMA 1EYZA 4ZD6A 5I6XB 2QUZA 1JFTA 4IVPA 3U2QA 2OD9A 1Q0LA 4A03A 4ZK2A 3L7LA 2W0LA 1PR1A 4PJXA 1KYWA 3JQPA 2JJSA 3HK2A 3A4TA 4LEEA 1GT91 1RT9A 3TBTA 3DP7A 1UWVA 5IYZA 1J8KA 1BWQA 4QRDA 1VE5A 5J1AA 3D1VA 2JCBA 4AURA 5JJCA 4JZJA 1WYJA 3RBXA 4REMA 3F47A 3T15A 2OI9C 1IBZA 4PVDA 5AJTA 3OJEA 2BFDA 2WIMA 4XTRC 2GCYA 4HZUB 1VBMA 3GLTA 3HJTA 4D9FA 5D1XD 3F8WA 4KI5C 4D9RE 4G5FA 3QRFM 2HW8A 1HEYA 4YREA 1THCA 4P6VF 4JI8B 3FRPG 2FO8A 5FHAH 2JJ1D 2QPDB 2R15A 3DVIA 4CQLB 2NNRA 1EG2A 1Q21A 3LN4B 2GARA 4JBGA 4MI9A 4UQLA 2J4WH 3C09B 4OLUH 3MBEC 3T3MB 3ORSA 5DVPA 3KBHE 4ONGL 4ZMSA 5D1QD 1K6MA 2AGJL 4JVWA 1JMKC 4LYFA 2XZCL 4QT4A 1FIUA 3MGKA 5IVXF 4I88A 1JGTA 2H8GA 3PL6D 3HC3H 2P52A 1H2RS 2ZT9C 3LWZA 2D7JA 1QHHB 3A4LA 4WTZA 2JLZA 3QEHA 3FNHA 2HAZA 1AQIA 4NQUA 4KSBA 2YHAA 5EOCJ 1N10A 3U2SA 1RUQH 2DLEA 1BEYH 4AUNA 5EXXA 5F7BA 5IR1B 2PS0A 3BSHA 3PE4A 2JKNA 3F5WA 2IDKA 3HG7A 4MGKR 2ZZKA 5GY7A 1RIUH 4WDQA 1OTUD 4PEVA 5JBNA 4X4ZA 2ATCA 4B34A 2CJUH 3SE8L 4BKLA 1VKNA 1OIXA 4PLKD 1FTYA 1SCDA 4JPSA 4QM6A 1W0JD 3MRQA 1LO2H 1WY5A 4RJTA 1C0EA 5DN6A 2H3EA 3K9BA 3WEMA 4N1CA 4RHCA 3FR8A 1B4JH 4OXRA 1FBIH 5AAWC 4XPGH 1JF5A 3P0VL 4KIFA 3DCNA 2CKBA 3DFUA 4HQ6A 4IDCA 3O6MH 1TCRB 4QGGA 1DBVO 3W1WA 3PUVA 3U4EA 3LZQA 4HVTA 4AEEA 3MLUH 4RPLA 1M2EA 1RLWA 1JI1A 4F7CB 2W83A 4HG4K 4AWJC 2W2OA 1L5GB 3TN0C 4F37K 2YV3A 5ELLA 2XBZA 1J23A 3Q3EA 4YP9A 2ZUTA 3SCMC 4DAGH 4Q9QH 4JT8A 5BN5A 4XHJD 4HNUA 3W8RA 2BNUA 4LVHC 1C29B 1W0CA 2DR3A 1G8KA 4F97A 4J3OF 3V4ZA 5J5EA 4H3VA 3NZHL 1ORHA 4WTOA 1G6KA 3NEEA 4C58B 3PWSA 1R4NA 5DR5L 1BCSA 2D7QA 2EFCB 3D2CA 3VC7A 5D3QA 1S4IA 3GWJA 2BVEA 2V9UA 1N8SA 3N41B 1U6AH 3QVJA 3TZVC 4ASUD 3SDDC 4PJGF 4K3EH 1E2FA 3NC1C 3MLXL 3LRSA 2C94A 5CVCA 2VW6A 1J07A 2BP7A 3IETA 4H59A 4N20A 1NLBL 3OBBA 4X0EA 3DVAA 4ZAYA 1C12B 1FNCA 1P9MC 5KHAA 1T9KA 3DX0A 5BUZA 4QT5A 3QEUB 3BZUA 1AOXA 1DOZA 1ZGCA 2AN5A 2CXUA 3K6DA 1QTSA 5EIIB 1QA9B 2QJDA 4QRFA 6PCYA 1DVFD 3UC9A 2IV2X 4J43A 2POQX 1IY9A 3RUFA 4PQFA 4KTVE 2FHPA 3BMQB 3ZQ9A 1E1QA 2HI0A 3QW4B 1A76A 2BKXA 3CBGA 5EG5A 3ROGA 3CVHB 4G8EB 4F3CA 2BSRA 3VSTA 4F1WA 3HN5A 3GDCA 3ZDYE 5JATA 1TA0A 2FY8A 1Z5LB 3WK9A 5HCUA 3SKOA 3RFUA 1QTPA 1GR0A 1EB9A 1UKTA 1W2GA 2XW6A 5DNYB 3A0OA 3HXTA 4HMEA 2BGLA 4Y1GA 3VR4H 1I6WA 3ZSSA 2CNNA 2LNDA 3DLPX 3HU3A 4WQMA 4B35A 3FGPA 3ZXAC 3IQZA 1HDEA 5EP4A 2HJFA 4GAJL 1GSOA 2NZ9D 4LSSL 2BP8B 3DAFA 4ZMRA 3LPCA 4I4TA 3NRQA 5DJ6B 4I0CC 3MCG1 1BXKA 1OSPH 2RHJA 4GLJA 2VXQL 2XD9A 1WWAX 2I55A 3NTRA 3QJXA 2VXTH 1H6BA 3MV9D 5T1MB 2WFLB 2X0VA 2AG5A 2MMXA 1ED3B 1JPVA 3UMFA 5GQBA 3I8XA 4NNYB 3LF2A 4PYMA 2VTBA 1MFPA 2GRAA 3BXPA 3TCKA 3L9BA 2C9QA 2EDEA 1I6LA 5TMEA 5U1PA 4GXUM 5J1TC 4KI0A 5EJ5A 2WGNB 3E7DA 3SIWA 3IESA 3K8LA 4PRLA 5JCOC 4OJYA 2AMGA 3H9QA 3QU9A 1Y3IA 1KVQA 3HG1D 1JDJA 2WMNB 3KSMA 2F8SA 2BT4A 1ZSDA 1CF1A 3P9CA 4BUQA 5E00A 3QO1B 4FA8A 2ZYIA 3RS8A 2R1YA 4IIZA 1NBAA 3RLFA 2OPCA 2P6MA 3E18A 1MFAH 4OHOA 1ZSVA 1PG2A 1XF4B 4JG5A 1AQ6A 5G1OA 1TVDA 3ZY5A 2VDRB 3U1QA 3RREA 3SGEI 1UCBL 5EZ6B 4YCBA 2O93L 2V9RA 1XGPB 1NAHA 4F96A 2NPLX 3BUBA 5BV7L 2ZIXA 4HSQA 2R83A 3LVTA 5J2UB 2JCVA 3I62A 2LOEA 3P9LA 3MWGA 3P0JA 4QGFA 2E4XA 4GMKA 1HBJA 5D8JH 1HL3A 3QEOA 1Q5PA 2VHWA 3PU7A 1NCJA 3RWDA 3VSUA 2J6CA 4DOMA 4NQXB 1VLXA 1O0CA 3CH1A 4XMLL 1A96A 3NO4A 3FTVA 4Y5YA 4ZD3H 1FH5L 1E1RD 2NY6D 1CFZA 2C82A 3DHYA 3K0BA 3WTUA 1F9EA 1PIGA 3BAZA 3WWZA 3D8TA 2Q7OE 1MXFA 1OPGH 1JIKA 2HIGA 4TN1A 5BO1L 2ZYTX 3PHLA 2WYVA 2CR6A 1BQHG 2YNMC 1EUYA 3W8EA 2GFBA 4YEDA 3OZUA 2CUMA 3WNKA 4UTXA 3ES6B 3ADBA 1JLRA 3L6BA 9ABPA 2CLSA 5F3BA 1UWYA 5I1LA 1K4CA 4D0LB 1Z35A 1E3XA 1Q72L 1W49A 3S88L 1E5XA 1SQSA 1EQAA 1MCPH 4PHCA 1G4UR 2YOCA 5CJQL 3QIUB 4ETQB 3F6EX 1U0QA 1ITCA 2N0KA 2CDGB 5AG8A 4Y1RB 4J1UB 5FWDA 2YA1A 4FGMA 4OX9B 3L5OA 2IIJA 4RESB 4F21A 1DUZA 1LV7A 3B3AA 1FUKA 1WZEA 2CALA 1UHVA 2JVJA 4F8JA 3ONNA 1BQRA 2IANA 4Q7JB 4JU8A 3IP3A 3UTSB 3R19A 3G23A 4MAMA 1UM8A 5IW6B 1XO8A 2YAQA 2P2SA 1G7MA 3HR6A 4OQXA 3TE7A 3H4MA 2IIQA 1YUHB 4BTVA 3B8YA 3UTTD 4CM4A 1EDZA 2VP5A 4BFOA 3DARA 1KIQA 3L1IA 5CA0A 5BWNA 3PYCA 4EZIA 1M66A 3IEUA 4RHXA 3K0KA 2FWLB 4URKA 4DZTA 4FAAB 1KEGL 3ERCA 1KERA 4GBXD 1GRCA 4DCQB 4ZAKB 2B4QA 3DTVD 4AIZA 3NAMA 1IH8A 4CFYA 4XXCC 2VXYA 5C0AE 3KUKA 2H16A 5C18A 2GAZB 1UT2A 3QORA 2DLNA 2CJPA 2KPNA 4KXFB 3RGVD 1GUDA 2JHFA 2YOFA 4M8QA 2NN3C 1LPAB 3ELBA 4CTMA 2EW8A 3S70A 3E3QE 4XYBA 3I6MA 4IXNA 3BISA 4WBNF 2I3GA 3L95B 1S9VB 5KVFL 2X4IA 3QGMA 1C41A 4TNGA 4N8EA 5JOQA 4XRGA 1UVQB 5CBPA 1BZDA 4X5WB 1NBVL 3ZNNA 2R9HC 1OAKA 3S7ZA 2F1IA 2WM8A 3QT2A 3ECVA 2NYUA 3K92A 4MVBC 1L7AA 3LS5H 4KTGA 2Z4QB 1TTCA 1UD4A 1FZJA 5LKAA 1SMKA 2CNWA 2BZ1A 3E2HB 3MLBA 1M8KA 4IZOA 1AZLA 1TCVA 4PTYA 3PV0A 4KHXL 5EUOB 3ONEA 3BUIA 5AOIA 3K35A 2PO6D 4AK2A 3RC2A 2DWDB 2VLJD 4F7DA 5EN2B 3EJTA 2OM6A 3DTDA 4XP5L 2H3NB 4YRQA 2H3KA 3WMSA 5F7DA 4N3GA 1T9GR 2AAVA 1KCKA 2YMTA 1MSPA 2J8UA 1EZSA 4B60A 2AJDA 2BBTA 5DM4A 1CE8A 3GGWA 1B8UA 4GAGH 5BMOA 4OJMX 2VDRH 5FYKH 1U5CA 4R5TA 4I4LA 4TVBA 5K4GA 2IEGA 4AVYA 4LY3A 1OIOA 4QU8A 4Z7AA 4WEOA 4P4LA 3TDMA 4PUBL 2OR9H 4PLTA 1U8IA 3OD3A 2DI8A 3P77A 4OMUA 4E2YA 3RBAA 4TVPL 6LDHA 4BC0A 3KFLA 1MC8A 1V1RA 4RM2A 2YMPA 1UZ6E 1FNAA 2HPAA 4BH8B 4IBOA 2I9LB 4L27A 2IQ9H 1Z45A 5C81A 2ID9A 4L0PB 3FAWA 3F3KA 2NTJA 2UU9B 3G9QA 1S5HB 3Q5DA 3GMDA 4HDAA 3ULVH 4XVSH 1FFTB 1TT5B 4RTLA 4C0HA 1UBGA 3U0TB 1KTJA 3E4DA 3RIFK 3NCFB 1G5TA 3LQ4A 3FQ1A 4GPBA 1ZANL 2PWPA 2C5HA 2CWDA 5H02A 3VWKC 1G2OA 2XWQA 4CEJB 4PJDB 1O5DT 1SAYA 3CLVA 2R8PA 5CEXA 2MIZA 2WKRA 4G5ZH 4GI9A 2FN3A 2HPOA 2BFBA 4ZRMA 1K4DB 2HKIA 3TL3A 2LABA 3BPCA 3V33A 5EGNA 1T5SA 1PJAA 3BGVA 5I01A 1AS3A 1KBVA 3TKYA 5JXED 4D74A 1N2IA 2WB2A 2FH8A 4PGJA 2DYPA 4YFDB 1KFAL 1ACXA 1S78D 3OLGA 3OP1A 4PQEA 4EY3A 3DJFA 4RUKA 4KCGA 1KUMA 4FFYL 1ONNA 1R0LA 4WZAE 1YVDA 3ICCA 2CVHA 5B3SB 4EOWH 5BWOA 3EZ9A 5GJSH 1UH5A 2BBOA 5D1XC 3QNXA 3QTLA 3WBJA 4GKKB 3LQ2A 3EYVB 3MCKA 4FQIH 3FRUA 1UUNA 4E2ZA 4XR8C 1F4VA 4PY8I 3W4KA 3QIBA 3C5ZA 4OHBA 1QBML 4ZDJA 1RRKA 3PUIA 4FZ8L 3JQOB 4GE3A 2OHIA 2VNHA 2GSWA 4YMPA 4JEUA 4LMQI 3TLMA 3BN9C 1HNXB 4MYSA 3VFWB 3L7IA 4JL8A 3IUQA 4WHYH 2X4PB 1DLIA 5D1QC 2A8YA 1RP8A 2EEXA 1GRNA 3T95A 4KMOA 3SBXA 1WUJS 4FXOA 3P73A 2VDOL 4KJWD 3UTTE 2FRDA 3TU6A 3EXHC 3SPVB 3H2BA 5EOQH 4TTQA 3CS3A 4LVCA 3B9KC 1XYYA 1NULA 3P9IA 3HDHA 4M62H 3O8OB 1NDMB 3CVVA 3FO0H 4OFPA 2W00A 3DURB 4TGLA 2FECL 3EGDA 1KK3A 4WO4A 3R3VA 4PJEE 1L7NA 1WF6A 5DXAA 1KMHA 1MEOA 3IKMB 3U0BA 1RFLA 1Z2KA 4JJGA 5C7YA 3EJRA 1E2ZA 3ZGVA 3EVNA 3WOVA 4CMBA 3RH0A 1YZYA 4II2A 2H1SA 3C3CA 3KVRA 4XWWA 4UT6H 3AHJA 1CEEA 4KE9A 4D3YA 1OTUC 2BSSB 5EU7E 4J1TA 5AI0A 4Q58C 1QIEA 2QLTA 1I1AB 2W5UA 5SYNA 4G7VH 4PLKC 5KTSA 1WTGT 3KQPA 2WKPA 1RIVL 1FNLA 5BOPA 3I0NA 3TMYA 2AMVA 3EXEB 5EUMA 4DNOA 2OOKA 2IF7A 1W87A 1KC5L 2Z9TA 5AKTA 5K0GA 3GYGA 1OGYA 2PX0A 2L42A 2FMIA 5EZIH 4BWUA 4P31A 2ZX8A 4QRRD 1JEDA 4FN0A 5C0FA 3I83A 3S8WA 5IIEB 3K1AB 4PJ6A 5K3BA 3I37X 4BYGA 4WK4B 2F7QA 3KRTA 5DYOA 3CFTA 2BGRA 2PGJA 3ZKMC 1GTRA 4U3SA 1WBBA 4CM1A 4XIIA 3GH3A 2PYIA 5JW4R 4BX9A 1N1GA 1SYVB 5D7IB 4F33B 3VJ6B 4UQBA 2JI8A 2LFGA 2J56A 3GTVA 3IK2A 4KRNA 3QIWD 4XX5A 2F2TA 4MA4A 2XEDA 4P4NA 3KQNA 1F8TH 1TCMA 3AY0A 1QIIA 4YJZL 3V7YA 3TJEL 5ALCL 3AR3A 1JNLH 4UQIM 3HRPA 1B43A 1QGED 3A4YA 4FSDA 5T33H 2Y9MB 3FO2A 4DP4X 4AKPA 1PD1A 4P59L 4NNJA 1ROWA 1EU1A 1LPPA 1JZ6A 2RGRA 2I67A 3O8DA 2DPKA 4ZMPA 4MVJE 1M05A 2XDQA 3MRMB 4J3UA 4JYCA 1X0VA 2EH7H 3MFQA 1AF7A 2HJVA 2IHJA 3KWXA 2DKMA 2UX7A 4L07A 3UY4A 4WKXA 1QYXA 2Q8AH 1Z9SA 4AM0A 3WYGA 4JP5A 1M33A 2MCFA 1PY9A 4DLVA 3UK2A 1VG8A 4WFFD 3LEYL 2P9BA 3UYKA 4MA8L 3LKSB 4XXDA 1FEZA 5H3LA 5AJHA 1AURA 2VH1A 4RIGA 4G9BA 1E5TA 4FQQB 2WAYA 3DYVA 2WVJA 1HYSD 3WD5L 3A6HA 1AP2A 5B39B 1P1BA 3EC7A 2WOJA 3PDJA 3FPGA 1NBYA 1PK9A 4GX1A 4PWJA 1QH8B 1KOLA 2NZXA 1E90A 4PJ8A 3GN1A 4XP6L 5CBEA 3WBFA 4JUDX 2FEEL 5THQA 3L1OH 1CEYA 3FFCB 4YK4B 4KXXA 5DZJA 4MO9A 4IIGA 4RK0A 3JYBA 1G7RA 1IN1A 1E8WA 2WNIA 1E7WA 2HDWA 4FABH 4EGJA 3CK0L 4RAHA 4PZ0A 5T3UA 5HD8D 1TIBA 4TN5A 4FI7A 1GKUB 2YD5A 3JWPA 5HM6A 4M1KA 3N7TA 3AJ7A 3ENNA 1JZ5A 3LNDA 2PRYA 1PEAA 1NJ2A 4H4DA 3LF1A 3ZZSA 4O02A 5B6JA 2C7UA 4KK8D 4FFLA 3K32A 4P8QA 1K5HA 4M0DA 5B7FA 1PZNA 3ZBQA 2ZE6A 2GEQA 1ENOA 3WUZA 3HCWA 1JV2B 3UMRA 3EGIA 2IT1A 2X4RB 4N2CA 3G6DH 5ECGA 2UUCB 2ZJFA 1SVZA 1G6RB 3H9ZA 3ORJA 2B8JA 3VXME 3C24A 2CXKA 5EZ5A 4NRXA 4Y6RA 2ZRHA 3FN9A 4K6OA 2OP4L 4WZ6A 5I9TA 3D2TA 1MCWW 2WHRA 4ENTA 3EAKA 1OZTG 1PX8A 3KPRD 3TH5A 3DZFA 3ZE1E 3W3BA 4QGYA 3GMPB 3DB1A 3WK7A 4PRDB 2OZ4A 2YJ4A 1UJNA 4JRFA 1N92A 1ZHNA 1NFQA 4XWOC 3ZDXE 3ZTJG 3THOA 1I85C 7CGTA 3RC9A 4NZ8A 2OAQ1 3IAFA 5LJIA 5FOBB 5CJOH 1Q3KA 1REQA 2ZZNA 3ZEAA 1Z16A 3DMHA 3T3OA 3E4CA 1WS8A 5TR9A 4IDHA 2NY6C 1OPXA 3AM4A 4CDHA 3KUXA 3JASB 4JLPA 1QQTA 2AITA 4NN5C 4KN8A 3GC3A 5I18L 2X76A 2YJZA 3HWX1 2XN1A 1CU4H 5CSZA 2YFKA 4Y2DB 1C9KA 3ZR6A 2AZXA 2V0CA 2BZCA 2WVTA 3WV4A 1JFFA 1G7TA 4HNRA 2Q41A 5AXBA 5D2LF 2OB1A 3R9XB 4WKCA 2GBLA 1H6DA 3RC8A 1A4RA 3PEWA 5GS2H 4L3EB 4TKUA 3I9GH 1VFBB 2OMWA 3P5BA 1Q94A 2H9IA 4QEGA 4QRRE 3EOAI 2LKDA 4EF3A 5DX1A 4LKOA 5ADWA 2IF0A 3OX2A 1P62B 3KR3L 3NJJA 3B53X 5D5MF 3UWOA 5CTJA 4ZPTA 4O5LH 3CPJB 5IB4A 4M1WA 2C2GA 4CDNA 1UFRA 1HL4A 3UJHA 4BXOB 3DR5A 4WUUB 1J22A 3B7TA 4LO9A 4O58L 4AX8A 1CB0A 2FDXA 2PUFA 4HDMA 4F8QA 3R4CA 5CLJA 4UU1A 4H3HB 1ORDA 3EDRA 1V7PC 1ZLSL 5CT5A 1E5LA 4LSQL 1GGBL 3HYCA 4KMRA 4Q52A 4P3DA 4FJ0A 4MIOA 1WDAA 4A2QA 4FXKA 5E1DA 3GKWL 3K3QA 3VQ1C 5LYJF 1AHWA 2ERCA 2WLKA 4CEIA 1H3NA 4RGQA 3FCTA 4PAGA 1NTRA 2VKXA 2JIBA 5LXGH 3RUHA 4N5NA 3DEZA 2J8HA 4V03A 4PJ7F 3D7SA 2D2VA 2JELH 1A7RH 4Y6PA 2NUTB 1LO5A 4LLUB 1MVNA 4OHUA 5EWLB 5B1CA 1UXGA 3ZY6A 1RCTE 1ZT1A 4BPRA 4BGLA 3QR1A 3T1FA 1Q1AA 4NRZB 1WD5A 3BXGA 3RIXA 4PW3A 1Q15A 4XWGH 3RGVC 2QEJA 4I2XB 4FLOA 4GGMX 4I3RL 1JBKA 3I58A 2QRVB 1UD8A 5DHUA 5LBGA 3RUDA 1GPOL 3IPXA 2CK3D 4RE5A 3SIKA 2CVPA 4M5YH 1M8FA 2DYSB 1GN8A 4MQFA 1L9TA 3GCDA 3MXTA 1T2AA 2R79A 2KMLA 3CSUA 2P9RA 1DX6A 3R23A 1USVA 1GV1A 4IGEA 3HHRB 4P84A 2IHYA 3R5JA 4E11A 1RHJA 3OE7A 3OFKA 1JU4A 4F91B 5KB3A 3EYFA 2XTJB 4C7OB 5LN1A 1M7IB 1LD3A 4YR9A 1E3TA 1OAZH 1EZLA 3J07A 4FA7B 3O45B 4UHKA 4ZYVA 2YZ1A 1LQUA 4Z7JA 4LC0A 2ACEA 3AUSA 4K0OA 1TI7A 3W37A 1TEXA 2H06A 1W4BA 2PO6C 1EQUA 2GT9A 1JPTL 4FU0A 1JGEA 4CKBB 2C8KA 4XCXA 4D41A 5IJXA 4FG0A 1I1CA 1XV8A 3DPBA 4PGDA 2OQRA 2ERJB 2CBXA 3PNMA 5GS1C 3S5LB 2K9FB 2DKOA 5CB6A 1G6RH 1VL8A 2AJTA 3PCRB 1E61A 3IV7A 4Y2JA 2NU8A 1F58H 2OXRA 3F6LA 2BZDA 1B26A 5BV7A 1GPDG 4PW9A 2CK0L 2TMKA 3OKYB 1RWPA 1Y4ZA 3RFFA 2O26U 1A25A 3U56A 4A63A 3CXDL 2WOOA 2YV5A 2PX4A 1U92B 3U81A 4BQRA 1SQ6A 5BW6B 1I0IA 3ILEA 3D1JA 4J49A 5E9DA 3CINA 3MNFA 2P1RA 4BNVA 1U04A 4HC1H 1AGCB 5LGHL 3QUMH 2H1RA 3KPRE 2PZMA 1A3RH 1FFOB 3IS3A 3JD3A 2CLRB 3S2FA 4KXZI 1EBPA 3AJ8A 3RTBA 3WN5B 3QVVA 3UHJA 2P5WA 1KRXA 2A57A 3UATA 1VJRA 1NANH 2NPIA 4NOFA 4A37A 1ULTA 4CN8A 2WMOB 4PGBA 1GOFA 1BAFH 3T9CA 3K2QA 4BJ1A 1FDSA 4FX2A 1OH5A 2EIKB 1OLLA 5H80A 3HAEA 2H52A 5A1AA 3QFJD 2JTDA 3WTWA 4ZXBB 1I30A 4P7GA 5DK3A 1JPUA 4L50A 1P7ZA 4CN1A 2X3YA 4GXTA 1FFYA 3O91A 4K71B 1XR9A 4OYLA 2D8MA 3V5NA 5LQBH 4PB9L 3I76A 5EOVA 2PRKA 3TZLA 3WB0A 2B2NA 4XX1A 3NBQA 2WV7A 5EZPA 1C4WA 4OI0A 5IQ9A 4CTOA 2XVLA 4MJID 2P6RA 4WBSA 4HIIA 3RG1C 4X8JA 1JFRA 5SY4A 4X7SH 5L7YA 4DS3A 2HZ7A 2JLQA 3HDYA 4JLNA 2A6DA 1VDZA 2W0SA 4OH7A 4EBFA 2OHVA 5TE4H 3WMQA 5DCCA 3FRIA 3SJ7A 3D0VB 1NUFA 2XPYA 5ID0A 2AQRA 4XCNB 1OZFA 3OCXA 5D70H 1CYDA 4RY9A 4FLEA 4GR9A 3K4DA 5GRZA 1CFJA 4BK8A 4AH2B 3RAJA 1KQ3A 3GXDA 2XWRA 1QMPA 3TNFA 2XMDA 1NYQA 3WLRA 5IVIA 1L5YA 2X6BA 5TIIA 1JPSL 1F6AA 4MW4A 2DL2A 1WSWA 4BRUA 2CYCA 1YI0A 3GLHB 3DOSB 4N2BA 4M7LL 2IDJA 1O6SA 4KXWA 1F97A 2PTTB 1ZVVA 2ZUQC 1YL7A 4ZUUB 3IYLW 3HOGA 5C5DA 5A5EA 4PVLA 4GL2A 2H2PD 4L5IA 5HHTA 4ZEWA 3ISRA 2CUIA 4ENED 4LKCA 4CMMB 1GXSB 3OX1A 5LR6A 1PNQA 2LGNA 4UMFA 3WRWA 3U4BL 2MR6A 1KWKA 5I8OH 1R8XA 4WWPA 2L7JA 3KYCB 1LXMA 5LPNA 1TYRA 2VHJA 2OESA 1ZX1A 4BRSA 1XTTA 5DJZA 1K92A 2YVUA 4QE3A 3Q2WA 2XVMA 3L8MA 3MRRA 4RK6A 4PJ7A 1V1MB 1YT5A 3LRMA 1IUZA 2PXCA 4B41A 2V6JA 2XHNA 4KFZC 4O4YH 3CUEF 4HWOA 1XOIA 1MF2L 3OAZK 3VA2C 3K5HA 2XUKA 4YAJA 5JS8A 4R71A 4K9RA 3A1DA 3RHSA 3GOHA 4IQHA 2IL1A 4H27A 3QXDA 4DJMA 4KXCA 2AEFA 4P98A 3VRLE 4ERSL 3RSCA 1NEPA 1P18A 2Y1KA 4XXWA 4NU5A 2BSAA 2R1WA 2DM4A 2DHDA 4OM8A 3GOQA 2IHUA 4HWGA 3ZHZA 1HEUA 1ZE3H 1V5FA 2HJWA 3DE3X 5C8DA 2FWIA 4RLDA 5DMYA 4ZFOB 2QQ5A 1ESMA 1ACJA 1TCBA 4ZANA 2R8BA 1SCNE 1H2FA 3EH1A 4E5XA 2X7HA 5JCJA 1GPJA 1U2YA 3K0WA 2GPZA 2OFPA 3VXKA 4IHOB 2RK6A 3QHFL 1P8AA 3GRWH 4RRPA 3IDIB 5FPKA 4MSWA 3AUTA 1CUVA 3EFDH 2JKSA 3N05A 4DEPB 4TTDD 4NBSA 3EEBA 7REQA 5KX5F 3T7IA 3EPJA 3CZ5A 3NV9A 3F83A 2FT6A 2RJMA 2FUKA 2GZMA 2Y27A 4NHCL 5E1BA 3RRYA 3MRNB 3BEVB 1N1DA 3NHRA 1MCRA 3LUAA 3GFTA 1FDOA 2DWPA 1FDLL 3F6YA 4DAEA 1J0BA 4PPTA 1GQRA 2JI1A 1DQNA 3FMOB 2QT9A 4XYLA 3SOZA 3T41A 3I42A 4PC7A 4B17A 4HGOA 1ZCJA 1M1YA 1EVUA 3BWAA 5AKLA 1LNUB 5I9SA 1VPLA 3LRTA 4P48A 4DSNA 5H2BA 4BEIA 4DGVL 4TQUS 2OKGA 1DE4B 1JU9A 2DQCL 3HFJA 2PUAA 4MKTA 3L2OB 3E6FB 1EDBA 4N76A 1MY5A 1MJ7L 4KUCF 1QR2A 2Q2OA 2WJAA 4ZFZB 5TDOA 1OW3B 2VCHA 4XM2A 2JARA 5JD3A 1YE5A 3TRKA 3UAAA 4OTZA 1A9RA 5TQ0H 2M1KA 4TXNA 3ZVNA 4LOEA 3QFJE 1XAKA 3PYMA 4LCYB 3CDFA 4N0UA 3ZCTA 3EQZA 3GSUA 1OGJA 4JE0A 1OR8A 3PU6A 5LMCA 3V6MA 2I1WA 4KOCA 2JCGA 4FFYA 1HYSC 3RRFA 3FH8A 3WTTA 1ZIPA 1DOHA 2INGX 3I04A 5ILTH 1XTUA 4MLIA 4MI6A 4AJ9A 3FOMB 2N7AA 1OCCB 2O7VA 2O3QA 3RJTA 2VTKA 4MJIE 1C5KA 4RKWA 1BM3H 1KMQA 5JW3L 4QUEA 3TQRA 1S3KH 3H4TA 3RIGA 5J1SB 4JK0D 3KYAA 4LDNA 2HQRA 3EDKA 1D7DA 2FJUB 3MV8D 3ZMEA 3QJOA 1RAMA 2AG6A 4RLHA 4WRLA 3GXNA 3ES9A 4B40A 4R0NA 1K9VF 1EERB 3SXUB 1HUQA 1WXEA 4XEHA 3OEHD 1CDCA 3NRPA 3L0DA 4G8BA 5DIZA 2FZ5A 1CT8A 2Q3LA 1ZCRA 4N86A 3Q8CA 2C1XA 2IXQB 5CLQA 3O38A 4MJ2A 2WZPA 4JJ5B 4NBNA 3TCNA 3ER6A 3LY9A 1SKQA 1V43A 2OMVB 5FL7A 3AM3A 3ZK7A 2J3JA 2QRLA 1IEQA 2JZNA 2J08A 4IFTA 4XWYA 1TO2E 1ZLXA 3KTAA 2ZYUX 2OCXA 4PC6A 4G6ZA 1UASA 3FWHA 5FGSA 2GESA 4NL4H 2FP4B 2YKKA 2P24A 3DHMA 4GUPA 4O25A 4PO1A 4GR4A 4KYVA 5DD6A 2X14A 1GNLA 2C4FT 2OV6A 4HH4A 3FZNA 2DR0A 3GEDA 1SWWA 3T77A 4MW1A 5E6IA 3G0HA 4PBVC 3A9VA 1JGUL 1EX9A 1AC0A 3QHAA 3A10A 1EUQA 4H8WH 3R7RA 2ZJ1A 3ZGLA 2UZ3A 4P05A 3SHVA 1DIAA 2WQXA 3TJMA 4PONA 3ML1A 4M0LA 5LB2A 3D1MC 3H2KA 4HX1A 4QXPA 2BKUA 1EWHA 2YD4A 1UOQA 1E9RA 4R81A 3V10A 4YSAA 1G0DA 3WHE1 1U81A 3NYRA 4LCIL 4Y2XA 4HVCA 3DTXB 4FE3A 4TT3D 4OZGF 2JANA 5T4EA 5K1JA 2IH1A 3NWEA 3RE1A 4Y9GA 2VRAA 3VVVA 1CICB 3PWPA 2AR9A 2I24N 4Z0XA 1SOAA 1AYOA 4NP4L 4X5PA 4ND8A 2P9GA 5IDWA 2LR4A 5EXTA 4K5NA 2ZG2A 2AQ1A 3RRNA 1G2IA 2VK2A 1A8ZA 3MMEA 2BR3A 1L9QA 1KN2L 1U95A 4Z0TA 2EF0A 4KU1A 3IAAA 5GOTA 5I8CB 2NO4A 5EJGA 1RCFA 4X9BA 4ZQBA 4KQ4H 1EWVA 1J0HA 4HIQA 1CQWA 1DAFA 1POXA 3VFVB 2RB4A 4NLHA 2QG4A 3DDHA 5DD5H 4DG5A 2JIOA 1RE0A 1S9XB 2UUDK 1H1LB 2X9VA 3JWOC 3B12A 2JLCA 2VJBA 4MR8A 3RI5K 1GYUA 3BXEA 1YQTA 1LTKA 1P1RA 1JBEA 4Y2RA 2OQIA 4H1WA 4DYDA 1QVAA 5LBSL 1WTCA 1Z9MA 3V6FB 3U46A 5I8KH 1B0IA 2AJSL 4LU5H 4FXGB 2A88A 3SMQA 1ZBDA 3DW3X 4KWCA 4YC7A 4MAYA 1OGTB 5KX5A 4BKTC 5A1TA 4GW1B 3BUPA 3AEKB 4V39A 2PPCA 3S1AB 1ZG3A 2JBAA 3C3EA 3DOUA 5A4DA 3ZW3A 3IDXH 4UNIA 2HSZA 2BNQA 4NRYB 4YUEH 5D1ZA 5C3TA 5JSHA 3UAFA 3ZHSA 1XZIA 3KR1A 3EN0A 1KI2A 4TRMA 4EBQH 1G5FA 4TZ6A 4OV6F 3RUGE 1GP2A 5DFTA 1ZK9A 1PGPA 5KNCH 2QV0A 2OMUB 1GPWB 3AG2B 4DO4A 4GRMB 4OO3A 1YCFA 1MPTA 4AMKL 3O8BA 4HUVB 1OJ7A 4ALLA 4LGMA 1KBBA 3HB4X 1YR8A 3H8SA 4YHPB 3KAAA 2WLJA 5EJ6A 1KJMB 2V98A 5DQ9B 3WS6A 3U48A 2VDJA 1BD2A 5PAZA 1P77A 1CD0A 1U2GA 2EX0A 2W60B 1CDDA 4KYTA 5E70A 1A9XA 2IUSA 1KP9A 2IBTA 1HTTA 1Q91A 3UHAA 2L82A 1FPMA 5SZIA 3N2KB 4J0DA 4RSRA 4G5XA 3MRHB 1ML4A 2IYYA 3P52A 5GGRA 3CFDB 1QHFA 3I5UA 4AL8C 3VR3D 3H2IA 1YN6B 5J12C 3TUZC 3OB0K 3EGSA 4RQTA 1ZMBA 5FAXA 3LBAA 5DC2A 5K8VA 1YTUA 3EMVA 3VMMA 2IU3A 4AQAB 3FF8A 1IN8A 3I6SA 2AQHA 1YB5A 1F00I 4LRXA 1Y3HA 4QATA 1PJLA 3D3KA 5BQPA 3CPSA 5E23A 1TADA 3WO4B 3F6BX 3HKEB 2BP0A 2FSUA 3VMPA 4ND3A 5IBCA 4U6TA 3IERA 4YRIA 1IQ0A 3SDCD 3Q43A 4UCFA 2MOKA 5DD0L 5AM5A 1T7ZA 4XE5B 2XZAH 3P9MA 4EYOA 3AW5A 4M86A 5FTWA 4P3CH 1SIUA 4LJ9A 4XNAA 3PQYA 1QH1B 2CUAA 4WUKH 2DLGA 3L1EA 3DX3A 1KFBB 4MZIA 4YDLB 4LFAB 5A3JA 1VYUA 5DRXA 4AN0A 4OLVH 1HH9B 2H31A 3FUDA 4IKIA 3N2NA 5ICEA 2P7TA 1NINA 4I18C 2A14A 3U4CA 3T1OA 3O4GA 4R2MA 4D8TA 2Y23A 1WT5C 2GCOA 4BSWB 2C4XA 2OBFA 4N8VA 2PCPA 5JW4Q 5GOZA 3RY4A 4PREB 1G9XA 3LAFA 1R6TA 2E76C 3RWBA 3P2TA 1S96A 2D7MA 2WUVA 5E8PA 1PZMA 3GR6A 4AJ1A 2O8NA 4N0MA 3D69B 3V52L 1JXFA 1EFVA 4OZGA 3HZMA 4UM5A 1ZH0A 3OOWA 2VW7A 4ELMA 2A3NA 4AY2A 3PE9A 1KJ3H 3CFEA 4N0QA 5TB5A 3UB3A 5DWUL 3CHRA 1ILSA 4DA9A 5EUKB 3NU1A 3U1BA 2PX2A 4G43A 3QA3E 1KVTA 2W11A 1GNRA 3WNLA 1QKZL 1YCHA 4U2CA 2BY3A 5DGDA 3V8PA 5T5QA 4UNSA 5KSUA 1DJMA 3X13A 3LHFA 1ZS8B 2ISDA 3Q8AA 5CJXA 3QQNA 4FZEH 3VYOA 2ZI3A 3CSFA 1OREA 5IW8A 4XTRD 1HRDA 3EFOA 5EEXA 3SBPA 4QKXB 1C50A 3IS0X 2XRYA 2JGEA 2VERA 4KUZL 3D6JA 4K8OA 4KI5D 2JFQA 3CVIL