2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
4C2BA 3OL2A 1YVRA 3ZE1B 2XGGA 4Z7NB 3NVQA 2ICAA 5E6SA 1PD1A 2WINI 3PPVA 4K3JB 5E6UA 4NEHB 1DZIA 3EGXA 3GXBA 5BV8A 1SQ0A 3AFCA 1ATZA 1MQ9A 5HGJA 4MMZB 4O3TB 1RD4A 3PPXA 3K71A 1TYEB 5KYYA 4NENB 3VI3B 3K6SB 4HQNA 3EG9B 1U8CB 1AOXA 3EGXB 5ES4B 4MMXA 5KYWA 5HDBB 4C29A 1YUKA 3EGDB 3N2NA 5HJ2A 2NUPA 3BQNB 1RS0A 4M76B 1L5GA 1IJBA 1MF7A 1M2VA 1MQAA 3E2MA 2NVOA 4G1EB 3NIDB 3ZDZB 2XWBF 1N9ZA 4Z7QB 1LFAA 3HXQA 4WFQA 3EG9A 3AL8A 1RTKA 1QC5A 4MMYA 4FWWA 1QC5B 1OLZA 4C2AA 3BN3A 5KYWB 1T0PA 1FNSA 4MMZA 1QCYA 4A0QA 2XWJI 1JV2A 3V4PB 3T3PB 4JX0A 3EFOA 3EFOB 3TCXB 2M32A 2VDKB 2VDRB 3RAGA 2NUTA 2VDPB 4G1MA 1XUOA 3EH1A 3F78A 4IXDA 3VI4B 1SSLA 4UM9D 1JLMA 1U0OC 5E6SB 1M1UA 1AUQA 1PD0A 2VDNB 1XDGA 3V4VB 2P28A 1UEXC 4PN7A 1JEQA 4MMYB 3ZDXB 3EH2A 4G1EA 3ZE0B 4O02B 1MJNA 2B2XA 3FCSA 3FCSB 4HQLA 1BHQ1 1Q0PA 2VDLB 3EOAI 4G1MB 1ZOPA 2I6QA 2X5NA 4F1KA 1BHO1 2ADFA 3EOBI 1M2OA 4NENA 3K6SA 4WK0B 4CNBA 4F1JA 3HXOA 3IJEA 1JEYB 3IJEB 3AL8B 3OKWA 4IHKA 4Z7OB 2O7NA 3K72B 3OKYB 3IBSA 3ZQKA 5KYXA 4WJKB 3ZE2B 5KYYB 3K71B 1IDOA 1SHTX 1ZONA 3QA3E 1CQPA 3FCUB 4HQFA 4CN9A 2I91A 1JEYA 1ZOOA 3NIGB 3EGDA 1DGQA 2NUPB 3TVYA 3BQMB 4WK2B 4O3UB 1JEQB 1JV2B 2UZYB 4DMUB 4UM8B 1N3YA 3ZDYB 1OAKA 1IJKA 2WW8A 1V7PC 1U0NA 5E6RA 1M1XB 2VDOB 1M1XA 3PPWA 3T3MB 3AL9A 2ODQA 1MHPA 2VDQB 1RRKA 5KYUB 4HQKA 1U8CA 1PCXA 2QTVA 4IGIA 1M10A 1XDDA 4CN8A 4JDUA 5E6UB 2ODPA 3K72A 4XW2A 1IDN1 5KYNA 1CK4A 3M6FA 5KYXB 1MQ8B 3Q3GE 3F74A 4HQOA 4O02A 1PT6A 3NIFB 3OL2B 3PPYA 3TW0A 5E6RB 4MMXB 1NA5A 2I6SA 5KYUA 1SHYB 4WK4B 2P26A 1AO3A 2VC2B 4GZ8A 1L5GB 1M2VB 4FX5A 1YVPA 1SHUX 2VDMB 3TXAA 2NUTB 4UM9B 2IUEA 4BJ3A 5LN1A 1T6BY 1FE8A 3HI6A
chains in the Genus database with same CATH superfamily
5BO1H 4G72B 2OZVA 4DEXA 1V3KA 2JJ8A 5LLTA 2YH2A 1PT7A 1QIJA 3QEKA 4HO1X 3C2AH 5F7HA 4RYLA 4YT4A 4MI9A 3Q5EA 3T9AA 3QXJA 3E0XA 1U8CB 1ZLWK 4P4KD 1T3SA 3C3XA 2Q99A 3M2TA 4B3RB 4YALA 4JQOA 5JW6A 4IS3A 3QO0B 5AI9A 2VHEA 3RV4A 4WFQA 4ZZ0A 5KVGE 1Z0UA 5KNDD 3FULA 1EJOL 4CLOB 4HHWA 4N2HA 4PV8B 4IKIA 3NLLA 2ZCHL 1N59B 3S96A 4FMDB 2WM9B 1ZGJA 5B1DA 1UBEA 4YO8A 1NJ8A 3RFFA 5LYJF 3CF2A 1IUOA 1FSPA 4Z4HA 2XI9A 4ZD3L 1S3FA 1QLEH 3IUJA 4DM4A 1M53A 3PHHA 1CLVA 2JGKA 3NPZB 4IR7A 3QEOA 5DLML 4CF5A 1QGDA 5JQGB 5A1TA 1GC1H 2AZXA 1E6KA 2D1TA 5HE8A 3PRZA 4JPVH 3AZPA 3DW3X 1RPAA 2DI9A 4EUSA 1S8DB 3LK7A 5C35A 1UOVA 1QUFA 1N7HA 1NG9A 4JDPA 3U0PB 1E9OB 1JDNA 2C98A 4QLOA 4XNDA 4I4LA 1AKQA 1Z9OA 3F2IA 5JY1A 2ZX6A 5HGXA 1TJHH 1U3ZA 3W9EA 3R5JA 3QC6X 5KTRA 4Q9AA 2P6RA 2H65A 3PHIA 2ZUUA 1KKUA 3EQ6A 4D97A 2GAFA 3VZDA 3M1OA 4U7DA 2HCBA 4QOKA 3QIBC 4N3GA 5AOKA 2WXKA 3RTLA 3E2PA 3RKPA 3OWOA 1KFJB 3BMOA 3IDXL 5KJ6A 3O0TA 2PXXA 1O9BA 1K6MA 2Q3LA 3AFHA 1PG7H 1OM3H 2WD0A 5FGCB 3V4VH 4LQ4A 1B2RA 4MJIA 3EYQC 1N0VC 3WKDA 5JW5B 1EWTA 1ZK0A 1PL6A 1T0IA 4AL8C 3M86A 3U9UB 1SC6A 1ZMRA 1IPFA 1FYTD 2UYLB 3H2PA 3I74A 3G59A 2PCPA 4GVLA 4URHA 3EJCA 3FTWA 4QPCA 4G63A 3SMQA 1EDHA 4ZMNA 1RLBA 5B22A 1G7HA 2APJA 4I77L 1SJEB 4HXYA 3B1WA 1J8HA 3GJ4A 3QG5A 4ZVRA 5AT1A 1HHKB 3HFRA 4KGJA 1JEYA 1KTBA 3HY4A 1J0ZA 4ZTZB 3KKEA 3DZBA 4KLNA 3TUJC 2W1NA 5DC4B 3P9IA 5AB9A 5CPFA 5A2BA 2DCMA 4PG9A 4YXWA 4OHRA 2R8PA 3FCAA 2BP7A 5DYFA 4JFAA 2GN0A 5I7EA 3RWFA 4Q3NA 3VU3A 4EPRA 3IP8A 1RAHA 2Z31B 4TKVB 2A9MH 3R44A 4Y2HA 3CUEF 3NAAH 2WILA 3K96A 4I3HA 3I6GA 4GKOA 4PB9L 1XCTA 4JEGB 2IYLD 1QYDA 3FQ4A 1F8GA 5F8RC 3C7DB 5CB6A 2XWJB 1RMQA 1I8KB 5IHLB 4DPLA 4YX9A 1SY6L 2BNQD 4F80A 4EEKA 4PO1A 2EJWA 1PZUB 4MO9A 3EADA 3N70A 1GADO 3YASA 3UTPE 4X64B 4RZCA 5DT9A 4TNVF 4AYDC 4GLRH 3MGOA 3D8TA 4Z7UF 1LPNA 4AJLA 5ADPL 2FI1A 3QELB 3LKNB 2Q1YA 4G6KL 4PG2C 4JASB 1HINL 4JB9L 3GPEA 3F96A 2UWEB 1KI6A 3IODA 4I7EA 2Q5FA 1MI5A 3P9NA 4ND2A 3DMMD 4NQZA 1CY2A 2PNFA 4G8IA 3QWBA 3OBBA 3PFUA 1ISHA 1FDUA 3U61B 3UIZA 2B4CC 2DX7A 3DV6B 4EQ6B 3AUWB 5A2FA 3T1QA 4URKA 2VW6A 1RAEA 3SBWC 5FFGA 2EUXA 2Z91A 4WF7A 4WNQB 3ZX4A 3A0OA 3PDDA 3O4VA 2OAP1 4XWOD 1L8AA 1GZHA 4KO7A 1B4JL 2YAOA 1VLLA 1KLUB 4WOPA 3CZLA 4B60A 5CLZA 4EKDA 3WGVA 3K1AA 1PLJA 4OU4A 3F04A 2JWHA 4IFBA 3QKSB 2BBTA 1DAKA 2NV2B 4JN6B 3UUFA 1YONA 1VIVA 3MINA 1E1QA 2SODB 4HGKC 3HLAB 1X6NA 4MKGA 1X3SA 3MERA 5FYJU 3ZWKA 3WWEA 1X5XA 4BNNA 1EX0A 5DD6B 3NJ4A 1GS6X 5FYKL 3DIFA 2EICA 3MNDA 2R6ZA 4MV1A 5HIIA 1RD4A 4A36A 4N85A 4CM4A 4X4XA 1BVKB 2UYLA 3GYBA 3RU7A 4BCYA 1ZVMA 3PUJA 1PZMA 2CD0A 1R0AH 4FP9A 1XPRA 4CQMB 1M6HA 3ZJYA 4XM2A 2XFGB 5HHXH 4EKYA 2ZRCA 7CGTA 1VI6A 4UFNA 2FJHA 3VUEA 2ZWLT 2V33A 2WYOA 5E1IA 2IDFA 3KXPA 4O6VA 2AEOA 5DGQA 4AI7A 2B8OT 2ZIFA 5IH3A 2RIKA 5HYIA 3QM1A 2EG9A 2HVBA 4IIXA 4KUZH 1KYTA 4TM8A 1LO5B 4N0PA 2BN4A 1UKAA 1R4MA 2KLSA 2WWMC 3L7EB 3ZV5A 2NY5L 2X2JA 1TVBA 3WTSA 2DQGL 1OLSB 1OE0A 1AY1L 4MKRA 4LXFA 3C6LA 3FROA 2I2DA 3BE5A 3WIVA 4OKVA 4LSTL 2FG7C 1A5SB 2GESA 3PHBE 4O4YH 5JNWA 4XPGH 3PJSB 1PWHA 7REQA 1V5JA 1U0LA 4BFIA 4JKOA 4EJ2A 4MXVF 3S2GA 4PV9A 2DE0X 2Z95A 2BNUA 3TEMA 1UZ8A 4JRXB 5JBIA 1CFNA 4EY5A 5GRVL 1KWKA 3N8DA 3ZWBA 3H83A 1R12A 1X7XB 5H9WA 3VWKC 3KCPA 4QVKA 2HCJB 4DERA 5FAKA 3LF2A 2D0HA 2EE3A 3D25B 3QDMA 3T4XA 3HWRA 2I1VB 2KLBA 3I01A 5TB5A 4PBDA 2BIPA 3QI9B 3CUUA 1JSRA 1C0KA 3HHRB 4XR8C 2CYAA 2QXYA 2Z8VC 3IFNH 5AKXA 4ZGGA 2Y9MB 3MTAA 4NQSB 1FLRL 1I3RA 2YHSA 1E2MA 5J6SA 4OG2A 4WZBE 4HH9B 2X1WL 1P81A 5I0ZA 1TZIB 4YS6A 1GR0A 4AY5A 4O0MA 4YDRA 1EHLL 4JVSB 4GRDA 2YHUA 3WBFA 5I9BA 4RK4A 3GIVB 4MINA 3CW8X 1ZUD1 3EVDA 1RZKC 2HDHA 4W9CC 3QE4A 2ANBA 2YDXA 2PUQT 3KWXA 3BWXA 4HQ0A 4IHQA 4DSTA 2EIBA 4Q4DA 3BVVA 4BNIA 1ZD5A 4YEDA 4O2BA 3TYGH 4L4YA 2VR3A 5KQPA 2H3NB 3LQKA 4TLCA 1B0UA 3W7VA 2R5NA 2OESA 4I6JA 4R1MA 1B0IA 3H8NA 2AI2A 1A8IA 3QLVC 3W5SA 2OW6A 4NOKA 4PIBA 3W3AH 4I5BA 3H2SA 2GG1A 5E5MA 4R98A 4JFWA 4O2AF 2H2HA 2X0EA 2P52A 4P36A 4KZPA 4JCWA 4NATA 1V7ML 4GUOA 5LGJB 4HWEL 4MAZA 4YP0A 4H3SA 1SUIA 1SCKA 4XGZB 2ZZNA 1KMNA 1NC3A 5IOPA 2WZQA 3RKRA 1E3SA 4ZV4A 1KP9A 2IU0A 4WRRA 5A43C 4LESA 4G5HA 4OBXA 2CZQA 3ESVF 4MCZB 1C2TA 2WVJA 1AZWA 2WVGA 3T2PA 1U3HC 1SELA 1JZ3A 5C71A 2WLHA 3GIZL 4IV8A 5JG7A 3OKCA 4WVLA 1JB1A 1KORA 1ZEAH 4C58B 3OQ1A 4FS0A 3HMQA 4DEUA 1BJKA 3K8ZA 2QP4A 2Z64C 1JF8A 5F7XA 3OP1A 3ZS8A 4RWHA 4GIPD 2VSNA 3ZHRA 1UDXA 3VXQB 1USUA 5I51A 4MS8D 1CR9L 3IX7A 3BX1A 2G7MC 4CTKA 3HCEA 2N7BA 1T2UA 3AQZA 4JXJA 2P5EA 5H3HA 1QNZH 3U48A 4L0YA 2A33A 4G01B 4R3UC 1DN0B 2PXYC 5GJSL 1RRMA 4RBPH 3MRHB 3V2GA 2NACA 3T7JA 1BFSA 1B90A 3V95A 1IFXA 4NK5A 4G8FA 2ECQA 2RC6A 2WM3A 5LQJA 4JFRA 4X5LA 3UH0A 1F4YL 3VOSA 5EZIL 3A3OA 2UVQA 1PAUA 4HNTA 3KQNA 5EZLB 2DPHA 2ID4A 1U31A 4KFMA 3MRMA 4OFPA 1UQTA 2XGGA 3AUXA 3DMTA 1I0IA 2XV1A 2HBRA 1FFOB 2ZIDA 3U7AA 1PX0A 1L5NA 4FFBA 1YH3A 2A7XA 3VXNA 1WTAA 2TMYA 2OSLB 3MBEC 1GQ2A 5AAPA 3M7FB 1X7SA 2JCCF 4XFKA 2IWFA 3TLRA 1TT6A 4MVJI 1CLZH 2I34A 5DNVA 2YLHA 2VQ1B 3BESR 4DUYB 1U21A 3UGXA 1ZOIA 4AAYA 4RYDA 1YI0A 4BYMA 2P5WE 1MI5E 3BREA 13PKA 2UXCB 1VJ5A 2XJKA 4L3VA 4YQFA 5F4ZA 5EPOA 4AJNA 3KPYA 4YFVA 1Q0HA 4N8SA 2ICCA 4C55A 2WSSD 4DYHA 2GSGA 2ACEA 3CV5A 4LDEB 2ASEA 2P65A 4INPA 3L95B 4M99A 3Q3EA 2GRAA 3WMGA 5L0QC 5DDHA 1XEXA 5IKMA 2XV6B 2E9JA 5DRXA 4DGQA 4RL6A 4U1HA 1RFDL 3TBCA 3WNOA 3FGOA 4RFEA 1YJQA 3WIHL 3U7JA 4G5ZH 1NBYB 8FABB 1HNZB 2JAUA 1Z5GA 5IROD 4J03A 3AADB 3HG3A 4RZQA 2D31A 3DTVA 3JVGC 4P7GA 2I65A 5TXGA 2BNRD 3C8KA 4BZ2L 3GSUB 1P5RA 1U0FA 2IVZA 1L5ZA 3U3XA 3PBKA 3LUCA 3OGCA 4CV1A 1E5QA 3CH5A 1OCEA 2PT7A 3D0OA 4NSNA 4HIQA 4R2MA 5GGRB 3SCMB 1TJPB 3KDPA 2EECA 1YY9C 3VU9A 5JSHA 1WQVT 2NZ9C 4D0DB 1T1ZA 3RFZA 2P4HX 4B09A 2AZ4A 2OLDA 4XB1A 1VAHA 2LCIA 5FV4A 3D9QX 1Q14A 3AU1A 3EBPA 5D71L 3QOYA 5DXWA 1AGCA 1L7XA 4QTHA 3M70A 3CPUA 3WNKA 2C5SA 4OHCA 4OIBA 1LRJA 2Y7SA 3SSGA 4LJRA 3V1LA 4YJGA 2GILA 4Z3TA 1QG0A 2Q7DA 4BLTA 5B1EA 5EXEA 4NV0A 2CBQA 2R84A 2HX7A 1BCSA 1SG6A 2IPNA 1S3SA 5L9DL 2ZVDA 1V5FA 2V7UA 2YY5A 2B2NA 3N2YA 1NLUA 4E09A 4RY9A 3D2TA 4GP9A 1W36C 1Q84A 1R3HB 5LUMA 2O5EA 1AKJB 1J2YA 4A67A 4M6NL 1F1BA 1N6QH 3ZXUB 4ZS6D 1GAXA 1U8ZA 2I7TA 3GFRA 1C1EL 2Y2UA 4D0CB 4A82A 2ZSVB 4CVUA 1DVZA 3JQFC 4OBWA 2BLNA 1ZGZA 4S1QL 2YJGA 4CT0A 4I1PA 1NA8A 2UY7B 3QUZA 4XARA 5A71A 4B6GA 1GW0A 4JG5A 4W5JA 2VRNA 4K7JA 5F3DA 4DMCA 1S9KC 2FEAA 2GJKA 3O2WL 3VTAA 1IQPA 5BJTB 2XG4A 5G0WA 4XN2A 5TY0A 4CLDA 1X1DA 4RVHA 1VACA 3UYPB 3W6UA 1UXOA 2WQAA 2V74B 9MHTA 2JA1A 4S0TD 2XGMA 5AQEA 1H1DA 4PMFA 5B7FA 2JLCA 5FOQA 2LGJA 3CZFA 3RJDA 5JXAH 1SKYE 2DQ6A 2Z31A 5E8EA 2PW1B 2NX5A 4X7TA 1WULS 1QKZH 2WKQA 1DBAL 5BNFA 3DX6B 1SN2A 4F7CB 4CC4A 1KT2B 3QUXB 4YN3A 3C5SA 3JY6A 1H8OA 3T3MF 3TVMA 4TTVA 1NC2B 5LBTA 3FT4A 2LZ0A 4WCFB 4F8NA 2J8UF 4Z1PA 1J8HB 4UOW0 3C5SB 1OB2A 1TCAA 2DUNA 5HRAA 2GTQA 4UAGA 2BY4A 4ZO6A 4WW2A 5JVDA 5DQDH 1P4HA 4CTJA 1QF6A 2J6HA 3C6LC 1YOVA 4F5ZA 1P60A 4YBLC 1TPZA 4ITRC 2PVPA 2ZKLA 5L7WA 4NCC2 1D5ZA 2NYYD 3OA0A 1PLAA 4TSFA 1U0NA 3MN8A 4KXBA 2VP0A 1CEYA 2NO1A 1NNSA 2YXNA 1NCNA 3WLLA 3L0IB 1UZ8B 3MLSH 4H8UA 5DO2D 5M7QA 4YSAA 3ZKND 4M55A 4XP4L 4JU9A 1QI4A 3PZRA 4K28A 2NT4A 1JK9B 3RIMA 4UHDA 3HHEA 5BQ3A 4I6GA 2BI7A 5F2FA 3AMVA 4PPYA 3ETTA 4LVNC 4OLXH 5LQMA 1QPPA 4JPVL 3WELA 3EVCA 1GSOA 4R4BB 2XMPA 3H2WA 1QF9A 4DMGA 4NN5C 4Z9AA 2K7ZA 3RL1A 3L3JB 4IBLT 1L6ZA 4C7XA 5JD5A 1GT91 1GH7A 3JAWA 4IGBA 2SBTA 2XZOA 1XSOA 4B0OA 1JYWA 3TJRA 4YDJB 1XP8A 1G18A 2Y5TA 4CG2A 3M3PA 3JUZA 5HHOA 2OT3B 4NC2B 4M0EA 3MWKA 5DD0L 2IOFA 2C7QA 4JOCA 1HSZA 3X1ZA 3VVBA 1RFDH 3WNBA 3DL4A 4XC1L 5CITA 2IDSA 2QN8A 4R0NA 4ZTUB 4NUGH 1UACH 2WLIB 3D0AA 4LMAA 1MV8A 3ETSA 5EJAA 1Y3HA 3TN0D 4YCLA 5IR1B 4PJ5D 5MHTA 1E42A 3E3NA 4ICIA 3VGJA 2QN1A 1A27A 3BGVA 4EELA 2AQNA 5JR1H 1WUKS 1J7KA 2EDJA 1XCQA 4KJPD 3VNUA 1UFGA 4Q6BA 1JR6A 1AQKH 4K9PA 3PHJA 3QQ4A 3Q7RA 2R1WB 1LLFA 4NZMA 4BAUA 5EFIB 1TUEA 4LOJA 1WZ1L 2O61B 3NFPA 2C07A 2P67A 1WUZA 1H15B 1RVDA 4XO5A 3DA0A 5EN2A 4ARBA 4DDVA 1W47A 2V3CC 1GTFA 5H2BA 2Z6AA 3I3EA 1TO1E 3OZKA 3WTTA 3TD2A 1VKHA 2VZTA 1VYUA 5DHYA 3IDZA 2VZ1A 2LDXA 1BD2A 2Q8AL 1WCIB 1XXDC 1KP3A 3HC7A 4KX3A 2QVZX 4UM9A 4WI9A 4MAYB 4M7LH 3T5BA 1BWMA 4WSKA 3NJFA 1M4KA 2BTOA 4XCCH 4RA0C 3G0BA 2YD5A 3OUZA 4EMBA 2AC2A 4NBNA 1VFBB 2XTAA 3QUCA 5L95A 3E5RA 2GN1A 4RA6B 2BFOA 1KT2A 3QUXA 2AQ1A 4MAFA 1W8NA 3VD9A 2LFEA 4Y4FD 3TSOA 3H0CA 3AT0A 3IEXA 5I73B 2WLSA 3AVVA 4Z7VF 4DZBB 5IUCA 2FKNA 3NMEA 5T1KA 2JH8A 4JU8A 4NZZA 4O3MA 1OLZA 2IVFC 2DEUA 3FFCB 3BP7B 3W5HA 5KJEA 3OAUH 3I5YA 4DLKA 2HFFB 3RWHB 1LTKA 2VQUA 2VDOH 1PJ2A 1MABB 3UAYA 5AENA 3B5TA 3E7FA 5JYLA 4HLNA 4N12A 4BX2A 4RFSA 2JBAB 1NOFA 1JF5A 4LOHA 3OLWA 4OQ4A 4R8WH 4JFXA 4LSSL 1OAJA 1BZOA 1DRJA 5DJYA 4ZMAT 1KI9A 4KYTA 5BXFB 1KZ1A 2BP5M 1CYEA 5T33L 1R9FA 5D1ZA 3T12A 3T4AB 5A2AA 2IQIA 1LMKA 4B3CA 2VQEB 4MWOA 4X97A 4KROD 3RVUC 2FK7A 4EENA 1CXEA 5ICXA 3HP4A 5ES3A 4GD3Q 5CP7A 3VD2A 3V6OA 5IIEB 4DHLA 1APBA 2HH0H 1WVMA 3OE4A 5JT1A 1F58H 3AONB 5EOQH 5JR3A 3OPYB 4JC8A 1H1TA 5KQGA 1C5KA 5LYJA 4KO8A 5EUKB 2V45A 4FDVA 1EEHA 2G25A 1DFBL 3AKCA 4TSRA 1GUYA 2O3UA 4QFMA 4EUEA 4OZGB 1WWWX 4XH2B 3KZ1E 3QJYA 3KZXA 2CJTA 3V8QA 4RVNA 5FYDA 2AFIB 1M7DA 1BKYA 3EF0A 1L4MA 4LXGA 2CVPA 3DAPA 4TMWA 1JA0A 1YS2X 3BKYL 1F2TA 2R0WH 3M5DA 3HUJE 2GWRA 1L7TL 2VJPA 2L19A 2JFFA 5EVCA 3FDFA 2ZXAA 2NU8B 1Z7WA 4PD4K 3B9AA 4A7SA 3A6KA 5ISZD 2RA1A 2FOLA 4HBGA 4QOFA 2N1MA 2X1LA 2JLVA 2C5BA 5I1LA 2Q76A 1FO0L 2HWWA 4JUCA 4AEHL 3C70A 3RIGA 1KJIA 1EE9A 2G76A 4ANXA 3TS1A 5HJGA 3IO5A 2VIRB 5E56A 1H9BA 3HWWA 3CX4A 4LY9A 2E59A 1EMDA 3ZX5A 2GXQA 1YEEH 2GPAA 4W5QA 1ICIA 2CDFA 3RIKA 5FO7A 1UJ2A 2CNDA 2ZWMA 3C14C 3VH2A 1WY7A 4DDKA 4UHBA 3RIAF 5A5EA 3BGDA 1OLXB 3IBTA 1K85A 5I7WA 3N59A 3GQBA 3I50H 4APXB 3WLMA 2EBHX 4I55A 4HD5A 1YNKH 1UEMA 5K8TA 2XWXA 1IJ9A 1HC1A 3CVHB 1JD9A 3KR1A 1XEDA 1G7QB 5T1JA 4DETA 4CM6A 1MWAH 1D0VA 2YWRA 2Y1DA 5TMBA 1RIVH 2L7QA 4CV3A 3HG0A 2O6EA 5D2NB 3GWZA 2HLPA 5C7LO 4A2DA 1QS0B 1Z18A 3QXXA 4Y0VA 4CIYA 4AW7A 2IYZA 4GAFB 1RHFA 4N9QA 2JFVA 1FV1B 1B4LA 4EUPH 1R24B 3AG4B 2NIPA 1L4EA 2DM3A 3BQUD 3BGFB 1FQOA 2A83A 2CLOB 4IJ5A 2OR8A 5E6SB 2WTUA 2COVD 3QAZC 2QMZA 1QOKA 3IT1A 5FB8B 5KO2A 2GPBA 1NQ5A 4WNYA 4H7FA 2AXGB 2ID9A 2B4CH 5IVHA 3H5IA 4I2NA 1SBIA 1DEKA 1I3VA 4JFDD 1U8YA 3GLHA 3AS2A 4OO3A 1O6FA 2BVQB 3KJIA 3MLPA 4FFMA 3Q40A 2YGOA 3T0EA 4B6QA 3JD2A 1N77A 2QRLA 3N3EA 2AW5A 1UXWB 3B2QA 4ZW3A 1FVEA 4F7PB 5KYXB 4MQMA 5FV7A 2C4WA 3NCWA 5JQHC 1T1WB 2I32A 4Q1DA 3D3KA 2JELL 3IMVA 5E4IA 1GZ3A 3C3YA 3LQAL 5IANA 1D6NA 4GKZB 4CADB 2I22A 3WEXB 2ZIGA 4HV4A 2OOKA 4J3UA 3D5EA 3QRWA 4LHUA 5F7MC 1U8IA 1L5FA 1YCFA 3V6FA 1BX3A 1NI4A 3U30C 4DPBX 4W8GA 3CWCA 5EUMA 1CTOA 1C7RA 3FMIA 3Q1LA 3W2EA 2HMWA 4WPGA 2EJBA 4UB0H 3TCNA 3T15A 3D0LB 1U2SA 3F7YB 1UB6B 3CXRA 1JFSA 4PJ7B 3UJIL 5E51A 1KMGA 4DJ5X 1U99A 4D1YA 2HPZA 3MD9A 4TVPH 4JFQA 4EVNB 1P45A 4EHNA 3DBHB 3D3VB 3VMMA 2XIIA 5ITZB 2G9KA 4MR9A 3C3MA 1CWUA 2NTJA 2NY0D 4WZBB 4NPAA 1U9IC 1X3LA 2HRHA 4DXAA 5ILTL 1CLOL 4YXLL 4K9QA 4YIQB 3IJPA 2W83A 4L8LA 5C5DA 1M6YA 4J6IA 4BFGA 1L8QA 4U6VH 4XHQA 1SDDB 5DTFA 1PZ5B 5FO2A 4I50A 2XVGA 4P93A 1NBWB 1OK8A 3TJEH 1IUKA 2CGRL 3WY4A 3AEUA 3AWGA 3G04A 4PJHF 3EGOA 4NZRL 4AUUA 1JF1A 1VJ0A 4FWBA 3IPYA 5T57A 3S2IA 3FCTB 1V2HE 3UG6A 3MUFA 5CIQA 1KBOA 3A6OA 3AI3A 3EBIA 5GJBA 2OHOA 2GHTA 2OXIA 3PWZA 3A24A 4WCDA 4PJBB 2WMYA 1LV7A 1AH2A 5EFOA 3E5MA 2BVPA 2DQFB 4R8RA 2K4WA 3Q13A 5FQNA 4AM0Q 3ISRA 4C54A 2Z5VA 5I75C 2XW6A 3R6TA 4H3VA 1N2XA 3PDUA 2AVNA 2CUZA 5JOQA 3BA1A 1SOKA 1LK2A 1YDPB 3WGLA 3U82B 1TJ5A 4J7RA 1FVFA 2C9AA 1N25A 3QZNA 3ZKXB 4O1MA 5JW3L 4UTXA 3BAJA 4R41A 4IDNA 1NVEA 1JA1A 4JV5B 4GUPA 4X9GA 4F2EA 4MJ5B 2QLBA 2GBUA 4JE4B 4JT2A 3RX5A 4QO7A 2F2TA 4ESVA 4XP6L 1DIOB 3HWSA 4U6XB 3OQBA 4CTMA 4Q4CA 5KYXA 3FF8A 2JCYA 5L2KB 3M6AA 2AQ8A 2D8AA 2O8EB 1TKCA 3KPPA 5C3IA 3L7AA 3SGJC 3NA9H 2YINC 1CXIA 5J4YA 5MP6H 3GSWB 1U7UA 4ICXA 3JQRA 3RV3A 3GEHA 4FMFA 4LQFL 3GJEB 3I1YA 4AJ9A 4RDXA 3WP1B 3MO1A 3WN5C 1UB6A 3BUQA 1RQ7A 4DWOA 1R3IL 5A6VA 3U0TA 1O8BA 4EG6A 5JHBA 3H42H 5J57B 3AB0B 4KO9A 3D3VA 5C32A 4UANA 1GPOH 4MUIA 2O0HA 2Q21A 3COJA 3QXAB 4FJZA 5IHHA 2PW2A 2KHZA 1IXKA 4WFHD 3BRGC 1T2EA 1BAFH 1LI5A 2X4GA 3B82A 4NFLA 5BYKA 1CZ8L 3SP1A 1J1ZA 2EQAA 3W5DA 2ZNXA 4HWPA 4X1YB 5BMFH 4I1RA 1TA0A 1LEHA 3LW7A 4DGWC 2CKBA 1VHPA 4WY2A 3LDBB 5AVQA 4Y9BA 3O2QB 2XIJA 4HOWA 2GHZA 2J3IA 1J8MF 1TQVA 2QUBA 4BJ6A 5JS6A 1E0JA 4KUZL 1DEAA 2AUNA 4B8WA 1NC1A 3ELYA 1WD9A 3RTQB 1FUEA 3CN0A 2F8VA 1WW2A 3KEGA 3QDGD 2WV3A 1L4YA 4GOND 4D41A 1XGZA 3MYYA 5EIQA 4YECA 2XLLA 1Z3IX 1VSQA 3R0NA 3IQEA 1NQXA 3WD5L 5F1KA 1WSBA 1Z8FA 3NHYA 4CM5A 3H8VA 1NVUQ 4A0HA 1JNHA 3UJJH 2UAGA 3H17A 3RC9A 2EWMA 4GM1A 1QVRA 2FL5A 2AXNA 1NPJA 3CX5J 5JC1A 1LNSA 3NOOA 3QXWA 3CRQA 3EVZA 2D4AA 1R4NA 1RP7A 4AIEA 1EXNA 5HTOA 4I7ZC 1JPJA 3UMVA 4BQFA 3W5JA 1T5BA 1NLYA 5AVWB 3PG2A 1PI3A 2G5PA 3LXBA 5C0RL 4I0PD 4P8QA 1HEUA 1I30A 4B95C 1YNSA 3CZNA 4KXDA 4QCIA 3FUIA 3EYUL 1XVUA 2QORA 5FWAA 3EMKA 3KPLA 3U2JA 5KUKA 3CR8A 2R8YA 4OVKA 2WJWA 1CDEA 4HIIA 2FPRA 4Q6IA 2RGGA 3QKUA 3U6RA 2ZETA 2AZMA 3E5NA 1X5LA 4HWOA 1UVQA 4H13C 3D39E 2FQEA 3OPYI 4ZUSA 4L08A 2PVSA 2IK8A 4C3UA 5FW8A 3RHZA 3HDGA 3LPCA 1AVAA 3S48A 4UQLA 1A69A 3EIEA 1YEFH 4BFNA 1OXMA 2FE0A 3PE9A 1L4IA 3DR3A 2B36A 2V3VA 1LEIA 2DFLA 1VCAA 3CH1A 4FHJA 4UQBA 1LPBB 4IMRA 5BSTA 4MRAA 2HWXA 4AO7A 5DJXA 4UTVA 1Z2DA 4N0UA 3MO1B 4L73A 4BBAA 5AOBA 5T3UA 4RY8A 3NBNA 2M8XA 1N12A 1YQWA 4J7XA 1WCQA 1CTMA 2J31A 3K1DA 1J1PL 5L4FA 3NTLA 5ADOH 1BCIA 1Y6ZA 3KPQA 2GBVA 2J2ZB 4N9GA 4P86A 2MSPA 1WZIA 4ZPTB 1DSSG 3E4DA 1F2TB 3ZVVA 2Q9OA 4G6JH 4YVNA 2I2WA 4LVNA 2DYPA 5FNZA 5J9PB 3RGVD 4BZYA 1QZ3A 3OPZL 3NP4A 3CJJA 1GKKA 1U94A 3FFBA 5EE0A 2GY5A 3B3QA 5DPMA 3BJLA 3HJCA 4KLZA 4F0JA 2WSDA 1PS9A 3I0MA 4MIKA 2FEMA 4MA4A 3NA4A 4DEYA 1FNDA 5JORA 4D9GA 3PCRB 2X58A 32C2B 3ECAA 4JGGA 3OC8A 3CN1A 1PQPA 5E24E 3MA9L 4P4KB 3LRSB 1IFHH 4BXVA 2F8IA 4GIBA 2MQ0A 3QMWA 1I4FB 1IAKA 4GFXA 3AROA 1K4CA 3SXJA 3JTMA 4RETA 1U2GA 3DDOA 2X0WA 3QXHA 5JS1A 3AKYA 1RXEA 4AMKL 3SAJA 2AOUB 3EBAA 3RVTC 3ICWA 3PGLA 4KI5F 1XDGA 3R9IA 5C0IB 3OQHA 1C2YA 4RHEA 4PYHA 1FQKA 2PKEA 4K3JL 3GW8A 1GAFL 1H42A 1Z6XA 3QPQD 5TJHA 1IAOA 3FN0H 3UC0H 1CUCA 3L07A 3FY4A 1ACJA 4C47A 3U9TA 4HDRA 4BX0A 5C1PA 1TPXC 1DDOA 2Z92A 5FO1A 1DUZB 4RAVB 3VOBA 3VO0A 3PEEA 1E8XA 2MJWA 4PJCF 3JXEA 4RJLA 2DBRA 2CMGA 3MZ0A 2H00A 3L3HA 4DKFH 2Y6VA 4HWKA 1QACA 1WS8A 3NOXA 2DC1A 4TV8A 2YVQA 3KHKA 1T9CA 4UMGA 3JZMA 2GN9A 3FGPA 1RU9L 4PRNB 4WVFA 5CJQH 2XX3A 5K9OA 2IPUG 4C7KA 3TQHA 1VOTA 5FULA 2WT8A 3EO1B 3NEOA 4D5GA 4PJAF 3ZL1A 5TK4A 1T4CA 4RVFA 3K2IA 2VPQA 4GMDA 3QBVA 3SS9X 1WXGA 4N0CD 2DQDL 5EU5B 2E7LC 3NVKI 2J5BA 1T7XA 2VMEA 1B2LA 4AH2B 3HA0A 5AOZA 2H18A 4WTOA 1NCUA 1OGPA 3W5CA 4YDKL 3HMWL 3JALA 3IBOA 3LIPA 4BH7B 1UEJA 4KODA 2H06A 5KNCA 5GWXA 4LHUB 2E87A 4YC7A 2AJUH 1V8BA 3QPAA 4MUKA 3BPNC 3COZA 4GSUA 2FUCA 1MPAL 1S2OA 3ZTYA 2RAMA 1KULA 2OBMA 9LDTA 1F38A 4A7VA 5CMLA 4Z49A 4J7AA 4MA1B 1KG0A 5K8IA 4HN9A 4KHZA 2HRQA 3G8AA 2QAGC 1JJIA 3KQSA 4GR4A 4BQSA 3INNA 3NIGB 2J48A 3GGDA 4PLGA 1M2HA 3QFTA 1UD3A 3S3JA 4D9QD 2P8JA 4LSRL 3ZTJG 2XMQA 5K6AC 3W5NA 5A1AA 5LXVA 1UP7A 3A47A 4PB9H 4H1LH 3VYPA 2G4EA 1KFKB 4PHGA 1T5WB 3K8KA 1Q94B 1AUXA 1KF0A 4JZJB 1PZSA 4HUXA 3VE0A 1L8OA 4G24A 3BJZA 4UJ5A 4XIFA 3WDKA 3PC3A 3ABSB 2EDEA 4Q0XL 1WUTA 4Z8YA 2PGAA 1OKEA 1QFSA 2R0KL 3WSVA 2P11A 4YFLI 4NZOA 1J05B 1OIXA 1DJXA 1KN4H 4JFSA 1RJLA 4B5KA 1BA3A 1GVIA 3DXAD 3NCTA 3R1GH 5EU6D 3SDAA 1LXCA 5JVDF 4G5AA 3WISA 3BUBA 2F3RA 5HJ5A 4TZKA 5KS9F 2W60A 2Z0UA 3KPMB 4HW6A 2HA6A 4JLPA 4DGYL 4UTAL 1R5BA 4LHSA 1P7YA 2I8CA 3CFEB 1JXGA 4KVZA 1NAMA 3PGJA 3O3BA 4EI5C 1KBZA 1ORHA 2R9HD 2H7XA 5C0EB 3TO4B 1KQGA 1A6UL 2Y2YA 4BM7A 2Q3FA 5KS2A 1R8SA 3KWUA 3TEZA 1IGCH 4OAOA 2RALA 4YRIA 2WYZA 3HLYA 1BE0A 2HADA 2HUHA 1KB5B 4GGPA 2ZT8A 3LUGA 1XGUB 4B6ZA 4J3FA 3IALA 2F62A 1SWWA 1A8JH 5HVFB 2X2PA 2BFEB 1JV5A 1NYQA 5DRWA 5G4KB 2WJZB 2G6BA 2PO6B 2R4QA 3EW9A 5FGCE 4OU3A 2VP9A 2YPLB 2GFBB 3V0IA 4GX0A 4UBNA 5BXQC 2PYED 1NBAA 5P8WA 2B3IA 1JDPA 1VCMA 4D9LH 8ATCA 2K3HA 2H32H 1VYVA 3WUWA 2Q3XA 2CJFA 4F2GA 3OOWA 1I4OA 2R8RA 1JHMA 1UAYA 3LN9A 5C7ZA 2VXUL 2XYVA 2JI7A 1MT0A 3Q2OA 3NYQA 5CHYA 5ACLA 3E15A 3TNDA 1CX9B 4LF5B 1FU7A 2D2VA 4NP6A 1TTQB 2JVKA 2GZ1A 5KW9L 1OGAD 2HRBA 2F19H 3KPSE 3GJ8A 1CE8B 5DHEA 4UQ2A 1ZS9A 1GGMA 5EXXA 1NGWB 2J1LA 4UHFA 2YUIA 4Y1FA 1PLBA 1NPUA 1KCWA 1BW9B 4GRLA 4GKZA 2LLLA 3HZYB 3UADA 2WYHA 2QQKL 3EZ9A 2QUAA 1KNXA 3TNYA 3FUCA 1Q7GA 4FZ8L 2E85A 2H7YA 4OGAD 4DC0A 4LE8A 2JGAA 1T5XB 3EUDA 1JV2B 1USGA 3TU6A 4L3OA 3QJFB 4G42B 4NMWA 2ZXDA 2V2TA 1UFVA 4OZFA 1QVOA 4NRDA 3OC5A 1JG7A 3MOAH 2WA1A 1UZLA 4X6FA 5JIBA 3A6EA 4DABA 4JSYA 1UM5H 3MAGA 3TLBA 2YASA 1KGIA 4XB7A 2YEZB 2A77L 1JHYA 3NIGE 1WLYA 2BFDB 4Y1RA 5C0AD 1D4OA 4YXHH 5BN4A 4H7KA 1RZGB 4Q93A 1A8ZA 1AP2A 2I3DA 3SICE 4ZNEE 4PJDE 1SHXA 4HLUA 4HLDA 4I4TF 4ZVSA 3U7GA 2V96A 2C57A 4D45A 5EZYB 5CD5D 4FGLA 4G71B 1NVDA 4JBYA 3KM2A 4YJHA 3R4VA 4G8EA 5CLLA 2W6JA 5DVZA 2WQSA 3VJKA 5F96L 2XRYA 3NEYA 3ZW7A 4OCSH 5LKAA 1HYSC 1JPSH 4OGYH 1HJBC 1KFCB 1TJYA 4WWKD 2O20A 4OQTL 5F7LB 4LRNH 4BWWA 4HZUB 3EH2A 5MEND 4EG3A 3K2EA 5CEXB 3KTAB 2ZI3A 2VL5B 4NN6B 3F49S 3DUHA 4QJ5B 3L7FB 1T80A 5KTOA 4UPDA 1UM6H 4HHGA 4MDRA 1EGVB 2OZ4H 2IHJA 4MVJP 2ORVA 4A0SA 3RU8L 1JN6B 3OG9A 5E94A 2FDCA 2G3ZA 3GZTB 3FO1B 4MK4A 1NR7A 4W9KC 4D4LA 3HE7B 3F01A 2QENA 4JN1H 4O0LA 2VLLB 4AMBA 5E8DH 2VLKE 3KETA 2PYFA 5FYJD 3DONA 5A4JA 5FOSA 3AETB 4WAFA 3NWJA 1MCQA 3DF9A 5GJWC 3QPXL 3BC9A 2K6ZA 1DKPA 4WBSA 1F1JA 4I1SA 1YEIL 4YT2A 2NVWA 3S99A 1I6WA 4UUNA 4IZOA 1NOLA 3M83A 1GR7A 2GPYA 3QUAA 1IBZA 2Y06H 3L95A 4EJSC 1Q9OA 4EPXA 4L8SA 1DEXA 1H6FA 4UVEA 5JJ5A 1H3UA 3KJFA 2PSHA 1MNAA 2ITCB 5D70L 4GG6B 5FWXB 1ZGLA 2XN9E 4OF3A 3ZH9B 3RZCA 1RZ8A 3F5QA 2NQTA 2WVVB 2EIZB 3PL6A 4OGXL 1IGFL 4OHYA 4S1SH 5E7JA 4XZ4A 3FH5A 4FNSA 1HDGO 4QEKA 3UEZA 4TWZA 5F4BA 1G1MA 5DMKB 2CJUL 4ND3A 821PA 1HX7A 1BYNA 2BP3A 2WV9A 3D9AH 2VRKA 4HGZA 1H3VA 5GTDA 2O30A 4XSVA 3MINB 1NKOA 7MDHA 3D5OF 3CH8A 4C83A 3JQAB 5KYGA 3ATAA 1XZJA 2R0QC 3DX0A 1HTBA 3CLEL 1CD1A 2YHBA 1YQVH 4HEA1 1QNLA 1PR4A 2Q07A 4MD5A 3MBWA 2B1JA 1T9BA 4PU2A 3HVJA 3TSZA 4JL2A 4PSVA 4QUAA 1PIWA 2XIQA 1V41E 3O6LH 5J9FA 4KOAA 4J12A 2YL2A 4UOJA 1TU0A 2QG6A 2UZYB 4RTJA 3QXDA 1JPFB 1QSVA 5AJXA 1VZHA 1IFRA 4F38A 4AS3A 1EFCA 3O91A 3O8XD 3C3WA 4ZW7A 2VAMA 1F0KA 3DZJA 4QC2A 4FOOA 1G6RL 3MJ9H 5EU3B 1NANH 4GLJA 1B4DA 3I2KA 4YRMA 2OL3B 2VPWA 4MSWA 2YSTA 2MSEB 2CYCA 3BP4B 1G84A 4E12A 3P0YH 2VJMB 4L1HA 5GZOA 4DSAA 2PH7A 3BSFA 4TKZA 2ZM5A 2A92A 2FXIA 3OWXA 2C26A 3B51X 1T66C 4B2IA 3T1TA 1JWSB 2C2HA 1OV6A 3INUL 4FK8A 4F9FA 3NZHH 2OYKA 1SCJA 1A1OB 2ZSVA 1P18A 5FPIA 4F8PA 3Q48A 3P0GB 4D8VA 3CD4A 1E3IA 5CB4F 1KIRA 2R2BB 3TF5A 2AJXH 5CGQB 2AJYH 3NC4A 1QGUA 4FDLA 4L5CA 4DF9A 1CJKC 1RK7A 1G1KA 4NAUA 1XAUA 5DLLA 5T5FH 1F8FA 1IFGA 4M7WA 3MD0A 4ZJPA 2QDWA 1V39A 3QDJD 1DJMA 3QG6A 1NGYA 1CFBA 2DLHA 3KYBA 3R3HA 4C3OB 1YE5A 5GV8A 1HHIB 2RK4A 4YUVA 5F1KC 2FSEA 1B93A 5C8YF 4YHPA 2H5JA 4XBEL 1XSKA 5C0BD 4B3IA 1DLIA 3QFJD 2ZS7A 1JSYA 1Q7CA 1O89A 1GOTA 1NYRA 2IC5A 3GLSA 3EXHC 2RB5A 3ZHVA 2R1UA 3WXWL 2IIPA 1CUHA 4XGNA 5M7EA 3ZH2A 4LIQE 1QLWA 1XYGA 1AXGA 1FRZA 1XRPA 3TIXB 5A6SA 1UEIA 1SFRA 4MUJA 2PWHA 1XNHA 2ZICA 3H2GA 2HF8A 3WE6A 3O94A 5D2NC 5CIPB 4LKOA 2QX4A 3PPIA 1CD0A 2A2ZA 3K6DA 3RS8A 1RSFA 3PJNA 3ND6A 3SKJH 4QJ3A 3ULAB 2I69A 3DMNA 3ZE1B 4LXTA 2B59B 5EIIG 1P0MA 5LZ5A 2PU7A 1H05A 3RP1A 4CU7A 2ZYRA 3Q5GA 4TNWF 4LVOC 3UCRA 1WDWB 2CBPA 4MV0A 3CHSA 4FFLA 3W4KA 3STXA 1GCAA 1YYCA 3OIVA 1OF2B 2VTKA 2J3JA 5T7BA 4PJDA 2Q45A 1KXQE 1DLHA 5MN4A 2XKJE 4REQA 3WGYA 3AHDA 2VR7A 3MNFA 1V26A 4MARA 2WXJA 2JFBA 1R6TA 1NPDA 2P8SA 2YS4A 1PQZB 5C86A 1FMJA 4HKXA 4KMRA 3PJSA 3W6ZA 4MS4B 1B0GB 1JHVA 2GKOA 4FIDA 4Q02A 3PCTA 4YRAA 5EU3A 5IFKA 2YXBA 1YD7A 4EI5A 3BUIA 3J81A 3OM0A 1TQDA 2WPDD 1Z0IA 2ST1A 3WFDH 5DMGD 1I6MA 2XUDA 1UIRA 3BYTA 3OZ9L 2C1ZA 3TRFA 2OMYA 2UZAA 2ORBL 4O4JF 2X6CA 2P8PB 1IZ7A 2FGKA 2CNBA 4MVCA 3AQXA 2ZCHH 1U8MA 3IFOB 4ZXBD 5LMCA 2F18A 2CZCA 4ENQA 3I58A 1HUQA 5FLEX 3QMPA 3AWIA 4L4VD 3NWPA 4HG2A 2XIDA 1LFDB 1DQLH 2PUCA 1UBKS 2ZRMA 3SE4C 2CJWB 3IFOA 1XKTA 1RZ7L 5K9KA 2IBBA 3HCOA 5IMMA 1LSSA 3GMQB 1U1GA 2XQGA 1UP4A 4WW0A 2XNCA 1X9LA 3ZMNA 4HZ1A 5D7LB 1KFAL 2P5UA 1LBQA 2QGCA 3EXG1 5EE5B 5DUMH 3DMYA 3T0EC 5C7IO 3QVGA 1NV8A 4OW6A 1HWHB 2ZOLB 1JN0A 5DZVA 4E9WA 1Q0XL 3GZNA 4X3PA 2R5WA 3RK0A 1KZ6A 2DN7A 3VMPA 4HAUA 3DWFA 4ASUD 2XE7A 4FULA 4GEGA 4D4HA 2ISQA 2ZYUX 3KLQA 1Y4SA 4YI5A 5KNLA 3S2CA 1QZXA 2BKXA 5DHYB 1UWGH 3UP1A 3T1FB 4K5OA 1UBHS 4JKIA 4IU3B 4JO3H 4I89A 4YHNB 2RGWA 3GLAA 1QLFA 1PHRA 2EX4A 1WA1X 3WLBA 4B3FX 1QP8A 2JCSA 4IS6B 3RBAA 3MLUL 2YWHA 3MLSL 1X7WA 3CT4A 4EPTA 4WK6A 4GPBA 4DFDA 4YXLH 1TK3A 1YN7A 4LLWB 3Q8BA 4S1VA 1OB0A 1IOVA 2IQAA 3K4ZA 3T3ME 1BREA 3LZDA 1PU2A 3HDYA 5GSVA 2E6UX 1B6SA 2ZKYA 3MRGB 2R1WA 1RWVA 4RF5A 4XBPB 3UJNA 1VRVA 2YMPA 1A8HA 3D2CA 3PUUA 2VSCA 2VCEA 4AZ3B 1T4BA 4ZZIA 1P75A 1J70A 4WLNA 4LPSA 4PY8I 2QPFA 4GNRA 1KJQA 4IOJA 2CUAA 3VRIA 1U3CA 2FPGB 2D0PB 1NVWQ 4PG6A 1ABEA 1RAAA 1NOKA 1ZUIA 2XOTA 3WUZA 4RHCA 4FGUA 3TL2A 5F5NA 2D3TA 4ZJ9A 1RZKH 1JYSA 1P5ZB 2FPOA 2FWBA 4A3SA 3RZCD 5FDFA 3GELA 3ZEAA 2BXYA 3P11H 4TLKA 5DD0H 1LBTA 2CL5A 4ASUA 1KXTA 4RFOL 3K9CA 4B2YA 2HDWA 3OKFA 5T64A 1WS7A 2NNAB 1LO4H 1VPWA 4HT1L 1PEYA 3KKOA 1MAJA 4R7GA 3OAUL 2A57A 2V98A 3H1ZA 3FAZA 2DHQA 3ROLB 4JL8A 3EDDA 1KTIA 1YHNA 5BRZD 4NO0D 3IE2A 5EWLB 5CJ8A 1P9NA 4A37A 4RX1A 4CR7A 3MZTA 4P2BA 4Y5XC 1N4XL 2OM2A 3OU6A 2WTRA 4PRDA 2QKIA 5F52A 3ZI4A 4ZI7B 1TR7A 2R66A 3TJEL 1M2NA 5FUXA 4NBZB 4FQ1L 1TD1A 2PRIA 1OAKA 2H1LM 4NYIR 1JS4A 4PFEA 1FCGA 3KZ8A 2NY3D 5BR1A 1ZHLB 1IMOA 4ACTA 3JVFC 1N5IA 2QAGA 5EP1A 1JFTA 2GC7C 5IJ9A 2IV8A 1U11A 4BGVA 2W00A 5EDSA 1NCIA 3U7QA 4KK3A 3KL3A 3BWZA 2EDWA 1E18A 5A3IC 3EIHA 4LK4A 4KYUA 2Z4RA 3D4ZA 3L7BA 4V11A 3EEOA 4RRPM 3IEUA 4ODUB 1I51A 3JQ6A 4UU7A 2IAMD 3KYCA 4X5WB 3BWYA 3TQCA 4HSAC 3FGNA 2OOSA 5CNKA 3UJIH 4ATTA 2Q3BA 1XGKA 1Z2KA 1AKUA 2AW2A 5K3CA 2NXYB 1A0OA 1GC1C 1IWPB 4U6HA 5E9DB 2D6FA 4E5XG 1YKGA 3GTVA 5IM7A 3MBXH 4OMCA 5DW3A 4FNLH 2DUWA 4YHOL 1ZCZA 2MOQA 5J6GB 2EDHA 3CX3A 2ZT7A 4MXDA 4Q4AA 3NTRA 3GBSA 5E4EC 5AP9A 4G43A 4HUQB 4BELD 1VP3A 4KTEL 2ITCA 1YRKA 1G7LB 4RXMA 4KXZI 3BKCH 3VTTA 3ZCRA 2QZ9A 3RIFK 2JIMA 1BH2A 5HDBE 1SU4A 5JCJA 3TLYA 4J9VA 4APQB 2UX6A 3QISA 2O2IA 2CFCA 2WU1A 3BPCA 1ABBA 1THCA 3MXWL 1K3ZA 1DKQA 3BK1A 5GIRA 2VXTH 2PJUA 4D94A 1NW5A 2D7MA 4P84A 5A2JH 3RYIA 5DYYA 4OXNA 4Z7QF 3P45A 2I2FA 1PR0A 4AGOA 3D39B 3QYPA 3HBAA 2XWRA 4YRPA 3AFGA 4GAEA 4PYJA 1WBDA 4D8PA 1XRMA 3N0TA 5JDJA 4QPPA 4HNQA 4RDHA 3UFXA 4B3EA 5IJWA 2BZGA 2GKIA 5HDBB 3W39A 1CICB 1E2QA 5KG9B 4XB6B 3R7WA 1GZQA 1O8CA 3M33A 4EVIA 1ECLA 1G0DA 2GTWB 4FZ5A 4UJ3A 1WBXB 4KDWA 2D7CA 4FZJA 4AN0A 5KAQF 2P4QA 3L5JA 5ERGB 4AQ8C 2ITDB 3GJFK 3NZ8A 5CFMA 3HDQA 4K6CA 3EKCA 3CN4A 4KXNA 4AYGA 4PU0A 2RH4A 4MGHA 3IP1A 2AV1A 3GUTB 2I5PO 3DE2X 4DGYH 1KSJA 4I1OA 4DL9A 3ZDYF 2F48A 4WTXA 1W93A 1QB8A 1TTPB 1MG2C 4DO5A 2R00A 3LQZB 1FZKA 3T8XA 2D8MA 2VITB 4NERA 4TQ8A 1T3HA 2WJGA 2H1XA 3B6SB 4DB2A 2DT8A 1E3TA 2EGHA 3LPAA 4F86A 4IEEA 1U3JA 1N6OA 3L9RA 3RWDB 3N2ZB 1GCOA 4K87A 2H2PC 2WWHA 4N2NA 2XV0A 4P06A 2BISA 5JRJA 4JLRB 2ATXA 4AKIA 1IAIH 6AT1A 5DDHB 3ZHOA 2JB5L 3FKJA 4XW2A 1IOZA 4PPTA 1ZHHA 4TV8B 3DTVB 2ZUSA 4YVUA 1HC7A 4RLFA 3I9AA 1H6BA 2V5YA 5F7WC 1PO7A 1PZGA 2QTWB 2DFVA 3R0IA 2E21A 1H2FA 1U8EA 5HILA 4GG6A 1YYMH 3OZWA 4HYYA 5EPEA 1TIUA 2QMOA 5BNZA 3H6AA 2PZ8A 4GO1A 1MD9A 4HIEA 4XBMA 1TQBB 1X1QA 1K2DA 1FFAA 2AEQH 4NCXA 3RHFA 4MLDA 3ME0B 4WHTB 1OXKB 4LJ8A 1TVMA 4AGQA 1SC1A 4K2HA 1DJOA 2ZQZA 3RRZA 3HNTH 1BWSA 4M62L 2H26B 2AEPL 2WQZA 1ZVHA 2AXHA 3EEFA 3OJDB 4I08A 1MBZA 2VDPB 4IOFD 1RJ9A 3U9LA 3V4PL 1U0OC 4BVJA 5J5VA 3G02A 4Y2VA 3OMIB 3SHVA 3S97C 4U1RA 2NXYD 2UZ1A 1BDYA 3A9VA 3VVLA 3OHSX 1VLXA 4C6HA 2A1TR 4FKKA 4WDIB 1TZAA 1L9RA 1T0OA 4DC1A 4AG3A 4RM2A 5ALMA 4E32A 4O2CA 4XMZA 3IBSA 4OI4A 1EWHA 4P9ML 3BLPX 3EOTL 4DJMA 4LNHA 3KPVA 3PCYA 3P40A 1N8OE 2ENQA 2AX3A 3DZFA 4QOEA 3ANYB 5BXYA 1G9ML 3B7GA 2XN1A 1TMKA 2FTAA 1RHUA 1Q1GA 3O8DA 1ULUA 4X8HA 4R7DB 1KTDA 4ZW6A 3HK2A 1LDMA 2ZXUA 5AVVB 2WT9A 1PGOA 1K5PA 3W1WA 1MQ8A 4YDQA 3H2BA 3VR2A 4KR0A 4QKXB 1ZC3A 5CTAA 1H3WM 5GQBA 1E4XH 4WI1A 2OMUB 4LDCA 2YAFA 1FFYA 1KLUA 3GXTA 3VXRE 1V10A 1UXIA 4GEJA 5LDSA 3FS9A 4TUUA 4XOCA 5J40A 5DM4A 3IQIX 1HMYA 1XVSA 3WYCA 5IJDC 3AHFA 5IHZB 4N8EA 1HFWA 2FH6A 4RPGA 3VG9B 5KIAA 4P0TA 2CR0A 1ZXXA 3TIDB 2GYSA 3EGCA 4FFZL 2CXNA 3ZGIA 3RURA 3BZEB 2KS6A 4RQUA 4LP4A 3QQPA 1W4BA 1N5JA 2F4NA 2I4LA 1VHQA 3A05A 3QCVL 3ILHA 3QTLA 3BD6A 4UT9L 4Q3OA 4QD3A 3JV5A 3FSGD 5HHXL 3VXRB 5HTKA 2QZ5A 3CSYB 3NIBA 2VLMD 2PR9A 4EYSA 3V0EA 1UK8A 5AW5B 2TMDA 4LSWA 3RC8A 1HRKA 2DLTA 1RM0A 3IF1B 1Z63A 2PVCA 3QEGH 1DIGA 4LBYA 3LWNA 1I2BA 1QBMH 3GWJA 1JG9A 3R41A 4OJTA 4P2OD 4EJFA 3N1QC 1KR5A 2E4XA 5ESAA 1JJVA 1NW7A 3DT6A 4DGVL 1KYXA 1BU5A 4U9UA 3SHOA 5FA8A 1M1XB 3MCWA 3FTQA 1D03A 3EHBB 4G07A 3B5EA 4NJOA 5JFOA 2ORWA 1OXUA 2VAPA 1NFKA 4FYVA 3BN3B 3LDUA 5IB5B 1X42A 2I4RA 3H2JA 4LF9B 2ZNWA 2PA0A 2XNSA 5MGBA 4XAKE 4LJSA 4ZPJA 3BVXA 4R8LA 4HSGA 4XNYL 2XGOA 4X9FA 4DV4B 2VO5A 4PJEF 5IU6A 4UNPA 2VRAA 1RYHA 3HVKA 4MI3A 1DXQA 4K2UH 5HGBB 5IB4B 3IA7A 3CH1B 4NEHB 1F12A 1LWRA 1V16A 3C8HA 5DJAB 1ZJ5A 1ZANL 3PDGA 2YZKA 4TL5A 4BO5A 5F0MB 3ZN2A 1V5EA 5I8CA 3NEXA 1QXSA 5HFNA 1EZ4A 1SXCA 1X7QB 1CLOH 4NQUA 4P9HC 2R69A 3ZDZE 4DN4H 4ND4A 3KEDA 4JM0A 1QLEL 3AREA 3HADA 3H9GA 3PU6A 3D2UD 3UMCA 4Q82A 1AXTL 4PG7A 1S9YA 2G40A 4IGEA 1ECPA 3PXAA 4UXIA 1XZNA 2AGVA 1NT4A 1VBNA 1B3RA 4HFJA 3U49A 4N7JA 4UQ3A 4G1EA 4HS8L 3QV1A 4JJ5B 4YYZA 4JFEA 4L07A 1R47A 4Y0NA 1AMXA 3Q88A 4N1EA 2JAQA 1LPSA 4FNOA 5D1XA 1SIBE 5K05A 4CILA 4A2QA 3UAVA 1JP5A 2J6IA 4HZLA 5TQJA 1VFAB 1AI1L 1BG9A 2GF0A 4HX2A 1DWUA 3W0LB 3ZHXA 1TJIL 4B6FA 2FSFA 3IJRA 1J9EA 3P9XA 5JD3A 1RY7B 4OCWH 2XADA 4C7BA 3UJTL 2WDZA 4LI3X 2O26U 1UA6L 4NPYB 5T6BA 1ORIA 3ZQWA 4GSLA 2FHCA 2EXYC 4BQIA 1RJLB 1QFHA 4FYPA 2OYRA 5D93C 5BR7A 3VGFA 3DE0X 3FG9A 1XSIA 4P23C 1UBMS 3NVQA 4XN1A 1QG6A 4GRMA 4R2KA 1NCWL 2O5YH 1C16B 2HMUA 5TF0A 1DANT 1NC4D 4LF3A 3GSNB 5K8VA 5E03A 2VMDA 3A3YA 1QWNA 3EJJX 1R4MB 3DCIA 4YDNA 1U28C 3PXXA 1R5IA 2RHJA 3SPCA 1DBBH 4HDRB 4E03A 5TT0A 1FP6A 1Z4LA 2V6FA 4U8HA 4JQVA 3Q5TA 2H07A 4Y2UA 3HSSA 3KLAA 5CJBA 2A5JA 1RW4A 4AO8A 1AE1A 4ABUA 3E3MA 4P0DA 4XNZB 1WR8A 3DYIA 3FOZA 4V1DE 4WLEA 2W6ID 4EYQA 1FH5H 1DJPA 3FR8A 2AJLI 5AW8B 4MUFA 2NPFA 2AJ3A 2IELA 2MYUA 2Y0SA 2LIVA 1F58L 4XMWA 1P9OA 1DKLA 2VJDA 3OEYA 4Q66C 2JHAA 1BVOA 5JMRA 2PCFB 1L4FA 2ACWA 3GMQA 2DB8A 1U8OA 3LRSA 2X0DA 3UKJA 3ARSA 1WS6A 4OH7A 5IQ7L 1JZEA 2BONA 3PDWA 3TAXA 3TKAA 3N9GH 1G9NH 5LXGH 1WIOA 2BRRH 2VN6A 2H1OA 5LGHL 4GZ5A 4AH2A 5BRPA 2VTBA 5MEOA 1DCEA 1NCHA 4GZ8A 2GUYA 3H1AA 2PNDA 2HZHA 2Z9DA 4YHZL 4L48A 2AE2A 3QFJB 2VL4A 3EZ6A 3APDA 1GV1A 2IDQA 1VXRA 3TBHA 4JFOA 3VFDA 2C2YA 1XTTA 3GBEA 4G67A 4F1ZA 5GGTH 5ID0B 3RBZA 4AROA 2BF7A 5BUQA 3WKYA 3VVCA 5DHAA 1Z4OA 3H5OA 1CFTA 4P08A 4ER3A 3LEXA 2X6UA 4DCQB 1NU6A 2FMUA 3FU5A 1SBBA 2VZSA 1Q5PA 1XQYA 2C4MA 4DXHA 1KENL 4XDYA 4LK2A 1CXZA 1IGCL 4I48A 2WMPB 3K80A 3GDFA 1N2CB 1U4OA 3GAZA 1U0EA 1JIJA 1VF5C 4L5BA 3SBOA 1SLVA 3UWPA 1VPLA 1NJ9B 4PJBA 4UOW1 4GKVA 3L17A 4RY0A 5IBUB 3K8YA 1SVUA 2POCA 1D8AA 2VBFA 3W0WE 3H5AA 4JM2A 2CLZA 3IA2A 2EE0A 3X1XA 3CFMA 5TS2A 4MIYA 3GJQA 2XQYA 1XAGA 4JLSA 3OU7A 2KUTA 4KDTA 3E9UA 4GQ9H 3QZUA 1GS8A 5HIKA 1NFAA 2NYZA 4A4DA 3VNRA 1J8FA 1G8KA 5ALEA 4FHDA 3FB6B 2Z92B 3FNFA 3A1VA 1ZEMA 3TK1A 3L6FB 4UMFA 4DZTA 2BWQA 2B7BA 3H6HA 1ZXLA 3GSQB 4DVJA 2VC2B 1E6OH 1MZVA 4HYEA 1SHLA 4FF9A 4ZEOA 2J3KA 1ZSHA 5AZEH 1FTYA 3MLUH 4OJCA 4GKKB 3GLHB 2MWMA 2APVA 5F9AC 2JHPA 5KUTA 3F6CA 1PEDA 4PRHD 4AY0A 4BE9A 3TL3A 4YJKA 1BFVH 4PJ6A 5KYWA 3HQ4O 5J59A 4LDJA 3POCA 3SOBL 1XNGA 3MLEA 4XWOC 2PUVA 3D0KA 4KR3A 2Q7OE 1UFKA 1W80A 2NQDA 2XRZA 2DTMH 2FPXA 3TB6A 5AVSB 1S8OA 4QDTA 1OROA 3LQRA 2C1EA 4PD4J 2ZJ8A 4JL1A 2OJZH 4PQFA 2LXNA 5F7KC 2BP8B 1S9HA 1RQNA 1WF6A 3LPDA 3H0TB 2VEOA 1VLVA 3BMOB 1QH1A 3QBJA 4E7PA 3THYB 1O6ZA 2I76A 3JWOH 4FA8A 4J4PA 2J44A 1K97A 2W0MA 1FNGB 2VDPL 4QRDA 1L0XA 2JJ2D 3ZPDA 1C4OA 3GC6A 1I4EB 3KPQB 1D9KD 5JSZB 3L1UA 1JZDC 3I3SR 5ACZA 4Q2ZA 2WBJC 1H5BB 2AMVA 3O9MA 2WLKA 4GIOA 1BLIA 3GT0A 4K6MA 5JHHB 1CFTB 3HCAA 3IOMA 2FAUA 3ITEA 1I24A 5AYUL 4MDFA 3VFVB 2Z5LA 2VLJD 1BQKA 2BINA 2IHNA 2YMQA 5KHLB 5TQ0H 1YDFA 3D6TB 1XZMA 3WWPA 2J4WH 5E5UB 2DLFL 1BXKA 5FL3A 4OQTH 1QPBA 3C12A 1SBZA 2GWHA 4WZAA 1XNQB 2ODNA 1Y8RA 2CO2A 3DEAA 2XBZA 3PEWA 3LZNA 3GUZA 3RZWA 2NY2B 2VT6A 3TVDA 4EJ0A 5C7XH 2A0YA 3IN0A 4AKPA 1SOMA 4RK1A 1AK2A 1FIGL 4PP1C 5JSKA 2GZHA 3RWJB 4UUMA 2KDGA 4H1LA 4KY1H 2HJGA 3ET4A 3ONDA 2O8DA 4FEYA 4HD8A 3SPJA 2KBEA 5HF9A 3GBVA 5ARCA 2YRLA 2RKBA 3WAJA 2YN0A 2VH5L 5EESA 1GNRA 3ZE8A 4R1TA 4LIPD 3LH9A 4XLLA 5BQDA 5E1AA 3U9WA 3HVHA 3LX6A 4IRJA 1LK2B 1ZR2A 2DQ4A 2W6PA 1OFGA 4UM7A 1V2GA 1LNUA 1NQBA 2CNKA 1TCUA 4YV1A 2ZG2A 2W2OA 3RD5A 1NCDL 4WI2A 1E9CA 1U5CA 1E2BA 3RS3A 4NM8L 4N65A 4E08A 3QORB 1O0CA 2GTZA 4FXKA 1ZLXA 2E46A 3L0ZA 3NM5A 1G9HA 4C06A 4L4VB 2VDJA 2HW8A 3CPHA 4DA0A 3V2UA 3QXSA 1IMHC 5K3DA 2WZ0A 1GWNA 2L2QA 1KIPB 5D5ME 4XPBH 3M6DA 2X0FA 4C0QC 1A5BB 3NUZA 1A66A 4AG5A 1A77A 1AKPA 1H66A 4Z0TA 3KFXA 1JEDA 2Q10A 1ASQA 4BFYA 4U1GB 3NFSL 1DQJA 3POHA 3PEVA 2EL7A 1HHHB 5BV8A 2B7DT 3MI6A 4M0UA 3KVQA 4B75A 2V17L 1GXSA 2O5XH 3OJOA 1I7TB 3V6BR 1ZNZA 2PMDA 1YUKA 4ZVLA 5EC1B 1FGNH 3MXWH 5DV9A 3H0TA 5JU6A 4KO3S 2R4UA 4PWYA 2OMZA 3RDJA 5I0WA 3VX1A 1XOIA 1YMMB 3KXKA 5CP8A 5HYJE 4DG5A 1ZVJA 1J00A 1E4HA 2BFCB 1CLUA 4KXXA 4XIYA 3SK0A 3CKYA 3I2CH 2OMEA 1R3HA 4M7KL 4IIBA 2F3QA 4KKLD 3ZR5A 2Q1SA 3NCBB 3HB4X 4P4RA 3PHQA 2JVJA 3KZNA 1JZQA 4Z7NE 5HUJA 4R69A 5I8CB 1CSEE 2R7EA 3G9AB 4DLBA 1I7QB 3SPVA 2DMGA 1RJDA 3C4JA 1QABA 1UWEL 1YVLA 3Q1SH 4ZQCB 2W8BB 3P9CA 1D0SA 3LH2L 1YU6A 1H8LA 2GK6A 3T4AA 5E4FA 1QORA 3C24A 1CFJA 3L4VA 4KO6A 4LMQI 4XCYA 1KZHA 1IGYB 3CZKA 3ME0A 3EBOA 1T10A 4PE5B 4ISBA 3IU3B 1S3GA 1Z4MA 4NKIH 4OLVL 3AHIA 3MA0A 2GABA 1DVUA 3LKPA 5I9TA 4NN6C 4AL4A 1P7WA 3ORJA 4PRBA 2W6QA 2XY4A 4D99A 4X6EB 1PV2A 2BXZA 2QTEA 1TQ2A 5LBSH 2FYVA 4I0KA 1XO8A 3UAFA 2XWZA 3SZOA 3U19A 1FOEB 1PJ9A 2E7MA 1KZQA 4FKZA 4FOTA 1Z16A 4JVWA 5B8CC 1CDUA 3KQVA 2GHWB 4GU5A 3TMKA 1O6BA 2I29A 2H7VA 3GRYA 2ATIA 2EYQA 3KEHA 4LXYA 3M1IA 1RLWA 5FGBC 4O1IA 3C3EA 2VOJA 1IBBA 2K7FA 4O00A 4PQGA 5T3ZE 3F5WA 2ADYA 4RA9B 1D5XA 1XJ0A 1L1RA 3S1LA 1H5UA 5EBLB 1W48A 4I9UA 3GMDA 2WE8A 4CV0A 4U39A 3WMXA 3UZEC 4M5YH 3INYA 4OHUA 5AW5A 1QSEA 1XBRA 3TLAA 2GI7A 4NENA 5DNDA 4J3SA 4DIKA 4YRDA 4DMMA 2HLFC 2HGSA 4GL4A 2XT6A 3FHTA 5GGVY 1MJUL 4QFCA 3P4NA 4FTVA 4CIVA 2OMTB 3IAAA 3RB5A 2JQZA 3ZIMA 2W81C 3SOPA 1Q1QA 4ICWA 1OE2A 4IKEA 2O48X 1E7MA 3AIIA 4G5RA 4KAQL 1Y34E 2EH8L 3D1MC 1DRWA 1X9IA 5IBUG 5A5GA 4IQGA 2DS4A 3CVVA 2EFEB 5AVZB 3FBKA 2QL7A 4I4NA 1OT1A 3TIDA 1KU6A 4B9FA 3WZLA 3GS7A 2DJUA 3V0HA 4G3YL 3ZYCA 2R1XB 1R16A 2A88A 4XX5A 5ALSA 1TTUA 2IGTA 1NURA 4JZKA 4DGUA 2ZRQA 4UVDA 1EUYA 3ZCSA 2GCPA 2CB9A 3GGCA 2J9XB 2ICAA 4LLVB 1KXVA 4GPTA 1TA9A 2N3JA 4N9GB 4QOIA 3KCNA 5IAAA 3KGSA 2H2SC 1WXFA 1AOXA 5DBOA 2MSLA 3MKGA 4DO4A 1MMFB 5JOFB 1XF1A 2HXSA 4PI0A 5A9SA 1T4KA 2A0XA 3I01M 4BXSV 4Y5XB 3WI9A 4P3OA 3GNSA 2H8GA 2EDQA 2NR6A 4HYTA 1VGRA 2OR9H 1XBDA 2B1HL 1I3CA 4GXVH 1J0YA 1K3UB 3OAYH 1T15A 5I7AA 3AT8A 5JLZB 4IIJA 1B0WA 2LHAA 1MEJA 4E9RA 5FOBA 4IFIA 4H9GA 3TT3L 1YACA 2JLLA 5LVEA 4O4LA 1UJ3A 1VECA 1QZZA 3TWCL 3TLEA 2EEZA 3UBTA 1NUNB 1NASA 1QTIA 3WV4A 3RF7A 3SM9A 2V9UA 5HTSA 3UPDA 2NVBA 4BLQA 2ZU6A 5J2TA 3FXIC 1R64A 4LSZA 2IPUK 3IBEA 3S1AB 4RISH 1T3GA 1KIUB 4WE3A 4BEWA 1FRFS 3LNEA 2K87A 1R10A 1Y9DA 2WJIA 2RCSH 4OVUA 3ZBQA 5JAUA 1EH9A 4IIQC 3FTGA 5BV2P 3NVMB 4G59C 2R47A 4P9NA 4Z7OE 3M6FA 4PV1C 1U8JA 2HA4A 3ENNA 3ZDCA 5JLAA 4NMXB 4HQ6A 3GSOA 4WTZG 1FXSA 2YUTA 4Y2TA 4A2EA 4CMJA 4HDMA 3DT9A 3VAZA 3SYNA 3VXUA 1Z6AA 4PPFA 1CFQB 4GOOD 4BRVA 3MVEA 1EEYA 4PTLA 1AX9A 2ODWA 3L5WB 1YA8A 5DJDB 5JPMC 3RR2A 1EHYA 1WH0A 1UA7A 3D7SA 4NO2A 3T8VA 1JHXA 5H59A 5CFNA 5I1CL 5H94B 3DBXA 2R4SH 4ZALA 3KJ4C 4NYLB 1F5WA 3IIJA 3QWNA 4JZJC 4NK4A 2H4FA 2JK5B 2V2WB 1DIBA 4J0HA 2FPUA 5AVSA 4JENA 4PNEA 3UOGA 1DU4A 3A9SA 2W0PA 4AT6A 4BFKA 4NJEB 3IGFA 1P73A 4X85A 2IEDA 4XM1A 2NYUA 1KMIY 4ZT4A 1TFPA 1PWYE 1KDVA 1SHMA 4P58A 2ICWB 4IGKA 4EIZC 1ESEA 5ICFA 4KV7A 2GN8A 3BWSA 2AL7A 3MTJA 2I99A 3PYCA 1RZIB 2IV9A 3HXOA 2YBDA 1YJBA 3IXLA 4AD8A 1R6AA 4FE4A 1GGKA 4PRPD 5D6NA 2VQ1A 1QRRA 3QKSA 3R6DA 3ROKA 35C8L 4Z4QA 4N3UA 1YRAA 2RH5A 4MV7A 4O3UB 2PL3A 2FEKA 4AEFA 3GLFE 1MDAA 3CVIH 4WDQA 3ROTA 4AKOA 3IVRA 3IXQA 2E9GA 5CLYA 3BQVA 4B35A 3NJKA 5ICXB 1R9JA 1T03H 1URZA 4NZUH 4LARL 1SUFA 1TQUA 2XZAH 1QPZA 1XF5A 5LM3A 2C9SA 1F8UA 5HVGB 1X87A 1PMYA 3X17A 3O82A 4NN7B 3SQBA 2OHHA 4L3CB 3IFLH 4XVUA 2PE5A 5MN6A 1L6IA 5E1QA 3WO3B 5KBKA 3VPBA 1HY3A 5AOVA 3REQA 1BMQA 3N76A 3DC7A 4NZTL 3F7TA 1MHEA 3I2YX 4Y88A 4EUPB 5JSZA 3IMFA 1QFJA 3QA3B 4G25A 4M1CC 4H1WA 1ZNYA 1N2ZA 4NWIA 5I9IA 4XXDB 2YWBA 3DVNB 3JRNA 4ZQKA 2J3EA 2WMPA 4JO1L 1YA5A 3FQWA 4F3RA 3LN5A 3RNKA 2GAOA 2GW5A 1JXJA 1A1VA 1GJUA 5DK2B 1FLVA 1Z6TA 2PWPA 1Z39A 1LXMA 1TQTA 5BV7H 1YDWA 3QLEA 1GKIA 4N8CL 2DMCA 1R0AL 1DBWA 1Z4PX 4NRYA 1G43A 2Q5HA 3GB9A 5DM2A 1CD5A 1VGEL 1XD0A 3QZBA 1NJ5A 1SC9A 3DPDA 2ZRKA 1J2EA 4IBYA 1K86A 4K26A 3FCBA 3GTNA 2NY7L 4QOSA 3K4QA 1EDQA 2HREA 3HRPA 3ZRCC 5IRCD 2KI6A 1QX1A 1B43A 2DRUA 1V7ZA 4IBWA 1S6YA 3SGKA 4OCZA 3UV3A 5EOTA 3FF7A 3O8LA 1MQ8B 3CIFA 2B0SL 4W5RA 1DE4B 3DX7A 3STVA 1U92B 2HOQA 5AKVA 3VYWA 5F89A 1HCFX 2R1YA 4ZYKA 1L5VA 5TGTA 5EWJB 4OLAA 3KHOA 5ECJE 1LW6E 2B78A 4JQCA 4TL4A 1HHGB 1Y42X 4ZYKB 1F4WH 3UO1H 1S5IL 3C74A 4NQRA 1K2WA 2JCXA 3RC3A 1ZA3A 2OWDA 4LBEB 3KHQA 3LCRA 3IMTA 3WHIA 1D5ZB 1PVHA 4IOSA 4MZDA 3ASZA 3RK1A 3U7QB 4GX1A 1MW9X 5C0ND 1Y3AA 1T2JA 3ROFA 4RSRA 5I30H 1N4DA 3CY6A 4JFXB 1MCOL 1Z88A 3BCHA 4XSHA 5B12A 4JLKA 4Q3EA 1GZUA 3HFML 3CX6A 3QBDA 5IVKA 5BJTA 1L7BA 2GM5A 3LN4A 6FABL 1XUOA 1IE5A 2EEFA 3AVXA 2I67A 4KHXL 3HSYA 4FYTA 3VR6H 3HYLA 4FKHA 3F6SA 3KBOA 3AVUA 3DNPA 3KHSA 1VCOA 1XNRB 1Y0BA 5ABPA 2WQUA 4LRSB 3LUJA 5FOWA 1WFTA 1QGED 4P9HH 2PR4L 3GJZA 1AQLA 4ZFFA 1XCPA 1VHTA 4ANWA 5B6IA 2NGRA 1UJBA 4HMDA 4D3CH 3R24A 2DQJL 3GTTA 2IHVA 5J56B 4AK1A 2A3TA 5KVSA 3AM4A 2W2QA 4N1AA 4C59B 2IV7A 5IB1B 3D08A 1AUPA 2ZRFA 1KXTB 5EJEA 2Y5TB 2NZ1A 5AKJA 2J4WL 5EN3A 4OHPA 1PLLA 5TE6H 2XOEA 2CDNA 4R9SA 3VDQA 5KS9B 3E1F1 5B57C 5TVGA 4EUPA 4JMXA 1E98A 1IC7H 3TDMA 4BDVB 2GVNA 2YJNA 4C87A 1YPZB 5JRDS 3T3HA 2O05A 4G7YL 2JL1A 3B89A 3L6CA 1NYTA 3WXVH 3K0AA 2NY2C 3NK4A 5EORL 3CHYA 1R4XA 1WIPA 4JIMA 4GXVL 3IMCA 4BJLA 4GIAA 3RKDC 4K6KA 4FMCB 5UKDA 5HHME 2CJUH 1XWWA 4JKKA 2P1DA 5DFTA 1NH6A 4F6CA 4F27A 1N6LA 2FX8H 2ONYA 3VD3A 1HCYA 1DEEA 3QFCA 2LW3A 1Y1DA 1YYLL 3EYWA 3FPAA 4EBQL 5I71B 4MVJG 2XNAA 1B2YA 4WCFC 1ZY9A 1TOXA 2EYSA 3RQSA 2R7AA 4R2IA 4KGZA 3FTYA 4KIFA 4OJAA 2MR6A 3TVMC 2I2BA 4MS6A 1P3DA 2WICA 2MSCB 2JI3A 2ZR7A 5FH9A 2IZZA 1BOGB 3FTEA 2N01B 1EZVY 4KFUA 1U6AL 2PPLA 3M6LA 1SUHA 3NALA 1OHQA 3V1TC 2CZNA 4Z5RA 1Z5HA 4NO2B 3A1NA 3ENEA 3DZDA 3B5JA 4A7UA 4NZUL 1WHSA 5A3QA 4DCCA 4W5NA 3X3GL 4XIJA 5DVOA 4OKDA 3BXPA 4XTRC 5F72S 1IRXA 2W92A 1KGSA 1R0CA 2V6BA 3QYAA 5EO0A 3KB2A 1ENYA 1U8MB 2VWPA 3KO8A 2HJLB 5LKNA 1HL9A 1RULL 2BYTA 1BMFA 1UCFA 2AYXA 4L8BA 3M17A 1MFDH 4I8DA 1L5HA 3MBIA 3K4DA 4IINA 3L3IB 5K0SA 1DRUA 1KO1A 3AW9A 1OZHA 3EVNA 4O5AA 3H3KA 3NBFA 1RHJA 2J6EL 2EJVA 1HDMB 4B6JA 1O94D 2A30A 3LNCA 2C9ZA 2WKSA 3CX7A 5KX5A 5I19H 1Q11A 1YMMD 4WHDA 1VL1A 3VPSA 3RC7A 1Q9WA 2RHHA 4RD3A 1I85C 3VDAA 4H6VA 3BWUF 5L7XH 1M0WA 3PC8A 3DRQB 3ZXXA 1H5QA 4KX7A 1MFZA 3Q1SL 2H0FA 5FDWB 1Q9OB 3LSOA 3QW2A 3HRZA 2N0KA 2BZ1A 5IOKA 1MJNA 1ZN2A 4ARZB 5E6YA 3TPZA 1CL7H 1K6QH 2AZAA 3D39A 4EG5A 1AQYA 3RUAA 3EAFA 4NQCB 1U3NA 5FOVA 4TTRA 3IJEB 3CHXA 3U17A 1FAKT 3GGSA 3PVSA 4HOXA 3RS9A 1P19A 4EHKA 1YQQA 4Z3JA 4WW2B 3U9PL 3DVNA 1V5IA 3RANA 2ZCKH 2FPIA 2R4SL 4I18C 5LSAA 4YRZA 4RMNA 1KEUA 2VDQB 3ESRA 5AFSA 3ESUF 1V16B 4LSPL 4B2PA 3WS7A 4DCUA 1XF4B 2FPLA 2D0FA 3N40F 3FCTA 2BOBA 2WUCH 2C8KA 3AX6A 4C0LA 2YKKA 1NA5A 4UTAH 4PZYA 3VZRA 2EXSA 1PS3A 4IHJA 2X6VA 3RM3A 1B8PA 1RIHH 3EXHB 4Z9YA 1QR4A 1W87A 3CBQA 4E9SA 1KSRA 1K6JA 3ASWA 2BFPA 3RYFA 5JO9A 1RVV1 1L6XA 3WYEA 3JTTA 2R2CA 4PLKC 2FNAA 2XYBA 3RJOA 1WFUA 1J0JA 2XDQB 3ECQA 1PG7W 2ED9A 3QVWA 3IRPX 3D4BA 3PUYA 3MAJA 1YRLA 1X5YA 1VKJA 3OX8B 2WBLC 4YSEA 4YAQB 3SHTA 5HIAA 4TL6A 3RSHA 3CSSA 1IVLA 1P84J 2KDYA 2RD0A 1M6OB 2G1PA 3O83A 5T33H 2F53B 2ONZA 5H70A 5T4HA 3UJ3X 5CVEA 2CIIA 4DAOA 4E9YA 5IK3A 3VW3L 2NY4D 1MF2H 1W0VA 3OIGA 5C8VA 4IIHA 3I3OA 4YJFA 4DQXA 4WK2B 1N5YL 4EN3D 3V4PA 1V71A 3DUFB 3EQ2A 1OSZA 4XWAA 3CG8A 2WJYA 1NBYA 5AUPB 1LDEA 3IOYA 1CYWA 1M7BA 1RUQL 4YJ3B 4P0PB 1UANA 3P2JA 4U1SA 5TQ2A 5LBGA 1EAJA 1XGQB 2OBYA 5IEJA 3DVLA 5HVWA 1J06A 4J4PC 4BHUI 4ZVPA 1HQ4B 2JI6A 1HSBA 2BS71 4ENWA 2OL3H 2A1UA 4BXOB 4M83A 4A5OA 4OIIH 1B23P 1NL0L 1HQ4A 1I1AC 4G8IB 2EIEA 4JLMA 3BFVA 4XR4A 3BP4A 3LX4A 3OBIA 4LSVL 3WU1A 3KYMA 1ZLUH 3WLTA 4D9HA 3K9GA 3RHWK 1GU7A 1TIKA 4LDNA 1S02A 2F58H 4JT9A 2WWTA 2FZ3B 5I6LA 3BEVA 3DV9A 4GYWA 3KKPA 4PQYA 1AK1A 4FTVE 2B5IC 2OBGA 1W2WB 5IJ0B 1C9MA 2ZB3A 4N8VG 2L18A 1RERA 3ONEA 3ADKA 2NU6A 5C8YA 5E4YA 3AF3A 1O2DA 4A8TA 3SLKA 1I7UB 3V8PA 1NLFA 4UTOA 3H53A 3T35A 5MERA 1G8JA 1JQEA 2QVKA 1O7VA 1RWQA 1OFUX 3EOBI 1BJMA 3MC1A 5IKXA 4YXFA 2PMCA 3Q3CA 5D7LD 1ZONA 4N3TA 1UPFA 3G0DA 4AMZA 1N9PA 4M4PA 3NBAA 4S24A 4OJFH 1BYOA 3QWOA 2PCXA 5GZNC 2J0UB 4PI2A 1QBGA 3QENA 1GKEA 4A6EA 4JFFB 5SV2A 3O4RA 3CM0A 1QBLL 3MJ8B 1L6RA 3PL6B 4H59A 1E20A 3E2IA 1WGVA 3WEAA 1IK4A 5J1AB 4QXOA 5EIEA 3T5CA 1CMOA 1P29A 1S7QB 4RTOA 3KJ4B 3W3BA 4I50F 1D5BA 3OLQA 3NABL 3LQQA 5I19L 4U7GA 2DQEL 3DIVA 2UVDA 1G20B 3MA9H 5JPIA 4KRFA 1EXUA 1BFDA 3QAQA 3G1TA 3EHBC 1B0RB 5HQ3A 1L4NA 3UATA 3I30X 2KWIA 3M3DA 3BB4A 2IEPA 1JG1A 3ENZA 4US1R 2ZTMA 2H52A 2WLTA 1F4AA 1YB1A 2J6BA 2OCBA 1N59A 1MFEL 5CXUA 5TF1L 3DIDA 2TMGA 1YZYA 1WVIA 1V7CA 2HLAB 1AKWA 3K92A 4CQMA 1T35A 1CRPA 3PVCA 4TNWK 3NORA 1OKKD 2BHTA 3UTQB 4EG4A 1KS2A 5AD0A 3OPNA 5KVFE 1SR8A 3CN9A 5CM2Z 1T1JA 1YDHA 1UC9A 1EAPA 5U4XA 1XZ0B 4CSPA 4X6CB 4MLSA 1XMEB 4FS3A 5J2TF 4CJ0A 3KG2A 3TB4A 1PS8A 5DK0A 1KEML 4OJNA 4HK3N 4XYLA 3MDJA 1ZM9A 4K86A 3DBXB 1KTJA 1DBJL 3AREB 4BIKA 4G2NA 5LQAA 4Z4EA 1QRKA 4Y19D 4CVXA 1Z25A 3HBPA 4HOMA 3IP9A 3MRTA 5AI5A 2YHGA 4X54A 3CLFH 3L4YA 3RY4A 4G7VL 4TT3D 4FYIA 4BDVA 2HXGA 4INOA 3NT5A 4MAMA 4AVYA 3I5MA 4OFZA 1Y7HA 4O5OA 2MHAB 1U2PA 1LDPH 4PP2A 3H7BA 3ZTTA 1VESA 1TX4B 2PIAA 2FT7A 4V0ME 3WFIA 2XUJA 1D0IA 4MHOA 2VOTA 2GPSA 3A6HA