2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
1MHPA 3EGDA 1ZOPA 1M2VA 3TW0A 1DZIA 2ADFA 2NUPA 1M1XA 1IDN1 1AOXA 3EOBI 1SHYB 2O7NA 4Z7QB 1PD1A 1JV2B 3EGDB 3PPXA 1M10A 1JEYB 1YVRA 1XDDA 3F78A 4HQLA 3FCUB 1QC5B 4M76B 1RS0A 4A0QA 1AO3A 5HDBB 3AFCA 4O3TB 1U8CA 1PCXA 2XWJI 5BV8A 1V7PC 4FWWA 4CN9A 3GXBA 1PT6A 5E6UB 1SHTX 3EG9A 1YUKA 2VDPB 4HQNA 1JEQB 2X5NA 4CN8A 3NIGB 1U8CB 5HJ2A 3M6FA 1MJNA 1JLMA 5KYWB 5KYXB 4WFQA 4WK0B 1SSLA 1QC5A 2VDMB 3AL8B 2VDOB 2NUTB 3EG9B 1L5GA 2ODPA 4Z7OB 3FCSA 4HQFA 3E2MA 1M1XB 3K71A 1BHQ1 3EH1A 1FE8A 2VDLB 2VDNB 1IJKA 4DMUB 2NVOA 2VDKB 4MMXB 1PD0A 3OKYB 2ICAA 4IHKA 4MMZA 3BQNB 3BN3A 2XWBF 3FCSB 4MMYB 3K72A 4O02A 1SHUX 4BJ3A 3EGXA 3HXQA 1QCYA 3ZDXB 1UEXC 3QA3E 1YVPA 3TVYA 4FX5A 3ZE2B 5KYYB 3Q3GE 3NVQA 3K71B 4WK2B 1MF7A 4O02B 2P28A 1IDOA 2QTVA 3ZQKA 3ZDYB 1MQAA 3K6SB 3V4VB 3ZDZB 1OAKA 2M32A 3EOAI 2VDQB 4G1EB 3PPYA 4IXDA 1JEQA 4C2BA 4UM9D 3IJEA 3K6SA 4WK4B 4MMXA 1U0OC 5KYYA 1M2OA 4NENA 4G1MB 4F1KA 3EGXB 5E6RA 4G1MA 1TYEB 1ATZA 3OL2A 1DGQA 1LFAA 3EFOA 1IJBA 4HQKA 1JEYA 5HGJA 4F1JA 4GZ8A 3IBSA 2I91A 2VDRB 3RAGA 1M2VB 1XDGA 3TCXB 5KYNA 4PN7A 4Z7NB 1XUOA 2WW8A 3ZE0B 4C2AA 4C29A 4CNBA 3OL2B 3AL8A 1SQ0A 3K72B 4WJKB 3T3PB 1ZONA 2NUTA 3NIDB 4UM8B 4G1EA 1FNSA 5E6RB 3ZE1B 4MMZB 4IGIA 3VI4B 4UM9B 2VC2B 1Q0PA 3PPVA 4K3JB 4NENB 5KYXA 5KYWA 1JV2A 3HI6A 5E6UA 3N2NA 3IJEB 4MMYA 1BHO1 3TXAA 2I6SA 1M1UA 5KYUB 2IUEA 2B2XA 1U0NA 1AUQA 4NEHB 1RTKA 1RD4A 2ODQA 5KYUA 4JX0A 2UZYB 3EH2A 3VI3B 4O3UB 5E6SA 4HQOA 1L5GB 3HXOA 3PPWA 3NIFB 1NA5A 3T3MB 3BQMB 5LN1A 1MQ8B 1RRKA 2P26A 1N3YA 2I6QA 2XGGA 1OLZA 2NUPB 1N9ZA 1ZOOA 1T0PA 3F74A 5E6SB 3V4PB 4XW2A 5ES4B 4JDUA 3EFOB 3OKWA 1T6BY 1MQ9A 1CK4A 2WINI 3AL9A 1CQPA
chains in the Genus database with same CATH superfamily
2AOVA 3R3ZA 5BY2A 4QF1A 1UR5A 1YWGO 3GUHA 3K35A 2BZDA 4R01A 2EJTA 1T9AA 4ZZ3A 2YJLA 5BMVB 4WCYL 3GSQB 1JECA 3UROR 2OTCA 1XZ8A 5E7MA 4DM3A 1KXZA 2KQUA 3NLLA 4OH2A 3F1LA 5C0IA 2APFA 3DB2A 2I8LA 1XNHA 1R3HA 4EDWH 2AGVA 3FPKA 3QRBA 4E9XA 2JJVA 4G0MA 1MLCA 5LB1A 5L9AA 5F7ZA 4N6OA 3RKUA 3UGQA 3MCKA 2QS9A 2QLLA 3QYAA 1XZPA 4BU1A 3VNZA 3CFCL 5ICZB 4U3CA 5IU6A 5BO1L 1UMBB 4FTVA 2DAVA 1AB5A 2VRNA 3CV3A 2XV0A 2IYAA 3JVFC 1TVHA 5EOQL 1C7IA 3BAZA 4LY3A 2O4UX 4H6XA 2H92A 1Q0YL 3HWX1 4FMBB 5KS9F 4J4BA 1UT5A 3HRKA 3A2NA 1NIAA 2O20A 1AJ7L 3DSNB 4R4JA 1YCSA 4G37A 4MVCA 2VQ1B 1C3OA 1GGUA 1AUOA 1N9PA 4E6EA 1IUPA 2B3TA 4WQOA 3NMUF 2FSEB 1MIMH 5C71A 1JBJA 3OPYB 2H1HA 3ZNQA 3BDAA 5ARDA 3BFPA 2XWSA 3INYA 4YRTA 1R3KB 4FUTA 1JU4A 3DETD 3HS9A 2QQLL 1R5OA 7MDHA 4GKZB 3H55A 1P1ZB 4M0CA 3TOVA 4I2XA 1VG9B 2DWDB 3ARBA 4QXAA 3H1ZA 4ZCLA 4OB5H 3QLUC 5PNTA 2IQ9H 5EQDA 4XB1A 3TNNB 1KYOJ 4HHAA 4G8GE 1THCA 3L49A 4S1DD 2OBLA 5I15L 2F1OA 3E7PA 4DP7X 1XGUB 2VN6A 1ANKA 5I0ZA 5FYJL 3IIKA 2AKEA 4OQYA 2EEZA 2X3YA 3PJDA 3T5PA 4EELA 1KIPA 3RVOA 3IMUA 5D70L 1RZRD 5AXDA 3T3HA 2ACWA 4JO2H 2WQWA 3CEPB 1KBGL 4LEOB 3ORYA 2C5AA 1DC6A 1PZ5A 5C5CA 2VJCA 3DVLA 1F14A 2PGLA 3KZVA 4JKPL 1JIVA 1KWGA 1XVTA 1ETZA 1KDIA 5AZ2H 2OV8A 4UMFA 2PWGA 1VHWA 1Q84A 3IP6A 4TL9A 2EDOA 2X8JB 1RFGE 2KYRA 3MCWA 3AUKA 3TNDA 3RFVA 1NDTA 1UHVA 4L7VA 1GNQA 2IL1A 4REQB 4RMRA 5KSBB 4ZXBC 1CBVH 5F9WB 5HGAB 3THML 1P19A 1P0CA 4A8JA 3VXRB 1M56B 3GPSA 3C6KA 4MTLA 1BS1A 3NHFA 1L7AA 4D0CA 3ANXA 4X0KB 1DAEA 3UYKA 4LZNA 1DSFL 4P0DA 1BAGA 1J9EA 2Q2WA 2QJOA 1JDUA 4YV2A 4LE1A 1JHXA 2ZANA 3N28A 5DK0B 3ZV4A 3MJ9H 2AEWA 4Q9BA 1B8PA 4MCZB 3E2HC 1ADGA 4K3EL 2APTA 1CT9A 1ZJZA 2DWXA 4B7LA 5FA4A 4R0LC 3BG5A 2CLRB 1NA5A 2C9ZA 2PUQT 4Z7NE 3F00A 1KQPA 4MA8H 4FG6D 2F6RA 2VDWB 4BINA 4DMKA 1H3PH 3MODH 5DI8A 4XC1L 4Z0BL 3IU3A 4GXFA 5D5PA 1BXAA 2IY8A 3W2DH 3E7DA 1YC8A 3N8KA 4INZA 1PLGH 4FLOA 1RLIA 5G5DA 1G9NL 2I6FA 1D1QA 5H0IA 4Q4EA 1I01A 1Q92A 4Q6IB 4YZWA 1EDZA 4OYHA 1DJPA 4FQ2H 1DDHB 2F1HA 3F83A 3CRQA 5BXYA 4XFDA 1BWQA 1N2HA 3DQPA 3C5ZD 5EA0L 1PS0A 4HIPA 3C6QA 3CSYB 1M8KA 3WE1A 4W9KC 2PSDA 1TQBB 4AQ1A 2VE6A 2VF4X 3C1UA 1LO5B 3O4RA 3K73O 3D6HA 2AG1A 4I1PA 1JR3E 4PV9A 3FQWA 2FRGP 3CLFL 3D3QA 1OP3K 2O5VA 4DP1X 4NENA 4GPAA 3WGUA 1VPTA 3KV1A 4DUPA 4IOMA 3PUUA 4BBWA 1J4AA 4QFDA 3HADA 4CW7A 4B3XA 3HC3H 2FHFA 4Z0XA 3BTOA 1OGIA 2CKDA 3GXUB 1MIOA 4Y6OA 3HCFA 1PQ4A 2XGMA 5ITZB 3P3TA 4G9GA 3FOEC 3O6LH 5AVSA 4I4WA 3CVHL 5ILQA 3QAQA 1HDMB 3TBTB 1JFQL 3O3EB 1U5AA 2W9DL 3RRYA 4XMZA 3BW9B 4RDXA 4LQFH 1ZEAL 2GN4A 4KE8A 3L7FA 1QIDA 5JZ7D 2EQDA 4LP4A 4JLKA 1RRGA 5C81A 2EZ9A 3TEUA 3GHYA 3RU9A 4EZMA 2XPGA 3I6YA 4XJSA 4O2AB 4LYAA 2IHNA 2EE6A 3FC8A 5DQ9A 4WSGA 3OJVC 2IPMA 5F1NB 1KEUA 3LQ1A 3DTXB 5CINH 3K32A 3I02A 1DZ0A 6CHYA 4F7TA 1Z4OA 3BUBA 3JCZA 2X70A 1TMKA 4KV7A 5KX5B 3FRJA 3PUWA 2H31A 2ZYRA 4ED9A 3NT0A 4N2NA 2QD4A 1QU3A 1ED3B 4WJLA 1F3DJ 3NCCB 4R8SA 1UJ2A 3QJXA 3CSGA 1CL7I 1V8OA 3EJUA 1HEIA 2N01B 1DPGA 1I2BA 2MQ0A 3ICPA 2EADA 2AKRB 1K97A 3UYRH 1UJ6A 3NBAA 4C43A 1A0OA 3GSUB 3LZ6A 2EBWA 4DDKA 1M1SA 3S28A 1GCUA 5MF6A 3ZGIA 4MTCA 1RD6A 1E4KC 3MNVA 3L1UA 4DCVA 5CIYA 3WKAA 3ARGA 4J1UB 1O9VA 2VZ9A 1E7UA 3SD5A 1HX7A 2NNCA 1X1CA 1QHIA 3VXUB 4N1EA 4EH1A 2BKXA 4KHPB 5AKGA 1GXEA 3RWJB 2CXPA 1POXA 1QIKA 4BNNA 4D9RD 1QKIA 3MRKB 1GUYA 4BH7B 3RKDD 2WIDA 3QFTA 4U31A 1ZINA 1XIWA 2I2XB 5FECA 2JGJA 3M1BB 1FGNL 2OV4A 43CAB 2VN5A 2NSMA 1YAHA 2F54A 1XDBA 1U5CA 1Z68A 4H1VA 1U8LA 2F8SA 2H16A 2AJLI 4YSDA 4C83B 4DO6A 2VTKA 2CLSA 1ZXKA 3IJYB 4PJ9C 4HUTA 3T8XA 3PXGA 5I73C 4Z7QB 3EQ6A 2X6RA 1JPUA 4KX5A 1KEKA 1E8WA 4CADA 4YC2C 2HT1A 5TRTA 3RIFF 2EKSB 4ZS7L 4XZ4A 3T3GA 1KDRA 4KDRA 3NBNA 2JJUA 2X8WA 5C3LD 3AG3B 5SY6A 2MMXA 1L6XA 3I6KB 4Q7QA 3VPCA 2H59A 1N33B 2X6VA 4TVOA 1S7CA 1DAOA 3VU1A 4XWYA 3QORA 1G9EA 4IR7A 1MIOB 2CIKB 3W5HA 1SIOA 3MINA 1E79A 4FBLA 5CCKH 2CFTA 2C77A 421PA 2XODA 3KB2A 1E5ZA 3DV4B 5L7XH 3BMCA 3KXDA 4JN2A 4R0NA 1V6SA 5ISMA 5T3XH 2JKRM 2H9YA 4OT1H 4WVFA 4HFJA 3DMFA 2JI1A 3H11B 1XU7A 4Y88A 4P2QB 1XEUA 4C4XA 1XMEB 3OAZK 4S1OA 4P7KA 2A83A 4AQYB 2FWSA 5BRZE 1CD0A 4QOKD 2OXHB 3DV6B 2CJWA 1G7HB 3QUSA 1ZK5A 1XB8A 3SE3A 1KBGH 4WLEA 3OB0H 2VBFA 1UMDB 4B31A 3C3YA 1AGDB 1ZHNA 3T38A 3SGDH 5E4EB 3S3DB 2CCJA 2JPDA 1JAEA 4FYQA 2R23A 4Q9AA 3TX4A 2ZSJA 4CGUB 1JPSL 5DVKA 1CG9B 4DEVA 2FNBA 1JZJA 2V8MA 2DIEA 2FPMA 4CUJA 4GSDL 4MR7B 1CIJA 1VI5A 4EHIA 1ZU5A 2YJTD 4GS7B 4HGYA 3NEEA 2JQAA 4XT1C 2CYCA 2ZOKB 4GXVL 4I5DA 4QT0A 4V0ME 1Y8RA 3MROA 1BMTA 2WIGA 1DIHA 2F9MA 3PC6A 2V0AA 3QOWA 1COZA 5D6DC 2P6OA 3SSGA 5HDWA 3UXFA 3L8MA 3NJJA 1CICD 3CQQA 1D7AA 1RZGA 5HI3D 5ICCA 2B8WA 1JXGA 3K2QA 4AENB 4R8MA 3C3BA 5T7BA 4P5PA 3SQBA 2VO8A 2W22A 5C97A 1BLNA 2FZKA 4G43B 4BTLA 3MBWB 2X3CA 2OFPA 3IEIA 4OFDA 2XPYA 1LS6A 5CLTA 3NXSA 3WIHH 3E6HA 3E70C 4K2AA 3N1FC 4HK0B 4JRXE 1KIFA 2QX6A 1I1AA 3AT0A 1GHFL 2PR2A 1Y1LA 4Q58C 5CLXA 1U1DA 4OFKA 3S37H 3HRZA 1LRKA 3HI6A 4M9QA 4EKYA 1RLTA 4NC2B 3I50H 4FI3F 1DMSA 2JKTM 4DLTA 3R5SA 4Q12A 1OXUA 5EN4A 4EECA 3UW3A 4JDVA 5BZWB 3WKDA 1UD2A 3L41A 5T5FH 5IHBA 5JJ5A 3PP3H 4NEQA 4KL8S 5JBIA 4BH8A 3QORB 1A04A 3HZMB 2FAXA 1X7XA 2X1WL 5EWIH 3U7GA 1QYIA 2ZXUA 3QRWA 1R9NA 3QHTC 4D5EA 4I50F 5A06A 3RPIB 2HCJB 3DHEA 3GJ8A 3MLVL 2CUNA 1OLUB 4NP6A 5JHBA 1NR7A 5EULV 1YUKA 4EY3A 4N76A 2WF6A 1CB0A 3ZK9A 2OX5A 3CQFA 1NQ5A 2OR3A 2J5RA 3LSTA 4KIGA 3DJZA 3BP7B 3SE8H 2Y36L 3GLIB 5AW3A 3JV6B 1KK1A 4XOBA 1Z35A 2IH1A 1ZGJA 2CBGA 3TA3C 2JMRA 4MW0A 1U7WA 5ELXA 4H26B 1S0UA 3ACDA 3QUXD 5CJ8A 3ONVA 3WMFA 3ZVRA 2GEEA 2XMQA 2Z9TA 2XT9A 5GGQH 5FYKU 4AUMA 2QBYA 3BXFA 1SJHA 2RR3A 4YSQA 3BZ5A 3MBEB 4I18A 1R6UA 4M7PA 2QXYA 1UOQA 3AG4B 1OW0A 1AHKA 3T12A 1Y1SA 2J5QA 3U7AA 4JRYE 1NANH 2XSZD 1E2WA 4R1SA 2VDPL 3ARGB 1CE1H 4KK4A 3EBOA 5EU6A 3F7TA 3ML8A 1CUUA 1U9JA 1RPNA 5FM8A 3HABA 2VOJA 3S34L 2IXFA 1T1XB 1ECFA 5IARA 3ZMEA 5DIFA 5F6HJ 5KVGH 4C7XA 4KRLB 2XQYA 3CNLA 3W8DA 1WCIB 3UBFA 2WLZA 4RPCA 4UQLA 4NQDA 1L0BA 1Q90A 3L1IA 2VWEE 2GN0A 1DAKA 3K70C 3F6JA 4PJXE 4BVFA 2P42B 2GARA 5B4VA 3P77A 4H4DA 3GBVA 3TQRA 3VC1A 4QHNA 3D39D 2BF4A 2QTVB 5T1KB 3CZFB 3TW0A 2FYYB 4EB0A 2X0VA 4A2EA 4N6GA 2I9KA 1YK0A 5DMKB 4AO8A 4AWAA 4ONFL 1W72B 2Z1MA 2H1OA 1PJ8A 2IXBA 4UDXX 2W9XA 2R9HD 2EKSA 2GBAA 4NYLA 1XCXA 3AI2A 3MPOA 4A0GA 5AM4A 1VDMA 1H5BC 2WYUA 3V5HB 3QC5X 3CE9A 1YB4A 3OZ7A 4APQB 1F2VA 5GS2D 1G8GA 2JEYA 1KB5B 1SIUA 3DX8A 2L19A 3FFCA 5D2LB 1UB6B 2HFEA 2O8DA 2CUIA 3LCYA 4IIQC 4QKTA 4OKIA 2UUDK 1ES0B 3SEAA 1VAHA 2WK2A 4V11A 3QEMA 4G1EB 4WY2A 3FH5A 3UGEA 1UKCA 2VRAA 3T0EA 4CLRA 4NP4L 2HBQA 1YJDC 2AG8A 1TYZA 3GJRA 5IZ7A 4MVJG 5CURA 3USES 3PKIA 1XDGA 3LHSA 1DKRA 1Z6JT 4LNUA 3U3OA 4KI5E 2GEFA 3BJZA 1RIHH 1E7SA 4JFTA 5BYAA 2Z4RA 1R3HB 4HRYA 3NRPA 1A2BA 3MELA 1OTTC 3U4MA 3M88A 3BH9B 1ZJ4A 5A0FA 3EEQA 1IAMA 4ND7A 2CLZA 1MFCH 4PAWA 2X1MA 3DX6A 3VHLB 5F9MA 5GS1A 1KJMB 4KH2A 2MCFA 2JQMA 4YX2H 4Q3CA 3FMGL 3IE9A 2VLME 3B1UA 4V0LA 5L3SB 3LEXA 1K4DB 2P43B 4N0QA 3NEJA 4C76A 4WI6A 2VDVE 3KL4A 3KPJA 4GBGA 5E2UL 3HO8A 2J31A 4L0YA 3LQ4A 1KQGA 1JPJA 4XMLL 1DADA 3SS7X 3PKZA 2NY3C 3BCRA 3L2LA 1XSKA 4K8OA 4AWJC 3OKNB 2XN2A 1VCOA 5KBYA 1IY8A 2B5WA 1FC0A 3RKDC 1FJGB 5CVJA 3ARBB 3IERA 2ZSVA 2JK5A 2Q9OA 3PFCA 1WSBA 2H9GA 2CMRL 2QVTA 3B7PA 1RZRA 4WUUB 3M1YA 2GFIA 3EHDA 1UBNA 3KBPA 1X7QB 1EI9A 2ORYA 3O3UN 4U1KA 2FYYA 2ICWI 1PGJA 5EJ5A 4AW7A 1SXCA 1ULSA 4NQUA 5CR8A 3FYTA 1KIUA 2OQJA 3X12A 2YHSA 4XIIA 2DPYA 2Y7NA 4ATTA 2GUYA 4BQNA 2VO1A 2SCUA 2GG1A 2YAMA 5L6YL 4V1DB 2A73A 5EE3A 4A2DA 4A6YL 4MAYC 4M1QA 4J07A 3ICEA 4PZYA 4E9QA 2AK2A 4RK6A 3S96A 4QJ5A 2W95A 3GEIA 2A6JB 4LDZA 3SSOA 4B53A 4ODVH 1T83A 1IJ9A 3T0FA 1BWRA 1GO2A 1YK1A 3ARPA 3MLUL 4AJJA 1KAQA 5I8EA 1FFOA 2BMEA 4FHBD 4RGND 2QJRA 3SMQA 4JY4B 3QX8A 1H6EA 2HTKC 5IHHA 4I77H 5KMGA 2VYVD 1OQXA 3MFFB 4WOJA 3U61B 2VDUE 1A7OL 1YBAA 4PRZA 3SYAA 5BN5B 3B36A 4YQZA 1IG3A 3D64A 4K6CA 3RAPR 3RHFA 3LX6A 3OJ2C 3ADDA 1XF5B 2H00A 3IULA 3X44A 3EH3B 5CA0B 2HUEA 2XG5A 4YXKL 2J0EA 5JNYB 1AAJA 4X8CA 4YSRA 1X5MA 4WI9A 2E49A 4MP6A 5MENE 2ZB4A 5F0LB 1OAAA 5HVFB 1ZH8A 2LKDA 3DMTC 3AADB 3BP5B 4E0RA 5H37G 3D0KA 3ESZA 4ZZFA 1K8RA 1G6VK 2RBEA 2DI7A 1DARA 4BB9A 3UKDA 4TS1A 3JVVA 3WQRA 2PSJA 3R7BA 3QULB 3ZTDC 3ZC3A 1Y1QA 1UAGA 5FS5A 5A0VA 3LS4H 1KCRH 4W9GC 1SCDA 3NCJL 3FFDA 4KO6A 4N3AA 1KJ2B 2VPXA 5IB4B 2FH6A 3GVPA 2H0QA 3GXDA 4QHMA 3ZHKA 1IGIH 4Y2SA 4HVCA 3H1TA 3BVWA 3N43B 4N2EA 1AK1A 3A9CA 2R6GA 3G5LA 3EPHA 5FW8A 5DJZB 2ZZMA 3MRSA 4DLXA 4XMVA 2D4AA 2D4HA 1HCZA 3EC1A 4LLMB 4WQMA 1G63A 5HILA 4NOLA 1OX4A 3GMNA 5HGXA 3GGCA 2BRRL 5J40A 3OQMA 2FJSA 5SV2A 1YI0A 1O6VA 3EF3A 4E5MA 4O25A 2JFUA 5BSFA 5CNMA 2AN9A 1XRLA 2VNIA 1E9EA 2DT8A 2LFGA 5CJQH 1QIMA 4L8FA 2R59A 4R1NA 4GG6B 4P82A 2ORBL 1UDXA 1KI7A 3HEAA 3QPVA 2WZPD 2IU4A 4NM8L 1NKSA 3D7NA 4F04A 1NCBH 3ZD6A 4U1LB 4X6CA 3GEBA 1XPOA 3PABA 5FWYB 4FQXA 1B1AA 4QM7A 2X1XR 4RANA 3PGCA 3WNVA 5K0EA 1GY8A 3CO0S 2FO8A 5HJ3A 2FG6C 3FGPA 4HUNB 1OGYA 1UJBA 2KQMA 1ZRSA 2GABA 4UANA 3EUDA 3SPCA 4L2IA 3IU4H 2B9VA 1Y3CE 5LAPA 1JTOA 1F18A 2XPGB 1QYDA 3RJ5A 4B9ZA 1RI1A 2PGXA 2W4MA 4HFUH 1H15B 1JXQA 4PIRF 3LN4B 5BRJA 4YRDA 3D5QA 4UHEA 1HRDA 4HIEB 3QG7L 1MFDH 1DC3A 4DJTA 2VP9A 4Z7WE 2Q0XA 1WQ4A 3SDAA 2WG0A 3GMMB 3TZ6A 3GELA 2GYSA 2YZ2A 4J8RB 3RF6A 4L3FA 2P68A 4CLEA 1H3UA 3MXWH 1FE8H 2O9JA 3WKYA 2V3EA 4BGDA 4WI1A 4FWBA 2ICWB 3BKJL 3NSXA 3EZ6A 3VWJB 3I37X 3H3BC 4MUBA 2QKIA 2OA0A 4JFWA 5DBOA 4KZDH 1OTHA 5HDRA 3VV3A 5GIPE 3KQWA 2VWEC 5ANHA 1XA4A 1SFHA 5JXEA 1B0RA 4AURA 4A7GA 4M6OH 1B8OA 1UQUA 3GMOA 2CKNA 3RWOA 3L1GA 2X1OA 4ENVA 4GT0A 5JXAL 3T1HB 1K75A 4KWCA 4G9FE 3EFBA 1GW0A 4Y4HC 2E3VA 2F1RA 1AIFA 3T94A 4IJ6A 3VXUA 4CILA 5DBIA 2R1TA 4AQ8C 2GC7C 4QBIA 4N40A 3EYAA 3QWFA 2OYRA 1HOXA 2DTDA 3VXSD 5J6GA 5T64A 2ARKA 4LJAA 4YDNA 1RP7A 2EZ8A 1F97A 2OHHA 2YWDA 4R9HA 1RI4A 3ZQ4A 5F9JB 4B6PA 1IZ7A 2Q2EB 1XE3A 3KJ6H 3EXHA 2MOVA 1OD9A 2Y0SA 4B4UA 3BAKA 1RHJA 2J3KA 1I32A 1IY1A 5EPEA 4OXNA 3WFDH 3O2DH 2K3HA 4FF9A 3RTQC 1IKFL 1ZMOA 2H29A 1MA3A 3M5CA 4X91A 4YHYC 5L4NA 2O8EA 3SGJA 3BOVA 4JI2B 1XHEA 4QHKI 3HBAA 4J4PA 2V4UA 3BDVA 4DKFH 3Q3JB 4CQJA 3FYHA 2J30A 1FZTA 5HYJE 1SHSA 3QUGA 1GYQA 4L48A 4HAFA 4XRCA 1ICEA 3ZW7A 5F7OA 5F9FA 2K70A 4PRID 4UT9L 3MS2A 2A9NH 4BNDB 4ZOAA 2Z5VA 5EMHA 2BP8B 1PUXA 1WD8A 4O1MA 4W9HC 2UXDB 1ADQL 3UXEA 2E5EA 1R3UA 1SCNE 1Z45A 3MG9A 4YLQT 3IE4A 4L0CA 4OQZA 3WGNA 1EQ2A 4BEIA 1T6NA 3KEDA 4KGVA 2XT0A 5DYFA 5LXGL 1J56A 4JUSA 5C18A 4YMVA 4PMEA 4DA0A 3RIKA 2JCCB 4IDDA 4RY0A 2CRMA 3H9YA 2JI8A 2IPUG 1OXMA 2FNAA 3KUDA 4HWUA 3MI6A 4F7PA 1USGA 3OJCA 3VMPA 2PYFB 3FN3A 4HF5L 2QN9A 3D05A 1KCSL 4P3PA 5BCAA 3IU4L 4QO7A 4UNTA 5SWQA 5JTWA 2JH3A 3HB1A 3MUOA 3EUUA 2FW6A 2AV7A 3AY7A 5DMJB 2WIBA 1BJ1J 2GKSA 5H59A 2ZBDA 3QQ9C 4LDOB 5I1GL 4PI0A 4E9LA 3VRHA 1JGIA 1G9HA 5EZQA 4JK0D 4N12A 4MD4A 3PPIA 1DRKA 3BB3A 2B0SH 4EMZA 3BX7C 4JFDB 3UTQA 2B1QA 1A5FL 4JBIA 1B15A 1HFUA 3L07A 2UZAA 4OHOA 4PCAA 3NA9H 4HAIA 3CCCA 3N1QC 1NF2A 4DCQB 3T0XA 5FCUL 4MPDA 3PUYA 2QENA 4OZGE 2OEPA 3O4OB 3QDMB 2AVNA 3GWGA 3OPYA 1KSRA 5C0GB 1FIEA 1YY9D 4C03A 2P2DA 2XJKA 4UMEA 1UACH 5I8OH 4L4TE 4WGVB 3ZI0A 5FYLE 1M1YB 2V7HA 4UQCA 1GYAA 3WKML 1HQDA 4IOSD 3CH1B 4F6RA 1AS6A 3A6BH 2CLFB 3MLRL 3ELAT 3RWHB 1F1GA 3F4LA 3C5CA 3HI1B 1KCRL 3FQXA 2J5LB 3A9RA 3H9BA 5BSVA 3SC4A 1G0YR 4MLPA 4BB6A 1SSLA 5A2LH 4I5EA 4RJIA 4X90A 1KIQA 3HG0A 1R5IA 3CVBA 4KFCA 3IIMA 1LNUA 1QSFA 1G5IA 1JYSA 4JYZA 1FRZA 5AZEH 5K0NA 2DQYA 3NHJA 4ZTOL 2Q8AL 1G5FA 1YOVA 1JSZA 5J3JA 4ZOEA 4RKRA 5FO9A 4HDRB 3VYPA 5DNEA 3LIZL 5EZJB 1MCFA 3HJTA 4YGVA 1HNZB 4BSJA 2JJSA 1K2DA 5T5FA 1ET7A 1GC1C 1GGIH 3IMRA 3IMFA 3TL3A 1N5DA 4NV3A 4X6DE 2PZEA 4BQRA 2BFVL 5E9NA 1UBLS 1XUOA 3T5DA 4MP3A 1O7VA 1KMMA 1SXJE 5DBFA 4PG5A 3IAEA 4LAFA 3KLSA 2CLCX 3EFFA 3LWDA 1AZCA 1MOZA 1YE3A 1MX9A 1E94E 2CO1A 3OCWA 5ESVA 3OY7A 3A6GA 1DKMA 4GP7A 2NCEA 1RZJC 4APXA 2EE0A 1E8NA 4QUBA 3HMKA 3LZFL 1RZFH 1MREL 3RJOA 2WN2A 3VPSA 1K4CB 4A2QA 5HDBF 1ODLA 4PJ7E 5HUQA 4JQVC 5EUQB 5T5NF 4YY3B 2AJXL 3OSVA 5JJIA 4L1DA 2OV0A 4C07A 1CBVL 3I9V6 2F54E 4DV1B 1VF5C 1LX6A 1V27A 3UTTB 3C60B 2VTEA 3LO8A 1W4ZA 2FHSA 4HLCA 4L5FH 1NAMB 3UTSE 2YN4A 2I4NA 1UBFA 5ECYA 2BSRB 5JT1A 3GGPA 4GRLA 2OVFA 3A1VA 3KLHC 4M0EA 5LUBA 3EB9A 3LDHA 1OOAA 1VJTA 3T0GA 5TDNB 1NCCL 3AIOA 3JQEA 4S0XA 3ZLVA 4PRBA 4WWHA 3X11A 5ACZB 4J0EA 5F73A 1V0JA 1QNIA 2XA8H 3VA2C 3PRYA 4BVAA 3I6GA 5CLWA 1K3ZA 2ZUFA 4WZ9A 1RJ9A 1R0RE 4FQLH 3BVPA 3OTHA 2EDLA 2KS6A 2E47A 3HXTA 1L7IH 4CUKA 2J1KA 3Q8WA 2VUYA 4JKOA 1FXWF 3RNKB 2ZE6A 5I1AB 1E40A 3ERXA 1N59A 1ML4A 3RFUA 1D2MA 3AESA 1FVOA 3CUTA 3UJAA 4IIQA 4N3UA 3RBXA 1EFDN 2AZMA 5KIAA 3WGUB 1YFKA 5B1DA 1R47A 4ND6A 1IEQA 1RFDH 1Z56C 4ELMB 1ZH6A 3D31A 3NBUA 4D41A 1H9CA 1PU0A 3IVKB 5IT2L 1DCFA 4KFSA 2IS4A 4MB2A 3TIIA 3B83A 2IQIA 5BRAA 4CVXA 3QE9Y 2XEXA 3BMOB 2ZKWA 4V33A 4LY6A 4JGGA 1KEGH 3NHWA 4BHUI 2W2VA 2YINC 5B7QA 2GTHA 3EGDB 2JBAA 5E0KB 4ZFOA 4G9BA 1WUKS 2H85A 4JLBA 1H9DA 1JQBA 1DLHB 2YWFA 5CH5A 1T8SA 1D9ZA 1Y18A 1QTNA 3ELYA 4F4HA 3QZPA 2NY5H 5IW6B 3LVBA 2A9VA 4RK4A 3TQOA 2AXEA 2VG8A 4FNSA 4RAVB 4DGYL 3K0EA 1BGXH 3GO1L 4EATA 1T1EA 4PGZA 1QK3A 4YSCA 2C94A 3AP3A 1G0NA 1WE5A 4FSDA 3ZOAA 5EDXA 4Q47A 2G5TA 3LRLA 2YRZA 1ESEA 2UZ4A 1PZFA 4K05A 2OL3B 4NC1E 2ODHA 4RA3A 1QKKA 2OCJA 5C0EB 3KQVA 4LSMA 4PJ5A 4DUXA 5G1PA 3CHPA 4UYPA 5I28A 3EJYC 2QRJA 1EIWA 4GM1A 1I1FB 4D7AA 3AU1A 4MXWL 3O6VA 3D9QX 5KJCA 1KIAA 5F7YC 2GSGB 3FDZA 3I58A 3NEOA 1S9YA 4IXWA 2QUZA 1E6WA 1BDBA 1XHHA 4LSQH 1WUHS 2M98A 4IRUB 2R0QC 3HLAA 2I25N 5CT5A 3DAPA 2WJ7A 2QM8A 2X9LA 1L7IL 1DQML 3TNMA 1FYWA 4HQQH 1BKDR 2EH8L 2VDML 1UXLA 4ENQA 3EH5B 5I4BA 3GEHA 1V5EA 3ETLA 4WW1B 3QUZD 4U7TB 5G1NA 2OY0A 5H37H 1IUKA 1NZFA 4XE5B 3GQBB 1QWNA 4MRCA 2C57A 1XAUA 4D8PA 2HIAA 5GJCA 3UCRA 3VTKA 4EG0A 3HB0A 3TJEH 1TVHB 3KSUA 4UE6A 4UB0H 5JQ6L 4F7WA 4MQFA 1JWMB 1DUVG 2VLRD 1PZXA 3MA0A 2JS7A 4KR2A 4JCMA 2D7JA 3BH7A 4XNYL 4LHSA 3IAHA 1SVCP 1MLDA 4F12A 3H1GA 3QUMA 2B36A 3TSYA 1CS4C 4YMTA 1YHPA 4OLVL 3QNMA 2OQVA 2FO4B 4C08A 3DO5A 4KKNA 3ZS8A 3HY6A 2Q3AA 5EWIL 1VYHA 2CVZA 1RZJL 4BEBA 3LRSA 2FFHA 3ZK8A 3KALA 2GITB 3V3TA 2UWEE 1A9XA 1AGFB 1ZA3B 2J88H 1N5YL 4GOJA 1YJXA 3QJHB 3QQ3B 4PM1A 1GYUA 3SDXA 1ET5A 3ODPA 3J2PA 1TMQA 4MMYA 4QRRD 4DWHA 1YCFA 2GBPA 2CF5A 3R0IA 4NY1A 1F1BA 2Z35B 5DK6A 4G5SA 5IT9A 4UU1A 4PAMA 3FDXA 4CIAA 4QTIL 1TPXC 3GARA 5ITBL 4PLZA 2JB6A 1QXSA 2NQDA 2HA4A 4DWJA 4WVLA 1HAUA 4M38A 2FSVA 2WV7A 2HG0A 2OR9H 1W4AA 2X28A 4GEJA 3ARDA 3IS3A 4KITB 25C8H 2TRHA 3KNZA 1PU2A 2AQKA 4FNTA 2VXUH 3VSTA 2DMKA 4ZQTA 4AXWB 4UM9A 4JT2A 3EC2A 4K5NA 1DOAA 4QRHA 4HEMA 4M8QA 3WJJC 4A55A 1MH1A 4UFPA 2FV8A 3B3IB 3WXVH 3PDIB 5ICYB 4DS3A 4FC7A 3O81A 1S5PA 1FYTD 1FPTH 3DVGB 4L5BA 4NBXB 1E4HA 3FFWA 3UV6A 3BH8B 5CVVA 3TQIA 1UJ5A 4UU9A 1LE5B 1TZAA 2COVD 1SF3A 3WTVA 1MPAH 1BE1A 3I9MA 2ZI7A 2Q3HA 5JFTA 1YDPA 1OTYA 3GT7A 2QADC 1TVKA 2GHWB 4WUKL 5JTTA 2WYZA 4IHBA 4XCYB 2DBZA 5FUBA 5F7UA 2H18A 3F71A 3A6CL 1UT9A 1GEGA 4WLVA 4WRLA 3PDCA 1DX4A 1PEZA 1QP4A 5DZJA 2DKNA 3AACA 1MABA 1EUCB 5FPIA 2V9TA 3RVDA 4AQEB 4ZT1A 1S7VB 2WG1A 3BE4A 3HN8A 4OF3A 1E1LA 2WABA 3MLEA 2FT7A 3LQAH 1MD9A 4OGLA 4OQEA 3UAWA 3PWTA 2COEA 3AUYA 4ZHQF 2PW1A 2PWDA 2PAAA 2ADIA 3U6RA 1AHPA 5B4MD 2A2ZA 2PX5A 4CIVA 4YIQA 1O4WA 1G6RH 1N6NA 4KUCF 1MPTA 2NGRA 4OX9Y 1OPGH 1TYRA 3ROEA 4J3VA 2GAJA 2VT6A 3JV5A 3LPWA 4XIYA 1GU1A 3D06A 1CYXA 5T3XL 3SVTA 4DZTA 5E5MB 3OZXA 3O38A 1MELA 3GZ4A 4IIBA 5I48A 4R8RA 3D07A 5BSUA 1L7VC 3RUDA 1GZ7A 2GKGA 2RCSH 4MB4A 5HHPB 1A14H 1MG0A 3JWHA 3ZDYF 2CC2A 2VZUA 1U7OA 5T4EA 5CHEA 4O2CA 1C1YA 3UJ9A 1QZNA 1RJYA 1LTXA 1XMQB 1OV8A 2OB1A 2EDXA 3CEJA 1CD8A 5GONA 4OFWA 3OTOB 2HDOA 1DFIA 2YXMA 3RTBA 3LL4A 2ZUQB 1IVSA 3ON5A 5LQDA 3G8YA 3RRQA 2A86A 4YSPA 4G42A 3L7OA 2BOVA 5FADA 3JQ7B 5BRQA 3UZVB 3K72B 2CGEA 1A2YA 2GVYA 1AV7A 1GZ6A 3A9UA 3QG5A 4LDCA 3KPQA 2WHQA 3JZIA 5KVDH 4JG1H 2XTJE 1X38A 3ABMB 1EWHA 2N1KA 2DBVO 4TRJA 4KQ9A 4M93C 4JLJA 1EB8A 3B9KB 4HC1H 1KJVB 4HDQB 3DROA 1DVFA 4JQSA 4Z7UE 2R1VB 2PLNA 1NPJA 3PQYE 4W1QA 4JU8A 1N2RB 5HMMA 1XMPA 3QXDA 2QQGA 2HJRA 2M83A 1QFOA 3PNYA 4P83A 4JY7A 4LHUA 4D46A 2Y0BA 1K2VN 3QWOB 3BIXA 4D8OA 4DGVL 1JGLL 2BERA 2XOKD 3PIQA 1FGNH 1RWQA 5IJVB 3WTBA 4O4JF 3AEZA 1DV2A 2QTEA 4X6UA 1ZD9A 1IIBA 3QEGL 3RWDB 5IREA 1QACA 3OQPA 2ISSD 4J91A 1IC4H 2HXYA 4DEPB 3OTTA 4E11A 1Z6TA 1JZ3A 4CSTA 1KMGA 3CPEA 4GBMA 2GHIA 1NMSA 3KYKL 3BQUB 1AE6L 5AOMA 4XCCH 2UZYA 1UM9A 4RTKA 4FNLH 5A5GA 5CINL 3DRQA 5KVGE 1ULUA 3WS6C 1W36D 1FTNA 4IBQA 4I87A 3VFVA 3V0FA 2VPYA 1DZBA 3JYHA 3A1EA 2XUHA 2A2QT 3FFCB 1PR9A 4DKEH 5JPNC 1KE2A 5J9PB 4C56D 3EVBA 3Q5DA 3LBFA 3VFGL 1OBFO 1O6TA 5JRJA 2AXGA 3OMXA 2DPKA 4ZC8A 4DR7B 3QO1A 4MMZB 1K3UB 1KAEA 1ITBB 1HC7A 1FAKT 1Z06A 3U3DA 3NAAL 1KENH 4P7FA 1DO6A 1BOYA 4J39A 3O1JC 4PRHD 4TSBH 1XAGA 4RCZA 3T8VA 43C9A 2K4MA 2CM6A 1F11B 2SICE 1T9HA 3JQAB 1TO6A 1NUNB 4NMHA 2EYRB 5ICXB 3EJPA 1Y5NA 1WV0A 1ECLA 4PNEA 1XD0A 4HKJB 4HBCL 1AM4D 2I5YL 3N2GA 4JH0A 4JQIL 1O03A 3ICQB 1Y8ZA 4J0KA 2VXVH 3U9PH 4NO5A 1KQOA 3W5IA 4ZOLA 5DRZA 2LHAA 4LEOA 1M2GA 1OZUA 1L6ZA 3QU5A 4V3BA 2MINB 4GYKA 4XGKA 4CF4A 5HPOA 1RE0A 3EHEA 2VLJB 4NIYE 1LVUA 3QQ9D 3S8GB 5KNDH 1FFXB 5CIPH 1IOLA 3NTUA 1K92A 3QWQB 4PWJA 2JCYA 4PO3X 3DLIA 3JAMA 1G9NC 4CT4B 1K9TA 1A7NL 1MNUL 5IJ0A 5F7DA 3RA7L 3HNVH 5E7QA 1I9GA 4D8VA 3GJ3A 3M1CA 1IM8A 4DCJA 2WU8A 1SEPA 1M1YE 2QP3A 1R6DA 1PLKA 4Q05A 4DBZA 2BLNA 3F05A 2QQNH 4TUYB 3S27A 2G5RA 2X4NA 3UBHA 4IMPA 4F1JA 2ITDA 4OZGB 1NWHA 2VDRB 2AMGA 4Z7UB 4HWOA 3RBZA 1NFDF 2FJHB 3K0BA 4HTAA 2APWA 4ZRGA 3EEOA 5IROD 4KW7A 5JEEA 4BNIA 4DUGD 1W0WA 4E5DA 2B98A 4PYNA 5JYEA 5JD3A 3BJIC 3EJ6A 5BV7A 2B2CA 4MQBA 3QVMA 1ZT7B 4HZLA 1QAMA 5IUSA 1RXSA 3BO8A 2ZDGA 1ZHOA 1T89C 4TUOA 3ZVKA 3UJ7A 2FL5B 1YS2X 1BREA 5FEBA 1GT91 4Y1AD 1ZDQA 4G9FD 5EHFA 1KA9H 3VRJA 2P3SA 2Q8PA 1PLAA 1P2DA 1RC0A 5IN4A 5A71A 2QSYA 1RP1A 2ZUCA 1S8AA 4HULB 1G7PB 4O2BB 1AGBA 4G6MH 4G6FB 1HMYA 4HC1A 4JRYA 2ICAA 1GTG1 2FJFA 1UM5H 1DZ3A 2PLRA 4L22A 3VR6D 2NR6A 4N8DA 4B7UA 4F2EA 5J23A 3VX4A 4NH0A 5JHDE 1PJAA 4J2XA 3GHBH 1L2TA 4YPGB 2WKSA 5IUCA 1TRHA 2WA2A 3ABLB 1U6KA 4OHBA 5F1KA 2WZ5A 2XTLA 2R7AA 4FG6C 4FQIH 4ZQKA 1X8KA 4ENUA 3GPEA 5D1QA 1UEMA 2Y1XA 1WZAA 2XG5B 3VO8A 4JFHD 1L7DA 1AA9A 1OHHD 3C60A 2RIRA 4MA7H 4R90L 3JQGB 4UQEA 4GYWA 1R12A 2V5UA 3ZVNA 3QUXB 4AIXA 1XK6A 1OBVA 4K6FA 4HBQA 3ETGA 4WFJA 3P1VA 2VMJA 2CDCA 2W70A 4PGDB 1CK4A 3OESA 4F21A 3OOHA 1BHJA 4G5RA 3KXKA 1OF0A 3JVGC 4CSPA 4WTOA 2NZWA 3ILPA 3HI5H 3PEEA 5EJMA 4WBSA 3V9FA 4QPZA 2NXEA 1OB5A 2QTFA 5I82A 3RAJA 4Y1EA 4MA1C 1OF2A 3RU3A 3KAQA 1PW7A 3B8HA 1C08A 2JK1A 2Y72A 4OZGA 2EXWD 1YUHA 2GJZB 1FP4A 2Y76A 3HL0A 4EUHA 4KI5F 2DLFH 4Q16A 2ZAIA 5TEWA 5GTDA 5B1CA 4ELME 1MFCL 3D12B 1DBWA 3KVOA 4UATA 4EDXA 2JG3A 4JFVA 4KDCA 3GCXA 3WK6A 3MV8A 3MV01 1L5FA 4MW6A 1US8B 3LY9A 2AKAB 2ZCJA 1Z32X 4P46A 3L3OA 3W2TA 3AVUA 3ZE0E 5ALLA 4OPMA 4EBBA 1H8SA 1HE5A 2GBTA 3QP3A 2HV8A 5L2JB 5KNDA 4ANXA 1JWSB 4C7BA 4NWTL 3V0AC 4J76A 4KN5A 2NACA 5FB3A 1FL3B 2CU9A 1G87A 1U0HC 5KJRL 4KX7A 3K7EA 5IT2H 4ENRA 3DXYA 3ILQC 5KYUB 5G0SA 2WSPA 2P67A 3TLAA 3QENA 5LGHL 2GJKA 2XMBA 2NX5A 4I55A 4UHHA 4EYQA 2NTYC 3H56A 5FUZL 1UENA 1U9IA 3E3NA 1FFQA 4J3OG 2BVEA 5DN6D 3QYPA 5FHQA 1FORH 5B21A 2VC2L 3G79A 1S9XB 1XF1A 3ZWWA 3AKYA 1FYDA 1M6HA 4K8RH 1DG1G 1RR6A 1Z4KA 2YQBA 3ZR5A 1F6DA 1GW6A 5A40E 3P0EA 5G4KA 5F7XA 4WAFA 3SX2A 4E2OA 3L2OB 5D1NA 4ANVA 2CO6A 4NHOA 3V46A 3IPLA 1U41A 1KWKA 2G4VA 5BOVA 3TYFA 2ZUDA 3FU7A 4J7RA 3AUXA 3TVTA 2I4OA 4M5SA 1QK4A 1VB3A 1WDLA 2MOGA 4K3JH 3FMIA 2D74A 2WIKA 1X5AA 4EVIA 3P5SA 2GVZC 3EOAI 3FRUB 2VDOH 5IAEA 5BYJA 3L1VA 1JGUL 2GJAA 2VAAA 1U11A 2JKVA 4B83A 3QXAA 1RZIA 3OJDA 1N25A 2VF5X 1VKOA 3D2AA 1E9PB 4M55A 1L9MA 1NFIA 4EB3A 3DGGA 3N2YA 4MD0B 3T0DA 2F3SA 4BN0A 2WLHA 3OKMB 4XFJA 3SO3C 4IFBA 3I02B 3EWNA 2W2LA 2W8BB 1DQPA 3AEYA 4P86A 2JF0A 2AL7A 3LZFH 1M6OA 4MIYA 3SPGA 5T5NG 1IY2A 2DR3A 1NBZB 3NFNB 4Q1AA 1WITA 5IHZB 3GXMA 4FQQB 2ZCVA 2HT4C 1YBMA 4TTDC 2PMZA 4ZMYA 2ZE5A 1FS5A 2FDXA 1M34A 2HLNA 1Z26A 3F74A 1SA0B 5CA1A 2VQ6A 1TW3A 1LBEA 1OO2A 1E6UA 3WDHA 2WIJA 1T04A 2J59A 3AR5A 5DHXB 4XCEA 1ONBA 2ZJZA 4UQDA 1VOTA 3V5KB 4F9PA 3V4VH 3IMTA 4CJ0A 1NM5A 3AEUA 3OLDA 4IKJA 4S35A 1D6VH 4WW0A 1XNQB 1JI2A 3GAMA 4WZBE 5LP6C 3EA4A 5JHLA 1G2QA 2V4ZA 2MT9A 1HQRB 1FORL 1AZWA 2ODPA 3EOBA 5CB0A 2QL1A 2B37A 5C0RL 2QTRA 2VK4A 3HO1A 5TC4A 4N9OB 1M74A 2AXHA 1MI5B 4B3RB 5HHVH 1UD3A 1P61B 1E9OB 4I1IA 2X0DA 3VW3H 1KELH 5BN4B 3WI9A 2EFHB 4JM2F 3LSYA 4RHXA 4XHQA 4FDLA 1U2HA 3RL1B 4KNVA 4YRMA 3CJJA 4O33A 1JYNA 4Q1VA 2X5JO 1KLGB 2GLTA 4BMCA 4XNUL 1THAA 1H8EA 2JL1A 3I9OA 1E79D 4Y2QA 1UDRA 2BEWB 4UTXA 2YA1A 1K1EA 3HVIA 4NWUH 3IKMB 2CH8A 4TVSA 1GJUA 1OB1B 5G4KB 2BP5M 3THYA 5F8QC 2BEVB 2VF7A 4OJAA 1L7RA 2C9CA 3OEWA 3D39B 2QHRH 3PL6A 4TN5A 4IJKA 3UMNA 2QYTA 3B8SA 4NQQA 3UK0A 4PHZA 4LSRL 1AGEA 1X9HA 2DLFL 3BJEA 2GASA 4MGXA 1EM8B 2P1DA 3CMMA 2X7LA 3PFUA 3OD3A 5CMAA 1Y7PA 3LKNB 2QRGA 1CVSC 3F8TA 3CINA 4IMIB 2YKKA 5JCOA 1ZGLB 4OJKA 3LUHA 4Y18A 3UP1A 1Z88A 4APQD 3AGPA 5JDIC 3BVTA 1II8B 3RVVC 3WWZA 2V03A 4GSDH 3ER9A 1X9RA 2L8AA 3FOMA 4OK6A 2PW2B 2XCIA 4ZQGA 4CC4C 4LU5L 3E38A 3IKJA 3SVLA 2NUBA 2ADGA 4DADA 1HINL 3ZOKA 2D8KA 5E2VL 1LK0A 1VTKA 1QGZA 3JD1A 9ATCA 3EIQA 4AG5A 3BQUD 3MOQA 1RAHA 1E9AA 1KSJA 2D7DA 3L5WA 2AT1A 5FA5A 3ZYZA 1A7NH 1NUFA 3QA3B 2EIBA 1Y7HA 3OB0K 4Y16D 1ZIDA 5HYJA 1N5LA 1X15A 4LPYA 4XX0A 1NN5A 4EKJA 5HQ3B 4W5OA 2ZOUA 4ZFGH 5JRDS 3QU4A 3L3KA 1W25A 4EHLA 3DVSX 5C8YB 2IBZX 4OT1L 2OAQ1 1AHWB 4D94A 3MTBA 3NFRA 4HLZH 3WNDA 3A67H 4OZFB 1EKXA 3FTUA 5AAWA 1QBBA 3BMQB 3IAM1 1GZHC 4GI9A 3GWJA 1AK2A 2VJDA 1WKCA 3W9SA 3SMVA 3P2TA 4ODWA 1ZH0A 4YHYB 2IYXA 1KC1A 4EOWL 1PNVA 3MLXL 5DWVA 1V1JA 1DCEA 5BQ3A 3EJTA 4XWGH 1BF2A 4Z7NF 4GLLA 1OCWL 1GZ4A 2PTTA 1Y1PA 1Z6YA 4DZBA 4NERA 3JQ8B 1IU1A 4NSKB 2F08A 4ZS7H 1P4LB 3UAJC 4N2GA 3DC0A 4BEWA 3L9XA 4OD3L 2XVZA 4G0VA 1X0XA 3VXNB 3VDRA 2CBTA 2R4SH 4OV5A 4N2AA 4DANA 1QBGA 2BFPA 4X6FA 4DK3A 1TKWA 1AF4A 1FPMA 2GBCA 4G41A 1PEWA 1GNLA 2O8FA 1E0DA 2CFCA 3BPSA 5TGZA 1TJ5A 5GV7A 2OO7A 3ME5A 4D9BA 3S0JA 3KE0A 3HWWA 4HMEA 2W6CX 3K4QA 5B3JC 2JLXA 2W91A 3HBLA 1NAMH 1RDFA 4JC0A 1N75A 2R8PA 4NNPA 3GP8A 3WZ2A 3F3SA 5B58T 5GHWH 2GFHA 3KDAA 5F7NC 3WS6A 3QYMA 1DFBL 2PX8A 4US1R 2BRUC 1VE5A 5CM2Z 1O6SA 1XYGA 1CICB 4Y2DD 3MOGA 1YRWA 1FMTA 1Z4LA 3MSCA 5AVOA 1ED3A 3HH8A 2YWCA 1UK7A 2WUVA 4HH0A 4NUQA 1QTPA 4MK4A 1V16A 4P3DB 5JZSA 4R4NC 2Z3FA 1JT2A 4I1SA 3HGMA 4ISVB 2QFRA 2Z6FA 1OT5A 2FW7A 3F58L 1EWRA 4MB1A 4NO0B 3GY0A 4MJ5B 3REFA 2FG5A 2AV1B 3P30H 3DMMD 3U3MA 3UMSA 5LLIC 3K0FA 4OGAD 1YAZA 1O6CA 3ARXA 2D7TL 3ZHFA 1QAOA 1KLUA 4B3SB 5A3SA 4YPOA 1YZGA 3UMBA 4AL4A 5EP1A 5IQNA 4KHTH 3BCUA 4TSBL 2MJLA 2W07B 4Z7AA 1P5VA 2NPOA 4I55F 4HB2A 3HC4H 2ZUQC 4MXVE 1IJKA 4UUQA 5LNEA 4MMZA 2FPSA 3V8PA 3D2TA 4RGMC 2HMTA 1EA5A 1ZVMA 4I3FA 4J2HA 3D3VB 2D5BA 3DI3B 1EBAA 3AWEA 5MHSD 1VZHA 1EDQA 2I4TA 2Y9MB 1TQVA 1PQUA 2OMUA 3SQNA 5MHSE 5LJYH 1RWWA 4RNCA 8ATCA 4RCAA 1ZI9A 4Y89A 5E6IA 1B4TA 4IGBB 2Y5QA 2WZDA 4J7AA 2CHNA 3VR5A 2OD2A 2J56A 1EFUA 3UZEA 3K09C 4QRDA 5D96C 3STVA 1A14L 1ZEAH 1GRRA 2PG3A 3TN7A 1ZN7A 2GESA 4DQKA 2NP7A 2WBLC 1S3IA 2C5DC 2FPKA 1ZHKB 3KLNA 1RMFL 4C4UA 3VGEA 1U0SY 1XPRA 2JFVA 4CVZA 4ZPTB 2MYTA 1REIA 2H5EA 3X0DA 2F1KA 4FFBA 4YLCA 2B4TO 2AVFA 1SJEB 3RI5K 1UBHS 4UCFA 3AL9A 4XB7A 1RC1A 1LY1A 3QJOA 1EO8L 5T1LD 2ENJA 5CJBA 4BRSA 3RS5A 1G66A 1VE1A 5JIPA 3MWFA 3VR0A 4G65A 2O61A 1IOZA 3MRGB 2D54A 4O2AA 2Z93A 3WGQA 2K6YA 1WC7A 3NHRA 3X2SA 5IROC 1M6WA 2A74C 1RJZB 1VL5A 2H3XC 1XF5A 3TEFA 3NC4A 5FBHA 4UIMA 2OFOA 3ZQJA 4RFLA 2ZTBA 5JLZB 1U8XX 4CFZA 4NBTA 5CN1A 2NVWA 5CX1B 1H1LA 3DHPA 3BTVA 1ESZA 2R2EB 2SEBB 4WUKH 2CDAA 5JIDA 4E9WA 1E2BA 3FFCE 1IGJA 5D6OA 3L3IA 3ZBQA 4L2LA 3SE0A 1JYEA 1U9YA 2IP1A 4Q02A 3GJ7A 3TG8A 1U8IA 5FK9A 1QZTA 5HZMA 4K9MA 2XFGB 5E4JA 4DRXA 1FPQA 3X1GA 1TF7A 3WRWA 1ZRHA 3MLXH 3EZFA 3H84A 3HNOA 4F45A 2IODA 4LPTA 1OE3A 4LN1A 2IGFL 4IILA 3WHIA 2OK0L 5T1DL 2YQ2A 2PX6A 1P6FA 2YFKA 1RMTA 3MUZ1 4YQXL 3G5YA 1QU2A 5TGDA 3QE0A 3NG1A 3HY3A 2OTPA 3AC0A 4ZAZA 1MFDL 1G7LB 1VEMA 4FFNA 1V8HA 3OCUA 5AHXA 1YHYA 1XWVA 1TW2A 4KWHA 2UXFA 3UABA 4AY2A 4QDZA 3QMPA 5D1XC 4YAJA 3SY8A 2X2PA 1XTRA 2XWCA 2L7QA 4ZDHA 1IHUA 3IDNB 1E8MA 1P9LA 3QUBA 3MLSH 4P4RB 5E6UB 1NQVA 2P48B 1S2MA 3ASWA 4UMDA 4OK5A 3CH8A 2W6JA 4GKOA 1PT7A 2NU8B 1RU3A 3PXHA 1FCGA 2CJ3A 3ASOB 3B7RL 3EO9H 1VFNA 2Z34A 3S7GA 1GFWA 2YWHA 3M07A 1XCLA 1P1VA 1QYGL 3S3JA 2E1RA 4JLRA 4GO1A 2GVDC 1MQAA 3N39C 2EDKA 4KIFA 1TUBB 3BPOC 4AG4H 1IZZA 3PWVB 4YZFF 2OHJA 1J0YA 4JFYA 1JEQA 1PEYA 1IAKB 1KN4H 7YASA 3BB4A 4KPEC 3ZSSA 4Q9QH 4S0SD 5IBRA 3M33A 5FUOH 4Q37A 4A82A 2X8JA 2R8SH 3DBIA 2VLKE 3VR6H 2E5LB 1M54A 3DV4A 3BMCB 4JHWH 2DLCX 4GU5A 3I8XA 3NA4A 3AI7A 2VHZA 3LH2H 4YDQA 3DX9A 1QW9A 1Z5LB 3I3DA 4OJEH 5HKLA 5EOQH 1V7CA 4K6HA 1S5HB 1N5KA 1C8VB 2IYOA 721PA 3P9YA 1XGPB 4AOFA 3V1UA 4JDUA 4L8VA 3K8KA 5I1JL 4GGOA 1ZXBA 2RMNA 5B39A 3WLIA 2GNOA 4PLTA 3KT8A 3ZXXA 3Q2CA 4UTOA 4U63A 1E67A 4PW4A 1KXHA 1LJ8A 1M3IA 3H8SA 4K9JA 2HFFA 1CQXA 3Q7IA 3GNMH 1EK3A 4I48B 2WMYA 5J1AB 2QRHA 4E5KA 4HAGA 4ZYUA 2GTQA 5J6GB 3RVXD 3AB0B 1ERNA 1HBJA 2P5EA 2VJMB 3MTDA 1E6OH 3ET9F 4NK4A 1TT5B 5I8CB 2HU2A 1E2HA 4J3OF 5GZOA 4MSWA 2BJMH 2XVKA 4YI3A 3WSTA 4IXDA 5NLLA 2MHAA 1FB5A 3M45A 2GN9A 4PPQA 3EIFA 3P0VL 4HUVA 3AESB 4Z2AA 2BH9A 2W6OA 1UATA 3VD2A 2JWGA 1PWZA 1B16A 3AREC 5CCHE 2HLEB 4P05A 4IH1A 1NOKA 1TEZA 1M6EX 5HHNA 1D2AA 2PXYC 3GHEL 4Z51A 3BX1A 2VPQA 4M7LT 1I53A 5CBKA 3BWMA 5CEXB 4E41D 4DMGA 4U0RC 8PAZA 3IQGX 4MHHG 4E36A 1N0IA 5E9DA 4JJKA 2M26A 2AUTA 3BIKA 3CW2A 1YB6A 4ONGL 2HTFA 2X9ZA 1B74A 2ZJFA 2MH4A 3ZKXB 1BYPA 2C9MA 3AV3A 1ZIXA 2WJJA 1IIIA 5HS6A 1AG6A 2R9HC 1IAQA 4TSKA 3VMMA 1KIRA 3KT3A 3VYTB 3L4WA 2VAJA 2VJOA 2A9BA 1H4VB 3SC2B 4A6EA 4K3JL 1IEAA 4CKYA 3EIHA 4TRPL 2D0OB 4H16A 4NS1A 5EC2A 4IEEA 5CN3A 1IE5A 1MFVA 1BYNA 4OQXA 3FPYA 2F1AA 5EIWA 4P93A 2W0SA 3QVJA 2ALAA 2UWEB 3EIWA 5J11C 3CU7A 4NOKA 1G7CA 3TGLA 1DDOA 3L45A 2GO7A 4WOPA 2OW6A 3AJ9A 3QLEA 4MV0A 3IJEA 5BN1A 1R5WB 1TD9A 4YAQA 1J5EB 2IDMA 4Y4HD 5DK0A 2BVNA 5IBQA 3ZWPA 3ZL4L 4N5LA 4Q6WA 2I0FA 4UEQA 5I9NA 2J2ZB 1R50A 3UMGA 3WENA 1IL1A 3VCLB 2VR1A 3ZHUA 5C08A 3T9EA 1PNDA 1YMMD 2C2YA 5I3CA 3MJRA 3OAZH 5IBUG 1LLCA 3G2IA 3IS1X 3SWWA 5SWSA 1EEXB 3RLSA 3N41B 4HH3C 2QD3A 4K9KA 1M7GA 3DURA 4YDSA 5MFPA 4KZ0A 2ODWA 3FCAA 4JP5A 2PZFA 6YASA 4KKZA 2HDWA 2R751 5A6SA 3DHNA 4XC3L 2OHGA 4NR0A 3C0KA 1FLRH 5AVYB 2DWEB 1QFJA 4EEXA 4JBXA 1U3JA 3H7IA 3ZHDA 5LYJA 3IV6A 1GZQA 4Y5VB 3WIHL 1R33A 3MPUA 2JFGA 4YJKA 1PTZA 1N9KA 5DD6B 3GAZA 1ATIA 4B40A 4RE6A 1NMCB 1K5PA 4AKTA 3IJRA 3ABOB 4QVKA 2P47B 1M2NA 4MQFB 1GH7A 2OYSA 5CFRA 1IGML 1BQ3A 4P4TA 5A2GA 5FV2A 2VK2A 1ASQA 3OKPA 4X3OA 5LZ5A 4G5AA 4HKTA 2OZEA 1JE0A 4N9QA 4Z5XA 5CXSA 5FYLH 4GM0A 2HFEB 2FATL 3N6YA 2O8DB 5BRZA 1UOWA 5CZXC 3MRJB 3KPLA 3SGDI 5FRDA 1C7RA 2BHYA 2HZHA 4FN4A 2LVCA 2J8UF 3K6KA 1JNLH 2HVKB 3EVAA 3FI9A 4NFYA 4GXNA 3GSVB 4CQMA 2JFYA 2YNMD 1JR6A 2Q6IA 2PS0A 3R3WA 5L40A 4JJ6A 1G9MH 1H6TA 3DBXA 2I9TB 4P0PB 1A3QA 4MGIR 2QN6A 5T3ZL 1OV6A 3T61A 1WMFA 4JFPA 3DV6A 4J6RL 4DKJA 1CFNB 2OKGA 2J9FB 5GSVA 4OFQA 3RWMB 4FHEA 4LP5A 3L06A 1KOAA 1TZHA 3OP4A 1PIFA 2XQIA 4L4ZA 4OBEA 3FF7A 2F5AL 4UOJA 4GI8A 4PRPB 2PYFA 2WU3A 2I34A 1CE1L 2IHYA 3SJ7A 5FNVB 4H4EA 4BAZA 4HOYA 5B39B 5IQOA 2EQBA 6REQA 3CHYA 1CX9B 1NW8A 1Y98A 3EYQC 2N9UA 2GRAA 3QFJA 4M0KA 5DD3L 5AW7B 3BK2A 2HUHA 1BRMA 3GLTA 1ONOA 1NAHA 4PZUA 3RSGA 5AM0A 1O3YA 1VPVA 1AO7A 5CCKL 2C61A 3J27A 3ZDDA 4X5XB 1NWOA 3U3JA 3SN6N 1ORIA 3QA3E 3E58A 1GGJA 3QFDA 3GI9H 2QMQA 1J05A 2NXJA 5DUPH 4ARZA 4X80H 2X4QB 1PGOA 3E22A 3DMHA 3P20A 3ECBB 4HLDA 4Q2ZB 3QZBA 3U6BA 3CR7A 3TVDA 4MI3A 4YO0B 1AXRA 4HAOA 3KPSD 1BGVA 4GQAA 3NOQA 2V5TA 1NLMA 3KS0J 1L1RA 3LQKA 5HVGB 1R5VB 1ZHLA 1KJYA 3W1VA 3S70A 3MF4A 1YZLA 2QN8A 3FUFA 3ZXAC 1EZ1A 5E9DE 1Y9DA 2D2XA 1JVBA 4OSPA 2PAFA 4NZJA 3I53A 1AOHA 1RZ7H 3WMEA 4NJMB 2DI8A 2BHRA 4K8RC 3Q41A 3KPRB 2EDBA 1QHOA 5E3JA 1FFNB 5AJVB 5AVQB 4R7GA 3ZXSA 4AVIA 1FH2A 1VKXA 2RK3A 3GF8A 3PQYB 4OAWB 4R71A 1X77A 4J0HA 2RI1A 2FT8A 1WZKA 2IANE 2ID7A 1M72A 2JH8A 3B2QA 3BT7A 1T80A 5DP2A 2VDPB 5JI3E 5IB1A 3PGXA 1XD1A 3FQ1A 1TR7A 4NBZB 4NNPH 1R37A 3KZNA 2EZTA 1PF7E 3OLQA 5KSBA 4G67A 4HDIA 3ARWA 3S9DB 3Q0TA 5DO8A 1K5WA 5LL6P 4FA6A 4GG6F 4ER6A 2VMFA 1MWOA 3T04D 3JAWB 4MYCA 1M66A 4ZZ2A 4QXTB 2FQQA 3DMMA 1KXVC 1UADC 3W5CA 2WIIB 4H88L 3WK4A 3RVTC 1OT1A 3ARSA 3L5XH 3IXMA 4IXNA 1IUNA 4JB9L 1DLFH 3RCBA 2RIPA 1FQJA 1M7HA 4DT2A 1U0FA 2CALA 5B6PA 1RJCA 4IBVA 2DFLA 4LW8A 1GG9A 5FNVA 1WBBA 4P5TD 4DFIA 4RDQF 5DWUH 3P3YA 4BQCA 4Q0MA 3K0SA 1QDLB 5DJDA 1DQTA 5TDOA 2GCGA 3MCKB 1DVFB 1FYTA 4P23A 5TE9A 1OPXA 4Z1PA 2QI9C 3J80A 5CG2A 4ZZKA 3ANYB 3L0OA 2WJYA 1PFWA 4I9GA 3UOWA 4XWAA 5H68A 3AXHA 1NF8A 1YMHB 4MEAA 4MX7B 1NXTA 1KEEB 4A68A 1C12A 3SR0A 3HU1A 2GZ1A 1OVZA 2Y3NA 4YC2B 4YEEA 2IUFA 2GGSA 4DA4A 5DJ8B 1MDBA 3ZE0F 4N41A 2ZSUA 1OJLA 4XP5H 4NPCA 3KWLA 1V7NL 4DFDA 4IF6A 1A4KA 2BVTA 3CUYA 5E2TL 1NCWH 4TOYL 3LC2O 3MXVL 1HM5A 5GINE 3VX3A 4P06A 1T5XA 5B22A 3LKPB 2C9QA 3S4SG 3L02A 3ZDEA 3D1MC 5D7SH 5AD1A 5LQMA 4Q6KA 5LD2B 1PUIA 4B9FA 4EG5A 1FTYA 3ZE2F 2H07A 4GWKA 2SBTA 5I1EH 2BMVA 2GIYA 2DQEH 4KUZH 4YCMA 4WD3A 3DBOB 3NBKA 4XMPH 5DWUL 2OFFA 2IHBA 4KSCA 1WHTB 1RL1A 3KQTA 3OQIB 5HTOA 4BFYA 3MGTA 4BO0A 5E4EC 1YFJA 1DLFL 2IF7A 4RUKA 4HH9A 1RYDA 1D8TA 1ZY9A 3DJSA 1DOHA 3TOCA 3T4AA 1XCWA 2W6NA 4S24A 1KY6A 4FFMA 3VXSE 5FOQA 3U30B 5AVSB 5CNIA 2GW5A 3U5TA 4YRZA 2G9UA 15C8H 4QULA 1HGXA 5ITZA 4C2AA 5FI5A 4CVWA 2XUWA 4Y9CA 1GWNA 3AABA 5KCMA 4LPXA 5EVJA 1FQ9C 5CFNA 2GK0A 3DOCA 1DKNA 1KJ3H 4WTZA 4YRGA 4XI9A 4AMGA 5SYAA 1ZMXA 1I7ZA 3SLGA 4K23L 4KI1A 3GWZA 3BXXA 2ZD0A 3ROOA 5F1OA 1NW3A 1JDSA 2QN1A 5L4SA 1K2WA 3IB4A 3GO4A 2P65A 2C2GA 2FQEA 4GRWF 4PG2A 4HGMA 4P3YA 3K1YA 3IAS1 3L8FA 5AW5A 3NHMA 1SXSA 5LGJA 3FB5B 1E0AA 1C16A 5DUML 5IABA 3CJRA 3ZQ9A 4PR5B 1E2ZA 3NCBB 2X3FA 2GXUA 4TPKA 2LU7A 2YLHA 2PLWA 3W8NA 3IV9A 3RYTC 3T77A 3GLZA 4RMIA 1PN3A 1VJGA 1J1OH 4YDRA 5AW7A 2O6DA 4JHBA 2EZ4A 3BJLA 3OURA 3GUFA 2QUAA 3Q8FA 2HMWA 2VABA 4D7BA 1G20E 5DVMA 5E1MA 2DECA 2MSLA 4JKPH 4A36A 2EX0A 3WB2A 3MRRA 3DO3A 5F7BA 1I8KA 3IFLL 4X8GA 1U9ZA 2ZRQA 4H8WL 3S1SA 4ODIA 2VAPA 3LQQA 3IDGA 1Q91A 2DQHH 1JHYA 1HLPA 1PX0A 1YSOA 5EWLA 3WFCH 4NHUB 7FABH 1PK8A 2YV1A 3ZE1F 1NOIA 3FVQA 3GJTA 4BC0A 1TTBA 3V9EA 1PEKE 2LLGA 1PR2A 1UWKA 3R4CA 5FHBL 2Z5FA 3X1MA 3RAGA 3ZWVA 5JXIA 4PJFA 1BFUA 4ZVNA 5KWJA 4F8QA 3A22A 2FPIA 1JHDA 3AQ4A 4PLPA 4MXVF 4R2HA 3HBJA 5CVEA 3N2EA 2REXB 1A7OH 3CSPA 2IHUA 3HYNA 3WTWA 3FSRA 2MSPA 1O9HA 1G8HA 1G59A 3H6JA 2H0RA 4MI1A 2TSAA 5CEZL 4Z1OA 2JZNA 2EYTB 4KOCA 4QXVA 4UNNA 3ESYA 5D5QA 1LDEA 3TTYA 1NICA 3FTYA 3TPKA 1E2MA 1H2YA 2B5IB 1UXGA 1H4TA 2CNWA 3PPXA 1LMIA 4FXGB 2Z0UA 4WEBL 1V3TA 3VFTB 2JCGA 4OZGF 1X1TA 2W2TA 5C35A 5ALBL 1CL7L 4HRXA 3ZZUA 1GPLA 5FUWA 1QJ4A 2FZ5A 4R8WL 2J0UB 1FNCA 2QRPA 2CK2A 3DEYX 1CGTA 1TETL 3MINB 3MJCA 1V47A 3QG1A 5TB5A 1W0JD 4TS3A 2REOA 5KANG 2E7LC 3LGXA 4MUFA 3IIEA 5A2KH 1I8AA 4C57C 2WT8A 1MOEA 4UTBA 4FQCL 3LUGA 1Q95A 3QBTA 4ZEXA 4QT5B 1N0UA 1I4TD 3NH6A 1QP7A 2A4EA 2GFQA 3ET5A 3TT1H 2WILA 3OGOE 3WY2A 3DXXA 3DEHA 1XIVA 3BF7A 4DARA 5MGNA 3FTFA 2AJCA 3GOQA 2OR9L 2FWAA 4RD3A 5ESXA 2YPKA 4GECA 3F7NA 3MJ8A 5D1XB 5F7WC 1T0BA 1W88B 3WLEA 4QRPE 2WYHA 2VXYA 2OZLA 1JU3A 1PL7A 3B9KC 4UMVA 1N6KA 5GGSY 5KTTA 1SY6L 1JPGB 2DLDA 4QU0A 2O57A 4YPFA 2F43A 3ISWA 4Z7VB 1SUCA 3MRFB 1COWD 4AYFB 4FB5A 5EY5B 2RKWA 3R09A 1R27A 4HP8A 4LJ7A 1UOPA 3DA8A 3ZUPA 4ND8B 2DMRA 5C8XA 2B08A 3D6FA 1HNGA 5B38B 2JANA 3EVFA 3QBDA 5BV8A 2RFXB 1T4CA 4FEAA 5EZYA 1QPKA 3B3GA 1XXLA 3KJHA 3K5WA 5A3ID 1VJDA 2X6UA 1RJ9B 4ENPA 1G3IA 1N5OX 2XA9A 1U3FA 3LKPA 2RJNA 1BQHB 3D30A 4LFHD 4FMVA 4B32A 2A77H 3FG9A 3CXDL 4XGRA 4FEGA 3HBFA 3WMSA 3MRKA 4G1FA 4LUCA 1BA9A 4YK4B 3KYOB 1B3IA 1DO0A 1OSPL 1MR3F 1N6QL 1P2FA 4JSTA 3D8BA 4D1YA 1FBTA 1BVUA 2V17L 1ZSVA 2KL6A 2OCYC 4GXQA 3TJHD 4M1WA 1D5BB 2CL6X 4DTCA 3MBWA 3AV0B 4EFNA 4UV7H 1VBFA 3U48A 4TMKA 1TTQB 1KYTA 1TKCA 4R5MA 1J0XO 4KV5F 4GQZA 4ZFOB 2JGEA 1MF2H 4LLWA 3CKMA 4I3RL 2IALB 3FT3A 5CD9A 1Y9AA 1GNVA 4O4IB 1KT2B 5F89A 4K3JB 3MUUA 3U0TA 4UQBA 5D55A 3DNPA 1JXJA 4EKEA 5AXBA 5LQSA 3NDRA 3ABSB 3BWEA 4ZTPL 4F7CB 2O8BA 1J8KA 4TUYF 1LQUA 1W72L 1RXLA 3WJ2A 1MC4A 4IOFD 2KM1A 2MINA 2FP4A 3WL5A 3FMPB 2ZBFA 1KMCA 4GHWA 5H9WA 1ULHA 3T0VA 4PVBA 4ODSL 1AQDA 1ZUWA 2BC4B 4CA4A 3MJ7B 4MW2A 3L5JA 4U0KA 1N19A 4LRQA 2IPKB 1EUDB 3DCIA 2OD7A 4EHKA 3FXIC 3U13A 4MUHA 1TLKA 4KK9D 4Q4HA 3BAEH 5IWAB 3OGCB 1Q0RA 4CMEA 5CG1A 4LBEB 1FJ1A 2Q5OA 1URZA 5F76A 5B2EA 4CL2A 4MJ5A 4OCYL 2IAMA 1IWOA 5IH3A 1HF3A 2RHLA 4HETA 3NAZA 4JHAH 5AI9A 4K9NA 3OC5A 3WL4A 3GZNA 4GKLA 3LRTA 4IDCA 1LA2A 5F4ZA 3DZHA 4MA3B 2XKUA 3F6IA 1IIRA 2XHZA 5HKBA 4L3AA 5AIAA 3BUPA 3ASVA 1DS6A 3BK1A 4LTMA 2AQRA 5FLVA 5TF0A 5FTLA 3PUVA 2GSMB 1I8MB 3NCTA 1Z8NA 5E00A 3RTAA 3D4IA 3WMPA 4A0RA 1QIGA 2APVA 4I18C 4LWOA 2WJ3A 4DYDA 4RMHA 1PG7H 5BVJB 1LWJA 3QKSA 4OCXH 4QM6A 1FJXA 4D81A 1OCOB 3ZK0A 2CHEA 3QIUC 2GHRA 4WERA 2WWTA 4ZMLA 1XZIA 1TNMA 3DQQA 4W1RA 1NGQL 2PH1A 3FH0A 5ALFA 2QVYX 1CBUA 4YMPA 3DL7A 4AZ8A 5JIIA 3QZWG 4NYLB 4YXHH 4DP0X 2G63A 4LRNL 4KK8C 3JW8A 5A6VA 4ML3A 3ZY6A 4CQMD 2E85A 1UP6A 1N3BA 5HDQH 3LLVA 4P5KB 4GG6A 1MVLA 3TLGB 3I64A 3ZU2A 4HPYH 3B6SB 5E8NB 3OMIB 1U2TA 3IVKA 2ETWA 3D3WB 3C98A 1QSED 3K31A 4F96A 5CLIA 4YDMA 4FI8A 4JB8A 4L72A 1A6UL 1S2GA 3CX4A 1C3JA 2VJAA 4GMFA 1QHQA 1OPOA 3IXLA 2X1HA 2OFXA 2AXGB 4FD3A 3MNDA 1NUSA 3DI2B 2DQMA 3WYCA 4MKMA 4PY8I 2NQCA 2FX5A 1BX3A 3ETDA 4PLJD 4XQ0A 2JIXB 3WA6A 1GAWA 4BN5A 4CLRB 3NJFA 1IJNA 4Q9QL 2N0KA 1Z5GA 3ETBF 3N55A 4JROA 1AR1C 2AR9A 2H26B 4NESA 5JYDA 2LAAA 4TVUA 1PSZA 4AK1A 4BBZA 5L4LA 3Q8CA 4WEBH 3HAEB 4ANWA 4AAYA 3E0GA 3MLZH 4ZVLA 1XYVA 5KNLA 3DHWC 1Q9KB 3LT1A 3RZCC 1EQAA 4LV5B 3CLHA 5JCZA 3OL2B 1QAWA 3T3PB 1DRWA 1ULAA 1VKNA 4PJIB 4NABA 1E5YA 2ETVA 3HKEB 3K4AA 4MV3A 4FL4C 3I6QA 2IZ0A 3FLEA 4KK5C 3SCMD 5EESA 2VT0A 1H65A 3AUJB 1MLBA 4PVDA 1QA9B 3AHFA 4LMBA 5BSKA 3GA0A 4YQYA 4RFEA 3DTUB 3PJGA 3QW2A 2CNKA 3UPRA 1CQPA 1QHHB 4XGQA 1RLWA 4CM9D 4U1MA 3KR1A 3BDIA 3KP1A 3TM6A 1PDKA 3HG1B 3D25A 3T09A 3GNML 4FHJA 3L4ZA 4CKEB 4BOYA 3ZTYA 3CZNA 1YR3A 5K51A 4ZCIA 3A6KA 3Q9QA 3PWPA 1IX2A 3RUGB 4U4IA 3UL4A 2DQHL 2C4VA 8CGTA 4CZ2A 5JIMA 3CXUA 1EK2A 1K5NA 3LX5A 3KUUA 2ZWKA 1ZHLB 2P5UA 2ZAGA 4XM2A 3KYJB 2EICA 3KXFE 3EGXA 2HMIC 3Q3IA 2XIJA 3ECWA 4EAEA 4NO0D 3U30C 1U8LB 3BSZA 2DKUA 4G9FA 1T03H 2PH5A 2WV9A 4A9AA 2XWXA 1FW8A 1NXXA 1SBQA 1RVV1 5DMKA 4LOVA 3ORJA 4U6XB 3W1EA 2LV4A 1DVUA 1ZSNA 1QX4A 5E8DL 2A0LD 1J8HB 1P2TA 5DU2A 3GMPA 2Q4OA 1IO4C 4PUBH 1ADWA 3DPIA 4NXNB 3WISA 1HMPA 1I4FA 3RI3A 4Z7IA 1IGTA 3WJJA 4LIQL 2I1QA 1FWXA 4R3WA 5E9JA 3LQ2A 1L9TA 1E18A 2CLHB 4RISL 4HGOA 3UC9A 4LSTL 3U4IA 5J59A 3QPQD 4QYOB 1QYGH 5C0AB 3V7YA 2E9IA 2AW3A 1KK2A 1Z1WA 4PCKA 1SKQA 3W5VA 4CNIB 2C04A 3MAJA 15C8L 1MO4A 2A6PA 5A7HA 3NV9A 1M05A 1PD1A 1DXQA 3FTPA 4HQLA 2IA5A 2P8JA 3ZWXA 1T1YB 3OCYA 5JR1L 2VWQA 3IR5A 3UZUA 3ZIYA 1TU4A 3KR9A 1NUAA 3ARDB 3AVTA 4TKUA 3GGDA 1M9WA 1Q19A 3OZWA 4AE1A 1OARH 4O4LA 4YV7A 3B1YA 1LC3A 3VZQA 3T7EA 1MCPL 5HGDA 4ZX3A 1QK5A 1JG9A 4QOKE 1RI8A 5JAQA 4JJOA 4YALA 5FGBA 3N6XA 3DZBA 2ZT7A 1N6RA 3QTTA 3ESAA 5CXQA 3VHQA 2OVBA 3VU8A 2I67A 3LP5A 4PCLA 1T4KA 5J4KA 1ZCRA 5DO9A 3UFBA 4B73A 2M32A 2CXOA 3MNMA 5KPDA 3BPNB 1UKSA 4K3GA 2HJ9A 3COSA 1YRKA 3AUFA 3GM0A 4NBVA 3KPRE 3E03A 4HOMA 1KYFA 1DEEB 1GLNA 1A0QH 4CETA 4LHZA 4HZAA 3UKJA 1XD9A 4X94A 3NOIA 4TZTA 4FFYL 1NMBL 5IB4A 3E4CA 3SBPA 3X14A 4ZS6D 1E4XL 2E48A 4BA0A 3VXMA 4HXBL 4C2UA 1Y1RA 1NLFA 1P6AB 2YRWA 2RHMA 1OAZL 4BVJA 4C6TB 4ZK8A 5EOTA 4NCNA 1E5BA 2QY9A 1EMTL 3HHMA 4QQKA 3CRMA 3MR9A 2LDXA 1HOEA 4YHKL 3V52H 4LPCA 2AG6A 4GIOA 3WV0A 5FLKA 5ER6A 3T71A 4L0MA 4MNQA 2K9UA 4NPYA 4WJG3 3ZGNA 4CMAA 4F8TA 3Q7RA 3N43F 3BWDD 4HK3N 4HEQA 1J11A 2KW5A 5EUBA 2XMDA 1JR3A 1AS0A 2FYTA 3L8CA 5DX1A 5I16A 2JKNA 5DGHA 3EYUH 5AM5A 4AI6A 1JZ5A 3B2NA 4CF6A 1SBSH 3P77B 2B4QA 3TVYA 1KYUA 4OCNC 3LECA 2RGGA 3B5JA 3SSNA 3RRFA 4U7GA 5KYTA 2DTXA 4LOIA 2P8LA 2Y71A 2GBVA 1QPBA 2LCIA 4Z99A 3TB4A 5GOZA 2PH7A 3LCRA 4GX5A 3ZGZA 3TSCA 1E9BA 3NAQA 4J8RA 4B0MM 3THWB 3WFEH 4DHEA 4KHZA 3L6RA 1MDTA 4J3BA 4DIMA 2MTBA 1J00A 1OTSD 3IPAA 3K1JA 4BCCA 3N05A 4IRZL 2XJLA 5LWYL 7PCYA 1XL0A 3TXYA 2I85A 1W9HA 3MERA 9LDTA 3AHHA 2XUFA 5CDFA 4GG6E 4XO8A 1UC8A 4BZZA 1LWRA 3A3YB 5IBPA 2A5DA 4GKSB 4DR5B 4L18A 1QNFA 3QG7H 3SHOA 3PGKA 5FUCE 3BE5A 3GMRA 3U0WH 3LOQA 2AW2A 5D7BA 2BSRA 4LYGA 1N68A 1WSDA 2Q8NA 1ZXLA 4ZGWA 4M6WA 1H3PL 2YWBA 3D6AA 4WSOA 5AVWA 2MQCA 3PXAA 4EY5A 2YS4A 3HS3A 2GD1O 5DC4B 2YRFA 1PNQA 3AOEC 5C0DB 1YRQA 2PX0A 3VXQA 1WBXB 3GI9L 3LZDA 4IHKA 3FKQA 3GQBA 4KUCD 4LCYB 1JNHB 4LQFL 1E4XH 2DQEL 3ASZA 3JQCA 4K8RB 3CIQA 1NJ5A 4ESKA 3NDYE 3NZ8B 1IDOA 4KREA 2WLTA 4BCBA 2FMKA 5HI3C 1JKXA 5JMWA 1GKEA 3G2HA 3HG4A 4G81A 4WI5A 2ZOWA 4FOLA 2IYQA 1MCQA 4IDOA 1BFOA 1MSPA 2CUZA 3EHBB 1TUGA 2FL5A 5IVXB 1G9MC 1P7KA 4HJGA 4QPEA 4WJZA 4TQPA 1U98A 1D9KC 3P4NB 1IGIL 4U39A 5D7LD 4PY8J 4Y7DA 4Y2PA 4S1SL 3ECQA 3THXB 4TMVA 3RWJA 5JLAA 1BLNB 3AIMA 2NTNA 3RU8L 5G4OA 3M17A 2CXQA 4Y5XC 4DN3L 3ZCQA 4KXAA 5E1GA 4GT7A 3I2IA 4R4FH 3K9NA 3AB7A 2H9GB 2X4OB 2EIDA 4LU5H 1P1BA 4BBJA 1ZE3H 1FYTE 1OLSA 5ADPL 3E53A 3HHSB 2XCSB 2CLVA 2PNFA 1N6UA 4C0SA 2L17A 1K7SN 1C5DA 4NLHA 3EPPA 4PG8A 1DE4B 3HB4X 2WWNA 4EFKA 2DL9A 3T7SA 5ICFA 1EP3B 4EBFA 2B1AL 1Y7TA 2XZZA 3W9DB 2ZX7A 4XQEA 3M6FA 2NSLA 1OAJA 1HH9B 2FATH 3HG7A 1EGQA 5JW5B 4LOUC 1U7DA 2EF1A 1Z28A 4FP8L 4LXIA 3HV0A 3P4YA 2YWGA 1VZIA 3MYJB 3UAZA 3LXXA 4UXIA 1CEXA 2VZ0A 4YR9A 3RO7A 2FPGB 4CT5A 4N2IA 4FMDF 3HYTA 3VO0A 1JRLA 4CM4B 1ASPA 1DV1A 2QTBA 3BP6A 4PJFF 1I3LA 4JFDA 1BW8A 2YD1A 5FOUA 3B9BA 4UVHA 3RBSA 1A7AA 1ZEJA 5L8VA 3SIKA 1J2RA 9CGTA 1BSVA 1KU6A 4LHUD 3RIYA 5TIIA 5DC9B 4U7KA 3QYJA 1I2MA 3H2GA 5DHVH 2F53D 3BGAA 1NFAA 2XMCA 3D0VB 5TE4H 4GWLA 2LZ0A 2Y1WA 3D81A 1II0A 4I46A 2DBJA 3OF6D 4BZWA 1ADYA 1GN9A 1A8ZA 2M6SA 2ZT6A 3A4VA 4AJPA 2JASA 2BM9A 4R2GD 3QISA 2OZKA 1MXGA 1EGAA 2Q07A 4TXMA 2DX7A 4B4KA 1CPUA 2HCZX 3S3TA 1S6NA 1WD5A 3IHKA 4GT1A 5CPFA 5KZCD 4EO7A 5GRXG 1EDYA 2FSGA 1OYYA 2APSA 3RK1A 4GW4B 4QFMA 5TEVA 1BXKA 3FYUC 5FTJA 4DHWA 1HG1A 3H4IA 3HWSA 1ISHA 3CB2A 5H81A 3HA0A 4DDHA 3T3MF 4XX0B 5TT1A 2P9QA 1CQWA 1TEHA 1P7KB 3STYA 4UE3S 4KLNA 1AP2B 3GYBA 1Y6RA 1UXOA 2EDTA 5C8JB 4PSUA 4L5CA 1N5MA 2V9RA 4BQ6A 4FFDA 1NC1A 3IXTB 3U9UA 1GPKA 3WIDA 1XPJA 3PEUA 3AY2A 1HE8B 3QIAA 3UW1A 4FMPA 3PR2B 2Y8EA 2JJ8A 1ORVA 1SC1A 1EVUA 3J7HA 3LUFA 4GB9A 3MQ4A 3X13B 3QEOA 4ENEC 2RFLA 4Q9JA 3V8MA 2YR0A 4LVOC 1H2AS 2P24B 4RTMA 1GVHA 5BV0A 3LPPA 2GT1A 3URMA 4ISCA 3D7SA 3WDKA 4L28A 4Q4JA 3L4SO 2REBA 1UZMA