2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
4M76B 3IBSA 1NA5A 1FE8A 1DZIA 1OLZA 1SHYB 1JLMA 1U0NA 1XDGA 3EG9A 4A0QA 3E2MA 4FWWA 4NEHB 2ADFA 1RD4A 2NUPA 5E6UA 1AUQA 1M2VB 1QC5B 4CN8A 1MJNA 3FCSA 3IJEA 1QC5A 1DGQA 4FX5A 4IGIA 3HXOA 2B2XA 5E6SA 2WW8A 3GXBA 3T3MB 1M1XB 4JX0A 2WINI 4G1MA 3ZDZB 1LFAA 4WK0B 4CNBA 5HDBB 1SSLA 3TXAA 1U8CA 1MQ9A 4Z7QB 1N3YA 1ZONA 3VI3B 1N9ZA 3ZDXB 1YVPA 4CN9A 3F78A 4Z7OB 4JDUA 4MMXA 1L5GA 2VDLB 1M2VA 3BN3A 3K72B 2O7NA 4IHKA 4MMZA 3ZDYB 3V4PB 2I6SA 2I6QA 3EOAI 1SQ0A 1MQAA 3ZE1B 1QCYA 1BHO1 1M1XA 3F74A 1JV2B 1YUKA 3OL2A 1PT6A 4HQKA 1JV2A 2I91A 3TVYA 1JEQB 1T0PA 4WJKB 1PCXA 4MMYB 4O02A 4WFQA 4G1EB 4GZ8A 3HI6A 1CQPA 1JEYB 1MF7A 4Z7NB 1SHTX 5KYWB 3K6SA 5KYWA 4NENB 4WK4B 5HGJA 2VDQB 3NIDB 1RS0A 5ES4B 1MQ8B 5LN1A 4O3TB 3M6FA 1BHQ1 3IJEB 2ODQA 3QA3E 3PPXA 3EOBI 2XWBF 4DMUB 3EGXA 3PPYA 3AFCA 3EGDA 3FCUB 1XDDA 1PD0A 2M32A 3Q3GE 4HQLA 2P28A 2VC2B 3AL8A 3OKYB 4UM8B 3AL8B 2QTVA 5E6SB 1V7PC 3TW0A 3ZE0B 4C29A 1ATZA 4K3JB 2VDRB 1M10A 5HJ2A 3N2NA 3NIFB 1RRKA 3OKWA 1U8CB 1FNSA 5KYXA 1T6BY 5KYXB 4MMZB 1ZOOA 2XWJI 3EGXB 3EG9B 2UZYB 1M2OA 2P26A 3EGDB 4MMXB 1L5GB 1MHPA 3AL9A 1ZOPA 4HQFA 5E6RB 2IUEA 3EFOB 4BJ3A 5E6UB 2NUPB 3ZQKA 1TYEB 3EFOA 5E6RA 3FCSB 5KYUA 4MMYA 4WK2B 1RTKA 3V4VB 1SHUX 5KYUB 4PN7A 4F1KA 2XGGA 3OL2B 1IDN1 1AOXA 4XW2A 5KYYB 3BQNB 3K71A 3K6SB 4G1MB 2VDOB 3K71B 4UM9D 4O02B 3RAGA 4HQNA 4G1EA 3BQMB 3K72A 4HQOA 3PPWA 1AO3A 1XUOA 2ICAA 4O3UB 1PD1A 3EH2A 1OAKA 1IJBA 1CK4A 1IDOA 4C2AA 5BV8A 1IJKA 3EH1A 5KYNA 2NVOA 1Q0PA 3HXQA 1YVRA 2VDMB 2NUTA 4IXDA 2NUTB 4C2BA 3NIGB 4F1JA 2VDNB 3T3PB 3ZE2B 2X5NA 3PPVA 5KYYA 3NVQA 3VI4B 3TCXB 2ODPA 1JEYA 2VDKB 1JEQA 1M1UA 1U0OC 1UEXC 2VDPB 4NENA 4UM9B
chains in the Genus database with same CATH superfamily
3D30A 4A2DA 3LQFA 3LDFA 4PBRA 1M5TA 1X6NA 3E2IA 2IZ5A 3PDIA 1CLCA 4Z4IA 2V2XB 4PJHF 1PHRA 3R9XB 1TTTA 5A16A 2OHJA 2EZ8A 5JMWA 4PRPB 1PWZA 3FOWA 1FP4B 4QO1A 4FSDA 4FEGA 3HSSA 2Q9UA 3E9YA 1S1CA 4Q16A 5CYPA 2QSTA 1WO8A 3IDQA 1MNNA 3LQYA 3SKOB 2JKXA 5DYTA 1H2XA 4HUWB 3DZKA 3KWLA 3HKDA 1N8ZB 5B3JE 4XNYL 4Y2HA 2J0EA 2QT0A 3S8GB 4ARZA 4RLSA 4D7BA 4UM5A 4FULA 4BASA 3L02A 3UXMA 3NP3A 1WEHA 5EBLB 3MVEA 3MC0A 2NQDA 4IGAA 1FCJA 1ICTA 1PWEA 2KLRA 2QKIC 3RKDC 3MXVL 2DT5A 4TUYF 3DXAE 2X6BA 3LKRA 4NCJA 3ENWA 3G5YA 5BPPA 2GXSA 3DEKA 5C9JB 2C9CA 1VA4A 1I7ZA 1XNJA 1SY6H 4RCYA 2AKYA 2R8BA 3IJYA 3QUZD 5CDSA 4QRSB 1E4EB 2QR0B 3ND9A 2FEDC 3KT3A 4U6TA 3CX7A 5TH2B 3LDUA 4BFCA 1G9XA 3LV8A 5FR1A 3N44B 3QW9A 2CXGA 5IW8A 2RHJA 3F4LA 1BOGA 1RTTA 4WCVA 5I1IH 6AT1A 3ASWA 1WB9A 1CR1A 3GIVA 2WYZA 3EQZA 3VGEA 1U1GA 3T3MB 3EZ7A 5FOVA 3TUJC 3BISA 5GJSH 3K0AB 3Q88A 2BP3A 4CVUA 5FYLL 1U7DA 4E5VA 1YVPA 5ALCL 3TB6A 4A7SA 2QTTA 1ZCZA 4CDGC 3VTMA 3JQ8A 4KRPD 2IQAB 3L45A 1EP2B 1NZDA 4IXNA 4KPUA 5CLFA 5CFZA 3RUGF 5KANG 4LGVA 1AUOA 4FXKC 3PLYA 2N7BA 1IOVA 1HXKA 1AUXA 5FA4A 5ES4B 3O6FB 4GVXA 2YA0A 3AHDA 3C7DB 5EWLA 4OCSH 1NIDA 3JYPA 4X9GA 1FGNH 5GSRA 2YJLA 4FNLH 1H93A 1QE0A 1ZHOA 2MCAA 2PRKA 1TQCC 3IFNL 1P61B 4U49A 1XLWA 1HOXA 5HYEA 2WNGA 3APMA 3U6RB 1ID8A 4MJ4A 1VHLA 5ICMA 1TZOA 1PR3A 2VJPA 3DMTA 4BUCA 1H5UA 1G9MH 4TNEA 2VDMH 3VFWA 1JYEA 2PUCA 1WMEA 2JCSA 4PPFA 4P7BA 1NOLA 3ROGA 4UMDA 4H6PA 1OCZB 1O87A 4RLHA 5DFTA 3HBMA 3BWAB 1YL7A 1ZV5A 2HJGA 3DX6B 2AUMA 1HT3A 4RK7A 2DQEH 1IC5L 4I8DA 4KUZL 1QMUA 4P9MH 2PVCA 3VR3A 1QFSA 1ET8A 4QRAA 1BQHG 2GCYA 4XWGH 1O9HA 4KXLA 2QAGC 4KNYA 3AONB 3BE1H 4P1ZA 4EPSA 1KU0A 5CA0F 1OA1A 1RIVL 1KI6A 2DH3A 4M8NE 5C3TA 3RTQA 5D7JD 3CDGB 3DVNB 2B9BA 3UICA 3W90A 2C5LA 4C6TB 4EDWH 3V0JA 5FKPB 3TWCH 3QZWA 8MHTA 1U3FA 3EXIB 4JHLA 3IHLA 5AFAA 1RADA 4I66A 3BREA 3HVNA 3EXJA 5B4MD 2K70A 4FHJA 3VSVA 4F06A 1FPTH 5IZCC 2FX9L 4YZFF 1WCV1 1PK7A 2DBZA 1KYZA 4Y88A 1Q90A 3Q01A 1TYJA 2G09A 1NC4D 2KH2B 4JLAA 1E3SA 3LX6A 4FTDA 2OTWB 5M29A 1WULS 4H18A 1UADA 5KB3A 1TMCB 4CM1A 1QLEB 3WKNA 3FVVA 1QNZL 1X1RA 2G67A 4L7VA 3OFND 2YA1A 1SLUA 2NGRA 2PR2A 2R4RH 2WQRA 2VJCA 3G2OA 2F1IA 4LTNA 3BUDA 4X0KA 3TVMC 4UQDA 3ILYA 5LZ2A 3D6TB 4G8FB 3GJFB 4RE6A 4G0UA 1NLYA 3QYNA 1F90L 3D6FA 3F5DA 1LBTA 3V7AG 1GGBL 3GLIB 4GQBA 3B9KB 4XNAA 4DV1B 3C8KA 1NMCB 4WSJA 2QSCL 5HZMA 3RIXA 2A77L 3EG9A 3PC6A 3GYBA 2Z3WA 3GPSA 3MV01 1UM8A 4XN1A 3UMCA 2DY2A 2F1JA 3GJEB 4YVUA 3IC5A 4EI5C 4KAQL 2R0LH 5ICGA 3QCUL 5ELLA 4XNXL 2H51A 1NJ8A 3HC3L 4P2CG 4B09A 3BSSA 3ILDA 4Y6QA 4OZFB 1Z2EA 1TDJA 3PQ5A 1TXKA 1EIBA 3TCXA 1E1LA 1NQ5A 3IPFA 1OAZL 5FLVA 1VG0B 2CGZA 1R6BX 3PWVB 3TUZC 2GVDC 4BO7A 2H85A 5IXYA 3AM4A 5DMIH 4HZGA 2N01B 3ULSB 2K45A 2GEBA 4AG6A 3C6QA 1YRYE 3N1FC 3AOEA 1UK8A 3ML1A 4PICA 1D4AA 1K5NA 3BZWA 4WXPA 2YCBA 2HWZL 1BJKA 4HWTA 4MP3A 2FU5C 1SQ6A 3BZDA 3EHBB 2V7XA 3OXRA 5H3LA 1ECZA 5KVCA 4DIEA 2OMTB 5BO1H 2AG5A 4RESB 4HQNA 4R1NA 2QGDA 1Z33A 5AVVB 3DW3X 3WIFB 3OCJA 3LFTA 3HJGA 5DBIA 3LRGA 1BBJB 2GM4A 3ZY6A 4JMNA 2COVD 5KSWB 5JWOA 3B3FA 4Y2GA 4YNBA 1KYOK 1NA5A 4AYGA 4XR8C 1CR6A 1AQMA 1Z5VA 2YUZA 3Q2OA 3SE6A 4JQCA 1WV7T 1Z9PA 3PA6A 2YGPA 2RR3A 1FFXA 1PZ2A 5EEUA 3IM1A 1MF2L 3PGVA 2A9KA 2OQIA 4QRTA 5BQ5A 1XKQA 4AQAB 3SBRA 1RI5A 3FU7A 3TBSA 4RPIA 1CUYA 5JS8A 2FECI 5F9WB 3U17A 2XUOA 1USQA 4GP6A 4GPVA 2B5IC 2J3MA 3SIKA 2MJWA 3LUJA 3NJNA 1GTFA 4JZOB 3VGAC 3IQDB 4WFHE 3QVJA 3M89A 1G2PA 5HJ3A 3WY1A 2EDMA 5CJPA 3DG9A 1Y5NA 2B25A 3P3TA 1YB1A 3HB3D 1WVGA 4B4UA 2XPZA 4R71A 5D1ZC 4L8WB 1GTZA 3LOWA 3N9GL 4Z4HA 3K81A 4JO4L 4MUFA 3TJMA 1XALA 4N5NA 4EG7A 1GPJA 4NDNE 2A9NH 5ANME 3EGDB 3S34L 2YXBA 3ZVRA 5F1KC 3ZQKA 2QMQA 3TBHA 2ORBH 1LJ8A 4C7MA 2ZSVA 1Q0YL 4ZD3H 2FX7L 5BUAA 2E4TA 2ZOUA 4POZD 2ENUA 1IDOA 3E2HB 5IUNC 4Z77A 4MQEB 1PBTA 2ISCA 2WXIA 4QGSA 3RYMA 1DAIA 5F1NB 5AW7A 3EIHA 1W85A 4XNZB 5ADUS 1QFYA 2AEEA 1SC1A 5DLYA 5KJ7E 3W5HA 1NX9A 1WQ3A 3ZGYA 3TH3T 3C6XA 3V42A 4CN8A 3MGTB 2LW3A 3BZ5A 2NU8B 1P5RA 2HSGA 7REQA 4MR8A 4Y1AD 3KLDA 4AENA 1V26A 1QFWM 3I1IA 3GW8A 3LS2A 1N32B 1YMQA 4D4MA 3T65B 4AQAA 3ULUH 2PD3A 1M7UA 3SX0A 2EDBA 4MGEA 4DVBA 4AG5A 3ZJVA 4FXGC 1EFCA 4OQNA 3MMZA 3PX2A 1MPAH 2JKJA 2I6GA 4X98B 2XZAL 4GRLC 2P40A 1H8SA 1O9VA 3CC5A 4X6BB 4KK3A 4P2BA 3W2FA 4G0VA 1XDDA 4CI0B 1O2DA 2G60L 4UBDD 4R5MA 1J39A 3QIVA 2VHCA 3ITDA 3SOZA 4E9RA 5KTRA 1NUPA 1R6AA 1XCOA 3TPUB 1N92A 3ET9F 5D1ZI 1ZJ4A 2BFFB 1R6XA 4D9MA 1V1JA 4E08A 4OQLA 5KX5F 4WOKA 4P23B 3IDYC 3KZ8A 1MHPA 1FYHB 5AVJA 4OO3A 1XR3A 1MEXH 4PUBH 3BWYA 3DWFA 3SCMB 2LVEA 1P2GA 1CQWA 3OR7A 1OTSC 2FX9H 1FPTL 4TT8A 5I8PA 4TTJA 4ZTBA 1VB5A 4OFYA 2R6R1 4XI9A 4X64B 1DO0A 2QQGA 4OV6B 1PLKA 2RFLA 1ZFNA 4EKGA 1T4GA 4NC1C 3S88L 4EQ6B 3O7WA 1VE5A 5A62A 4NKQB 3K0FA 4IJKA 3D7LA 1U0JA 2WJVA 2FIKB 5DZJA 4FHZA 2SODB 5DLLA 3LQZA 2VP9A 3JV5A 1F5SA 4OXKA 2AJ3A 4N0PA 2BSTA 3OAZK 1FYEA 1NT2A 4RF3A 1CICC 4R6XA 1DBJL 5DNDA 2J5RA 2Y2WA 1H1TA 2WKPA 3BKMH 5HGGS 5EUQB 1QLFA 2AXGB 2G2NA 1NGZB 4PGCA 3TE7A 2Z65C 3LIZL 2BJWA 3P9YA 2VL5A 5ALBH 4AJOA 5IK2D 5E4YA 1EK1A 4ZMWA 2Z2YA 3CC5B 1RP1A 3WMSA 5IROD 4Q4CA 4N1EA 4LSUH 2C3YA 4AQ7A 1QNIA 3CN3A 3S0JA 3FONA 1P4IH 2JXMA 2X23A 3LTVA 4TQPA 3QNXB 4Z7IA 1FEZA 4ETQA 4Z3GA 4B32A 1QMPA 1X87A 3JVUA 2NYYD 4LRIC 4N5ED 4P0TA 1K2DA 4MX8A 2GTWA 5DS1A 1NQUA 2JAQA 3TNYA 2LRHA 4LOKA 4WN9B 5EPMB 2NXEA 4I4NA 4PY8J 4CUKA 1BS2A 2N7AA 3MBWA 3D8NA 1BWRA 1XH1A 1ENYA 3TF7C 4XOAA 5FYJE 5BMVA 2IU0A 3T34A 2WWNA 4PLFA 3L7NA 5FO0A 1R6DA 4JPVL 2G7MC 3GM8A 1D5CA 2DPGA 1W8DA 2MQCA 4A5OA 3EOAB 1T5LA 3PG2A 4ZJUA 5LZ5A 1U6KA 4HWNA 2VW6A 5HHNA 1DBVO 3G6DH 4OBRA 5TQ2L 4NFHA 1QDEA 3EH2A 1JN0A 4V0KA 1C41A 4BCCA 3DYOA 2IDJA 4C5AA 3ARDA 4NO3B 4R9NA 5B4UA 3L8EA 1GCGA 5LQCA 3BKJL 4TLTA 1YNOA 2QRHA 1V7NL 1X86B 1PVVA 2HIMA 4FA7B 4FQHB 2QKSA 4MA1B 3ICPA 4ARVA 3T3MF 2ACWA 5B4VA 1RPQA 4RSHA 2IP2A 4L3EA 3ROQA 4XTRD 4XBEL 3V8EA 1GJRA 2AJYL 2W59A 3CUUA 1F3JA 4D96A 2AQRA 5FKPA 1WO2A 1M2EA 4JZJC 3FJYA 1IO4C 2JFOA 2YHGA 5CDTA 5BOSA 1IT9H 4OUDB 4XYLA 3I9GH 1PNDA 4GQIA 3LT1A 2K3HA 2UZIR 3QLJA 2QQLL 4JU9A 1OTYA 3LQ4A 4PJIA 4HAYA 4CIBA 3CNKA 1TFRA 3TC9A 4OFZA 5FO7A 3QBEA 4HRAA 2OJ1A 4UE2A 5CG1A 5CFLA 1GA2A 2DFVA 1Q20A 4UAOC 1T25A 1M9WA 5DRXA 3KM0A 2IWRA 2FWJA 3QWHA 1ZD4A 3SDXB 2X09A 4M4SA 5B7FA 3ZHOA 2RH4A 1UXOA 1JYNA 1UP6A 1E94E 1H15B 1ZHLA 3ZK7A 4ZRGA 1NV8A 3JV0A 2JFNA 1Z18A 3HPRA 1OAKL 5IB2B 4C3UA 2DI9A 5K20A 5J7CC 3VSCA 1JGDA 3KWFA 3Q7SA 5CCXA 3D2UD 2X9VA 4JO1H 4P4RA 4XPAH 1L0BA 5CA0B 2NZ1A 4LLAA 2H2PC 1ORRA 2QP4A 1HDMA 1NC1A 2ZRNA 4WW2F 2OYCA 4U7JA 4F3KA 3R3XA 4LYDA 4Z7VB 4NM8L 4AMXA 1HYBA 3FCAA 4NQVA 1OTSD 1JD7A 2XECA 1T3HA 3MRSA 4Z7UF 1U8CA 2C7PA 1BWWA 1VXRA 1IX2A 3VVCA 3G5XB 5CH5A 4B95C 1TMOA 1MCFA 2X19A 4XMUA 5DUMH 4OHXA 5B38A 4ACAA 3PRKE 2IQAA 4LGSB 5BSKA 1SKAA 3TQRA 1QU2A 1CC1S 1GLNA 1L5RA 4LJ4A 3ASNB 3NHUA 3DC7A 2GEFA 3U4BL 2XBTA 2IAMA 5T3XD 4JXZA 2X3BA 1L9PA 2F5BH 2O4CA 1AFVH 1K8RA 1J8KA 1TJ4A 4DLSA 5EJ5A 5I1LA 1WF5A 4M6WB 1IBKB 3KQYA 3L2OB 4YGAB 2DS4A 2HA1A 3OB0K 3R0JA 3KYDB 1OFIA 4EJSA 2C03A 4XC1L 2AK2A 2QU8A 2Z2XA 4Y4HD 3CZCA 4B4OA 2I4NA 4PWGA 3GA5A 1YS2X 3BHMA 1U2HA 4G5QA 5KTMA 1ZGCA 3L6DA 2A14A 1CZ8L 2BC9A 3CFNA 1FO0B 3N05A 3NCEB 1QI4A 4HJXA 1UKYA 1JHZA 4JFYA 4U7DA 3WFCH 3DYPA 4GXVL 3KDPB 3CZEA 4XB7A 3V5NA 1BF5A 3UAJA 4Z7OE 2O8BB 4HUUA 1M0SA 1NW4A 4GPBA 2ZE7A 4NSKB 2A6KA 3HNRA 4K3DL 4EZJA 3ZKQD 4D7AA 2OECA 3PWTA 3WIBA 3FFWA 3O92A 3ROMA 4ZCIA 2N75A 2XUIA 3JQAB 3VXKA 1AQDB 4PO1A 3RIHA 3OU7A 2XQVA 4KR6A 4QO1B 3SQWA 1QB7A 1KYQA 1O94A 5CFAA 4TNGA 3ZZLA 3RHWK 2O0JA 4TSFD 4HUKB 4B84A 4BUQA 1Q1QA 1D7AA 2GITA 2EF0A 1ISHA 3CZ4A 4G8IB 3CEJA 4PXAA 4G1EB 1W19A 1F0LA 5DC4B 2RBEA 3MWEA 1LDEA 4ARCA 1EMDA 4KO2S 3SQMA 2CLVA 1C1XB 3P4NA 4YDNA 2WVHA 1KJMB 5B7NA 5J5EA 2HPAA 1DUYA 2YWBA 3F7NA 2AJLI 2JJTA 1MOQA 1ZN2A 4AMKH 4CN6A 3HC0B 2WHVA 3JX9A 1REQA 2DE0X 1SOXA 1Z6XA 3AHFA 1GLVA 1TMYA 4WEOA 3ZU6A 4AL8H 1IQPA 3LY5A 2UUDH 4PJAB 5JPIA 4Z4FA 3Q10A 5GGUB 3ZE0E 1JGTA 2QTBA 1F6LL 1II8B 1BQSA 1UP7A 3B2VL 1YVRA 1XSIA 4KKAC 4R3NA 2O4EA 2E7MA 2CDEB 2F00A 4DT2A 1DQML 1ZO8A 3AEKA 4R3SB 1FU8A 1GGJA 4TN5A 3HHPA 4B45A 3H13A 5A3QA 4LNUB 5KTNA 4KMQA 3BWBA 3LRMA 3HCCA 2IUFA 2BIIA 3PWNA 1YKGA 3TIFA 1DC5A 4JYCA 4Z7WE 4CDMA 8FABB 4MUKA 5DLML 4KQEA 3BP6B 3A9VA 1T2JA 2JH9A 3S35X 4Y1GA 1Y6FA 2EOAA 4Q2ZB 2Z08A 4AX8A 4F3CA 2HFEB 3OCWA 1AGBB 3C5HA 3S3JA 2XZQH 1BE1A 1G1CA 2PABA 3F58L 3R0ZA 3LRXA 1WEJL 4F2WA 4N40A 3L1GA 4KR7A 1GCYA 1ZIPA 2F4NA 3DWEX 4QU9A 1P0QA 2ZCJA 2IV3A 2IYZA 3H54A 1N7MH 3LQAH 3EVDA 1G7JB 4IRSA 2W6ZA 2JI2A 2V9QA 3JVFC 1YEGL 3EYVA 5BMOA 4OBEA 2OG2A 3VYNA 2HHLA 2HJSA 5KNBA 1V7ML 4NCNA 4L8BB 5KPDA 7TAAA 4D80A 1UWFA 3Q8CA 4BBPA 1JYSA 2D31A 5FNVF 3BP6A 2BM1A 1OAXL 5L7TA 1IAVA 2XPCA 4OQPA 3V4VH 2I32A 2ZVPX 3T1FA 3AKYA 4K9EL 1QZ1A 3SYLA 3M7OA 4D8PA 4JHAL 3A4FA 3ZDZF 3MBXL 2YL2A 1U0QA 1S9WB 3NZHH 2ZUFA 3UPUA 2R6DA 1C8VB 1EDHA 4FWWA 5I26A 3ABLB 2EWVA 1HWYA 4H13C 1H0DB 1J8HE 1PW5A 2Q4DA 3REFA 1I7ZB 5MFPA 4CDRA 4BV8A 1D6EA 3M3DA 4L4VD 1PYWB 2AJVH 1E3XA 5CLYA 3I2GA 5L8LB 1SAYA 1PZ5A 5GGRB 1OWOA 3GPCA 1TKWB 1WAPA 2ZG3A 4PJAA 4DEPC 3GSOA 4QYOA 1S8OA 4WTXA 3FVTA 3CLSD 4LDCA 4Z8YA 2KERA 1MW9X 3R7SA 3OAAD 1BFSA 4JVOA 3JAMA 4OQ1A 4KHPB 3COYA 3CBKB 4CMMA 1WVIA 1UPCA 1PX4A 2JJ1D 4U8HA 3HKDB 4YCAA 4Y6OA 2OCGA 3B13B 5TR9A 1IZ9A 5SWQA 4PJAE 2CW5A 1C2YA 3V79C 4HDSB 4K7JA 4G8BA 3ZWXA 4ZDWA 3JQ9A 1BDBA 4R69A 5JMOC 2P9BA 3PXDA 1RVV1 1RPNA 3V4VL 4NRYA 1YZVA 1FDLH 3ARGC 1CDGA 4XH2B 3AFMA 5AOLA 4GYJA 1PEZA 3RVWD 5DJXA 1K9VF 3GGGA 4EBBA 4RDHA 3BO8A 3GD1C 1ZHNB 5DC2A 4DVRH 2X14A 3RVOA 4YQFA 4GC9A 4AWXA 1OGYA 3TH4T 5C35A 2VIRB 3T7EA 4K1LA 1CTNA 2Y1DA 2ZZNA 3VC2A 4APXA 1RZ7H 2B21A 4I2VA 4RIEA 3ZRSA 1KGCD 2IADB 2XACC 1BQ3A 3DBIA 3GRZA 4PWYA 1I1FB 2LXNA 5JJKA 2ITDA 1FVOA 1T7YA 5D5MF 2PZAA 3UHAA 3D09A 4BP9A 1EVYA 3R6WA 3HJ0A 4I2XE 3UYKA 3ON5A 4HV4A 4Z3DA 3WL9A 2IBTA 1GAEO 2V9UA 2K9FB 1AI1H 3P9XA 3CZSA 5BO0D 3QNFA 4JD5A 4MV3A 1D2PA 4RWHA 1NN5A 3HCEA 1N9GB 1RPKA 2P2LA 4EUEA 4NGHL 1BMFA 2HMYB 4XRGA 3DBXB 4WDIA 1IHUA 3MJEA 3PLNA 4FFWA 4BFOA 4NBTA 4NAVA 2XZTA 2ROQA 5CM8B 4JHVA 3TXYA 2HMVA 1P73A 1U8HB 1XB6A 2NO9A 1YRLA 5I0VA 4FFYH 2ZZKA 3FYHA 3C2QA 5CFMA 4UIMA 3OZUA 4EVRA 5E24E 1M5UA 1G8PA 4AZ8A 4Y19B 4QFBA 1P7KB 1AKPA 3CVWA 1UB5B 4U1GB 5BVHA 2RIRA 5HM6A 4NQEB 4LMQE 4YSSA 3N8NA 5LP6C 3TPFA 4ETYA 5IMLB 3JWNC 1IFRA 1UBFA 4MI3A 3A58B 3KYMB 2IMNA 2JNWA 2XMRA 1DKUA 4TLEA 5KJRL 3EYQD 4WO4B 1IHYA 3UQYS 1UADC 3DRTB 2KW5A 2HAZA 4D25A 4G6KH 3WSTA 3K6OA 3IVRA 5KTKA 2COUA 2GBAA 4B46A 1ZD9A 1SOMA 4PLVA 1KLUB 4FNOA 1LS1A 1FVHA 3KAQA 5HRUA 2TS1A 3RBAA 2PUTA 3FDFA 5DRTA 3NJVA 2F8VA 2P3QA 2ODNA 4CN1A 2Q29A 1XR9A 3BRFA 3K9LA 1KF0A 2IL1A 5DEFA 4MQXC 4HY3A 4R98A 2W71A 3V6MA 3TOCA 5KZCB 2F8OA 3ECBB 4ETMA 2KPNA 4KWUA 2D13A 4DJDC 1ORIA 3P9CA 3BSWA 4LXXA 1ZSVA 1SN5A 3IDIA 3BXEA 3EHDA 4X4ZA 2EAEA 2WIMA 5EBWB 2E6QA 5D55A 4BVJA 1X7ZA 1C4OA 3MJ6A 3BPLB 4K3HA 3QMVA 1KRXA 1E6JH 3GP8A 4LEXL 1FZMB 2QJDA 2Z31A 2XUKA 2QN1A 2B1RA 2WFAA 4YHNB 1NWHA 3T7CA 4PJGE 4ZUVA 4D5EA 3S2AA 4LU5H 4J0CA 3MKGA 1E66A 4X8GA 4UWQB 2OX5B 3G5UA 3QIBD 4OZHB 1SZPA 2VYNA 5INDA 3CS3A 5BW8A 1PUIA 4N8PA 5KQMA 4KIUA 4G42B 3G23A 5JORA 3EZXA 5C08E 3ARBD 3OHSX 1KQFA 2W2LD 5FJIA 4YFLI 3PQ3A 5DFVD 5GJBA 2ILLA 3EDDA 2XXAB 4RX4D 1O6SB 5F2EA 4D3CH 3PRJA 2O2HA 4WN3A 5JY6A 3U4CA 2VJNA 4DMHA 1L5ZA 3QFGA 1JPNA 3GPEA 1X70A 2VJLA 1SOUA 3L4BC 4Z78B 1MU0A 4IXWA 1YHPA 1UMBA 4FHBD 3NM4A 4GIAA 3KJ6L 4NZNA 4BO4A 2C2KA 2CYBA 1IEBA 4DCSA 4WZ6A 4F33A 4EZLA 3ILSA 2J9XB 1H2ZA 4ZZ3A 1DVXA 5F73A 4X6CA 3RS2A 3FRHA 4PJ5E 5FWAA 2ZROA 1TYBE 4PLNC 1JKJA 3HH8A 5SZHB 1D1PA 3LEVH 3ILXA 4HDRB 4F6RA 3HFRA 2HNKA 3CY6A 2GVYA 2O3JA 5KSAD 3OBBA 4X50A 5F7FA 2DR2A 4WU5A 3A31A 4MUHA 2B0SH 2BCJQ 3RY4A 3TW8B 3IXAA 2BGUA 4U00A 2REQA 2NADA 2QQ5A 1HIMH 1Q1JL 4N0YL 4LGMA 4D0BA 2F53D 4UNPA 5CO1A 4ZQHA 2IFFH 4A0RA 3V7WA 4M8LA 2ZRGA 4KXDA 2BFOA 4QOEA 3WSVA 2G63A 1OD7A 5AM5A 2ZCKH 4AM0A 1LO3L 3GV0A 1RXEA 1JVKA 1MQ8B 5DI9A 4PRAB 1QPKA 1PVHA 2GBTA 3QEHB 3U30B 4Z9XA 4YR6B 1XF4B 3G02A 3IKLA 3BXPA 4GQPH 1VMDA 2A73A 4RPLA 5EWIH 1YC5A 3L7CA 3RJ9A 1RYZA 2CHGA 1RFDL 5HBGA 3HS9A 4UOW1 2W2VA 3MROB 2ZKLA 1VSBA 2NSXA 5E6RA 1E28B 3CD4A 2JLPA 1BXZA 2QYHA 2XB6A 1PLJA 1XKTA 2YWJA 1NINA 5FB3A 4OLXL 4Y16C 1I3NA 1NVTA 2F54D 3K9GA 4ORZC 1X3LA 2XI9A 3P0VL 5EP4A 2JKYA 5IS2A 3ZK9A 1OAKA 3MTRA 3Q7QA 3WNZA 4Z76B 4NJMA 4U2FA 3GBNL 1TU2B 1MSPA 3UIZA 5DGRA 5BQDA 5HI5D 2X9WA 2ZT5A 4AM0B 1E6UA 2HWKA 3DFZA 2ZF8A 4N0EA 1OHHA 2DWTA 2B2XH 2D5AA 1UT6A 2E8YA 4ALAH 1NBHA 3M70A 3W8NA 3WLAA 2H9YA 1JPEA 5JPNB 4UCWA 3DR5A 4OAWB 5HGHB 2DH5A 3EYFB 4ZV4A 2OJEB 4S2EA 5DJCA 1FUIA 1BXRA 2FYVA 4XAQA 4TF4A 4WLUA 3TIEA 3ZC3A 1N59B 3GLTA 3G9VA 3WDSA 2ZANA 3AW9A 3U9LA 3MRLB 2PQ6A 1MENA 3AL3A 5CCEA 3VISA 3DUWA 5FL7A 4E3ZA 3LQ2A 3K9BA 2EQ5A 4C07A 3L04A 3CJJA 1EVLA 3A2NA 1BKDR 1WXIA 1L5MA 2OMXA 2W4IA 3HYTA 3NOIA 4HIHA 3RVXD 4A36A 3WL3A 4MJ7A 1IBYA 2C4FU 4FI8A 4XPGL 3OKFA 4TWIA 1OQOA 4X6FA 5HJ3B 1VRCA 1KUMA 1EHAA 5HJDA 1J99A 4IUDS 2B39A 5GZ6A 1NUNB 3KPPB 3UJCA 3GJEA 3THYA 3UGKA 2HQRA 1H8HD 2XWCA 4LK2A 3LN4A 3TBTA 1L5YA 3OP1A 3FW1A 3WY4A 2O8CB 4H15A 3TM5A 3UTCA 1SVKA 3ZHRA 2Q62A 2ERYA 4TL4A 5J2UF 2C3UA 3ZKNC 4G1BA 1GV1A 4AXWA 5GRUH 1K72A 5E7MA 4KO7A 3SLKA 2J43A 2RI0A 4PEEA 5AVUB 2BIOA 4CIDA 3HA0A 1KSRA 3SM9A 3O94A 1ZOSA 4UATA 2AK4A 3L16A 2JC3A 2CK3D 4EDXB 2RJOA 2QJOA 4HS3B 1MAVA 2DW5A 3T1FB 3SX4A 1BG6A 3HBLA 1E1QA 2AGJH 3OEHA 2ALAA 3DX9A 1JSZA 2J8UF 1F6DA 5EBWA 4HQ6A 3ZKSD 3DYIA 4WFHD 3NHKA 3DAPA 3QC5X 4F2HA 2R4SH 3CFEA 2UYOA 1PS3A 4RS4A 4YJDA 1K2VN 1C7QA 1RXVA 4M3HA 4C54A 3N2YA 1JV2A 3E3AA 1XROA 5HDQL 4NBWA 4FQJL 4GUPB 1YK0A 1YAIA 2LU7A 4O02H 1OU4A 2C00A 1EI9A 1S2NA 5JZ7C 3L8DA 3LYUA 5LWYH 2DI8A 5AW9B 5CCJA 2Q3HA 4RKQA 3FIJA 5ETJA 1H4QA 4HNTA 2V9ZA 1TCUA 5F2FA 5HYVA 2HMIC 1CUFA 3W2GA 2Y7QB 4CQLB 4BAUA 2PWBA 3Q2CA 4E68A 3ASOB 1UMCB 2JLZA 4OXQA 4G5HA 3FYUC 3EJYC 5GMOA 5CJBA 3AGVA 3AO0B 2NY4B 4OLBA 4XBPB 3I6KB 1N75A 3CUSA 1X7QB 5D2NC 4N65A 4XFDA 1L5FA 3RRZA 2CGYA 4OJAA 5J06A 1DBKL 2IYRA 1WBXB 4A6XA 2BZCA 3E9RA 1K7SN 3IS1X 1S2DA 5K1NA 4LEOB 4K0RA 3KLPX 3T2QA 2VDKH 1T34A 1XZIA 1UT2A 2Q76B 3M3PA 1YJXA 2UUAB 1YEIH 5D1ZB 2O8EA 4QEDA 1KPRB 4ZXBC 2AXWA 1KKUA 3IQIX 1BCRA 3J8F7 3ULUE 5A5EA 2XQFA 3WL9B 3SGEH 4Y4KC 1N67A 2H92A 3CE6A 2H2SC 4AC2A 1W49A 3CE9A 3S36H 2H41A 1P1ZA 3MJ9L 3FBTA 2YWYA 3FU3A 2PZJA 4PZUA 1A3RL 3K9CA 2Q3LA 2VAVA 3W9DB 4W9JC 2R7MA 1UACL 1LWNA 1QFZA 5CGZA 1KENL 1MQAA 1TT6A 4N1CA 3ROOB 3X44A 5DFWH 1KVUA 1Y6NR 2YW9A 4WFQA 4AY4A 3WXVL 3HAEA 1ZCFA 2ZRAA 2DQIL 4HOMA 1SXGA 5I66A 2BFGA 4BQCA 3TJRA 1B2RA 2KZ1B 1NKVA 3CMOH 3IWUA 3LZFL 4Y2DA 1X0XA 5CBPA 3GLAA 5I8KH 4DAEA 3KIPA 5L3SA 4E5XA 4MP6A 3GGJA 3VFGL 1A0QH 2BWJA 3NPSC 1JXAA 1N8OE 1IN4A 1CMOA 3V9PA 4GMSH 1HNGA 1JVOA 4P49A 3TRJA 4UQOA 1H2EA 4HLEA 4KE8A 3DX1A 1JHLL 3VSAA 2AEPL 1U7HA 1AUPA 1VZ3A 4EUPH 3V7MA 1M1NB 421PA 5KWSA 1JGVL 3FRUB 4BO2A 2Y1YA 2JAOA 1U91A 1FNLA 3ZL1A 2E5FA 3M8KA 4X7CC 1PGJA 2HX9A 3NCWA 3L43A 3HLKA 1W6LA 4GW5B 3VYSB 2ORBL 4XUCA 3AGWA 1D4ZA 2G9VA 4PGBB 5HRCA 3ELBA 3TLXA 4P7GA 2RB4A 2C42A 2A6KB 1XGTA 2AK1L 5EZ6B 4KMLB 5BRZD 1HG1A 3RHFA 2HTFA 1UFQA 3WU1A 4Z86A 3DWIA 3MLSL 3NIFF 4XNDA 3G1TA 5E2BA 3AWGA 1CJMA 3DX6A 3AF3A 4ITVA 1U8TA 4XXWC 1OXVA 3TLEA 5DURD 4NWUH 3PI6A 4LE1A 5TVKA 4MGYR 4GEKA 1PTKA 3OU2A 3CHRA 5EIWA 3TVYA 5DKFA 3GGCA 3H05A 2XD9A 3HEBA 5DX0A 4UU9A 1PIGA 4BLSA 4MO2A 5ALWA 3LHFA 3RLIA 3KLAB 5T1JA 5C34B 2NU9B 5J1AB 4ZYKB 1RP7A 2BEUB 5IWAB 4M60A 3U6RA 4C55A 1Y7HA 3PXHA 5ITFA 4DMMA 2P65A 3WSWA 4EUPA 1A47A 3P1VA 4J4PD 1G9SA 1CETA 5GGTL 3S36X 1F2UA 1I4TD 1L8LA 2VBIA 2CF5A 1I3UA 5AD1A 4X1IB 3G49A 1CUOA 5L88L 1E8YA 2EFHB 4U02A 2C83A 2C97A 4TKZA 1AZBA 3LPNA 3CLRD 5BWCA 4IHQA 4Q4HB 4J90A 5LN4A 3OZSA 1IL1A 4DQAA 2WUWE 3L1HA 1PIWA 4IDAA 4ZQCB 3VDNB 3PB3A 1Q0QA 3RHTA 2C1OB 3OGCB 4G11A 4OYHA 4I0PD 1GAXA 3SQBA 1P6XA 2SKDA 1G21B 4DY4A 4HJJH 2HRDA 4ES6A 4G8EB 2FH5B 1NLDL 4TQGA 3RTQB 3DKPA 2HQOA 1L6XA 1L0PA 2VYND 3ELAT 1HDMB 5CJXA 3CJTA 2TAAA 4K8RH 2Y0CA 2YV4A 4G9FA 1CVLA 3IL2A 2WQSA 3PIQA 2GHQA 3EGCA 5JW4R 4MA1C 1VI5A 3CNOA 4DGYL 1GNPA 3ADBA 3RUAA 2OJZL 1NBWB 4ZO8A 4DV0B 4P7KA 3RGVB 1N5IA 3B8SA 3SKMA 1MFMA 3I9OA 4DP5X 2JGJA 4MEBA 1BZ8A 2CBGA 5I9QC 1TRHA 1XZ0B 5GS0H 1CP2A 1LNQA 2FLVA 2AQ3A 1NUSA 3GFRA 3GJTA 3RFZB 2C9MA 4LRUA 3LP8A 4AMVA 2DR3A 2PUQT 4RA6B 1KFCB 4KQ3L 4TLBA 5DSCB 3PDWA 1IBHA 1U8PA 1ZUIA 4TTSA 4DN3L 5ADHA 2C58A 2NY2C 2IF0A 1ULZA 1BXUA 4BC0A 2ZSIA 2H6PA 2YD0A 5MEOB 3UAGA 1L5GB 4M46A 4U6YA 2O6EA 5IJWA 4H1LB 4NQEA 2A9VA 1G21A 4OJDH 1CSEE 1XMWA 1E3QA 3GH3A 1NBOA 2E4YA 5ICFA 2JHPA 2C1ZA 1CYXA 4U1GC 4PSCA 3DLBA 1IJBA 5SX5K 4NCDA 2VYVA 1WLHA 4GKZB 1IGIL 2PTHA 3RB7A 5I2IB 4MUMA 2Q6OA 3LPOA 1FFCA 5FYJU 2ZR8A 4L7QA 1PG7H 5ALGA 2R7LA 2FLMA 1N7ML 3FQWB 5B39A 5AMXA 1RZIA 2FN9A 2RH8A 3DX3A 5HJ7A 2X6VA 5FHAL 4CT5A 3QRLA 2VJ8A 4JY5L 3O90A 4JFDB 5A6LA 2BGLA 2DMGA 4K71C 1EZVY 5JOFB 1XZJA 4Z7NE 3IAS6 2UZXB 2Z9CA 3QVAA 1BVUA 1E5CA 1ZOIA 2IWFA 2DEXX 5C8YB 1LO5B 4B8ZA 2YXDA 1P4JA 3EGSA 3ZR5A 4M86A 1YJDL 4D5GA 1B3JA 2Q3MA 2GFQA 2Z4QB 2NY3D 3M8OH 3T61A 2PCPB 1CUZA 5ESAB 4LXQA 1JG4A 2YGVA 3TEWA 3Q7RA 1BD3A 4Q6IC 2D2EA 2O8BA 5F8RC 3IJEB 3H04A 2AJTA 4WTZA 3U44A 3DR3A 1HTBA 3VZDA 2QNBA 4KDWA 3I8XA 1VCAA 4I0PC 3DZCA 3WGVA 4ABWA 1CGWA 4NYJR 2PGIA 1G9EA 2W0SA 4JQVA 4PJ5D 4PZCA 4GE0A 1QH9A 5B3LA 3B3IA 3CRW1 5IULC 5E8EB 4RFSA 4NXNB 1PY9A 2NR6A 4NNPL 4WWPA 5DD5H 2ZKHH 2QGNA 1WOMA 4XHJD 1UVQB 2YWHA 1YZNA 5A6MA 3SDAC 3KM2A 3QE4A 2XN1A 3IBOA 5CFNA 4D46A 3P2MA 2AOWA 3EGIA 3JV4A 3LLSA 4KX3A 5CB6A 3C5SB 1FJ1B 1XJ5A 2FD6L 3OAYK 1QVAA 2XKBA 4MA7H 5JIMA 3PGXA 3UJ9A 4NQZA 3R9XA 3SO5A 2YSSA 3PUIA 1NGWA 3E18A 3RT9A 3CRNA 1C0KA 5BV0A 1K88A 2RCYA 2GEQA 1U5BA 4OT1L 2PRJA 5CS7A 4JFQB 2R87A 1CTOA 3PSAA 2MIIA 1ZAGA 4TX1A 4J3NA 1KNOA 1H6FA 2AXFA 1HI6A 1ZE3C 2ZLBA 2OR9L 1KPHA 1K27A 5HDWA 4TL5A 2DPYA 4ZIRA 3IXTB 3UP6A 1DQSA 1SDDB 2VQ3A 1PG7X 1TAUA 3MBEC 2H2GA 3ZOKA 2C61A 2IS6A 5FYDA 4DMFA 1E1RA 1QZXA 3K4AA 3T77B 2GCPA 4NYJQ 1P5VB 2HB0A 2ZIXA 1OLSB 1NOJA 1U6JA 2UZ0A 1KORA 5IKCB 1YMHA 4WMLA 2YPLD 1B76A 1TD1A 2XICA 4G72B 3MJ4A 3MSXA 4EW2A 1T04A 2B15A 3AEUB 3FNIA 4U1LA 2W7TA 1VGKB 1B4JH 1SUSA 4IUBS 1UBTS 2XGGA 1KFEB 1CNFA 3T5AA 3GOQA 3S2EA 2OFFA 1T5DX 1JDJA 1WBXA 3EYSL 1WX1A 5EJAA 4F7TB 3IN0A 4PYHA 5T4HA 4YRDA 3MOIA 1F0PA 3TBVB 2HAEA 4M1GL 1R18A 2VQDA 3M0EA 1ZK5A 4KB5A 1JGEB 3VHLB 3D4OA 4KI5D 4EK9A 3KVRA 4G67A 3BEWA 5F7KC 5DR5L 3WTCA 1W2WB 5F9JB 4IIJB 1WCBA 4BBZA 3N87A 3IUQA 2GN2A 4YV7A 1RAFA 3VE0A 1DX4A 2O20A 3CVIH 1E7YA 3NTUA 5C32A 5GGQL 1YLBB 5LHDA 3B82A 1UZMA 4ZFOB 4FFYA 3UF0A 3HBPA 5DUML 3RVJA 3CW9A 4GP9A 5CCBA 3RU2A 2O3SA 4RJIA 4EL5A 1QA9B 2CFOA 4QULA 3FB7A 5LCVL 1OV4A 1W44A 3CE1A 4LB8A 1T7VA 2FWOA 2ICWA 1UH5A 1RKUA 3UG7A 4IMKA 3DL2A 2A9BA 2Q8AH 3W2HA 4P2YA 4WH0A 3DLQR 4GRLA 2HT4C 3DO6A 1A50B 1OSPL 3C45A 4I1RA 1QCCA 2D7MA 4R26H 3RPBA 3JR3A 5I9QB 5IW1A 2ZJSL 5HS4A 2WQVA 1Z7JA 3HJNA 2J8OA 4HLZG 3IKCB 4D74A 3FAKA 3FNBA 1GU7A 4FABH 3K2QA 4AE0A 3PPEA 3C7CB 5DMXA 1P2BA 2ZXCA 4BVLA 3R7NA 4HU2A 4JG1H 4QXTA 3ZDZE 4N0CC 1S7QB 2VZLA 4WZBB 5E5MA 3DZ8A 1U8LB 1VKOA 5JZ7D 2OK8A 2R62A 3B9EA 3SXUA 2RI6A 4X90A 4H5SB 4LRYA 2RBLA 2VF4X 2OMXB 1M66A 5TFSL 1P18A 2JKIS 2RHDA 3BD6A 1FDUA 3C6SA 1AC6A 4JX9A 3T4YA 2BEUA 3MQ2A 3A6BH 3VFNA 1U8KB 5ILQA 1PFWA 3PP8A 3SZRA 2YDXA 4BMSA 1LK2B 4MWFB 3V1MA 4Y9CA 4HEPG 5J1AA 4HJ0C 3LHPH 1W0KD 4GR5A 2YV3A 4EG5A 4ZARA 4TQIA 4KFUA 2RKBA 3BE8A 2GQ0A 1QYVA 5CBEB 4TSKA 2ZPKL 5FYKL 4DS3A 1RUPH 3MV9D 2EE6A 2HV8A 3NU1A 3B37A 5TX7A 4K2UL 4KYTA 4UBKA 4B79A 2QRGA 2D4FA 1COZA 1LLFA 2O23A 4MHHI 1CEXA 1I3OA 4PSPA 3HY3A 4MDIB 1BG9A 1CF4A 4XPIA 3IUYA 1ILSA 4L3VA 4NBUA 2GXUA 2A2ZA 1F56A 2QPOA 3L07A 5FOUA 1WPQA 4FBMA 3MRCB 1DQPA 5J40A 3BCSA 5EOTB 5HDRA 2ZPAA 5CSZB 4D3XA 1DTEA 3R76A 3KVOA 4PRNB 2WMOB 5F77A 1NCBH 4Q4JB 3ZU3A 3Q6MA 2D2IA 1N6PA 1W5BA 4F93B 6YASA 1SCNE 3VFOB 3HQ4O 5H02A 3DV4A 3TO5A 3W5VA 1O94D 3GMNA 1PY4A 2E86A 2FSEA 1RJ9B 2BP8A 1FYTB 4ZEVA 1RJDA 3RO7A 3S2YA 1LILA 2BRRL 2Z5FA 5KOJA 4QTTB 1G7SA 1KJYA 1MV5A 2C9OA 3TLGA 1SMOA 3H2KA 3ZR6A 2O59A 3MBIA 3QFTA 3MLEA 4UBJA 4CMEC 1N2RA 4CN9A 4RVCA 5HNKA 1MJFA 5JAOA 5I66B 3W34A 1ZM3A 4WI5A 1O97D 1O5DT 4CL0A 2PX3A 5HHQB 2OZLB 1DVFD 3I3EA 4MNGA 4ITUA 1AQ6A 1ISGA 4N6OA 4HXBH 3K5HA 5CA0A 4QHMA 2D8MA 3QAQA 2ENWA 4I6GA 4KQIA 3LIZH 1QZ3A 4TV9A 3CDZA 3NBXX 3RWGB 3VAYA 3UC2A 2IANA 3O2VL 3BKML 4TNVK 3DE2X 1XJ0A 3VU8A 3HZKB 3U7IA 1SBCA 2EDYA 3P9WB 4TXLA 2PBRA 5LA6B 1RZKL 4QWWA 3W06A 2CKNA 4KLRA 4JR9H 1D0SA 4UVDA 5EZQA 2C8VA 1XZLA 1Q9OA 1P19A 5J9FA 3ICCA 2WA1A 2PNJA 4EVNA 5CM2Z 2IANE 1RM5A 1P7VA 5CIQA 2VHEA 1WU7A 1U7OA 3KOZA 3EEYA 3IMCA 1TQTA 1F4LA 4B6EA 2XW6A 5JJBA 4Z7UA 4U2ZA 4R2JA 3DPSA 4HXYA 4Y2PA 3A5VA 2FVYA 2JCVA 3O6LL 3T7TA 5JW6A 3NHAA 4A27A 4GDMA 2X7XA 4X97A 1Z28A 1GPYA 2QA5A 3I6LE 3SY6A 2YFYA 4AUEA 3F7VB 4BVEA 2ONKA 2PMEA 1KYXA 1MC5A 3O83A 2EXYD 1AY1L 3QUYD 5JORB 2G60H 3QHTC 1NKTA 1GHFH 3BGIA 2A6PA 1SC6A 1XMEB 4B9IA 5AKKA 1I1AC 3T7AA 4Y1FA 4LVUA 4GKOA 1GNLA 4YRIA 1L9RA 5EDXA 3N2IA 1OYOA 1JV2B 2OM2A 4MW4A 4KV9A 2QTZA 1GKYA 4XZ4A 4FXPA 1JEYB 2HT2D 4MS4B 4PJEA 4W5WA 3ETDA 3EBHA 5L4MA 1TD9A 3KPRA 4KJPD 2Y0DA 3MV8A 2ET6A 4ZZ1A 2GZRA 3KOWA 4XQ9A 2PAFA 1GAFH 4AYSA 2QGBA 4LCCB 2XJ9A 1Y3DE 5E2WH 2G70A 2GZSA 4NZUL 3IHKA 4FWBA 3D4YA 4DQKA 2AEFA 1O5PA 5ALJA 1R4AA 4FC3E 1CYEA 2CLKB 3ENNA 3MV8E 1TEFA 2EFYA 4MXDA 2X40A 3WGIA 3E3NA 1CFNA 3BP7A 1COWD 4FI3F 1TJGL 3WK6A 5CBAA 2IWGA 3VSDA 4L9WA 5HOEA 3FWNA 1F4PA 2OBGA 3BEVA 2YZMA 2RJ3A 3OXSA 1U0GA 3A1NA 3CB4A 3FGOA 1AACA 3FJ1A 5A3SA 2GEVA 1EJBA 3ARBA 3N6RA 2EEZA 3I0NA 2BJML 4J6RH 2YHAA 2XLBA 5FGBC 3TCNA 2MTAA 1KTLA 2QNRA 3ILQD 3GI9L 1EX6A 3QJHA 4DSYA 3F6EX 4MA3A 4RM3A 2PJZA 1G2QA 1WZEA 1N3YA 3N40F 1ZTXL 1E2IA 3CXDH 5LBSH 1HVXA 4TLSA 1VIMA 4DCTA 1TLMA 3UHFA 2AJSH 1DAOA 1MUJB 3RG8A 3MLWH 3LNFA 5BNIA 1VL1A 1JPGA 3MOBL 3B3QA 3TIXB 4FNMA 3V6BR 4AC4A 3ARXA 1S3FA 3UJJL 1W15A 1B93A 3B9KA 2BDTA 5HYSA 4LI0A 1JZTA 3T09A 4DP7X 3W3AH 5DVLA 2CMGA 5I16A 4BNIA 4JMPA 3KCNA 5LVEA 1VHTA 4R1PA 1MF2H 4QTZA 1H6CA 4LSZA 3RTDA 4G36A 1Z8HA 4HAWA 3PXXA 4H59A 2IOIA 4OFYD 2XG5B 2QTMA 4DQLA 4DXHA 2A6IA 1UBLS 1EGJL 4C4YA 4E1VA 2RB8A 1WAAE 3G2IA 2DB8A 4LN1A 4NRDA 5K3FB 2Z92A 3GFPA 5EL0A 4WW1B 2RIKA 2NV6A 5HX7A 3OE4A 5DNEA 5JCZA 3AVOA 5GRVL 3I9MA 1ZOLA 2BKAA 4R5TA 1IRIA 3SDXE 2AF2A 2Q2QA 3QKUA 1QG6A 2C9PA 4Q3EA 1J9SA 4NCAA 1Z17A 2NO6A 4ODUB 3TUIC 3TLZA 3FUJA 1FYFA 2J8UB 1WZIA 4N6GA 3BTUA 1UPUA 4R40A 4RA9A 1KE2A 4EX6A 5SWQB 3QDGB 1VJRA 2R1WB 1KCVL 4U6VL 1MRZA 1AK1A 1T1ZB 1HWHB 2XVKA 3SYAA 3IP7A 1A5ZA 4IDQA 4YACA 4FLOA 1BQRA 1ORSB 3WWYA 3IVCA 2WBXA 3OIGA 5D72H 1X1AA 2P8JA 5DI3B 1H1LA 1AS7A 5GVRA 4EJSC 2VXUL 3QQ4A 4UVGA 5DTQA 2UU9B 4PRNA 4WA8A 3UBTA 1A4CA 2Z83A 4ORGB 3A8TA 1UYWH 4YIHA 2ZCLL 4HZUA 4G6AD 4IOIB 3G82C 3GLGE 3IFLH 4NM4L 3WI7A 3OCZA 3EY4A 1YHNA 5GM2A 3I9JA 1R5IB 3TEJA 1TVKB 3U0VA 1SOWA 5TDOB 4C0JA 5FHQA 4M7ZB 4R97C 5DK3A 3PL6A 3DAOA 4NRZB 2A5GA 3ZWOA 4MMZB 3ZXUB 1MJ8H 3EYOB 4JOQA 1CK0L 1R12A 4RORA 5JNSA 3IF1B 3QWQB 5EXDA 1WIUA 2WUGA 2XIBA 3BQNB 4Q3CA 3GSXA 1H9VA 3TYFB 4M6NH 2KQMA 3Q9SA 1JIVA 2UYCA 4FZJA 4HQOA 2OGTA 3TL2A 2XZLA 2QLBA 2XE4A 2QV0A 3DKKA 2QGCA 3OLQA 2AD1A 1OWMA 2IA5A 4LV6A 4D0NA 4XDHA 3FT1A 1VPLA 4BUHA 3BWCA 5FUZL 5IVOA 4OI1A 4OFIA 3TSCA 1WF6A 1MB9A 4FZ8H 3ILPA 4AMWA 3HXOA 1LWHA 4P4UA 3QEUB 1FY2A 1EFTA 3GDFA 1G1AA 4KO5A 1CRLA 3PX7A 2YOCA 2LPMA 2A33A 1HYSC 1W59A 1VIWA 3P3YA 4E2YA 3HSYA 3SS8A 5EUOE 4ND4A 4M8SA 1ZH4A 1VE1A 5IT2L 4JFAA 4YCSA 1U3HA 5THXA 2EDEA 3MUHL 2QTRA 2FMHA 1TEXA 2J30A 4JRYA 5TV2A 1OF1A 2I7OA 4LOJA 5BRQA 1Y5MA 5DE3A 2IPOA 2GZ2A 1SIUA 3OQBA 2IOOA 3LXMA 4TQEH 3ROKA 4YJ3F 2WWWA 2HF9A 3VJ6B 2FR4B 3DPDA 1E62A 1FFPB 2XMDA 1CGXA 5F7DB 3BFPA 5E7IA 3ZVVA 1SJVA 1AO7E 2GI7A 1EP9A 4E5DA 4BLWA 1QRKA 4X5LA 1BHJA 4G9FE 4HD8A 1KAEA 2WDZA 2NNCA 3H8SA 3OQMA 4C1NA 4FEYA 1TKBA 3BPNC 3PC4A 5KNDA 3UKOA 4OGYH 4HGYA 3KAKA 3IRVA 4YONB 4B82A 4ZW3A 1NR7A 1TLTA 4ZW7A 3IV6A 1U9IC 3C6MA 1Z6JT 2WVJA 1EZSA 1ZH0A 5AW1B 1FX1A 1CUCA 2IDCA 4CU6A 1KXQA 2B30A 1HNXB 3R0IA 5F7HA 1UAGA 3V9AA 9ABPA 5HF9A 2BEVB 3ZTJH 3IDMB 3SQDA 4LHZA 1L7EA 5KG9A 1R1CA 4KPGA 1P2CB 4AUJA 4L5BA 3A4AA 1S7TB 4OCSL 1B41A 3D9QX 3PDIB 5E1QA 5AUOB 3AREB 1W1UA 4XVRA 1GHTA 3B1JA 3QLUC 1EZ4A 4CGTA 1KO8A 2ESRA 2YEVB 1Y8ZA 1XVVA 3W57A 3JVDA 2PVPA 4J94A 5EZOL 4DP0X 4PV9B 3IFPA 4BX8A 4MXWL 1NQOA 3G7TA 4Q9KA 2W0MA 2A92A 3U26A 3KD2A 3H75A 5E9NA 1FP2A 3GTTA 1DJXA 5ALDA 3BXOA 3OIDA 4ISVA 3IPXA 5HK9A 4N0QA 4N2BA 3OFVA 5D7BA 3M45A 1J1OH 3RGVA 2REBA 4QG7A 3S6CA 1MC1A 4JY5H 6CHYA 1OP3K 5ERWB 1W36B 5AKEA 3MREA 4G0ZA 2B59B 4WKOA 5SZKB 1T4BA 4XN2A 3HYRA 1CRPA 1BLNB 3V48A 3QDJE 5EOVA 1KTIA 3HZMA 3TB4A 3BC1A 5IM5A 4ZJZA 2MPAH 1UZ8A 1UXKA 1EUUA 3AEZA 4ZYXA 4I18A 3Q8KA 5JXED 2UV3A 2DAVA 1RMQA 4ODUA 1AMNA 3JZAA 1HYQA 4FFWC 1B43A 4IS3A 4Q1VA 2ZJ6A 3Q6IA 2JAHA 1ETZA 3L9BA 3QPVA 2X05A 4E5KA 4F7CB 3ML9A 3IJRA 5E03A 1JDNA 2IXFA 4HDKA 3IU4H 2REOA 3UAJD 3ZDFA 5EC1B 1X2EA 4PANA 2RHRA 4MB6A 5B53A 3FQ4A 4UREA 1I2AA 1G7PA 1F2XK 5FTJA 2J0UB 4ENPA 5LO7A 4YAFA 4M93C 5AVRB 5D2NA 4DUZB 4FCHA 3EZNA 4YJHA 2YLHA 1MABB 4F27A 1U8NA 2UXTA 2QR3A 2CWRA 5FUXA 4EQ6A 1E20A 2ZX6A 2P43B 4UDNA 2WQAA 2OJZH 3R3JA 5IX8A 3NA4A 4H3VA 2H32B 1FJHA 1SG6A 1Y6QA 4P3DB 2GEUA 1Q92A 3R1GH 1XZHA 2WKQA 1SIBE 4AJ4A 3NUGA 2DQ4A 4TVUA 1CG6A 3OFJA 2A74B 1JGDB 3M9XA 1P17A 2X41A 1YPZE 3ENQA 3OR6B 1QGYA 3X1KA 4ZVNA 4G1UC 5E9DB 4G0MA 3W5SA 1KP2A 1XTZA 5MDHA 1OR8A 3TYGH 1DQLH 2GZ3A 4WFKA 4PS7A 1AKEA 2X5NA 1H2HA 3L92A 4NENA 1JIIA 3FUCA 3C6KA 3SQOA 3IFPB 3ENVA 3RJDA 2IAMD 4RGNE 1P84J 3GJRA 3OXSB 2Z8YM 5M04A 1QFHA 3NJJA 1ZIOA 3KEGA 2QELA 2ZTSA 5HS6A 3KO8A 3FS9A 2FMFA 3T4PA 3HJBA 2F7RA 1PV1A 1VXOA 4TV8B 1AO7D 1A9OA 3DVRX 4WESA 3T8YA 2ZJ2A 1D2RA 4GMKA 2UVQA 3A9UA 3P77B 3PL5A 1FH5L 1L4HA 1VADA 2OO7A 2OE2A 3TAXA 3AL0C 1A88A 1G7IB 2N0SA 2RHWA 4YHOH 1A8PA 2P1ZA 1X7YB 2CUZA 3H4TA 3Q2WA 1N10A 2A9AA 1HC7A 1NGXA 3RAFC 5KC8A 5DT1H 4Q2ZA 3VNVA 4H16A 3NUZA 5AM0A 1TQHA 3GEIA 1AIZA 1E5DA 3WLJA 1EFUA 4LKXA 1SO8A 3FHEA 2WPNA 3HLAA 1E9OB 4HQQH 3K9NA 1JPJA 1M7IA 4XBGA 2X7LB 4PZYA 2BHSA 3BHNA 3ARFC 4G2TA 3LIZA 4NOMA 5DLDA 1QK4A 2VW7A 1JE1A 5KSPA 1UOLA 3WG9A 3L3DA 4NO3A 3KJIA 3OL2B 2QAGA 3CVHH 4ZP1A 2OGWA 2VDOB 1DJOA 3AB7A 4FQHA 1T2FA 3DO8A 3M1YA 4HI0E 5D5QA 3V7AE 2XQGA 4K7PY 4DIDA 2O3UA 4XYEA 3AGQA 3QJ5A 5KYNA 3RFZC 3PWPE 4KI5C 3OQPA 2OMUB 4PGZA 2IXEA 4ZVTA 2FDRA 1Y5IA 2ZS9A 5TTRA 2JB6A 3ZZ0A 3HA5A 1BYUA 4MCZA 4NFDA 3NM5A 3OECA 3D69A 1XZMA 2FL5B 1U36A 4U1IB 4K28A 3MV7A 3HG7A 3PIQB 1NLZA 4I3GA 2XYBA 4JQXA 3KU4A 4FFSA 1ORSA 4YHBA 1WWCA 5I5IA 1U41A 3WN5B 1WIWA 5C0AE 1EK0A 5KMGB 3Q6GH 1HURA 3QIBA 5KBMA 4C78A 3ROLB 2Z57A 4I87A 3IMVA 3P54A 2NMVA 2UZ1B 2XKNB 1BOOA 1K5GA 3E03A 1GDTA 2R29A 3CLFH 2ZJAA 3CNLA 1CFNB 3QXWA 1TIKA 2UZIH 3KGTA 3UB3A 1WTGT 4F8NA 3HMXL 2NZJA 3C24A 2J45A 4YGVB 2OM6A 4RKRA 4DLNA 1E0AA 1NICA 4FDVA 3OAUH 2XCUA 3K0CA 5D4QA 4ESEA 1W2GA 4JANB 4XMTA 2WWVD 1CQIB 5EMLA 1F06A 3CSSA 4Q9HA 4KPFC 4PJGF 1E9CA 3WUZA 1YMUA 1G66A 1BFKA 5JXJA 2Z0UA 3SMVA 1JGLH 3G7NA 3PGLA 5BW7C 4M03A 1KMMA 4TWBA 3KDMA 1T66D 2Z3ZA 2Q5IA 2P5ED 4J5VA 1AKNA 4YUYA 1PDKB 1YOVA 3PL6B 3PHJA 1M2JA 3WFHB 5IAKA 5HFAA 3QELA 1NCJA 2WAYA 4FPXA 2JFQA 1NGPL 4JQOA 1NVWQ 1DAMA 1NZRA 3NAGA 1RJYA 1QRTA 2XRZA 3TBTB 1L6PA 4N5EC 4UW9A 3EWIA 3FYDA 1T91A 5EJMA 4X24A 1XTVA 1CJYA 3MCLH 1J1XH 2E37A 2H1WA 4V1DD 3E9EA 1PQZB 4P54A 1ERNA 4MDFA 3AMKA 2V17H 4NEHB 4ZYLA 1R0AL 1FVCB 4EBQL 3V4UH 3ZE1E 5IHUH 3I9IA 1ZRNA 4TMYA 3RF6A 2HIHA 3BB1A 5C31A 2VGLM 3J80A 2R9HC 1KZYA 5JHBA 2H1VA 1TU0A 3OA0A 4OIIH 3CGTA 2IPXA 3V95A 4KG7A 3RFRA 2BSXA 2J6EL 3MXTA 4RS3A 3PDGA 1UWXH 1R3IL 5TGBB 4AV0A 4Z4EA 4HV8A 1VKJA 3G0BA 3EW3B 4XMLL 1IL0A 4HS4A 4DR3B 2MPVA 1S5PA 8AT1A 2V5SA 3QQPA 5JATA 3IE2A 4NPYA 3HC4L 4LBZA 1WJ3A 4M8QA 5IZ4A 1JDCA 3V0EA 5JXEC 3O6KH 2QZ5A 3VTKA 4DUPA 2WG0A 3BVTA 4PJ9D 1XMXA 3TO4C 3W9BA 2NY3C 3T65A 3AW8A 3HYNA 4RY2A 3BQUB 1FAIH 4FGJA 5DXWA 4IIUA 1I8MB 1CQIA 5FWXB 4P2OC 1NCAH 4RZQA 3H5AA 3IP3A 1M05A 1XX6A 1FTWA 4BHUA 5IUJC 2W0FB 4I46A 3KD3A 3L4XA 4F3RA 3QHZL 4MXVF 1ZY2A 5EJ9A 4JRFA 3L9XA 1L8XA 4FJ0A 4G9EA 3LEYL 1WHSB 5AQEA 1PZUB 4ZCLA 4JYAB 1NCHA 1CV2A 1I1YA 3A21A 4OB5H 5HGBB 3M6DA 1CW2B 1DELA 2OVBA 3IV7A 2YZ7A 4ZMBA 1NKGA 3HA7A 4E22A 3SC6A 3BCRA 3ABZA 1CS0B 3FTYA 1OILA 1TOAA 2JJQA 4H7IA 3SSGA 1RQ7A 3MXWL 4BZQA 5TF0A 2BSRA 4RMUA 4FLMA 2ODAA 4ENTA 2HH9A 5INTA 2OL4A 3S1SA 3CVCA 4XPGH 3KFVA 4I3RL 2UAGA 2WNSA 3C15C 3HUDA 3TBCA 3EDEA 2ICWJ 1J2UA 5JHDA 4MR8B 2KSQA 3DE0X 1K5PA 3ARSA 2EAUA 2CGRH 1A1OA 4XWYA 1A9SA 3C85A 2QI9F 3DSFH 2Q4OA 3D4BA 2UXBB 3CCBA 3QR1A 3OZWA 3QO0B 3LAFA 5K09A 2X6TA 3OZLA 5E3HA 1XF3B 3MJTA 5JYMA 4LRWA 1G3QA 4KITB 3LDBC 1J11A 3P02A 1M6HA 3D5QA 1GKLA 2EDWA 3QNYA 4RIRB 2AFHE 1WMDA 3GXMA 1TUIA 3Q9LA 2DH2A 5HM8A 1BRTA 2WPDA 1EHNA 5J6HB 1C8LA 2ZT8A 5LOVF 1JCVA 3ZL2A 1IEXA 2MTPA 4F11A 2WLLB 3RWGA 2I7CA 3RRQA 4ZCTA 4JI4B 1QBLH 2GPNA 2DMKA 3ISYA 4N01A 2EP5A 3KJQA 3GJ8A 3N7AA 3MV8B 1XWIA 1MIOB 1V1RA 1JGEA 3JWDC 4Z7NF 1V55B 5K0NA 3KPRE 2C29D 1QAMA 1RI3A 1GSKA 5KSZA 2JEZA 4XO3A 3FPAA 3C6LB 1DN0A 3F8WA 2BGWA 2NZ2A 4XVJL 3LH2H 3H42B 5CURA 4JM2D 2I2AA 5DK2B 3UN1A 2ZWOA 4C0SA 4NKIL 1EV2E 1FJ2A 2MCFA 3U40A 4NT6B 2DLFH 5ALMA 2GNAA 2P5EB 4N41A 1OTTD 1Q9LA 4G9FD 4MCYB 4C0WA 4PRDA 3FTNA 5DMKA 2KX7A 3UKDA 4TRMA 3PL6D 1VECA 2JDID 3MG9A 3SKYA 2VHXA 2O8CA 2FSPA 3K8OE 1TVDA 2P0EA 1C8QA 2DYPD 2BY1A 1A4RA 5CSZA 3OP4A 4P5KB 3D3VA 4M1ZA 3DO7A 2BLLA 1L3WA 3A67L 3LMKA 2RFXA 4FD2A 1X3DA 4FX2A 1GGIH 3J81k 3GXDA 4HFUL 5E99L 2QL7A 5IHBA 1P3JA 2FPSA 3QORB 2OV1A 4BZZA 3E05A 1MB2A 3QZPA 2PEZA 4R7VA 2BSTB 4F58L 2H1FA 4X93A 1H3PL 1TCAA 3ZYIA 1SD2A 2ZX9A 1X6VA 2ED6A 1UD3A 3HL0A 4KLCA 5D86A 4XMPL 3FGPA 4ICWA 3WGUA 5E4TA 3MRKB 1WWWX 1KYFA 3EVAA 4YMIA 3FCOA 1PD6A 5ESDA 4KUEA 2IANB 1LK2A 2YK1H 4MWFA 1QP1A 2XVLA 2ADYA 4I0KA 4PCLA 5AVRA 3HMWH 4FFNA 5CCKH 1X9HA 4GC5A 5AUMB 1WIOA 1ZSHA 3T4YB 2FNWA 4KHXL 3F8TA 4CLRB 4QGBA 1DIGA 2X8LA 2QSQA 3L3GA 1KFJB 2BMWA 1XRRA 4IH9A 1T22A 3UTQB 5LZ4A 3D39E 4M5YL 4H4CA 4BCBA 1PX3A 4JUCA 5FA8A 1OW0A 2HDOA 3TGPA 3GJ4A 4Z76A 1QQ7A 3VXQA 1N5AA 2ZZUT 1KTBA 4MCYA 2HW8A 2YFKA 1G1MA 2DMHA 3L40A 4G5FA 4Y1RB 3INUL 4P57B 2A4CA 1GDDA 5MGBA 4GI7A 3ZWQA 1MJJA 1TVCA 3N6YA 4WLVA 1MA3A 3GJFK 2QKIB 4UXIA 1WGVA 2GS9A 1DWUA 1OLSA 2B0CA 4JVSB 1CUEA 1DX6A 1U90A 5DHQA 2O07A 2MHAB 4WFFE 1WG8A 4GI6A 3BIBX 4NCC2 3VD9A 3SD2A 4DLWA 1X4XA 5HE9A 1ML0A 1DQLL 1WU8A 4ZEMA 2Y1OA 1VDZA 1XGRB 1R7RA 1IUPA 4RWYH 2ZJFA 5U4QA 4DR5B 1AYRA 2VUSA 4O02B 5KDOA 2Y6UA 3R1IA 5JPDA 4I3SL 7CGTA 3KVQA 4FGMA 2CIKA 4G6KL 3A3NA 2QW8A 3UHPA 1POWA 3CPJB 3BO8B 3MBKA 2O2XA 3QUYB 3T5MA 2QP9X 2WSIA 2OCXA 3PXEA 3U9UA 1GG8A 1XYVA 1MXGA 3H8VA 3E9DA 1VPOL 1D7BA 2OCBA 1GGNA 4XBGB 3KEFA 1E7UA 5LG1A 4KODA 1ZPDA 4EXKA 2EH7L 5DGIA 1E5ZA 3BD3A 1YBHA 1E0OB 2WUDA 4JPKL 1X7XB 4JRYD 4N3GA 3M6AA 4DDWA 2EARA 5KMGA 4WHCA 1BX0A 3UL4A 3FUTA 1E8ZA 5DMYA 3QBJA 1PZCA 1IGJA 4LZZA 4JQIA 1XMVA 5ISZA 5B2FA 3C87A 4LJSA 2HJKA 2PU5A 1MTZA 3EUAA 4MJXA 2YV5A 1A5SB 1L7NA 3BK1A 3LT4A 4ZJ9A 4YV0A 3UUEA 1C1DB 4JNCA 5CK5A 1S4IA 5DJ0A 3MLYL 3ND6A 1ZT7B 3DVSX 1QEXA 4RGBA 4BV3A 4LGRB 3MV8D 4IQ0A 3LH9A 1ET5A 4FDAA 4PW0A 4R83A 3PCYA 3U2JA 4AZVA 4NQVB 1EAQA 3U9SA 3LQQA 1SHWA 2IZZA 2GAAA 4MHOA 4Y6RA 4ZJPA 2HKHL 1U6IA 1R5NA 5DDHB 1F3RB 4IF4A 5CFOA 2J0VA 2UVPA 3QQXA 3EXEA 5HKLA 2X6QA 2XRYA 4MQ7A 3FVWA 4N9WA 5JY1A 5DWPA 5C7XL 1GPUA 4AIZA 3EJZD 3ISRA 3KKLA 1FA4A 3F98A 2AFIA 3SPGA 2BVUA 3PQYE 5BV8A 1JMZA 5EJFA 4YBQC 1U3UA 1ZMTA 2ZG6A 4G9FB 4OGQC 1SD1A 4LZAA 2KYIA 4WV1C 3H2WA 2RQEA 2BEWB 4U6HB 1NA8A 2L7JA 1TM2A 1CFJA 1UBKS 3QDHA 3FFXA 3EDOA 3O6FA 3IDJA 5AG8A 3OF5A 3DEJA 1TM4E 1ID1A 2XY2A 2TYSB 1MG5A 1TZIA 4WRLA 3QJFB 4Z7JA 1MPTA 4B47A 2AVGA 1J8VA 5DZLA 1AO7A 4EY7A 3JAWA 3U7QA 1DAPA 2CH8A 1J0DA 3V8PA 3HTXA 5ISZB 4PB0L 3GG2A 2ZUXA 4XDGA 3ESCA 4HV8B 5DRZB 3VPCA 2H1IA 2WU1A 4X66B 4DDMA 3V1UA 3R3HA 2QQFA 2SKEA 2O6CA 4M56A 1Z3IX 4C22A 3APCA 3NX4A 4WKNA 2E21A 1YEFH 3TBFA 4ND1A 3RWIA 3PE4A 2CMDA 1OJ7A 3FRPA 1C12A 2OB2A 4KRNA 5JPCA 3K6KA 4NV1A 4G63A 3EMBA 4JY4A 1WUZA 1AGYA 1N7GA 1NFQA 4FK8A 2HU7A 3UO1L 4P33A 1CY7A 5CT8A 4P3XA 3USCS 2FMTA 3UHJA 3EOBA 2DZDA 4JENA 2W58A 3QUCA 1I7QB 2FAXA 3DO5A 1I51A 3B1YA 4C7KA 4ZUWB 1L7TL 2W6JD 4FQXC 4UHFA 5B7MA 3GUTA 4RD1A 2JKSA 2EW1A 2VH2A 3FOMA 4CMHB 5LXTA 3V2HA 2WM8A 5ESAA 1L9MA 5FM4A 5EZLB 1Q12A 1Z0JA 1QSEA 3SZUA 3E9ZA 1N1GA 4HLZH 3QXCA 4BK5C 1E3FA 5DJ5A 4XM0A 1TVEA 1VPVA 3T8XA 5H3HA 4DB2A 1CE6A 3WG7B 1OQXA 2IJGX 4FMCB 5FWRA 2D06A 3F5QA 2WSKA 4HCGA 1BXVA 1KIMA 2DUWA 2GI4A 2JFBA 4XH2A 5UKDA 3ITKA 3QUMA 2DKNA 3IEVA 4KJQC 1I9RH 4QBTA 3THML 3ENEA 3SKUD 1BYIA 4L8SA 1QAQA 4V1CA 1KNXA 4ZANA 3A1DA 3VZBA 3HBGA 3Q2NA 1O9WA 3UK7A 2P2NA 3IDMA 2PGOA 2QJWA 3BGMB 4OXIA 1R3JB 3F2LA 3V1YA 1RWKA 3H9QA 3NT5A 1UKCA 1ZYUA 3JQBC 4UCQA 2VWEC 2QMOA 2YHIB 2ZQZA 2G71A 2D0FA 1ZM9A 3UV7A 3JR7A 1W76A 1I8TA 1EFPA 3VBEA 1GUYA 3HUFA 1INLA 2D7OA 2FL5A 1T3TA 5HHPA 1W91A 3LKNA 3MRGB 4PGGA 4Y1AA 1DQMH 5AOBA 2EDFA 5B4TA 1AHWC 2F59A 4H0LC 1GNSA 4G1MB 4BNTA 3QPKA 1ILUA 1G6KA 2ZKMX 3WFBL 4FXGA 3OOSA 3S5UA 2TMKA 3RJZA 3BFQG 4LRXA 5IDWA 1HL7A 1O6FA 4XCCH 3TL5A 1UOPA 2VDKB 2J6IA 2PWFA 2PZMA 5FBZA 2ZX5A 2VPZA 2CQVA 4M7LL 3FWYA 2Z4RA 2G4CA 1BVNP 3ETJA 4EOWH 5BRPA 2F3PA 1F4WL 4YBQD 3NG1A 4N6RB 1W25A 1IH8A 1F9EA 2Z8RA 5D4HA 2EH8H 4IHBA 4MYTA 5EC8A 4FP8H 4A6DA 3DX8B 5ESXA 5KHAA 3FO0H 2J85A 2R1XB 1FRGL 4CTNA 4IJQA 4DLVA 4HNUA 3NRJA 4D8YA 4KBGA 2VJAA 4TXJA 3BUSA 2XKSA 1TJ3A 1N9KA 1OT2A 2QTLA 4KXVA 3JW8A 3DK0A 5AW1A 4DCUA 5GISH 1JQEA 3C3XA 4X7TA 4U1SA 3Q15C 4DVBB 1ASQA 4A03A 4BK8A 1D5XA 1XMOB 3GLHB 5G4KA 1OB5A 4FOTA 4PJ8A 3DKHA 5AVTA 3S35H 1IGYA 1XEFA 2C9UA 3UAEA 3VI4F 1CD1B 4KFMA 2HHCA 1GTMA 1P6UA 3HXKA 5EUOB 4E03A 4TLDA 3WJ7A 2X1MA 1GW0A 3QYCA 2XWBB 2BVTA 1JWMA 4GBXA 4BKTC 4XD7A 4YCNA 5DTFB 3HKEB 4QT5B 5C0DA 1T1JA 1RURL 2ZJ0A 4C0QC 3Q72A 1SN7A 4F4IA 1GLGA 1SPBS 3IF1A 2P7HA 5CD3B 3PP4L 1DZBA 1HXYA 2Y76A 4OF6A 3UAAA 4PGDB 5F0LB 2E7LA 3IKTA 4AWBA 1HQ4A 3STUA 1DHKA 1HAUA 3CX8A 4UU7A 2C77A 4FMDF 3KZVA 3WE6B 3M49A 3IDXL 3CRQA 4H2AA 2YPVH 1XQVA 4H6WA 1H22A 2JGIA 4DN4L 4IS2A 5FB8A 3BVXA 1FNGB 1N6RA 3FUUA 1JNLH 2VTKA 5BUGA 3G5YB 3BK2A 1C9YA 3T1VA 4Q4LA 4NAQA 2P2DA 2CCGA 3O4VA 4OFQA 4JDZA 2YQ2A 3N2GB 1QIEA 2Y66A 2WNKA 5I4CA 4L4JA 3DVAB 2XOEA 4H2CA 4N9QA 3AQ4A 4N76A 3LRLA 4Z6KA 5EE0A 2XUWA 5D2NB 1TPZA 3RS5A 1D5WA 4U0KA 1GZPA 3PKJA 4J3BA 3W2DL 2OV8A 1JHRA 2W6ID 3O4LD 5KVEH 5ECJE 2ZATA 4Y1AB 4HS8H 4TVPE 3IB3A 3VUFA 1F11A 3RYCB 3DLAA 2PO5A 1D5ZB 3AFNA 4XN4A 3AP1A 5EUMA 3GI9H 3B2NA 2P11A 2ZPUA 4G7YL 5CMAA 3TBWB 3ZDXE 1RWBA 3H1EA 3M6LA 2ZITA 2X42A 5B5SA 1B0GA 2E8ZA 2M1XA 1QRNA 2VXCA 4BO3A 6ABPA 1JZJA 2AJ8A 2GN0A 1VYTA 2GHWB 3FOLB 4DG9A 3TQSA 4XPAL 2PPCA 4WW1A 1TJGH 1T1XB 1I24A 4HGWB 1UGKA 3CVUA 2OHOA 2O2DA 4B6ZA 4ESOA 2IY9A 4F20A 1V1MB 3L6FA 3BPCA 1RPAA 2FRDA 3FB6A 3Q3JB 5CGQB 2CCLA 4F37K 4DSTA 4MI1A 3EOAA 1CL7L 1GGMA 1AG0A 2PJRA 4PLGA 5LB2A 4CKQA 1X38A 1LQTA 3QOXA 4CEHA 2V2TA 1IM3D 1ZA2A 5EIBC 5J13C 4ZN6A 1LZKA 1V5GA 1INEL 5MN6A 4I0WB 3AG6A 3KUKA 2VFAA 3DEZA 4OLUH 3TRDA 3CR7A 1O6BA 3IJSA 1XVLA 5ENWB 5I82A 5IJXA 3C75A 3LOUA 2GPAA 3BYZA 1DNPA 3A4DA 5DEZA 3OEEA 1KWKA 1KK3A 1Q91A 4P4SB 2VS1A 1E9PA 1E60A 2AMUA 3UTQA 4W9LC 5ISMA 3PL6C 4OUKX 1W6RA 4DVGA 1Z5UA 3SDAD 5EMKA 2AP2A 5JQGB 4CLRA 4S05A 3BXFA 5CGYD 3VWKD 4CIVA 1XYYA 1GR1A 5BN3A 4Z3JA 3WZLA 3UBMA 3K53A 1QUPA 5EXSA 2CV1A 5ALKA 1FNSH 4POAA 2AAAA 3VXUB 2XYRA 1JFQL 3RFUA 2XMCA 3UG5A 4BO0A 1F8XA 4Z0BL 1C3OA 1DCKA 5BVGA 4ZFOL 4S11A 3QG1A 4P3NA 1C16A 5K39A 4O2AF 2DG2A 4F33B 2QRZA 3O2VH 3RTBA 2XXFA 1ML4A 3S55A 4NC9A 2ZI3A 3GG9A 4QAJA 3JBG7 4HF5L 4X5WA 1OYYA 5C0CA 2R6JA 3P32A 2IBZY 3NNNA 3T52A 4AEIH 1H8NA 3KT0A 4C7BA 1V39A 4EB6A 5JAMA 2VBCA 4ZCSA 4JE0A 1VCHA 5GY7A 3OJLA 1J2TA 1ZS2A 1PT9A 4BDVB 2BFBA 4NP6A 5BZXA 3RYTC 2MOVA 1EFRD 2DQGH 3MUEA 4JQYA 4ECAA 2CJPA 1X7WA 2ZI4A 1P4IL 5AB2A 1PR9A 1N6UA 1W46A 2Y3NA 3OJDA 3BKCL 3U7HB 3BWXA 3MLZH 1U3CA 2JEOA 3EYAA 3WO3B 3IMSA 3OKKA 4R4BB 3GDGA 4Z7QE 3BP4B 5CD5D 1E4VA 5FAXA 3LA8A 4U1IA 4X1KB 3AUFA 1NCBL 5C5EA 4UUJA 4LSQL 3RWHB 3OD5A 1SD5A 4FXKA 1A76A 5JISA 1RBMA 3JQ6A 4P83A 3VWJC 3IUNA 3NYQA 4C83B 3HCRA 1UB6A 1IGFH 1UUSA 5KHLB 4FG4A 1AB6A 1LEIB 1Q0PA 1FS5A 5F1NA 3KSUA 4MAYC 1EVQA 2GESA 4K07A 1JEYA 1NZFA 2YWEA 3NRBA 5ABPA 5T8IA 5HIJA 3KELA 3TLYA 2V7NA 1R3LA 3EIEA 4X5XA 2HI0A 1MHHA 4L05A 1U0FA 1XDZA 2OJEA 1RUPL 1U3YA 4BLPA 4M5ZH 1IN5A 1FVEA 4MVJP 3STWA 2J6BA 3GRAA 4RJ2A 4QOKE 3L3JA 3GHPA 1M6WA 4P2OD 4IIEA 2ODIA 3KWXA 3BGSA 3N0VA 5IC6A 4RISL 2ONCA 1KEGL 4IPTA 4YHMH 5A2QA 2IBSA 2CD9A 3VR0A 3O4RA 2Y6VA 5F88B 1OGSA 4ESHA 5DHSA 1X42A 4V02A 1ITZA 4A68A 5IKMA 2L3BA 1TF7A 1OZHA 2B4KA 4KUGA 3D5EA 4HRXA 3BP4A 1E63A 4QBGB 3T4AA 4WV3A 4AUYA 2NZWA 4UZUA 1EAJA 3GIDA 2CMRL 1QIHA 1CFZA 3AACA 5IEHA 3U7YH 4IAOA 4KAAA 2ZTBA 3FU7B 1MEOA 1PWHA 2X1OA 3HFSA 2I33A 4EZBA 4IRJB 1E65A 1SVBA 2VK8A 4NL4H 5E6YA 2HNBA 2A9CA 1MIEH 4M36A 4OIAA 1K0UA 3LCJA 2VOTA 2NR6D 1CL7H 4J6FA 3BVDB 1E5UI 1TQCB 2H7WA 4QUKA 4V1DB 4HN9A 3VPSA 3PDOB 4R2GD 4P4NA 1HQDA 1Y98A 1V2HE 2WP0A 1PLCA 4DZ8A 3PGJA 4GRAA 4KVCH 1GDHA 4PY7B 1HI6B 4ODXB 1FSGA 4JFVA 3HG2A 4YDIL 3VI4B 1HE1C 4WU7B 2FX7H 2W6QA 3D3JA 1CR4A 5H9WA 1NCCL 1JP7A 3WHXA 2BN4A 4LCCC 2Q07A 3PFGA 1SC4A 2ICWI 3I42A 3NPMA 3CMGA 2X3CA 2CALA 2JIZA 4I6JA 3PGFH 3ELUA 1D2GA 1LPAB 4L4XA 4JO4H 3BRSA 3BD4A 1MAML 4D9KA 1SVUA 2FZ4A 1Z07A 3D06A 2JF1A 5EU6E 1EK5A 3DJZA 1PK9A 1OOEA 5AKXA 1E6CA 2HKFH 1TTQB 4P46C 4XNUL 4MQFB 5MFZA 4RE5A 1UGNA 1L5VA 3LS5L 4UVHA 2YAFA 2Q5FA 3H6HA 3TRFA 4C0HA 4RCAA 1TU2A 4KQMA 4RZ3A 3QT2A 1D5MB 4HIJA 2CYCA 4L3OA 3ECUA 5EQDA 3U56A 1SUBA 4BFXA 4LLMB 3U1PA 1DSFL 4Y30A 5LJIA 2HH0H 2XQ0A 3NDBB 5AOMA 2D54A 1A1MB 3OTIA 4G85A 3LAWA 3NA9H 4BNNA 3FB5B 4M9QA 3AESA 4DN4H 3WTBA 1NL3A 4IGBA 4PRDB 1HNNA 2YAMA 2NU7A 4LYYA 3JATB 1BAGA 3PD1A 1UEIA 4F37F 3MBOA 4XPFL 3C09C 3ABKB 3LK6A 2PWPA 4D9FA 3PT9A 4YSEA 2IV8A 4PZLA 3SEFA 1V1RB 3IEKA 1K7XB 1H0SA 1U9IA 3OJCA 3ZQ6A 5IQOA 1F20A 3IOMA 2VNKA 4N54A 1V3UA 3EJTA 3PNQA 3OT5A 5FD8A 4FSXA 2X4PB 5AW7B 2B78A 5AK5A 3GB7A 3TGXA 1MZPA 3P4LA 3P27A 2GW5A 3ZTCC 2HZ7A 3BL5A 1S8AA 4L6CA 4PLCA 1X5FA 4A8HA 1YS6A 2R69A 4GGMX 2EZ0D 2JPDA 1VGQA 4NDMB 3RG1C 5KN5A 2QMZA 5T33H 4J03A 3ECCA 1N1EA 4RBNA 2GYWA 3IALA 1PU2A 3DD5A 4FTVA 4C0XA 4GX5A 1K4DB 3CVBA 2OL3B 3GLUA 4KXUA 4KV5F 4N7RA 3AWEA 3L9WA 2VPTA 2OORA 2PH5A 3GD5A 1BVYF 1XDWA 3ES6B 1KDRA 4XR4A 2R0LL 3LNHA 5M7EA 2V65A 1F51E 3EXHC 1DIRA 2GPSA 3BEDA 1F4WH 4DNFA 3KJ4C 2ZWVA 5MEOA 1E4XL 3LN5A 3H6GA 4JM4H 5C0JB 1RM4A 3LWBA 3TX2A 3AQDA 2B8TA