2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
1U8CB 3ZE2B 1SHTX 4HQFA 3ZDXB 1FNSA 5E6UA 3HXQA 1M2OA 1M1UA 1L5GB 3K71B 2XWBF 1OAKA 4K3JB 3T3MB 2VDOB 4XW2A 1U0OC 4CNBA 5KYXA 4WK0B 2ODQA 1N3YA 3EFOB 1JEQB 3VI3B 2B2XA 3EH1A 4IHKA 4CN8A 3FCSB 1M1XB 3BQNB 1SQ0A 3AL8B 3NIGB 4IXDA 4NEHB 4WJKB 1MJNA 5E6RB 3ZE0B 3TXAA 4F1KA 1MF7A 1U8CA 3EG9B 3N2NA 1QC5B 3IJEB 5HDBB 1L5GA 1JEYB 3K71A 1OLZA 3TW0A 3K6SB 5BV8A 4UM9B 2VC2B 3TVYA 3OKWA 3NVQA 2XGGA 3PPVA 1JV2B 3EGXB 1JEQA 3ZE1B 3V4PB 1YUKA 3FCSA 1AUQA 1M1XA 3AL8A 3EOBI 1RS0A 3AL9A 5E6RA 1IJKA 4NENB 4WFQA 4MMXB 3AFCA 1N9ZA 4IGIA 1ZOPA 4O3UB 3EG9A 2VDRB 5KYUA 1QC5A 1FE8A 2NUPB 1U0NA 3IJEA 3EGDB 5KYWB 4O3TB 1RTKA 5E6SB 3BQMB 1T0PA 2I6QA 3PPWA 1JEYA 3K6SA 1RD4A 3PPXA 2UZYB 4C29A 1MQ9A 1JV2A 3OL2B 1IDN1 3EGXA 1IJBA 1BHQ1 4WK4B 2VDLB 1ZOOA 1SSLA 4C2BA 1PD1A 1V7PC 3GXBA 4M76B 3HI6A 3K72B 4NENA 1AOXA 3EFOA 4JDUA 4MMXA 2P28A 1LFAA 4MMYB 2WINI 1Q0PA 2NUPA 4FWWA 4Z7NB 3EGDA 3TCXB 5KYWA 5E6SA 4FX5A 3ZDZB 1YVRA 2WW8A 1DGQA 3IBSA 4MMZB 3OL2A 2I91A 5ES4B 3ZDYB 3ZQKA 1TYEB 1SHYB 3RAGA 3T3PB 1XDDA 1JLMA 4GZ8A 3QA3E 3HXOA 5KYYB 4CN9A 4DMUB 2VDPB 1UEXC 4O02B 4G1MB 3K72A 1AO3A 2VDMB 3NIFB 1M2VB 1ZONA 3BN3A 2O7NA 4HQNA 4HQOA 4MMYA 4BJ3A 1PD0A 2ODPA 4WK2B 1XDGA 3EOAI 2I6SA 3VI4B 1PT6A 2NUTB 2ICAA 2QTVA 3M6FA 3EH2A 4MMZA 4JX0A 1ATZA 4G1EB 3OKYB 2IUEA 2X5NA 2VDQB 2VDKB 3PPYA 1BHO1 5HJ2A 4F1JA 5E6UB 3F74A 1M10A 3FCUB 3NIDB 1CK4A 1MQ8B 3E2MA 5HGJA 4C2AA 4PN7A 5KYYA 4Z7OB 1QCYA 2VDNB 4HQLA 4O02A 4G1MA 1M2VA 5LN1A 1IDOA 5KYXB 1NA5A 1T6BY 1SHUX 3F78A 5KYNA 5KYUB 1DZIA 1XUOA 3Q3GE 1CQPA 1YVPA 2P26A 1RRKA 2XWJI 2ADFA 4A0QA 4UM9D 4Z7QB 1MQAA 3V4VB 2M32A 2NUTA 2NVOA 4UM8B 4HQKA 1MHPA 4G1EA 1PCXA
chains in the Genus database with same CATH superfamily
1A5ZA 3VXRD 1KI6B 3BCDA 5EOCL 3WJLC 3GJZA 2GLTA 2V9QA 4CLDA 2GESA 1NDQA 1DVFB 4MAUL 4URHA 2EU8A 4JPWL 2BTOA 2BVEA 3TVMB 1DI0A 3KM0A 4ZHQF 4ZALA 3U2SA 4L85A 3W5NA 2MWCA 1TR7A 2VJ0A 4ZS6D 4GSUA 2BR3A 3GINA 3S96A 4PP1D 4OI0A 4HAZA 3ZRSA 3MT9A 1MCWM 4KYTA 1VLVA 2HJVA 3E18A 4RMIA 5D7KE 3MD0A 1NKRA 2ZR7A 3U40A 3BIJA 2FGWL 2IELA 3DBVO 3MGTA 1RU9L 3K8OE 3Q2NA 3WE6B 1N0VC 2CMGA 2PS0A 1Y7PA 4AG4H 5GZND 1QBLH 4HJ1A 4Y0GA 3QJYA 1TYRA 2A4MA 4UZEA 1E4EA 3QRWA 3CVWA 1CUWA 3OHXB 1H0DB 3R1GL 3BUPA 4MW2A 5TD4A 2JKJA 5IK3A 1URLA 3QUAA 4UAVA 3D6FA 1U8QA 2YICA 1XZFA 4OCLC 3W11D 2WYZA 3V6LA 2J9FA 4NXKA 4PBVC 3CLVA 3MTDA 4E21A 3QHTC 2O1WA 4NI6A 3OM9A 2F3RA 4PRIB 5JW4Q 2WTXA 3PQ7A 2R96A 3GSOB 3I84A 1KGCE 2VR3A 1BGWA 3CONA 1W29A 4LP5A 4P2RE 4TSCH 4KXAA 3QFRA 3GZOA 3PNKA 3QQPA 4YHLL 1G1KA 1NJ9A 3GS4A 4OMUA 2QGDA 2IHVA 1FIEA 4R2IA 4Z7QE 1QKJA 3GIVA 1KJ2B 1KARA 5IT2H 2VVTA 5ADPH 5T64A 4KK8D 1LK3L 3A0RB 3WZLA 3PVCA 1YS1X 3FB4A 5FO7A 1D7BA 4NL4H 1JMKC 1W36D 1A3RL 1AN0A 1JV2B 3KZCA 4DLVA 3NVAA 2CHQA 2P24B 2G71A 4G80A 4Z0NA 2XUAA 4R90H 2D74A 2CZQA 2IADB 4Z2YA 3VMOA 1CI3M 1HAWA 4DK3A 3D3KA 1RAEA 4ZDHA 2C8JA 4FR0A 1DUZA 4HCGA 1RKBA 5HYJD 4YRJA 4G7YL 1WO8A 3V46A 1RXEA 4IFEA 2UX6A 2DQIH 1NQWA 2XLBA 4PPQA 5GJSL 1X1CA 1OAUL 2G0NA 3PFKA 1WFNA 2WQ6A 3WIEA 4XM0A 3W5DA 1O6FA 3OLXA 2E9GA 4KZDL 3FTFA 1OWNA 1BVHA 1DKLA 2ZE7A 4WFIA 5J59A 4XJXA 4FYXA 2C9XA 1CB4A 3ZKQD 1U11A 3L84A 5IW3A 3L5XL 2PT7A 3NN8A 4YMUA 2B30A 4U9IS 3D0RA 1WBZB 1T1JA 3B3JA 1DVFD 3ZHKA 3DXAD 5GOTA 2QZJA 1HFKA 3ILEA 4EVIA 2UYLA 1H2YA 3UV7A 2M32A 1F4YH 1JF5A 3KTAA 5DT2A 1UPUA 3S8YA 4OJEH 1D0VA 5JYCA 4PRNA 1AIFB 4O51B 2Z43A 2VDOB 3MLEA 1OHQA 4ZCMA 4GY4A 3HKCA 5LJYH 1FHGA 3L3DB 1Y1LA 4XZUA 3HFSA 4D3DA 2P1ZA 4XN1A 2FMTA 4UUJA 3LZNA 4M21A 2H4EA 5E6RB 4JO3L 4KQJA 3KQTA 1TVKA 2GBIA 4EI7A 1HYSC 1C81A 1QQ5A 2OCJA 1BDIA 1J9ZA 5JXGA 3PCXA 2R0WH 3DYPA 4L3WA 2HT3D 3T5GA 1ERNA 2QRNA 1CXLA 2AV7A 3H8NA 5L53A 5G5DB 4IRJD 2CBPA 4C0JA 2W4QA 2AOUA 3CHOA 1H66A 3KFXA 4O5LH 5HGAA 2BMEA 4ELMF 3SDAD 1BYOA 4Z6KA 3RDTB 5H2BB 2H6UA 2RGDA 2VUHB 5KU7A 4DKAA 4KTEL 4CG3A 3RVMA 4PRID 2GJ6A 4CF5A 1N2CB 3GK8L 3CX7A 5C86A 4ENVA 3F47A 1YSOA 3HG1A 3WC4A 1NMCB 5D2NC 3PRYA 1FK8A 3WMWA 2ZJ5A 1ZGLA 2Z9DA 2XV6B 2A4KA 2Z92B 1SB9A 3HMXH 1I7LA 3EH2A 2GZ3A 4KKCD 4HN9A 3K0AB 4UQ9A 1TUEA 1XVTA 3EVFA 4AJPA 2CDEA 4BV1A 1JG9A 4FP9A 4J9UE 5AKTA 1BFOA 1S5IL 1JS1X 4LRIC 4E4TA 4IDQA 3MWKA 1BQLL 1QVZA 4IQHA 3LH2L 4PLPA 5JY6A 4FLMA 2C1XA 1NTRA 2P5YA 3K2BA 1SOMA 4WNQA 3P8ZA 1SN2A 1UJ2A 4DESA 4W9EC 3VYNA 4HWUA 4WV1A 7FABL 3HC4L 4LYDA 3PYXA 2IIQA 3H1BA 1P4RA 2AQRA 3Q2KA 3CV5A 2R9HC 1UA3A 2G3NA 3V95A 2XRYA 4KK3A 3SC2B 1WETA 3GXFA 4OHFA 4QDXA 2DTEA 1TK3A 3HZZA 1A4KA 2CFTA 4NKDA 4HQ6A 1TKRA 1Z7BA 4KIUA 1VGEH 2W2LA 5C6TL 1EHLH 1P5ZB 2BTQA 4K3EH 1ZS8A 1QF7A 4IHJF 1RUAH 2ZSDA 3C87A 3T9WA 4L4SA 4C4BA 4U2ZA 3EDDA 1N78A 3NPSB 2G5TA 2AJYH 3E58A 2D03L 4XMWA 3NP3A 4H5SA 1IEQA 4XP4H 2HXAA 1H3XA 3UAOA 1LEKA 4PU2A 3GDOA 3OJOA 5HKLA 5CP7B 4GWGA 2UUOA 2ETWA 4X20B 3CVCA 4RHFA 1ESCA 2QTVA 1KAGA 5DK0A 1PK7A 1LK7A 4PRPE 1E79A 2LAAA 1OFHA 4YXKL 3GLHE 3VXUB 1HNNA 4HLEA 1VKJA 3DSNB 1MHCB 4X6CA 1UXLA 3SOPA 2X4PA 1PPIA 1XTZA 1LBEA 4OFBA 3O0RH 2OUIA 2J43A 5KVFH 3WL3A 3EQ6A 4TTTS 2OCCB 2PCJA 2RB5A 4M53A 3AM8A 2HMIC 4FDAA 2B1AH 1V27A 4A2FA 2QUJA 4E2OA 4CIAA 3NJRA 4H7JA 2IF0A 4KLNA 1ZCAA 3X11A 1N6IA 2VE6B 3IOCA 3WTVA 4YRFA 2HT4D 5D2NB 5J12B 1ELOA 4LYGA 3D3WA 3ZHXA 3OZTA 2XTSA 3A0OA 4FRWA 4TULL 4O2FA 3RDTD 1SRRA 4X7BA 3HLAA 3CRQA 1IZZA 4OHWA 5CGMA 4LL9A 3UJIH 5F4ZA 5I82A 3F6JA 5EWMA 3S70A 3FNGA 3K09A 3I2HA 2VYCA 3NDBB 4FEAA 3B43A 3BP4A 3PL1A 5D4QA 1IB6A 4G8FA 3PC4A 4BO9A 1APBA 4LC0A 1Z6ZA 2RHMA 5HI4C 5EN2A 3QXHA 1P75A 1Z5ZA 3LT5A 4IIEA 4PZDA 4B48A 5SWSA 2XHZA 1Y6FA 5CUSH 4EUPA 4HOZA 3H65A 4X42A 3LQKA 3O75A 2DETA 3IPYA 3R3VA 5I9TA 3D05A 2GO1A 4TKVB 1ZANL 1DO5A 4TRPH 3IAGC 1DDOA 2GO7A 3ZDYE 3EXHC 4BFVA 3I2CL 3I3OA 2CPUA 3HZRA 4JZKA 3NIFE 2Q3XA 1B4LA 1SXZA 2X70A 1XGQA 5CNHA 1GYQA 2WWMD 5ALVA 4TLAA 2EW1A 2G72A 3ECSA 5F7MC 3GLGE 1VKXA 3ETDA 4DRXA 3SICE 5K0FA 4XGRA 5DJAA 2I7SA 5KJRH 1PZAA 1KJNA 2IC5A 2YFYA 3SQOH 4CM4B 4NAUA 3F98A 3OSKA 4OCYH 4M7LL 4R3UC 4BBWA 3TBHA 3KUCA 5TH2A 2Q28A 4CLOB 4JFRA 4OIIL 2GG1A 5CWSB 3GMNA 1KGXA 1AQJA 5L4FA 1X5ZA 4MI1A 1P6WA 4AOFA 4J0GA 3VU9A 3JTSB 3WLRA 4RA3A 3DDUA 2Q62A 4JFFB 4ANUA 1LTXA 1T1RA 3L9XA 4JVNA 3GZJA 4PJHE 2HSJA 4IIQC 1VMDA 4NZTL 4PY7B 3KPPA 5DNEA 3SQXA 3KPUA 5F1IB 4ZTZB 4DEUA 1COWA 2FW0A 3VXUD 1L9QA 3O4JA 2RACA 2QMHA 4MUAA 4GVXA 1PQYA 4X8CA 5JQGA 4W9NC 2G3ZA 1I24A 5DVNA 4AKEA 1JAXA 1WFJA 4V2BA 1WE2A 4OMFG 3VGHA 2AKRA 3GLSA 4GGOA 2CC2A 3KWFA 4XVUC 4PR5B 4EDHA 5FL7A 5JMRA 2JAUA 4LOHA 2DM7A 4IS3A 2VDQB 2ZNXA 5HMLA 4Z3DA 1KEVA 3WSWA 3BCUA 2XH8A 3KQNA 4RFSB 2BCKB 4AZWA 2P8SA 1KXVA 1UYWL 3TP4A 4QG3A 5HNKA 3V8OA 5JASA 2Z4QB 3G7UA 3YASA 3FULA 5DPMA 2A73B 2FYYA 1WLHA 4R1LA 4MOWA 3DX2A 1Q91A 1KIRB 5CPBA 5JD4A 3DBLA 1VDZA 5LKNA 1BFSA 3HMWL 2BZSA 3DL2A 3T3MB 3ESCA 1WRBA 1OW3B 3AY6A 2B2CA 4LCWE 3SF8B 2WQXA 4G8AC 4FMCF 4LEXH 4Q0XL 4RWYL 4TWAA 2JGKA 1U8PB 2G4GA 1PG7L 2TMYA 2D3JA 4S11A 3UG4A 4BVAA 2X09A 1GVIA 3U0PB 3EXHB 5IT5A 3GZNA 3G0OA 3ARED 2HUHA 3CMOL 3RIFF 3K9LA 4I1RA 3WNCA 2F7RA 4LNRA 3VWKC 2QPTA 1QPGA 2UWEB 3PGFH 5B38B 3U5ZB 3RB8A 2AC0A 3TZKA 1IZ0A 1VZIA 4BMOB 5TSDA 3OKKA 3WGZA 3NFYA 4R8KA 3GJ0A 3P4MA 5CGZA 1G3RA 4K9DA 1DWUA 3AAZA 3KQMA 2AKAB 4F6RB 2LHAA 3GGOA 1CUCA 2CLSA 1BZYA 3GLDA 4OF6A 5DB4A 2OVFA 4PJXF 1ZHNA 1XCQB 1DG3A 4LZKA 2C4MA 4ZK8A 2XZPA 4XMPH 4WLFA 2FQDA 3GEBA 3NBYC 4PTUA 3VXTA 3H84A 3FUNA 4DSYA 1S7TB 4HUUB 4XBGA 3AG6A 2VWQA 3GMDA 4Y1SA 4UVDA 5B4UA 1O9HA 3KB1A 5HJDA 1UKVY 2GASA 3KLQA 1F3JA 4EF3A 4IIQB 4F60A 1NC4A 5FAKA 5T7BA 2XE4A 3KOZA 4ETWA 2ZE0A 2FWIA 4B32A 5CA1B 1K7SN 2P9HA 4KXZH 2WIGA 2QKSA 4O0MA 3HJ0A 4UUOA 1EEYA 5AZEH 3DNFA 4WHTA 3AMKA 4LWQA 2Q7OE 4ECNA 3WFJA 2PJZA 2WXMA 4HWEL 3GSNH 3O84A 4QGSA 4LLDA 4NX0A 4RGQA 3BQ9A 4ETNA 5IT4A 5HFAA 5FTWA 4EDXB 3DVSX 2CLRA 5DHFA 4BTVA 4N3CA 3OLIA 1ZA3B 4XOBA 1RZKH 3W81A 1FTWA 1ZXBA 5B7GA 4O3TB 4ELDA 1SUSA 1XCTB 4NLLA 2EP6A 1EXDA 4GX5A 4XJTA 2A4EA 1FHNA 1D9KA 2ASVA 3JWNH 4S35A 1ODAA 1V35A 1MPAL 5I76A 3QYNA 4DDWA 2Y9PB 3MLUH 3DLPX 1FV1A 1Z8DA 4D0GA 1HOXA 3O3CA 1NAKL 3SDXF 4P36A 4J3OD 3RZWA 3HXTA 2VZLA 1TCCA 5ILQA 3WYAA 5BQPA 1DEHA 4O2AA 5A16A 1ZONA 5TPZD 3BXNA 1TOXA 3ADPA 5GONB 3HW7A 4JKMA 1RWXA 3TNMB 4QRUB 1E0OB 3G6JE 3NHAA 4LMQE 2W80C 3WGQA 2QRJA 2ZOLB 5E4FA 4UHKA 1JLLB 3VWKB 1SK9A 2B2NA 1L4BA 2W0LA 1V3JA 3P2DA 4UU8A 1QYGH 5CVJA 4UQLA 1NFIB 1C3OA 1PDWA 2Y4OA 1S9YB 2RFXB 2V9UA 4Y7CA 4EJSC 3MTIA 2OCIA 1KMMA 2RGYA 4RZKA 3DF7A 1JXQA 3TV3H 3RODA 5KTYA 3WN5C 2XUKA 1T0IA 2PXAA 3LPNA 3LHKA 4KVAA 2NY5C 2X8AA 1UUSA 4GR5A 2G3MA 2WA1A 2QDWA 4MCMA 5H94B 3NTRA 1GQOA 1DARA 1N8SA 1UP4A 2QL1A 2YIVX 5KC9A 2QRHA 1ZS2A 3JVEA 1GHFL 5JXEA 1OEZW 3PF2A 4XVJL 5HDQH 2CDAA 5DLDA 4WU7A 2L0DA 4LHUA 2GJ8A 5DD3H 3ID6C 1T0PA 2HYIC 3QDME 3L01A 1KUMA 2HVJA 3W6PA 3ANXA 4X1IA 1DAKA 5LXTA 5E8RA 3OG6B 1AXSB 3ZGLA 4NZJA 1BW9A 4MYUA 3ND9A 1JYEA 3JZMA 1XTMA 3CX8A 3FH5A 2L8AA 1K9VF 1AQYA 4R1PA 3OD3A 3BXGA 1UWFA 4WZBE 3TZVB 3AHGA 5JPNA 1VC2A 4UEWA 3IEXA 1N2BA 1LB1B 4RFEB 3IDMB 1DQJA 4Z51A 1H5BA 5HIKA 3AHJA 4UFNA 1ZINA 3E1GA 4B45A 4PB9L 2DPXA 1I9RH 3LY7A 3VZQA 9LDTA 3NCYP 4D7AA 4CMHC 4NECA 5ETJA 1ESDA 3F74A 2A83B 1NURA 5BSHA 2ERYA 2FSUA 1G4AE 2RBGA 3R76A 2XECA 2DOKA 3BMOB 1BSIA 5AKYA 2OJZL 2DQ4A 3DHNA 1OI3A 3IH5A 1QF6A 1KVTA 4YMHA 3PNWA 4RCYA 4K9MA 1RQ5A 3BRWD 4JG5A 4CQMA 1EFTA 1XGRB 3JQ9A 3LEVL 5SYMA 4CF6A 4ZCRA 3HTXA 2XZLA 4IBLT 3CR7A 3ECBA 5E2VL 4QPJC 1C4OA 3WKMH 4O4LF 1CFVL 5FWDA 2F9MA 3KU4A 1U8MA 1IUZA 3WNVA 3QI9A 1BOGB 2R4QA 3E84A 3R0ZA 1EO8H 1RZJL 1U98A 4LKRA 1JVSA 1QFWH 5AVTA 5DHRA 1RURL 4Q1DA 2NU9A 1ST3A 3BWZA 1RPJA 1TJMA 4GICA 3SHWA 4PWZA 1WJ3A 3LAFA 1EBUA 5CU5A 3D39E 4MV7A 4WH0A 1BC5A 2QF7A 3WN5B 3CR8A 1HAUA 4X63A 3SDCC 5GRVL 1Y34E 2GN6A 1ZMRA 3QY9A 4D9CA 3PGDB 1EVQA 5C5EA 4YRLA 3ZTCC 5KS9E 2Z64C 4H40A 3O94A 4R7NB 2O5ZL 2OXGB 2YR3A 2XADA 2J3QA 1V48A 5CD5D 4Y2SA 4U7WA 4AJJA 3P2IA 2CK0L 4X99A 2IYYA 3SXPA 2CZCA 3NZ8B 2NYUA 4OZIF 1EWRA 1J8KA 3UBTA 3IWVA 1W93A 3LYRA 2I6UA 4EE2A 1WTAA 4V1CI 2DLTA 4G1UC 2PRSA 5J2UF 3CN9A 3CX6A 3WA6A 4L8GA 3LKQA 4J2HA 4Z7UB 2HLFC 3QFDB 3IEPA 3D7NA 3QE0A 3ZCTA 1UD2A 2DERA 3BH9A 4Q4AB 2AXQA 1E27A 2INGX 4LP4A 1GGNA 1XMIA 4GW5A 1U2EA 3FT9A 5CFQA 5FR1A 2IOMA 5AH0A 1DO8A 3F9RA 1FFNA 4QF1A 2OKGA 1P4LB 1QVWA 2I71A 5H3CA 1UMDA 3T15A 4CMHB 4FFSA 2O8VA 5JTTA 3BT2H 1RI5A 1GPUA 5CDUA 3S2UA 1O6GA 3PC7A 2VZ8A 3ZXUB 4NJMA 2J5QA 5DF0A 4PJ8D 2XRAH 2HCTA 1FE8L 3C98A 5DD1H 1ESEA 1ZH4A 3UTPE 1PTZA 3RVUD 1VECA 3B9EA 1UM4L 1GOGA 1YO6A 3QKSB 4NFHA 2YAHA 4CCYB 3KJ4B 1TU2A 4AU1A 4IEFB 2DFDA 4X8JA 1CZ8L 3W82A 4FEEA 4TUYB 2WWKT 3K72A 1SFDA 3JV5A 4Z7WA 5SYAA 3AYXB 3IAS1 2WIIB 5F88A 2IAMC 4Y5XB 1UJ5A 1D7AA 4UEJA 4DCOA 1EUQA 1SRDA 4UMVA 2FP4B 1DC7A 1E7UA 2HEGA 4U39A 3L8EA 4A8TA 4PFQA 4ODSL 2JATA 2VSDA 3GT3A 2XDQB 3VQ1C 3MERA 5I8KL 5HPOA 1SCAA 4FZVA 5IB1A 1R3KA 3DQQA 3GPSA 3L5KA 4PB0L 4DEYA 1RW4A 4IF6A 2ONZA 1QW9A 2QTEA 2R0ZH 3LIZH 3VMFA 3SDCB 3ORYA 1E1NA 3O1JC 5KJ1A 4N87A 3QNMA 4D9GA 1T66D 4A16A 1KJ3H 4QGBA 4BWVA 2JGDA 3FG9A 4PIPA 4HTFB 3URMA 3PVZA 2X0IA 3O8DA 3TL6A 1EVZA 2X7JA 3Q3VA 3V4PB 4C0HA 3Q5DA 3TH4T 2BMVA 1CF8H 3JWNE 2R23A 3NCCB 4K4KA 4JY6A 4MRMA 2NTEA 1I3GH 1NW6A 1SU4A 5T67A 1CW2B 1VM6A 3CIFA 5E9AA 4GG6B 4BKSC 4PPYA 2YGOA 3BUYB 4LCCB 5AVQB 1ZIBA 3M07A 3PEWA 3U3RA 1X1BA 4EELA 3C6ZA 3VPDA 4X84A 4GI9A 4XMKL 4P80A 3L4BA 4QPZA 4IVNA 3RFTA 2Z8YM 1E7QA 4E0BA 5C0JA 1EGJL 3E4DA 4JQYA 1NNSA 3NCXA 4XE5B 1FL6A 4G8EB 4P4RB 2PUHA 4F8EA 3IDJA 4DH2A 1BECA 5E8JA 4MRBA 4JHZA 3TQTA 1W8OA 2JJVA 2Q9BA 4LVOA 3CZQA 4UCQA 4E6PA 1M7BA 1R9FA 3A6ZA 3UXYA 4F2EA 1D0IA 5J5EA 4OCSL 1IBRA 2XB8A 2JIQA 3STXA 1ESZA 4MWFA 3BIKA 3MGOA 4OH7A 1Y3DE 4DILA 1BVOA 2VTBA 3B2UC 5I1HH 3RJMA 2WKQA 2YXFA 4IEIA 5HDLA 2OK0L 2UVEA 4HGNA 1AI1L 1A7PL 2C2KA 3K8YA 1E5YA 2ZJZA 2R1UA 4JAMB 4NHUA 2R97A 1ZM3A 3WX0A 1JKXA 5EEYA 2IAMB 3ZKXC 5IMMA 4GIPD 3KCPB 1M1YB 3AP3A 3FLBA 4K7PL 1EWHA 3DE7X 4G8GD 2G06A 5BO0D 5LJIA 4FL4C 1PAMA 1RZVA 3PC3A 3NBFA 3BOSA 4HVBA 4M5YL 2GBUA 4G3YH 2NWQA 4PJ6A 2QVKA 1H22A 5H1YA 2ZRFA 3BE4A 4AQEB 5CM2Z 5FNVF 2E8YA 5JJIA 3DBXB 5DHYB 3DFUA 3WYRA 2H11A 2I78A 4FHEA 2YMMA 1YTUA 3N39C 5FWQA 3BVNB 1MB9A 4ZG1A 1H2ZA 1D7DA 1UOVA 4HHGA 1WB5A 3KQUA 4R4BB 5FX3A 3OOWA 1U4OA 1MCPL 2HHJA 2OMWA 3D9AL 5D71H 5I6NA 1U31A 2PLWA 3FRJA 4D96A 1G7JA 3IM1A 4Q19A 1VE7A 1CTOA 2JFCA 4DOHE 4F1JA 4QTUB 2XX0A 2F1OA 2XXGA 3S2CA 4DC1A 4JFSA 5I8CB 2JKTM 2TRHA 3DOSA 3IP7A 4YR6B 3FU8A 1N4DA 1WY7A 3PC8A 1NXVA 3Q7QA 4JUTA 4HH1A 3MD9A 3Q3GA 1FNSA 2XCUA 1SDAB 2P8PB 4KH2A 5JAQA 1IQRA 1XGUB 5C09A 3UAEA 4IRUB 2DQDL 4KTDL 3EYOA 1ZZEA 3GHHA 1VL1A 2QPDB 2P9QA 1HYRC 4D80A 2OV4A 1XLUA 2W6PA 2X6QA 5TX7A 2BVPA 1FBNA 3BO8A 1HZJA 3APNA 4HALA 3VI3E 4IWNA 3QQ3B 4KQMA 5IUNC 2OULB 1TE2A 4AX3A 3V8EA 2DCMA 1BN6A 3D06A 1MY5A 4M7RA 1TD1A 2VL5B 4X6BB 5GGUA 3DUWA 2XIJA 2GKSA 1ZLSL 4RKRA 1FVHA 3B2VH 2C1ZA 2UZ1A 1CICC 2H65A 4XP6L 3BDYL 1TQUA 2A0FA 1ZVSA 5FUMA 2WKSA 1KDPA 2ZBFA 2XWPA 5EKXA 5KSUA 2QN8A 4YCCA 1XQXA 5C35A 2Q3CA 1Z5UA 1K6JA 3NGBB 4RULA 2R0KL 2BE7A 2H3HA 2ONCA 5E2TL 5EUBA 2QG4A 3AQYA 3TA3B 1NQAO 3DVNB 1S02A 3ML1A 2P46B 2HRQA 2W07B 1SCDA 3FZYA 1A9EB 1HH6B 3T5AA 3UIZA 1CG9A 4ZNCD 2AYZA 1SBHA 3ZKXB 1QBKC 1WA5A 1I1HA 2UVFA 5T1KA 4OGLA 2AEEA 3OPUA 1BCRB 2FAUA 4TS1A 4I5EA 2AMLA 3LDGA 3IAAA 1D5BA 4JLSA 1F3LA 3RTQB 3STUA 1XUOA 1V05A 3ULAB 1AQDB 1BA2A 3NCHA 4TLTA 3N8DA 5EJ6A 1WBYA 4TX1A 3EYSL 3WFCL 5E2JA 4CF4A 1EB9A 3GCWA 3TR0A 2F53A 2F6RA 3WNBA 3RRFA 3WE1A 2IZ1A 4KOEC 2F1KA 2VO5A 4LBVA 3QG6A 3GJEB 5JDJA 2QPSA 2DQSA 1DBRA 2HN7A 3MLXH 5CR8A 1KVRA 4XBMA 3UBMA 4C55A 4AMGA 5IJVB 3BAFA 3WQBA 2OLKA 3RPEA 1O77A 3ARBC 5FYJE 4F2MA 3LN5B 4GXUN 5ICZA 4WQOA 3ZIMA 1UOOA 3PITA 3CPLB 1RHMA 5ABZA 1J5CA 5KSPA 3ZE1E 3RB7A 4KVNL 3ROPA 3ZV4A 1I3RB 3BHMA 3OPYI 3D7SA 3OH8A 1ZGGA 3BZEA 2ODBA 4YZFF 3MRRA 2CDGA 1BQ4A 3ZSTA 3ABMB 1N2HA 5TPWH 1GIAA 4HAWA 1HZLA 4DYVA 4OB5H 4BNFA 4FTVB 4BMNA 3TCNA 2IPXA 5K8CA 2A9VA 2PUVA 5ACMA 4PAMA 3WJJA 2JHFA 5CYOA 4ZOQI 4FS8A 3HTLX 2NUTB 5EKSA 1I51A 2C9ZA 1DU4A 4I89A 4NQEA 4OFDA 2EFHB 4RVOA 3LBYA 4YJ2A 2QRLA 3G68A 4GEGA 3KO8A 2W9DL 4LHEA 5D96C 4LWPA 4OBBA 2OCFD 1RYBA 2A1WL 4ZX5A 4GAAA 4BINA 3TMYA 1AQUA 5F78A 1CZKA 5H16A 2QZ9A 3HEBA 5EIAA 3O4LA 1NMQA 4KHXL 3IJSA 5JS1A 2R1VB 2VXQH 4NZOA 3W8DA 4CM8A 1TSRA 4JJGA 3UBGA 3VBCA 5DJ6A 1PFOA 4QAMB 4XVSH 1TYZA 1W94A 4I5IA 4C3UA 3RQIA 1U7WA 3BWAA 3VCLA 4P7FA 4WJKB 3OV6A 5DD5H 1H05A 1CZNA 4FCTA 1V26A 3VXMB 3WY4A 2HUEA 2D6FA 3MCLL 3ESMA 3EFFB 4W99A 1GZUA 4YEDA 3WLBA 4HNQA 4K6MA 3L8GA 3D7MA 2PNJA 5E4JA 4CM9D 4WWKA 5LBIA 5HKOA 3QUZA 3LCRA 3LW8A 3BRCA 2QD4A 1FAIL 4MVJP 2BSRB 2WUVA 1PJWA 4FUQA 3AHEA 4BYGA 4W1TA 2IKQA 4EVNA 4QOJA 2FCBA 3HHMA 2QQFA 2C3PA 3WLLA 4YRPA 2AJTA 1KT2B 1INDL 3TJEL 4MHHG 4LWZA 4A7PA 1X42A 5MDHA 1OU0A 3WDJA 2WIDA 3QAQA 3TTSA 5JOPE 1LK2B 1JWSA 3GRKA 3MRFA 3CRVA 3WHXA 5A4KA 2ZPKL 1ID8A 2ADYA 1SHKA 4LBEB 2HAEA 1A7OH 4ZPJA 5TDOA 3ARBB 3P54A 1A8HA 4IIXA 2E9JA 5DTIA 1GZ3A 3CEHA 4XPAH 5DT9A 1P5UA 4KRMB 1S8DA 3K16A 1TFPA 4NM4H 4R26L 1GQ2A 1GGIL 1BVKA 3D09A 4RMSA 1E0JA 4I5FA 4OLVH 1NW3A 1OT5A 1P80A 2Y3IA 3P4LA 1YVLA 2JFVA 3H9YA 2VDPL 4FGSA 4L5YA 3TIIA 1P6QA 3DGFC 1TAHA 3IU4L 3EYVA 5TDHA 2YGNA 2X0VA 4ALAC 4DMFA 3HI4A 3ITKA 4G6JH 4KQ4H 4PJGF 1LZLA 1A71A 4E30A 3CUYA 4JT4A 1RRFA 1BWMA 1KGSA 3J7TA 1W2WB 2XQGA 3PQDA 3MNDA 5FECB 4U7GA 1XDZA 5E6ID 1UXOA 4K6HA 2V5TA 4L2IB 1SXBA 5KN5B 3VFSB 3O2NA 5C81A 4FTVD 4KYVA 1FF5A 1L5VA 3FX2A 3PKZA 4MR8A 5A3RA 2XNKA 4N22A 2VP5A 3WB0A 4AN0A 3DV9A 3UJTH 5DGRA 2CJTA 4FI3C 3EGVA 2Q76B 3E03A 2I4MA 1O7JA 4JO2L 3TNNA 3N0TA 3BMVA 3DMRA 5DMYA 1QIKA 3NAZA 3IULA 1XSOA 4HX1B 1ISSA 1R3HA 2IP2A 5HFJA 2HSGA 4KR3A 1NDUA 4QAQA 3OE7D 3T5PA 1BHJA 1A9YA 3WNZA 2A6JB 4AUNA 4XNUH 5I0XA 1II0A 1BBJA 4OHBA 1SNRA 4UQPA 1M10A 5IB4A 9MHTA 1FMLA 4KRYA 4G4GA 3PF8A 1SUFA 2AXEA 3KTOA 3HZVB 3ZBPA 4M1KA 3MS7A 1FW6A 1I3CA 3ZZMA 3UJJL 3MROA 4MQTB 5TEWA 1MRFH 4I5DA 3TT1H 2BMFA 1Z5LA 1AS7A 1EHCA 2BHRA 5AK5A 1NUGA 1KFJB 3EBLA 3SN6N 2KKQA 2VH5R 3S3JA 4E5VA 3N8NA 2OZ4L 3V4UH 1DUYB 1IL1A 2V45A 3TTTA 1JPSL 3C6SA 2RGNA 3TW0A 2G4EA 2Q50A 2ZKLA 4J3FA 4PYKA 3INOA 5DASA 3OR6B 2FW1A 4C56B 4O2BB 4XSHA 1I7ZB 4I1YA 2LW3A 2XMSA 1A47A 5B57C 5I6OA 1GA2A 4YHIB 3BUSA 3G9QA 1NG9A 2Z31D 4MEBA 4RHCA 3WDIA 2IZ5A 2JF1A 3QPXL 3JARA 2NNAA 3PXDA 1EAOA 1RRCA 2D2IA 2K7PA 1V1RA 1U42A 1T9AA 1WEJH 4AQAA 4FNQA 4AZVA 5FLEX 4K9EL 3B70A 4YMIA 2VYQA 3ZHQA 2B59A 1YMMB 3LFTA 1WZCA 2X6AA 3S2IA 1O75A 3U4EA 1VP9A 4JQSA 3TBSB 2YHBA 4K3DL 1FYVA 1GZSA 4YV1A 4A6YL 4BHTA 4UC0A 4KJZA 2QE6A 5DTFA 4EAEA 2TRSB 2XE6A 3MTBA 3GRUA 4LASH 2QGBA 4EG6A 4OK5A 1UAAA 3QH4A 2IV9A 3GQBB 4Z4GA 1Y4SA 2P5WE 4XGKA 1CGSL 5E99L 1P7ZA 3L0BA 3OQ6A 3UMFA 2WMNB 4WHCA 5DQJB 1HDRA 2QTRA 1HZKA 3C1AA 4Y4KA 1CE1H 4DUXA 4NC9A 4GUPB 4YAIA 2OFFA 3HGMA 3RRNA 1LA2A 3K2KA 5CEYA 4QHKJ 5AL0A 2A1UB 3IESA 4HDMA 4NPYA 4RH1A 3UWKA 4AUMA 4MV8A 5BSWA 1Z7JA 1XHFA 3ANLA 3RIAK 5HHPB 2J32A 3U4KA 1QLFA 4U6XB 2V3CC 2RALA 4TV8A 4KTVE 4LDNA 3PR1A 4RQTA 1T25A 4D9RE 1HQKA 5EU6B 2OSBA 5AAWC 4L8BA 4QX6A 3G2IA 4OUUA 4REQB 3WA7A 1GA1A 1CGYA 1YA8A 1DBKH 4KDFA 2CJPA 1SUDA 1YZLA 2FSHA 3CBJB 1SPXA 2QBYB 3L7FB 3W0WB 1BWPA 3HE6D 1QHOA 3BMQA 2DFLA 1XD8A 4ID9A 3WO4C 1UGKA 2RG1A 2MQCA 3ES6B 4MS4A 5C7YA 1D6MA 4DGQA 1RQNA 1H9VA 4L07A 1ACYL 4AITA 5F1OB 4IIHA 1FP6A 1YBMA 2YQBA 2WWIA 1BW8A 4WY8A 4RHUA 3VR0A 2WTAA 5BRJA 1P77A 1TAGA 4WDQA 1TMQA 3SIWA 1YA4A 2WF5A 3ABSB 4KYIB 4CVXB 3WI9A 2ZIZA 3NT2A 1ZLDA 3NKFA 4G1EA 2VDML 2VSKB 3GVCA 2II6A 2V2TB 1X4ZA 1N34B 2ZYUX 3RFZA 2DX7A 2CHZA 4C56D 1X5FA 4E9VA 1J4AA 2WYIA 4KY1H 2XQJA 2JL1A 2DQYA 1I8IB 1DQRA 4HN2A 2AK4B 2QFRA 2W9XA 1IIRA 4GSDH 2IQAA 2L7QA 5TDNA 4I50B 5LSAA 3A06A 1YNTA 3T1FB 5JSZB 2CD0A 1RT9A 1I8MB 3DFKA 3NTXA 1V8ZA 1JGDB 1S6YA 3QKUA 1T0HB 1T5WB 3C0KA 1CXEA 4N6RB 1I8LA 2RAPA 1XCXA 2QX4A 1T3LA 5JNWA 2BNRE 3NTQA 4IMRA 1YQXA 1H0SA 2B1HH 1UK9A 4YJKA 2RARA 4JB8A 4DIXA 3O38A 1XZIA 5KSAA 1EK6A 1I4TD 2ZBEA 2QU8A 4B6QA 1USQA 3U1QA 3AEUB 4IDOA 2K45A 2WSPA 1DJPA 1I7NA 2EFYA 3MOGA 1QJ4A 1U8ZA 4PNPA 1XR9B 4NJAL 2PMDA 2EFCB 1QEWB 4H0LC 2NZIA 2V7QD 4RGNE 5FYKD 4EY7A 1GLNA 1HDYA 5FD8A 4HMQA 4M4PA 5BRZE 4ZHQB 2VJ8A 5DS1A 4F11A 1T2QL 4KTGA 3ZCVA 3SKMA 2MYPA 1GNPA 3IRCA 4FLOA 2JK5A 5AVWB 4P0DA 3VWJC 1L8AA 5FKPB 1ZICA 2A94A 3N6RA 3L4WA 4CKYA 4HQFA 5D9SB 1JK8B 4XPIB 5L3QA 2BH0A 4G7QB 2Q0ZX 4DNXA 4RD0A 3NCFB 2KS0A 3ZSSA 3WO4B 5EU6D 5C92A 4BE4A 4G59C 4F5CA 4PD4K 1N6OA 3KYOA 3KX2A 3D2TA 5B1SA 2JGFA 5EJ5A 1N7MH 4MWTA 2QTNA 1Z0FA 1XZQA 5CKAA 4B3DA 1G0NA 1JFRA 4QHLA 2YS4A 1QZTA 1IGYB 5CDYA 4CN4A 4OJQA 1SYVB 3L1GA 2CE2X 3G2NA 4J7CA 1FCJA 2VSYA 5JIHA 3FK3A 3OQVA 1LE5B 3QPQC 2B7DT 2WABA 2WHEA 4AEIL 2AUMA 3W8EA 3SWWA 5JXJA 5T4BA 2IWKA 4I3GA 4YRRA 4JR9L 2ED8A 2QP9X 4XJSA 2C83A 3QUCA 3FMGH 3WO1A 1FIUA 1XK6A 4BMCA 4TSAH 2V5RA 3I73A 4HUWB 2J31A 2VSCA 3BUIA 3FFXA 3PWNA 4RHEA 1T35A 5IAJA 3UERA 2X6RA 4FFWA 3QYFA 2FLMA 2DCUA 2YQ4A 1SZJG 4M0UA 4QULA 1TECE 4Q1AA 3HZMA 4K9NA 4MI6A 1CT9A 5FS5A 3QXDA 3VFRA 2CUZA 4KXXA 2CCJA 1M2OB 3AUVA 3CRNA 3CZ5A 4LEOB 2FPUA 4K5LA 4DAOA 4IRSA 1TA9A 3A6CL 3LDUA 2YUIA 3I9PA 2I29A 1CGWA 3SHFA 5E6UA 2RA1A 2QVMA 2H9AA 1QS0B 2OB1A 3IHTA 4HDRB 5LM3A 3T7JA 3HZYB 1M0EA 1LW7A 2AE1A 3JR3A 2YN4A 2YAOA 1LDPH 5HHME 3EO9L 3GAFA 4WRLA 2QI9C 3WBFA 3B5EA 5AUMA 1CMOA 3VFNA 4INOA 5ALRA 1LO2L 4PLKC 3IDAA 3DEJA 4C4XA 1Q1AA 4TVOA 1AHHA 1WUHS 2PBZA 3WLTA 4W9HC 1OOWA 3VRLE 5A2IH 2J5LC 1Q9LA 4QXUL 1QLEB 1DUSA 1KEUA 1U1IA 1SQ2N 1OARH 2X1MA 2D0HA 4HRVA 1NM5A 4P22A 5IHWA 5HDQA 4GW3A 4MNQE 3L4ZA 3I1FA 5HK9A 1PNCA 3MSXA 5H02A 2NY2D 1JPFA 5HKBA 3D6TB 3G0HA 4QT4A 3H7BB 4MNTA 2Y1LA 2HX8A 4HV8B 5KOVC 1B6RA 4Y89A 1UCBL 3E05A 2O8EA 1KZQA 5HCNA 1D4OA 3CN1A 3PREA 4YDHB 2FQXA 5EIIA 4RGOL 1SU7A 1ODLA 2W81C 3U2IA 4BIIA 3LS4H 2BFMA 3P2JA 2Q5OA 1ZC3A 2ACWA 1NVUQ 4NO0D 1RZIA 1FTYA 3RVNA 4I0CC 3U1TA 2N3ZA 3P0RA 2E4XA 1PFCA 2X2UA 4KO5A 2CT8A 1CFMA 4P2QB 4JHUA 7REQA 2R751 3B2NA 2FFJA 4MUYA 3IE1A 5J1AB 3RS4A 4LGPB 1MX3A 5KBDA 3JQGB 4Z0BH 4OF4A 4A0RA 3AVOA 3C3DA 4IU2A 1HQRA 5CSGA 2VT2A 2NTNA 1CU4H 1YL5A 3OFKA 5GV7A 4AXXA 4ZEMA 3NVQA 1NGWB 3SS7X 1Q84A 5GSRA 1EPUA 2VSMB 2R4RL 3H11A 1RS0A 4QRTA 5FFMA 1IKFH 5C0AA 2AFHB 5LN4A 3EG9A 3Q9LA 1C3EA 3NHZA 4LFHG 4A82A 3LAWA 4R1NA 4HU2A 1ZGLP 1F6WA 1SCUB 4FCVA 4IW3B 5DYOA 1E2HA 1QE5A 2QTTA 3E3AA 2G0KA 4CMIA 3WDMA 3F6YA 4HCRH 2BS71 2UY6A 1JZ4A 3PFNA 3I6LD 1N5RA 3W9UA 5A5DA 3DVRX 5CM9C 2DTML 5AKHA 3S36H 5EIWA 5SZJA 3HY6A 2YXWA 4XA8A 1KTRL 1HHJB 1PUJA 3R5HA 2PYIA 2QG9A 5LNEA 3GTTA 2J5LB 1GLVA 5IH7A 1MZZA 3A2MA 1C08B 2Y06L 1FLAA 1GRVA 4FI6A 1HEIA 1FZJB 1XMOB 4QTYA 2OLJA 4Q7MB 5FOSA 2WPGA 1OASA 1LC0A 3D2LA 3NJXA 2Y0BA 4IHJB 2ADIB 4ZUSB 2D7PA 5DTJA 5C0CA 1TZBA 1SY6L 5CCDA 3IT0A 3R5SA 3MV8E 3ABZA 5IVXF 3SDDA 1YCDA 1ZP6A 1EO5A 3WL9A 5EO1B 3TBYA 1IGTA 1KBBA 1N0XH 1T91A 5D2CA 1UACH 2W6OA 1O5DT 2AX4A 3I50H 3ZZQA 2VS1A 3CZFB 5DS8A 1YV9A 4YCDA 5JYEA 2H6EA 1MWOA 2DHCA 4G42B 2K9FB 5L3SA 1J8RA 1JXJA 1BVYF 3VZDA 1I3OA 2JIRA 4HNHA 4OHRA 1K27A 1PQZB 5E6SA 1UMBB 3SDYH 3AVWA 2QQNL 3U39A 3H16A 2X28A 4N8SA 5DJDB 2D7OA 2UZ0A 4DMUB 1MWAA 2AYXA 4B3MB 1WSWA 2Z2ZA 1FVCB 2IXGA 4P2QD 1GPYA 2IV7A 4K2UH 2RB4A 3K0FB 4ZS6C 4PP1C 1KKLA 5FM5O 4NEGA 3SD5A 4KO4S 4HG4J 5TK4A 3VD9A 1P2UA 4HBGA 4TKUA 4XXWA 5ESQB 4LI3X 4QYMA 5IGXH 4W7SA 1MJ8L 3CCHA 3M2TA 2DJIA 5CEZD 1XA4A 3RF7A 2RBLA 3WJ7A 5ANME 2E0PA 4Y16D 1KIFA 2OGWA 2B20A 3CJQA 2NX5B 4DKDC 5JQ6L 2QJTA 1KTJA 2I9KA 2P80A 2ZB4A 4AZUA 3QB7C 4TL7A 4BGEA 3ZKWA 2F58L 3GZQA 1SEQL 2FJFB 1XDTT 1OLLA 1S7VB 4JMLA 3IDXL 3RNQA 1FG2A 5HGBA 1N3NA 1ACCA 4CNQA 5FADA 1Y6GA 4OHYA 4LSTL 4IDCA 2YZMA 1JEYB 1LD3A 4BNZA 5EG5A 3G6DL 4MXDA 4ZQFA 2Y67A 5JXWA 3W11C 3K4ZA 4RGYA 1A4CA 2PKXA 5KI6A 2I2WA 3G79A 3CHQA 3UOWA 2MSDB 2A78A 3NTOA 1GDTA 2QPEB 1N57A 1EFVB 1S7CA 4RIIA 1YMUA 3K2QA 3QPKA 2CUNA 2DWEA 4A03A 1ZRSA 5JDCA 4MS1B 3UTTB 2ENPA 3JWEA 1IC7L 4K9SA 2EDYA 1Z4QA 2VJQA 4XLLA 1Q77A 4EXPX 2G9QA 4GKJB 3NO4A 1UXJA 1XRMA 2IH3B 1E7VA 1UKZA 1A4AA 3TJPA 3GFRA 4KK8C 1TJIH 2E55A 2GITA 5J8OA 2K3TA 1JRHL 4AYTA 3CLTD 4AQ1C 3SF0A 2IEGA 4KBFA 5ALHA 2HC9A 3QQDB 2RB8A 3L4EA 4H6VA 3OQNA 5ILTL 1UXWB 3USES 3VGPA 2B4CL 4PLTA 2JJ8A 3WZMA 5BYKA 3MBEB 3EIXA 1O97C 3V4SA 1Y1RA 4EL5A 1MHEA 1WZEA 1YGYA 2X15A 3LYLA 2X4UA 4RTQA 5HILA 3SPXA 3KPSE 1BYUA 3L6DA 1UKEA 1JZ8A 4OD2A 1E1QD 1KJVB 5I1LB 1NYTA 2PGAA 3PQ2A 1MA3A 1VRCA 4FWTA 1ZL2A 1BEZA 1UMCA 2WIAA 3SQMA 3C2AL 3RG1C 1GOFA 1CXFA 5DJYA 1DTEA 2DBLL 2A7QA 3F2LA 3C6BA 1AAJA 1RR6A 5IKMA 5E5UB 3FNFA 2CRMA 1KMQA 1IY0A 1N7IA 1DVFC 3BEOA 2IYSA 5D7IE 5G1OA 3VR6H 2XN9D 2OR7A 3TVMC 3UMTA 4C54A 2DQFB 5DX0A 2C3UA 1CFTB 2PKDA 4Z78B 3CWCA 1B2RA 3CU1A 1TZGL 5K69A 3SJZA 3TCXB 5K1JA 4C22A 3AHFA 2GK4A 1M53A 2NU7A 2DQEL 3T1OA 1P7KA 4A7QA 4GUOA 4N7JA 4XFDA 2HU8A 3U82B 2EC5A 3IAPA 2UY7B 1GLGA 1GCGA 3OETA 4FMCB 3ZWCA 4Q47A 1YB2A 1HEUA 3TQRA 4F27A 2EICA 1RWWA 1LJUA 3K31A 4DREA 4TQHA 4HDAA 5BV2P 2VJBA 2PUDA 2AQ3A 3L2OB 4P5DA 4H35A 2HT3C 3T6ZA 3E5NA 3Q9NA 4NN7C 3UZUA 1C0PA 1P84J 3EDRA 5D5ME 1UWVA 4IRJC 4JJAA 1X5AA 4AYDC 2F48A 1TKBA 1TENA 4KDWA 4JFQA 3DOFA 2OCKA 4JDVA 5BVHB 1IB0A 1U92A 3CX2A 3SDAC 5M7QA 2BSAA 2BN4A 3S2EA 1C7SA 5T1MB 4EEXA 4FG2A 4MS6A 4ZO9A 3VH8A 4NQUA 3X12B 3QKWA 1QOKA 5EUOF 1DSYA 1GDDA 3PJRA 4M89A 2GBVA 5LCVH 2JI3A 4D79A 1ZK0A 1J8MF 4PJXB 1OIOA 3UCQA 1W36B 3GSUB 1U8HB 3UTTD 3ECCA 5BUSA 2FPMA 3GRWH 3DROB 4K15A 1EM8B 2O1EA 2Q0XA 2W2MA 3DR5A 4IDFA 1D8TA 4KKCC 3EDCA 3TBWB 3MFQA 3J81A 1DIGA 3TSWA 3T1HB 4QG7A 4Z8XA 1BSVA 4ZU1X 2HAZA 2H8PA 3GUFA 1FNEA 5B53A 2CJSA 3VNZA 3PI6A 4BFUA 4CLRB 1JG4A 2IU0A 1ED3B 4AQZA 4Y8VA 1WXHA 4Q9CA 2XZAH 2ZT8A 1SURA 5GS0L 1DDTA 1P39A 4S2UA 4GBJA 4NABA 1K63A 5CIPB 4DQXA 3DMFA 3J2PA 1QQDB 2Y72A 2CO4A 2OL3B 3BP6B 3JTTB 3T8XA 2FPSA 3IQZA 5SYNA 1O7VA 1TYAE 2PXYB 3U7WH 5BQ7B 3QOYA 3STBA 3MBED 1GV0A 5CXUA 1FFCA 3WMQA 3BHNA 4AP5A 4XR4A 2CUHA 2Z8SA 3W3AD 1I85A 1XTSA 3QKRA 2J7PD 4E5DA 3PCYA 4YFDB 3EXIA 3N70A 4UD2A 2BOCA 3VDRA 2J3IA 5KYGA 1IBYA 1KXJA 2G63A 1MCNA 3DXAB 5AW0B 3DKPA 3B37A 4WFGE 1RAHA 1G0YR 1R17A 3D7LA 4PTTB 5IBUB 1A1OA 4PG6A 3G5AA 1A5FH 1UINA 5EZYA 3TSAA 2XN0A 2WFLB 3OXRB 4WCDA 1RLIA 2F8OA 2DR0A 2AFIB 5DWUH 1PLKA 3B6ZA 3C8KB 4Y4FA 2FOLA 4XRCB 4O1HA 2J4WH 1W85B 2Q9UA 1DQQA 1EUDB 4DK5A 32C2A 2HLNA 2P6UA 1WOMA 1A8JH 3OUZA 1OGAA 3NJHA 1H1LB 2AK2A 4GBED 3SDXB 4UHFA 1W9HA 2XNJA 1RHJA 2F59A 3ARFB 3WNJA 3FTWA 3W37A 2XBLA 3NUQA 4UNQA 2O54A 1CN4A 1I53A 3HNOA 3ZE6A 1QKZH 4NN7B 1A3LL 4XARA 5T5NF 4TLDA 1U5AA 2G9HB 1T9CA 3M4YA 4GXRA 2I76A 1FCCA 4EXKA 4IRJB 4IG9A 5CHNB 5D00A 2ASEA 4MUGA 3SDAB 3AM5A 2LR4A 3FQTA 5JMWA 1M34E 1N70A 1MVFA 1EG2A 1NI4A 5B3NA 1E3LA 1G7MB 1U3GA 1YJCA 4YSUA 1ZSYA 5LQDA 2DQCH 3EJYD 5EMNA 2HT4C 1U9ZA 3LQYA 4ZPTA 4X93A 2PABA 3RDTC 3OJMB 4TNWF 4YBLB 4NCIA 5MEOB 1YG9A 1AR1B 1KXQE 2A7XA 4EFLA 4URYR 4WNAB 3SYTA 3MNZB 4BU0A 1FDLL 1NMCC 3D3VA 2W6JA 4RC9A 3O6MH 1GU1A 4E5NA 4GEKA 2CFCA 3P2BA 2FPXA 1ISRA 2AF2A 4EY8A 1K72A 1CIJA 2VN3A 2P9EA 4GVPA 3EKCA 4H88L 2YBRA 3GSQB 3FPFA 3DX3A 1AZVA 4ES9A 1PLAA 2E6JA 3VB9A 1MQSA 5I4CA 2WFMA 2DLHA 1YB7A 3T3EA 2JLAA 3CS3A 4QUKA 2ACEA 4HX5A 1KBOA 3MNVB 3LYAA 5TMEA 3I2YX 4KMOA 2NMSA 3GNMH 3DSFH 1BD2A 2WJAA 3NHFA 1JNNH 1TMGE 2QVIA 4DSAA 2WWMC 4PYGA 2PXYD 1OAAA 5IMSA 4X50A 4N0PA 4Z4EA 1MNUH 4PJ5B 4GAGH 4Z4HA 4BFCA 3B56A 5CNMA 2OORA 2NTYC 1E6OH 3GFPA 3GXBA 5CDFA 3QO1B 3QF7A 1UPTA 3JYCA 3MA9L 3FWPA 2I80A 5DBFA 4LXGA 1NCBH 3BFKA 4CMBA 4W63A 1M05A 2AJXH 3EPPA 2Q2LA 3AFIA 4BX2A 4DUVA 3F90A 3C60D 1R5NA 1CR1A 4XYLA 2CHDA 4ARVA 1Q1JH 3IGFA 3B1ZA 2JGLA 4O4LB 5K59E 4TSFA 3NPSC 1HS6A 5HSGA 3QH3A 4L78A 1AZNA 4JR2A 3TK1A 4XLZA 3HXLA 1J9TA 3FAWA 1TUBB 3QC6X 3KB6A 1J0ZA 1VHTA 2H4XA 3L1EA 5GTDA 2IYFA 3HACA 1TXGA 2AL7A 2AQ2A 3I6MA 4TRJA 2VJOA 3ARFD 4B5LA 3BAEH 5IB3B 1F9AA 1BDMA 4N2KA 3FA2A 1WAMA 1MMFB 4WZAE 1RDFA 5AQEA 4GRDA 2DY1A 3ZE2E 2VAWA 1JS4A 4UD6A 4ZI3A 4BNTA 1E9OA 2FEJA 1BOFA 4TTJA 4BH8B 1U1GA 4HS8H 3W4JA 1E28A 5FIEA 1L7IH 4XPHL 2B8NA 3MCZA 2J3JA 4PVMA 1OQOA 3MU3A 3TOXA 3C9NB 2I5YH 2CGRL 2I07B 2PHZA 1F06A 4NWIA 4DQOL 3P3SA 4CR6A 5D93C 2KH2B 5J12C 1HL5A 2YK1H 4OZIB 1BXRB 4M3HA 3FOLB 1J09A 1N1GA 2XT6A 4RSMA 1USZA 2BP8B 3TCLB 4OLZH 1AR1D 2Q20A 3BN3B 1GNSA 3OVUB 3DAGA 1Y37A 4FYHA 2GK2A 1NBVH 1YH3A 5CCGE 2OGUA 3ZJ4A 4FEGA 2NCEA 1XEUA 1R0YA 4CF7A 3WIIL 1OE0A 4LQFL 3M17A 5C08E 4QBTA 1SLWA 3TTWA 2ZWOA 2YDXA 3E35A 5FA4B 1Y5IA 2MNUA 4YHKL 2I60L 4KK4A 2ZDGA 4JLUA 3LPPA 4GW1A 4JUFA 2HBQA 2PSEA 3DTTA 3AREC 1JNHA 4Z3IA 3TM6A 1W72L 1XR8B 5CLTA 2OC9A 1QORA 1LRLA 2ZRAA 5CSZA 5FV2A 1GGUA 4IVRA 2V17L 3W39B 4IL5A 4C4ZA 3CO0S 4IMLB 1HC7A 2ILTA 3F6CA 2JGRA 2V9CA 5J5AA 3ARGB 2C4FT 4P9MH 3E53A 4DPBX 5D51S 1FA9A 4H15A 4L50A 4MXQD 2X89D 1DLFL 4PJ5D 4UU1A 1ORWA 5FWXB 4WW1B 3ZW7A 3F04A 4MGXA 4CVZB 4JODA 2BVNA 3M1IA 2ZIXB 2QQ0A 2XHEA 3ARQA 1QSEB 43CAA 1L4HA 1EEZB 35C8L 4G6KH 4LK4A 4ZC8A 3W0LB 4HZUA 4MAAA 1TLTA 5C0NC 2QROA 1L4MA 2R8RA 2Z1KA 3C6EA 1EEUA 3VRJB 3U6KA 2V0NA 4XX1A 5KOHA 3VJ6A 1CP2A 3NANA 4IYKA 3EUUA 2J55A 4DCQB 2A30A 2DL2A 2KI5A 5D5PA 1E2FA 5ALBL 1V1MB 3C48A 5LD2C 3NH7L 4EYKA 4QMEA 2DQHL 4QA9A 4POZD 3UXFA 3LNIA 4EQ6A 4LSUL 5HP5A 2BIHA 4BBZA 1Z7YA 4QHMA 1WFMA 1NMAH 1AS6A 5ALCH 2YIHA 3AVQA 4FSXA 3SBQA 2IDMA 4TMXA 4N40A 3AB8A 2FEPA 1V11A 721PA 3DWEX 4RSHA 3K3QA 4OJYA 5CN1A 4NBSA 5DRNA 3H3FA 5D93B 4R8LA 4EENA 4J91A 4Q6WA 2UXCB 1CDJA 3LUDA 5FYQA 2A86A 4LE0A 4YH6A 3UPRB 3G7TA 1C7FA 3TQSA 1EZLA 1S9HA 1WL8A 5A7BA 1UB5A 3U9PH 4RPLA 1RHHB 4J3OC 3RWJB 2N0KA 2EQAA 3NAAH 1P2VA 3KETA 2N0SA 1KBGH 3I83A 3UWSA 1U3HB 2YMOA 4YLQT 2HIGA 3RBXA 2X0DA 5AW4A 4XCVA 2X42A 3OKLB 3L1OH 3AREB 1WCWA 2JXMB 4PWIA 5EKTA 3U7IA 1PSDA 1ECJA 1WPCA 3DD1A 2RGEA 4YAUA 4UT9H 1U9IA 5I15L 5L9DH 4GG8A 3KGSA 4YEEA 1MOSA 3HS0A 1DAMA 1AKQA 3S3TA 3PZBA 3X1KA 2F7OA 4ATNA 4HY3A 4Q6KA 1OFIA 1FU7A 5L0QC 3BGWA 4B74A 5GRXG 1Y8QA 4PN6A 3O41A 1DL7L 3RC3A 3HUTA 5C3LD 4YPGA 2QPLA 3LKSA 3D08A 4YUEL 1T4GA 1HKHA 3NJ4A 5A2LH 4OXYA 1HT3A 5ITBH 4ID3A 1RZUA 1P73A 2LU3A 1S5PA 3WKCA 5IEHB 5D2LE 3PIIA 5GM1A 3GXDA 3ARGD 1C1XB 3TD2A 1BQHA 3LA6A 4EZEA 3HJRA 2HWZH 4OZGA 2RHLA 2IDKA 4B7UA 2G60L 2JS7A 1HL4A 2XTJD 3S2SA 2ZSAA 3FKQA 5K0CA 1QSED 1TK2A 3WLJA 1D1PA 3GMOB 3BFJA 3CSTA 1Q12A 5LD2B 4JJHA 5FNVB 2AJVL 3JTMA 3RFUA 1N7HA 2HA3A 1NFDE 1MFMA 4JELA 1YEJH 1G9EA 5GS3A 1G7IB 5C37A 2AQTA 4QKQA 4Z7WF 2K6GA 1L1QA 4A7TA 2FK9A 3GBMH 5HVGB 1KAEA 3NTCH 3PAVA 4W9FC 2WXHA 4RPIA 5BNIA 1U91A 2QN1A 5BS0D 4JYBA 4PNZA 2WXLA 4B1FA 4YE4L 3O8OB 4C4OA 2DWUA 1MCRA 4XPGL 1U2TA 1CJKC 5F76A 1TCRB 1PG7W 3TV8A 5FPTA 1V7QA 2KYRA 4QEDA 1EVTC 1OTSD 4CKQA 3EB9A 3AVPA 4BFFA 1XGTB 4P98A 4CC1A 3O6FA 1LO5A 2QX8A 4XB7A 4PGZA 1T1ZB 1TEFA 3G5XB 3IP9A 1U1DA 3KBBA 4MVJI 2YJZA 1L9RA 4RF2A 2C9BA 1PJCA 5IFAL 4K71C 1IWBB 1G4UR 3THXB 5F64A 4MQMA 5B3SB 3SJVD 4UTBH 4AF6A 2BP3A 5I74B 4LJKA 1N59B 3HVNA 4M1DH 3L7YA 3QITA 3IC5A 2OFWA 3JT2A 1KCRH 5JW3H 4KAQH 3EDQA 2QR2A 3OTHA 3H1FA 3EPHA 1CS0A 3BG5A 1U3HD 4FB5A 2PUGA 1YY8B 1ADFA 2Q6LA 3P2YA 1JEAA 3AF6A 4DMRA 4QGFA 1LC3A 5L0QB 3TF4A 2X7LB 1PEWA 3RWEA 1I8UA 4CDMA 5A7GA 1N1EA 4O29A 2HSWA 2WHVA 5DJ2A 3L0DA 4RSRA 1LDGA 4R4FH 1QH1B 2AC4A 3QSGA 3SZKC 3WU1A 2EXWC 4X5WA 2IG2H 3C8HA 3GXTA 2GN1A 4HD8A 5ES3A 5CD5C 4I18B 3BGDA 4YSOA 1XGZA 1ETZA 3RWOA 1WD8A 4BSJA 2I7XA 3UYOD 1O03A 2F9LA 1ISMA 1N8NA 3KEGA 4XVTL 1O6ZA 4B3GA 2VLRA 2J1ZA 4MVCA 3QF4A 4P4KA 2OP4H 2OFXA 4HDSA 3K9FC 5JUEH 2NIPA 3FCCA 1L5RA 4K05A 2OCAA 1ZRUA 1TX4B 4LDZA 1KP9A 3BKMH 1CS4C 5E7IA 4GKBA 3I6QA 3SHVA 4DKXA 3CFIC 2RGCA 2QX9A 1AZSC 2QUAA 2C1OA 4R9HA 4UU9B 4QLBA 4LXXA 2WF9A 1MLCA 4XB6B 1G1YA 4ZFQA 1U0GA 3ECAA 1YEHL 3KGTA 3ZD8A 1JK9A 4UOQA 4FYJA 3EHDA 3TDNA 1HDMA 2GK0A 3TZVC 4JRWA 1FNCA 2O23A 1UENA 1W5BA 2WT8A 3G8YA 3L7BA 3SSNA 4PJ8C 5H9WA 2ZOKA 4IDJL 2CV1A 2AHIA 5FUCC 3PR2B 1DO0A 4HJTA 4WZZA 4Y4HB 2H07A 3RVUC 5C0GA 4PO1A 2EYSA 4LMBA 2NXNA 1QR6A 2J1XA 2YFOA 2ESVE 1MOEA 4K71B 3BA1A 1YEKH 5DGCA 2VK1A 3B78A 1VPWA 4PRHE 4N9WA 2JVUA 4NICA 1CF4A 4NBUA 4EYOA 3RC2A 5JALA 2CNZA 2JB5L 3HB7A 1DDIA 3PDCA 2VIIA 4BQ6A 2HYDA 3QUKA 1T0UA 3MMZA 1U2SA 5AW3B 4ERNA 3LNHA 1DXQA 1BEYL 4UAGA 1AHWB 1W35A 4QIHA 1LBIA 3U7QA 4HX2A 4HS6A 3C97A 4AY6A 1GGCH 1ZTXL 4WCYH 4MYTA 1IVYA 4U1LB 4MZ3A 5FUYA 3KLNA 4NAJA 1M6EX 2HA7A 4B6EA 4JJEA 1A0QH 2REOA 2KLTA 4F8LA 4OFZA 2WBKA 5ILOA 2ZUVA 3EH5B 2VWEC 2OSVA 2NY1D 3K1DA 1RFGE 3GNQA 3LKVA 4Z7VA 2QN3A 1T66C 4O02B 4E5YA 1KI9A 5IQ7L 4J1TC 1S9WB 2I6SA 1E5BA 5L8LB 2GCYB 2VAXA 3FMFA 1GTNA 1J5EB 5JD6A 3SGDI 1E4XH 1E8ZA 2HEIA 2HA2A 3A2LA 4U7JA 2I8LA 5EP2A 1YDHA 1OSPL 2EE2A 1PT9A 2XTLA 1M2FA 1L5QA 1A4XA 4MPRA 1KYOJ 4PM4A 1H6DA 2I2BA 4V24A 4ZYKA 1PS0A 2VTFA 4MWBA 4J4PA 4XCFH 4N12A 4PIBA 4S1OA 5AW1B 2IIPA 4HT3B 2VZEA 2OO5A 4JQXC 3RG8A 4F7DA 2R5NA 4US0R 1VFBA 4JRYE 3PDDA 3DX7B 1RZ7H 3DGGB 2OCYC 4B9CA 1QAWA 4Q1VA 3SK0A 2ZJSL 4NCDA 3NEEA 2R47A 4BM7A 621PA 3P2MA 1Z6TA 2C3MA 4AXWA 4F2WA 5LQUA 4PJ8B 1DKRA 4RLDA 3KQSA 2JG3A 5IG7B 5DYYA 3F64A 4D8UA 3NYWA 3RFXA 2JLSA 4X7DC 2DPKA 4J5VA 4X92A 3DXYA 3WQHA 3SLKA 3OZKA 2JH2A 3ZDDA 1TYEB 3GSVB 1OQAA 2ZJ3A 4W9CC 2KHZA 3AHIA 4R2MA 1KLFA 1FVEB 3GMRA 5AI8A 9GPBA 3HYRA 4UQDA 4Y4HD 1PT6A 1GG8A 4B0PA 1V8PA 2MJLA 2YXVA 2QIPA 3RYIB 5B2EA 3NBAA 2JWHA 4MIKA 1UBCA 3KJ4C 1WHTB 1VBFA 3CN3A 2YN5A 2IO5A 3UROR 1UJMA 2JCSA 1EEQA 3FKUS 3FONA 5JAIA 3QRLA 3I42A 5HYQA 2D4DA 4ARBA 3DKVA 1VFUA 4M3JA 1WGOA 2AABH 2J2ZA 4Y5XC 3FUEA 4C57C 1EB8A 1HL7A 4Y6GB 5E9NA 2L4OA 4GNKB 1ANKA 4M1CD 5ICYB 4ITUA 1WQVT 1G7QB 1P0FA 2EF1A 3JALB 3MV11 5K0LA 3K7UA 2IKSA 4O3MA 2JHGA 2FW6A 3EC2A 3FPAA 3CJTA 1I1NA 3THYA 3QUML 3W6NA 5KANI 2R7AA 1TXKA 4DBLC 4HKJA 4CEHA 3OT1A 1IRIA 2HWXA 4K26A 4IJVA 3OAUH 3CSUA 2RJMA 2VN8A 4JFEB 3RFCA 2CGEA 1L7RA 1G9ML 4DRZA 2XQBL 2IOFK 3ORQA 1JHLL 1SZDA 4XH9B 4QE3A 3MNMA 2ARJA 3OF2A 1F8TL 2R6DA 4DP1X 4WI9A 3AV3A 2ISQA 1BM7A 3MQ2A 4YAQA 5GWXA 1F4WL 3GUTB 4XMLH 1HKLL 4X7SL 5AW6B 3DZIA 5JHBA 5K9KB 1WFUA 3W5MA 2O07A 1D5ZA 4YASA 4KO6A 1AVAA 5IJBC 3OX2A 2NSHA 1KB5L 4K6OA 4KP7A 1N5MA 4XSVA 3THOA 2L17A 1Z5YD 1MUJA 2CHWA 4DLXA 4PJEE 3OQBA 3MOAL 4LCCC 4DN3H 3UC0H 3LQAC 1CKEA 1XVVA 2KS6A 4F9PA 2G75A 2LDXA 4G5HA 2XWTB 1DAOA 5AR1A 5A3QA 4GMHA 1PJQA 3DW1X 3LQ4A 3ZYIA 4DJMA 3B7YA 4BVJA 2JFWA 1BBDL 4NBYB 5ED0A 2ZWAA 1JN0A 3AUAA 1AOHA 3OPZL 3BXPA 1NV8A 3CFDA 1DQDH 5DJCA 2P4SA 3FDZA 4YY3B 1E4KC 1CF1A 1C9NA 1ZESA 3DRTB 5CB4A 2O5EA 4YBRA 3RVTD 3O9WB 2L18A 2OKMA 2R6ZA 3RHZA 2O1XA 4P2RA 1IAIL 1MR3F 3DMYA 1ZHHA 2ZG1A 1OROA 2ZDQA 4ZW3A 4TUJB 4HHAA 3D2CA 5IFKA 2EX4A 5F33A 3LZFL 4GM4A 5FYJH 3IMGA 4N3NA 2O4UX 3CQPA 3OKWA 4P5MB 2EJVA 2O3SA 3LCJA 3ZR6A 3K30A 1XRLA 1BZDA 4JBHA 4G8GB 1WS7A 5GRJH 3V9PA 4B9KC 1ZAYA 4CXMA 2Z0UA 2NTVA 4ZANA 3LIUA 1I80A 3Q5OA 1IOVA 3GROA 1IDN1 4TQGA 1K8RA 3HE3A 1CJVC 1QCZA 2VNKA 4U7KA 3QVUA 4YI5A 3OB0K 1T36B 2GUWA 1N9GB 1ZWIA 1PSKL 5JZMA 3S44A 2PP9A 3NRCA 1SF5A 4M0EA 3L3JA 3P19A 1DSWA 2ITDB 1KYWA 1DIOB 3I61A 2IC2A 4LHSA 1CIUA 1P2TA 1IJ9A 1NNUA 4Y2NA 1O6SB 5CT9A 1GS6X 1W96A 4D3XA 2PL9A 1FZOA 2VJMA 3RS8A 4NJEA 3LKOA 4R83A 4YDJA 5LGHL 5BNTA 2FG5A 2RGWA 5HHXL 2F5AH 3PE9A 3IB4A 1YC5A 3GMMA 3CBKB 2X12A 2HU2A 1EK5A 3JATB 3TYGL 1LJMA 3N7UA 2PYDA 4YGVB 3OIYA 4I19A 1XX6A 3AJ8A 3MXTA 1A4BA 4GOND 1EZVY 2ZYRA 3TQCA 1V3UA 4NPHA 3MLWL 2OMVA 3IAXA 2J08A 3OB0H 1LDNA 1Z4JA 3W7BA 4JFED 3FUWA 5IBQA 4H6PA 1JWMB 2FHSA 3FRPB 3A32A 4PTYA 3UYLA 1HILB 1S2OA 5MHTA 4I5GA 1JNLL 1HSZA 4FJ6A 3GUHA 1U7ZA 2A74A 1VPOL 2JH8A 3MWDB 2O3TA 3RRQA 3VG0L 1GTFA 4E46A 4N0FB 2K70A 3VD5A 1PKXA 5FWYB 3K5HA 3BD8A 3LSOA 4AB1A 4D44A 3DVFA 2XBMA 3N5CA 4BP1A 3SXJA 3UWMA 5KREA 2HRLA 3OC0A 5DHAA 1VJDA 5T8KC 4TUOB 1BAPA 1E2MA 4FAAB 5THXA 1IXKA 3HCCA 3BIOA 3BQUB 5I6LA 1GRNA 4MVJD 4Q6BA 1VCOA 3BS4A 3H9HB 1CURA 1YRBA 1FUNA 1ZLYA 4XBPA 2ZQKA 2R1TB 1IZJA 4E5PA 1LO3L 3E22B 4PU0A 1AKTA 2DWDA 3ET4A 1Z3CA 1E18A 4RQQB 1N6QH 2G09A 3B1XA 4RWZA 3O9WD 1TJXA 4B9IA 3S1SA 1JPGA 1HT0A 3NGBC 2CUIA 3TA3C 1BMTA 4JY5H 4F2FA 2YL2A 4D3SA 3WO3B 1Q94A 1IAQA 4AL8C 2NGRA 4JPSA 4BSVB 2ROXA 1TITA 3DUHA 3K6NA 5JHLA 3KR3H 5BOJA 3LZDA 1IEBB 1JHTB 1WW3A 1VRVA 3DMNA 5F44A 3KVVA 5C9ZA 1ODJA 2KC0A 3FXAA 4KX5A 2EBHX 4PAGA 1FYXA 4OLWH 3RTQC 1S7UA 4HGPA 2FZ3B 3F9CA 1SXHA 1N8ZA 3LLCA 2W71A 1E5VA 4DQKA 4U05A 4AJ0A 5A4FS 1TGYA 3ISTA 2OR3A 4BZ2L 1DKNA 1ZBDA 5I17B 1E5ZA 4XNQA 2D4AA 4WCFB 3DV0B 1EGHA 2CV0A 2XVKA 2YR0A 2EZ0C 5LCVA 2A14A 4RZHA 2ZX6A 3MLPA 2UVPB 2CNOA 5BUZA 1D4FA 2M2IA 1QLHA 1NLDL 1ZOOA 5FTNA 3RL1B 2FUTA 4P4SA 3PRZA 1GUFA 3MRTA 3V5NA 1A8PA 4KVZA 4ZDKA 2CLIB 2ZQZA 4ED9A 5GIRA 1DN2A 1MNAA 1JGVH 4GGMX 5KG9B 1QLRA 4QRPE 2E82A 3AL0C 1D3AA 4X4XB 3RL2A 4HH9A 3FO1B 3IO3A 1BAFH 1QSFE 2WU3A 1OCCB 2R25B 1PVVA 1YJDC 4J6RL 1B0RA 4B5ZA 3QQ9D 1VLZA 3G5TA 2Q8AL 2V9ZA 5E6IC 2JCCE 3ZY4A 2GK3A 2X4LA 4QTHA 2RHEA 2WP0A 2WTRA 3VA7A 3NT5A 1GSOA 4PRPA 4FLFA 5JH7A 5JNUA 3VD3A 3GLHA 1X87A 5FO9B 2NZYA 4DZTA 1F2UA 1G8FA 3ZCXA 1MELA 1KFAL 4PWGA 1KO4A 3CD4A 2PR4L 2VJNA 3MNWB 1IILE 3KELA 4POUB 2JIZA 4L2LA 4M3KB 1PLJA 2QB5A 3H3KA 5MEQB 2E9IA 4H7DA 5DIZA 4R69A 2RC6A 4XAWL 1H4QA 3A24A 4I1NB 1DEEA 2B2XH 2ILVA 5TFSL 3M5WA 1A8ZA 2GEFA 2D00A 3BQUD 4AYFA 3SFZA 1EDBA 2HA6A 2F4NA 3I0ZA 3ULUF 5DZNA 2KZKA 4COOA 2QLTA 3CXHK 1HCZA 2OZPA 5I8WA 2LT9A 1QYIA 3ZZ1A 4R3WA 4KUCF 5C8YA 1AGNA 1SCJA 4RKQA 4JXJA 2FZLA 2CJXA 3LHPH 3HYCA 4UDTB 2MNJB 3AZOA 1UA6L 1ABBA 3AWGA 4J4HA 2GKGA 3NAMA 1FUIA 2UU9B 1FNGA 4DCSA 5DTMA 5F1KC 3K5WA 4ZAKA 1OD6A 3DUFB 3NRPA 3JQ8B 1IBHA 4MJLA 4LZAA 3BAXA 5KSBE 3SYMA 2XZQL 3X1FA 2Y9RT 2DKFA 3REVB 2PAAA 1RJLB 2Y1YA 1KMCA 2WJWA 3RV4A 1KV3A 3POCA 1N6KA 3MODH 3TO2A 4V1CB 1YDPB 5IVOA 3AF1A 3LUJA 3INNA 5EL0A 3B20A 5CD3B 4QOIA 3B5TA 4RPHA 3DOHA 3SKYA 1N6UA 2Z31C 4O4JA 1YECH 3L3OA 1AIPA 4JGMA 1IC0A 1HPLA 2QHLA 1AP2B 1JF1B 3OU6A 3GLGA 3I6YA 3WSTA 1TZHB 5D7LB 2FATL 1HURA 1I10A 4PGDB 3CG0A 4IIFA 2Q9CA 3ENVA 2C5LA 4MASA 2F17A 2R7MA 4V39A 3TXAA 4K8RL 1SB8A 3R7WB 1OAKL 1TVEA 1N2JA 4IGAA 3V48A 1EFUA 1XZPA 4KJQD 1ESNA 3RSFA 1T2UA 2CAKA 1JVNA 4G71B 2FUNB 1AGDB 4XPTH 3S8EA 1UKCA 2BSXA 4RD4A 4HLUC 1M57B 5E6IB 1ZMXA 3BXZA 3WXVL 5B3JF 2X0UA 4F8JA 1N5IA 3N8HA 2XLCA 4YV2A 4M9CA 1XH2A 1NLBH 2X2FA 3LLMA 2YEQA 3ZOKA 1W8DA 2BEJA 1BMDA 1A6PA 4FQIH 4FNAA 4LSGA 3HJHA 5BCAA 4UHHA 4PJHA 4PV9A 4PLCA 3WGJA 3CFNA 4JFXB 4LSSL 3PTLA 5AP9A 4HUKB 2E1PA 3UW3A 4EMSA 3THMH 2Q49A 1YMHB 4J16C 5FBRB 5EO0A 5J89A 1OB1B 1QRUA 3EEQA 3H5IA 3MJ6A 3RBSA 5IR1B 3T0GA 4P93A 3AIKA 4E1VA 3AUXA 4OZHE 4NUPA 4GKLA 3RLIA 3HFML 1IN6A 5GGYA 3MIIA 2HIHA 3U9LA 3DLAA 3BKYL 5MFPA 3R9KA 4ZRMA 4HIPA 4S1SH 3WV5A 3N41F 4YRIA 4HQLA 2Z8YA 4L1KA 4MW1A 4BATA 4CGYA 4K88A 4YO8A 5KWEA 3HVJA 2YYYA 4JC8A 3RROA 4DO5A 1EQAA 5JJKA 3B3GA 1THMA 2QNBA 4EQ3A 3QEQD 1E4WH 1QX1A 3ZTNH 1F1GA 5HWSA 4HAOA 4YJGB 5GADl 4DKFH 4KI0A 3U25A 3JYQA 1FORH 1ZDQA 5F7YC 4NATA 1S89A 1GOTA 2IQ5A 3U46A 1NKOA 3QHZL 4Z76A 5EPMA 4LCWA 3UA4A 5KSYA 3QO0A 4PF1A 1U8IA 3PIDA 1E3TA 2XMDA 5A40E 2OSXA 1TZOA 4POYA 5D1QD 4GUAA 2F90A 4HG2A 4L4XA 3BK1A 4UDOA 1S9XB 4XNYH 3I32A 1ZE3C 2HMAA 5EZ5A 2Z31B 4IIJF 4W7HA 1SHZA 4N8CH 4NO3A 2GH1A 2YWYA 2EDNA 4ZT7A 1OZAA 4HBQA 1KZYC 1MHHA 2Q9OA 4DY4A 2NNFA 1K92A 5FEBA 3E2PA 3LRPA 4QHSA 3HMXA 2N56A 4NOJA 5B1AB 1POWA 5IVXB 5J6HA 2IU4A 3KL2A 3UG3A 2OSLB 4JSRA 4Y9RA 2FO4B 3GL9A 3APDA 3VNYA 1ZDMA 2A5LA 4RKWA 3AVYA 4BFIB 5D7LD 3SFTA 4OAPA 3ONFA 1T8TA 3FCUB 4JG9A 3DAPA 5L2KE 3V3KA 1T03H 2WJVA 3G5LA 2VXUL 4PW0A 1TZ8A 1SVCP 2E89A 1NMBL 2VRAA 5T33H 5A4JA 3CIOA 1F6AB 2E46A 3MFFA 4MQFA 5EOQL 4J1SA 5DHQA 2IL1A 3PQFA 1RFLA 3DLQR 2HJKA 1B8VA 2YC2C 1KCSL 5IJKC 4AX4A 4K9OA 3RGWS 1BOOA 5B21A 4XVRA 2GJPA 5F0LB 3M49A 1HRKA 1J8HE 4ABTA 5C2JB 4RMVA 1EZ4A 1J1OL 2V7UA 1ZEAL 4DJFC 5B3LA 2QLFA 1BQEA 3AP2A 5C7XH 5HHTA 4JYZA 3V8BA 3C75A 5DZOA 4OD3H 4PY8I 1XWVA 4I3HA 1UEYA 3AS2A 1ADGA 5IH3A 2XOXA 4D81A 5FDWA 1MDTA 4PXSA 2IOYA 4F9TA 3ACBA 2NNWB 4GP4B 4X44A 1XLTA 3U81A 2VK8A 1SQ6A 4K81B 3HE6B 3G5ZB 4JITA 1OK0A 4UVEA 4Z7IA 1SXNA 2BGKA 1DGQA 2H9YA 1VMIA 3NCYS 2WSSA 4KBPA 2BIQA 2GHIA 4GMXA 5AAMA 5E94B 3TIFA 1QUNB 1LP9E 2R8OA 3WGNA 4WK6A 3HNRA 1Q0EA 2J3HA 5FO8A 2E4UA 4J3XA 3G6JA 5EN3A 1ETUA 4A2CA 2FR1A 3VVBA 3PNPA 3TSOA 4J6FA 1THGA 2C0CA 4MVJF 2B5WA 2O8BA 3MB5A 1Y6JA 1D6EB 4N3AA 5K6RA 1KJJA 2EJ1A 3L4KA 4D8TA 3IFLH 2P8LA 1U3WA 2OX5B 5LQCA 1MBZA 1KU6A 1Z9LA 1MAMH 3BVDB 5KYXA 1Q95A 1NKGA 1SQ5A 2Q3BA 2D1YA 4LLWA 4KRLB 5AWNH 4Z53A 3K20A 3PP3K 4U1MA 3A9TA 4U7SA 4EG3A 2ITFA 4F04A 4N39A 3F7NA 1WB9A 2ZSWB 1NATA 2O14A 4QDZA 4JQVC 1UJ3B 4G9FE 9PCYA 1G1OA 3CVHL 3R06B 3HI6H 3APMA 4F4CA 4F33B 1U6IA 3EZ7A 4Y9SA 1TM4E 1H9DA 3H8SA 4DQDA 3WLFA 3IQWA 1BHQ1 1NPJA 2XFXA 3QDMA 1VE3A 3QK0A 4D26A 3CN4A 1IGJA 3VFPB 2ZAMA 1FFOA 3RIKA 3FYSA 2Z8XA 4XI5D 2KMLA 5LYYA 1KN2H 3C5CA 3WK7A 3VQTA 4LFBB 2ON6A 3WWYA 2NM0A 4O8ZA 5JW4N 3L5JA 3QCTH 1V7ZA 4M60A 4WZBA 4EJ0A 3ROZA 5LQJA 5GMOA 5LDDC 3OFNA 3PP3H 3WIOA 3QUTA 1AMOA 1ZR2A 4OF0A 3BVVA 4LPWA 4ZOEA 2G40A 1KIMA 2A9QA 1Q9WA 1O8CA 4JE4B 4MRAA 1NF2A 4G09A 4JC5A 4PREB 1XJ5A 3DVLA 2PMZA 1TF4A 3P69A 5HVWA 3SQOA 3FVRA 1X1QA 4ISBA 4V1DB 5EOCH 1DWQA 4I4WB 4FOOA 1ZIDA 3IS3A 5K0JA 2QELA 1RMTA 2WJ4A 3WTTA 4MAUH 4UYQA 4JPWH 2NY2C 5DJ0A 3CTTA 3PDOB 2IYVA 4CCWA 2CMKA 5B55A 4ZCSA 4UTXA 3D0VA 1SUJA 4MUHA 4UTRA 1YL7A 4G2TA 4LKCA 2QHRL 4LEIA 1KFEB 5DMJB 2OCLA 3IQDB 3LXRA 4QJ3B 5LB4A 2PW2B 4HYTB 4D0SA 1YR1A 2P6PA 3OPYB 3MRNB 3LQFA 2GJ6D 4IZOA 3K5SA 4NOKA 4MB6A 1LNQA 3GFFA 3HG1D 3O3MB 3AXLB 2VSQA 2FGWH 2VDLB 1ZQ9A 1T4KB 2X9LA 1DTSA 1CUHA 2ZUBA 1VPTA 4CT4B 3TEWA 2R1YA 5SV3A 3ESYA 5HYIA 1W581 1KLUA 2O6FA 2RFLA 3D39A 2NZUG 1O7DC 3IJHA 2GYWA 1B42A 3RSZA 4Y2HA 4QCIA 3R1GH 3KRTA 3LT0A 2ZWSA 5EUKA 2MSCB 3FB7A 3TEYA 3GGWB 5E95A 4AZ8A 5KS9A 2Q3AA 4JDTL 1KPIA 4MINA 3C5WP 5EUOB 1MO6A 4EJ2A 3UGTA 4RWHA 1CPYA 2P41A 1A1NA 4MMZA 1NXTA 1UAGA 2QL5A 5IVHA 1IOZA 1SVOA 3O1HB 1QFJA 2E4WA 2XEXA 3HBPA 2A5UA 3F3MA 2Y24A 3KAPA 4NQSA 1AKMA 1QH8B 2XB6A 2FLBT 5IHZB 4UTBA 3V4VB 4NZ8A 4Z7OE 5ENWA 3FUFA 1FG9C 3ZDZF 5IMOB 4NBRA 5J4LA 4YHLH 1W6UA 4PSUA 3Q6FB 1EFRA 3PWUB 2MYNA 3U3JA 2VW4A 4CPDA 4ZJ9A 5IXSA 3AL8B 1LK3H 3V8QA 3RKDD 1X9IA 3LF2A 1B8OA 1A3RH 4DQLA 3D4CA 3ZWYA 3RU9A 1OL0A 3E2HB 2Q3MA 4F2HA 1NONA 1CV2A 3LGXA 3TF7C 4MGKR 3IQIX 4L18A 1SOSA 4NULA 2VG8A 2EDTA 4G7YH 3HRZA 2PH5A 3T7SA 3CFBB 4YHML 4N49A 5AXBA 2WM0A 4KIGA 5GJSH 1OAUH 2X6TA 3TYFB 2OHGA 4FSHA 1H8HA 2NY2B 3QWHA 4LF3B 4KZDH 4X6DF 4W9JC 5AXCA 2I2DA 2FEMA 3H1PA 3NOOA 3QULB 5IC6A 3DJFA 3L5XH 4V1DD 2EL7A 1ACZA 3W9DA 1F0KA 3KYCB 4Q3OA 5E8EB 4LZLA 5AW7A 1YYCA 2WXIA 1RPTA 4RLSA 3FYHA 1KYQA 5FPKA 3ER9A 3IPFA 1X7ZB 2P2DA 3QXTA 4NO0B 3IGAA 3DIFA 4ZCLA 3K0SA