2VDNB

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 128
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdnB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdnB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdnB03
1N3YA 3VI4B 3F78A 4F1KA 4XW2A 5E6SA 3ZE0B 3K72A 3BQMB 4G1EB 4JX0A 4UM8B 5ES4B 4HQFA 5E6UA 4G1EA 4GZ8A 1JV2A 3EG9A 5KYWA 2P26A 2IUEA 1JEYA 1M2VA 1U8CA 3OL2B 1QC5B 1SHYB 3IBSA 3EOAI 4C29A 4WK2B 1FE8A 2O7NA 3QA3E 1LFAA 1V7PC 3TCXB 1JLMA 3K71A 1AO3A 1MQAA 2I6QA 2I6SA 2X5NA 3M6FA 3HXOA 4JDUA 1QC5A 4HQNA 3T3MB 3E2MA 1IJKA 1L5GA 1U8CB 3ZDXB 3OL2A 4HQKA 3FCSB 2XWJI 3EGXB 3K6SA 1AUQA 4FWWA 1M1UA 1SHTX 4MMYA 3AFCA 4HQLA 2NVOA 4C2AA 4MMYB 4G1MB 4MMXB 5HGJA 1OLZA 2NUTA 2ODPA 3NIGB 5KYUA 1DZIA 3K6SB 3BQNB 1ATZA 4IHKA 5E6SB 2NUPB 2WINI 3OKWA 4IGIA 1YVPA 2P28A 5HDBB 1PT6A 4WFQA 3EOBI 4BJ3A 1AOXA 3F74A 2VDKB 1SQ0A 3HI6A 3T3PB 1XUOA 3EFOB 2QTVA 2VDMB 1CK4A 3ZDYB 4CN9A 3EGDA 1OAKA 4C2BA 1MJNA 1YUKA 4MMZB 5E6UB 4NEHB 3RAGA 4Z7QB 1IJBA 1SHUX 1PD1A 2B2XA 5KYYB 2ODQA 3FCSA 4F1JA 4UM9D 1SSLA 1FNSA 2M32A 3K71B 3ZDZB 3VI3B 1TYEB 4NENA 4O02A 2VC2B 3NVQA 1T6BY 3ZE2B 3TXAA 5BV8A 1JEYB 5KYXA 1MF7A 3BN3A 4UM9B 3EG9B 1ZOOA 1XDGA 1ZOPA 3AL9A 1JEQA 2XWBF 2WW8A 3NIFB 3GXBA 3EH2A 3EGDB 4M76B 1JV2B 4PN7A 5KYUB 2VDRB 1L5GB 1MHPA 1UEXC 1RS0A 3AL8B 1YVRA 3TW0A 4A0QA 3HXQA 4WJKB 3PPXA 4CNBA 5LN1A 1QCYA 2UZYB 3FCUB 1M2OA 4WK4B 1BHO1 4Z7NB 3NIDB 4O3TB 1BHQ1 1RTKA 3PPWA 5E6RB 1XDDA 3TVYA 3IJEB 2VDOB 5KYNA 4G1MA 4MMXA 2NUTB 3PPYA 5KYXB 3V4VB 3N2NA 1M2VB 1ZONA 3ZE1B 1MQ9A 4IXDA 3AL8A 1RRKA 2VDPB 4WK0B 1JEQB 2XGGA 4CN8A 3EGXA 1IDOA 1MQ8B 3EFOA 1U0NA 2ICAA 1DGQA 1N9ZA 3PPVA 2VDQB 1IDN1 1PD0A 4O3UB 1T0PA 2VDNB 4HQOA 3ZQKA 4FX5A 3K72B 1U0OC 5KYYA 1RD4A 2I91A 1CQPA 4O02B 3V4PB 3EH1A 4DMUB 2NUPA 4K3JB 4MMZA 1NA5A 1Q0PA 2ADFA 1M10A 5E6RA 5HJ2A 4NENB 2VDLB 3IJEA 4Z7OB 1M1XA 3Q3GE 5KYWB 3OKYB 1M1XB 1PCXA
chains in the Genus database with same CATH superfamily
4AYBA 3RJDA 1P1IA 3DEIA 1AS6A 3NHBA 5A6LA 4HS3B 2QN7A 2D8MA 3I2FA 2Q2EB 4YDKL 4AKIA 3QRLA 2GS9A 1H2XA 2MT9A 2PTTA 5I4CA 4H7KA 3C1AA 3ARXA 1BD4A 1ODFA 1NLYA 3K6SB 2COQA 5LXGL 2GZHA 3PNWA 3MRHB 4NQCA 3ZH9B 2P28B 3PLNA 4N24A 1QKKA 1XD1A 4NUJA 4LVOC 3LD9A 1WSAA 3REWB 2ZJ0A 4A2LA 1R0RE 5DM70 1OHZA 4ZOAA 4FQ2L 3T7KA 1LO5A 4MASA 4ND8B 2XSKA 1R6VA 1K2WA 2IPLA 4H88L 1W8NA 3EYWA 2H8KA 1TKWA 2HK9A 5DASA 4UMVA 4EG4A 3TR0A 4LWPA 1NLFA 5E5UB 2NX5A 4CSSA 3OWOA 4JC0A 2P9HA 1HWHB 1SKMA 1WRBA 4W1RA 2ZCJA 5BVPL 2FFHA 3Q9PA 2QKYA 2G5PA 5IHUL 2SKEA 3EUDA 4KX8A 2H16A 4O4JF 1NZFA 2VDOH 1DBML 4JLJA 4ZRDA 3KYDA 4GX1A 4IH4A 4O2CA 4ZQIA 2PS1A 3F3MA 5E99L 4PE5B 4RJJA 4HDSA 4NQXA 4OCYL 3BE8A 5GVRA 4NM8L 1LX7A 4HNUA 1YDWA 2JBWA 3IJYB 4KFRA 2HSZA 5C51B 1UPAA 2FQDA 3GDBA 4PWFA 2VL5B 2ZREA 4XBPA 1ZSNA 1SIBE 4KAJA 4OHOA 5E9WA 1KT2B 2A4CA 2O0JA 2YMXL 1FDTA 2AMJA 4URHA 1LDBA 2WF8A 1DCEA 2B1RA 2EX1A 4CI9A 5C9JB 4HVTA 3OO1A 3GOHA 4UD6A 2FLRT 2QY6A 5COAA 3SE7A 3ADBA 3Q8FA 4FQCL 3MWDA 4PG8A 2EBWA 4DC0A 4DPBX 1C4XA 4BZ1L 4LOKA 4OQTA 5D1XE 4HLDA 2BZDA 1WDAA 2AVGA 3OV6A 4ONFL 2GVNA 3CN7A 3VXSE 4LSTL 4PRHE 3I9PA 3DUSA 3KLLA 2Q9UA 5E9AA 3HB4X 2NXZB 4HLCA 5KW9L 2XA9A 4C07A 3OAAA 2AJDA 4I1OA 4XOIA 5FR2A 4MV5A 1MAMH 3ECCA 5AI0A 4NCJA 4MINA 5DEJA 1N67A 4YWGH 1QHHB 4F7EB 4BEIA 3OHSX 1YJCA 3EVTA 4M61A 4ZSOB 1KNQA 1E7VA 5DD3H 2PMEA 4FF9A 1L6XA 3TTVA 3OZ7A 2JJYA 2EIJB 1QV6A 1BHJA 3P11L 4D74A 4OSUL 5KUMA 3GZTB 2AXGB 4AQDA 2NSQA 1UTDA 2GN8A 3DPBB 2IYTA 3B2UD 2YN5A 3FUIA 1INLA 4LEXL 2J3HA 2MPAH 5H4YA 3HVHA 4ZRMA 1Z32X 1FLDA 1VADB 3P0EA 1WZKA 5D3MB 2QKIC 2WYVA 3ZOZA 4N0DA 2ZCKL 1CLZH 2G6TA 2Z04A 2MINB 5I9MA 2ZXWB 3S8GB 3VWKD 3E80A 3CO0S 3U5TA 4ON9A 4EJSA 4BKSC 1ZICA 5IJAA 2XXFA 3AJ8A 2KERA 4F7PB 1H1LA 3T7SA 3PAUA 3GN1A 1G0NA 1TD1A 2H2AA 1RHQA 3NVAA 2GYWA 4JLKA 3BWAA 1M83A 1K4YA 3K0SA 4FONA 1JDZA 5J1AB 4ZDHB 1NWOA 4LQFL 5FUMA 4WCFB 1VCMA 5KNCH 3A9WA 3SEZA 4NZ9A 3UZVA 3SKOA 4GS5A 2ITDA 2GKGA 4OI7A 1YJ8A 4AF6A 1C41A 4I4WA 1WF3A 1ZGLM 5BO5A 2F9FA 1A9XA 4FSHA 5D4JA 2FX3A 2WD8A 4Z7IA 4GUOA 3TIXB 1GAJA 5EE0A 3I23A 3RILA 3BORA 3OF2A 4LFBB 3UZQA 4PX5A 2EILB 3NM5A 2C4MA 2X4TB 5TEWA 4I1SA 2OMVB 2XKSA 1OA1A 2SHKA 4JROA 1E1YA 3FYUA 1MQ8B 2YSSA 1U7TA 3BOVA 3RL2A 3BFJA 4OTZA 1X5MA 1JT2A 1CI5A 4W9MC 4N3NA 4UMGA 1EBAA 3QZWG 2HRLA 4RMTA 4QO1A 4Q9HA 5H2BA 4P59L 5I6OA 2QQKL 1CZOA 5AW9A 1V6CA 2XBZA 1G7IB 2Z1KA 1QUFA 1XZIA 5EMMA 2CLRB 2VLJD 2GHWB 1E1LA 4JFZL 4JI1B 1G84A 5TT1A 2VJ8A 1G7TA 1UKTA 4PFQA 4IJVA 4NR0A 2ED7A 2V4ZA 3L1VA 4KVZA 3KGSA 5IB3A 4KY2A 4MTLA 2A94A 2R2EA 3ARBD 1WEHA 1A4KA 1NHGA 4X6DF 2EIXA 1IVNA 3L0PA 1MRFL 3AF4A 4DXHA 1GZQB 1Z13A 3A1VA 2XHNA 4CM4A 5KTRA 3SQDA 3CQFA 1Y1KE 1EI9A 3O2WH 1Y18B 4LMQI 1K98A 1TFUA 4AYSA 3RUPA 2YICA 3T09A 1QAOA 1MLCB 5JNYA 4ZO8A 3UH0A 2P52A 5IF0A 4XB8A 4FLOA 4Z4EA 2IZ5A 4BRSA 1C3JA 3RS0A 1Y1UA 1X14A 2CO2A 1M34B 5GONB 3RVDA 3T2OA 3IMVA 4TTAA 1QSED 3V0DA 1GKIA 4OTXH 4GRLD 5D2NB 2VQ1B 1Z62A 4NOKA 3TOPA 4XR9A 3NJFA 1JWAB 1OYOA 1FCGA 5IIEB 3WJ2A 4GKSA 2PAAA 5AR1A 3AM4A 1XGQB 1DCLA 3S6CA 2GHIA 4LCIL 5F2OA 1MJ7H 2XWTB 3H5IA 2X6RA 1LBQA 3P5SA 1Z8NA 1AZRA 5KZCB 5FBHA 4ZFGL 2VPWA 1UMKA 3F8WA 1PLAA 3ECQA 3FMIA 3SC3A 4EO5A 4ZEVA 4OXYA 4KR2A 5DQJB 1NTDA 2OHFA 2X4SB 5IW8A 4DHWA 3QYFA 1XDZA 2FUQA 1CNMA 4L9LA 1RZRA 4NONA 4RIRA 5DUBA 3UTTD 4NRYB 4OJMX 3SHOA 1U92A 1JB1A 2H85A 3C5HA 2E7CA 5T57A 3LIUA 2SCUB 3JQAB 3LUDA 2H6OA 5DD6B 4LYHA 4KKBC 4LF3B 2PCJA 1CUHA 4LEBA 3J81k 1NXPA 2CD7A 3OJ0A 5HVNA 5J4MA 4P2RB 4ND2A 5D1ZB 3HR8A 3NEXA 1DQLH 3Q1KA 4FXOA 4K94C 1I9EA 5IROD 4A0GA 3P3SA 1XZQA 5GZOA 4UEWA 2KE5A 3KAQA 2DTXA 4CKBB 1CD1A 1ZQ1A 3OFNA 5I66B 5MEQA 3IJHA 2BP8B 3NUQA 4WK4B 2LD4A 4MWEA 2PLNA 2NY4B 3RGVD 3Q06A 2AGJL 4FMPA 4PLPA 1O94C 3SKMA 3RU2A 3AIKA 3BEVB 4XHJD 3QZLA 3ZR6A 3GK3A 4EUPH 5KHAA 3EPHA 3R0IA 4ATWA 3D4OA 2F74A 3DVLA 4O2EA 5BSGA 2VAMA 3GI8H 3H1FA 3OVUB 5HGBA 5F4ZA 3PIQA 2ZWOA 2QMYA 1Z38A 5LFAA 5H0IA 2HU2A 1IAKA 4OP3A 5HF8A 1KB5B 3ESQA 3TJHC 1AP2A 3DVGA 1OLXA 3K8YA 5FPQA 1RFGE 4R5XA 4IVQA 1SVMA 3NBAA 2C9BA 3RWOA 1DJMA 1VXOA 2Y2WA 4UNSA 4BLOA 4MR8A 4UD2A 4GLBA 5EHIA 1GLGA 1LE9A 1Z66A 2Z3VA 5J4HA 4I0PC 1KBBA 3WYFA 3DX1A 5T3ZH 4MB5A 3YASA 1Q38A 1ZEJA 2XZDA 5JJBA 3WFZA 1EINA 2WVAA 1BJ8A 1QI4A 1IYZA 1DB3A 4WK6A 4Z0BL 2E7MA 3INYA 1Q9KA 2YAEA 1WF5A 1WEJH 1YK0A 4GKBA 2JQAA 2GFBA 4ONOA 1R9FA 2D03L 3NABL 1V8BA 1TA4A 1MC8A 1MJ7L 2NW3B 4Z7QB 2WC1A 1KULA 3NNDA 5A04A 1H3GA 3VFRA 4RM2A 4AG3A 4U2GA 1I7ZB 1NG1A 1Y0BA 4ZVKA 2YXDA 4GFXA 3V7YA 2EH7H 2CDRA 2VFAA 4E5UA 5DHDA 1QTNA 4OK3A 2OQIA 4EKGA 2Y6SD 2B3TA 2WM8A 1EAQA 1VCHA 1NW3A 4AJ9A 1UZ8A 4M48L 1EX6A 1WWBX 2FWAA 2WHQA 4UQ2A 4UBLA 3RYIA 1PR1A 1A8PA 4QUDA 1ISGA 3HCVB 1AXIB 1UP6A 3L1KA 3GF8A 2X40A 1F4XH 1T8UA 4EEEA 4N3CA 5I7OA 4BU0A 2I9LA 1JVKA 3IS0X 2G1KA 2O14A 5C0DA 4KK9D 3ITEA 1WPXA 2VRWA 3R3JA 1XH1A 3U3OA 1GGTA 3BRDA 3MREA 2XQJA 4KZEL 1UCBL 1P2TA 3DHVA 2O5XL 1KEEA 2I26N 4NDMB 2IRWA 4K1LA 2IUEA 3U60B 1NFKA 4KX5A 5DMIH 1QC5B 1SR8A 3QK0A 2A67A 3HHEA 1ZM9A 5D9SB 4TKWA 3DJTA 3PDDA 4Y0NA 5KSBB 2VLRE 4D9JA 1DUSA 2IBBA 2CK3A 5KKNB 2Z5VA 3AU1A 3Q2LA 1O57A 1OKKA 2WWRA 4J76A 2C57A 2D5CA 2W0LA 1XJ0A 3UO8B 3TA3A 2E5LB 2UUAB 2GEKA 1CTMA 2YRPA 3L3IA 5IUSA 3CZ9A 4AJNA 4P0DA 3WXWH 1ZW1A 2H31A 2ZWNA 3SDXE 2XKBA 2WTMA 2R8SH 1FDWA 3D18A 1SSLA 4IKEA 5JTWA 1BQRA 1G8FA 4TSKA 1X5HA 5JLZB 2AABL 1P0SE 5EZSA 2V7VA 3MN8A 2D31A 2UZIH 1ZL2A 3QVKA 3IAAA 4IS6B 3V7UA 4KRXA 1Z07A 4BO8A 4FDWA 5CDUA 3JYCA 3A14A 2Q07A 1IDOA 2C2YA 3BQUD 4FQIH 2DWEA 1USQA 5ALIA 2P4HX 1KCSH 1NBOA 2ONKA 4ZMBA 2OZ4A 4U49A 1QIJA 2D6FA 4TT8A 1H0KA 2PCFA 3NA4A 1ZG3A 4AJ0A 2FLWA 1AXTH 4EMZA 1GN9A 1VF5C 4GI6A 4J5VA 5LWQA 4G01B 1R5NA 3IPRA 1DNPA 1S8FA 3RD5A 3WGZA 1MJUH 4ZAZA 4UQDA 2BNQD 5C4IA 3QQPA 2VXOA 3VPXA 4QLRA 4XASA 3U7YL 2X7LB 3GY0A 2H7YA 1ENYA 4OI2A 2WF5A 5H37G 3A0RB 1KAMA 3BFOA 3EXG1 3I30X 2LLNA 2M6LA 4AZ0B 4Z3KA 3OJFA 2EKSA 3V4SA 5TDOA 5AW1A 4X7CC 1TSRA 4UOZA 5IAKA 4RFSA 5I1GH 4ZCQA 1YB5A 1LK3L 2GBLC 4BIMA 3CW9A 4RTLA 4F2EA 3QNZB 1ZA6B 5CINL 2FWOB 2P2ZA 4AH2B 1F0YA 2ZYIA 1O97D 3FFCB 1ULTA 2FF7A 1AD9B 3NBUA 1OL0A 1K8QA 3UATA 3SCMC 3KELA 4B6EA 1L5VA 3WADA 3IJSB 4DMRA 3GBMH 1P39A 2FSFA 4NQSB 4R90H 3FFOA 3TO2A 3CUPA 2GCOA 2JGRA 3G5AA 5LKAA 3ERXA 5HXMA 3SPHA 4U6TA 1F6WA 3IL2A 5GGQL 1OGIA 2DHCA 1VGVA 3OMXA 3K0WA 3MV7D 2C0CA 5TS3A 3D7MA 4HUTA 3AQDA 1B3JA 3PFCA 1NOFA 1SEBA 2LW3A 1GPBA 4V0QA 2WOBA 5H4HA 5I1AB 1RJZB 1A71A 4WI6A 3B51X 1JP5A 1RHFA 1E4HA 1T1SA 4EVRA 2QSCL 2Z2IA 3NHYA 1XLTA 2EW8A 2ZI6A 5K0BA 4BGIA 1Z0MA 1GTZA 3A25A 2O8CB 5EUKA 5K3FA 2VDMH 1MFZA 4Z4FA 2J8UA 2MIIA 3NEEA 3HR5A 1NV9A 2AMUA 1K0FA 5A3JA 4RFEA 1KJ3H 1ISIA 4RYLA 2I6SA 3KNBB 2YKLH 3E2PA 3A1UA 3CZSA 4QQNA 1CIDA 4Q3KA 5AQ1A 43CAA 2EXXA 4F8PA 3A6HA 9CGTA 1TLLA 3U9PL 1CFNA 1DJSA 1MY5A 1J8SA 2DUUA 4IJUA 2ZPKL 3WB2A 5DM60 2HFEA 4PB0H 1KN4H 4OB5H 1U8OB 2WNIA 5A6VA 1U5CA 2GK6A 4JG5A 1AE6H 1SF3A 2UZ4A 3ESNA 4U7PB 2VQUA 1BV8A 4JI4B 2YDXA 2D1FA 5KQGA 5E4OA 2P4UA 3KQYA 3H99A 3RTGA 4DEPB 4KR9A 4ENQA 5C5EA 4N6OA 4Q0MA 2WQ8A 1QYGL 1DBMH 3ZHOA 4K71C 4YROA 5IVZA 4DCQB 4UJ5A 4M7JL 1VE1A 2PM8A 1HTWA 4XD7D 3LFTA 3W0WB 3UTCA 2WVTA 1PP4A 3P0RA 4F3FA 3LKOA 3TIIA 3PKZA 1IZJA 4NBYB 3SPVA 3GO1L 1Q91A 3CT6A 4KFMA 1QRNA 2XGGA 4ZQFA 3K0HA 2CMRH 2PNJA 4P4RA 1AURA 3Q3IA 4A55A 3IEXA 3BQUC 3ZZLA 3IKTA 2FMTA 1II8B 3RRFA 1XMQB 4B33A 1OB1A 2QROA 2DU8A 3KPUA 1HLDA 2WTAA 3QTTA 1G41A 4L27A 3H1BA 2HAEA 1QIHA 1EEUA 3TB6A 3L3JA 5M2QA 1V7CA 1EK6A 1YUBA 1KTCA 5DWPA 3S36X 2OCFD 3C6QA 3MMZA 1ZRNA 4C2UA 2DQGL 3CDGB 4LDQA 2PCFB 4K9OA 1E4XL 2XZZA 4QUAA 2GPNA 2P2DA 1VCIA 2VTBA 2Y0SA 3BAXA 3V6ZB 3GIZH 3MBOA 2DJ5A 4M6AA 2GTWA 1Y8ZA 3FM9A 3OF3A 3QORC 3WGVB 2R96A 3K81A 4F21A 4X64B 1K5GA 3P94A 1MOZA 1WPCA 2W2MA 5KVEL 4GOJA 3CTMA 5C2BH 5SY4A 4BQEA 2JCGA 3RU8L 7REQB 4PGBA 1JQEA 2HKAA 2ZR7A 4PZPA 2JVJA 4YAIA 4JLRB 1ODJA 2FSEB 1PR6A 5HYQA 1U3CA 1NQWA 5KSAC 2B5IB 2FWOA 1EO7A 3CFBB 4PQEA 3T5CA 4KNWA 3RX7A 1V2HE 4P23C 5T4BA 3T7CA 1PY0A 4XAKD 3C16C 3LZFH 1IEWA 1ZONA 2E7ZA 1SBCA 3UXHA 1M7UA 1JGEB 3FKSD 4AZWA 2AQ3A 2QYOA 1SEVA 3VX4A 3WBBA 2OK8A 3JARA 2DJUA 1OY3B 2A74A 3Q9QA 3CWGA 4HZGA 3RVRA 3WFHB 2AEPL 4MS6A 3NJVA 5EIBC 2Q7OE 4RGND 5CK5A 2PKDA 4C4BA 3SPGA 3ZUCA 4WU5B 1JWMA 1OAOC 4ODSH 3IBFA 3QNXB 4CU7A 4N5NA 4R41A 1P7QA 2XIDA 1T4CB 3KBFA 4UVIA 4HBGA 4OV6F 1RUPL 2FVXA 4QDKA 4Z7OF 1AUQA 5BW5A 4WW2A 2EWVA 1MO4A 4C2TA 3WN5C 3F4BA 2PVPA 3FQNB 3BH8A 4FL4C 1DU4A 4P54A 4G8JA 5DK2B 3PNLA 1T89C 3K2QA 3FRPB 4Y1EA 5FDWA 2Q6VA 2EP5A 4HS9A 5JUWA 3UJIL 5ADPH 3WEXB 2Q10A 5JNUA 3QVAA 3GHHA 1WIUA 1T1ZB 1CG9B 1H6DA 1LLDA 2BF7A 5J11C 1XGQA 2ED6A 1QCZA 2YXMA 4GRAA 3V7MA 1JQ5A 4NE2A 1E6JL 5I5GA 2X70A 2D13A 4TLSA 2VDKL 1YJXA 3GJ5A 2RHJA 2AG0A 3MUGB 3BT2L 3JYPA 4XPAH 5J4LA 2X3BA 1JWSA 1QCYA 2HH0L 4BYGA 3IQIX 3GNML 4X5WB 5C92A 3AEQA 3C6XA 1AAJA 4PSAA 2A6IA 3LT0A 1PJ2A 1QDLB 1ZOLA 3B9QA 1LSUA 4F9EA 5JHLH 4A7UA 4XSGA 3AG3B 3LKOB 3B7RL 4K7FB 2HX7A 5BS0B 1E9QB 1VEMA 2DQDL 4C4ZA 1LILA 4I0WB 4MXQC 3DHJA 1E9CA 3PQYA 2LW7A 1C4OA 3HI4A 1A69A 2JRLA 4E14A 2BE7A 3CX5K 1NZJA 3SE0A 4YRTA 3FE2A 1J0BA 4DAGH 1XIVA 4QRDA 1BEYH 4RMQA 4N0EA 3FPEA 3VOSA 5EKDA 1N25A 3AAZB 1WJGA 1GTL1 2DPGA 3A4TA 2NXZD 4ZOBA 4ZJUA 1CFSB 1P2BA 4NBKA 4MI1A 1S2OA 5E5LA 1RIHH 4F56A 2MQ3A 3NM6B 1IUNA 4DBLC 1PY4A 4MEAA 4IEIA 1Z4MA 4NLHA 2HRBA 4KXBA 3AJRA 1KEGH 5AMXA 2XMBA 2GN4A 1CJUC 3FZNA 1A82A 4NJEA 3HYNA 3F4LA 5C37A 4REQA 1UMCB 4FGJA 3NXKA 3OLVA 1FNSH 4EQ6A 1NLBH 3TPFA 2JFGA 4BB6A 5JIHA 3QIBC 4GC9A 1H85A 3QWFA 2LFGA 1UMBB 5DVPA 1KN2H 3RL2B 4O8ZA 1KSFX 2Q8AL 5DTJA 2X5PA 4OQTL 2OZEA 4KWIA 1S8DB 2X0EA 4QGBA 5KOMC 1B8NA 1N2IA 4KY1L 3SSGA 3VFSB 1I9CA 1R5IB 4OIIH 3LVEA 3ZLVA 2D0DA 1NUTA 4J16A 3FTSA 4QXMA 3VGJA 1JK8B 3L81A 2ATVA 5EE5B 4Q4AA 3CX5J 4F8OA 1CY1A 1K4MA 4B6GA 3OJCA 2XFXA 3LM8A 3WB1A 3O2DA 3NHPA 4KFSA 1QV9A 4CVNA 2W5PA 2OXRA 4GPTA 2PWFA 2G6BA 2IDFA 3V5KA 3UICA 5HD8D 2Q7NA 2AANA 4A2HA 3WICA 5ECGA 4G8IB 1U8MB 2C5HA 2C83A 2OBXA 1HQYE 4FERA 3R0NA 4LY0A 3WJ7A 1P9MC 4FNSA 3FL7A 5B39A 3WUWA 3I61A 1D6EB 3ZLQC 5FO8A 4ACAA 2RD2A 4BWFB 2JGDA 4BDTA 4M0FA 4V1CA 2YQ2A 3KZ8A 5FPKA 1DO6A 5HFAA 4WI4A 1UB6B 3Q44A 4TMTA 2VC2H 2YXWA 4NNXB 4ZNCD 1H1LB 1IKNA 2DBLH 1F9AA 5DN6A 5HIJA 3GMPB 1F6BA 3HC7A 4O58L 4K3VA 5I1DA 4ZALA 3EYAA 3QO0A 2KS0A 1Y7IA 4GR9A 1BQLL 2H6PB 1G20A 1XGKA 2GK3A 4FYVA 2WMYA 3H6GA 1PZNA 3CVXA 2X14A 1KTJA 2F90A 3FTGB 5FS5A 1RPKA 2C9PA 4JUFA 2FMIA 1L0BA 3PUYA 2BS8A 3L95B 4PI0A 3CNHA 5FHBH 2WVVA 4UU7A 2BSSB 4HV4A 3V5DB 5B1SA 5AVWB 3QOFA 1VGEL 2GB4A 3TBWA 3R20A 2GLTA 2N1TE 2ZI5A 1LBEA 3FU0A 1YB6A 5E1DA 1KKMA 5E4EC 1SZDA 5AUNB 5D7IE 2GITA 5FO2A 3ESVF 2EDJA 5KBLA 4RAQA 2D3JA 3SO3B 2PPCA 1EVIA 4GW1A 4LCVA 1KAOA 1NNSA 2WHVA 1AX9A 4E41E 1A9YA 4PBWD 3GRFA 1JG1A 5LWYH 1XQYA 4MW6A 4R7LA 1ZLUH 5CNKA 1HY3A 1SQ0A 3GI9L 2CV1A 3C7AA 4OP1A 5MEPB 1W94A 3ES6A 4TGLA 3KLPX 2ZQZA 4OB8A 5GINE 4EW6A 1PKQE 4YJZL 1CFSA 2O6FA 1ZNYA 4A0SA 1OVGA 4BZXA 2COUA 2UY6A 3M1IA 3WIDA 5CCDA 4PJ5D 1YZQA 3DX4A 2ZBEA 2DBRA 3SZ3A 1JS4A 2X88A 2WHXA 1BGXH 5I0VA 4P58A 4MRMA 3DL4A 5KJ1A 1N0IA 4N6RB 1GL6A 2HMIC 2YHUA 4PG7A 2EXWC 2WV7A 4FOPA 3T4YA 1ND0B 3UTOA 2H32B 3QZUA 1M0WA 3EJSA 3ZJ4A 5D2CA 1BQHA 1RHHB 2BVPB 1OI3A 2ORED 3GS0A 4DKTA 2PSFA 3STHA 5JDIC 3CH1A 1HETA 1Q19A 4FQ7A 3Q5GA 4UTRA 2WKLA 4BX2A 1TTPB 2FQFA 2WJPA 4RA9A 2FR4B 4RZUA 1UT1A 2W9EH 4GXQA 3PF8A 3BGAA 5LQBL 1E2HA 1VSUA 3II3A 3CXDH 2AV7A 3UG7A 3UBMA 3T34A 3HM2A 5FPPA 4HFWB 2PXAA 4XGIA 4FG6C 4GZ6A 3ZE8A 2ZU6A 3SC4A 4PJDA 4H8PA 1K3FA 3BE1H 4JFOB 4ANVA 4ZGWA 2EAEA 2FJGA 2ZR0A 3SXJA 3HBAA 1IPFA 2H29A 3H97A 1Q9KB 1GQRA 5DYOA 3CLSC 2Z5LA 5LOVB 1GGBH 3QUXA 4HHAA 2IHYA 2C7VA 4HNVA 4RNRA 1CK4A 4NB7A 3NCWA 4IMIB 3T77B 4EJ1C 4YSEA 4LBVA 3VH8A 2YTZA 3DG9A 4PGEB 5I18H 4PJAA 1N1DA 4MAYB 3HPJB 3N05A 2EDWA 2CCWA 3BUYB 3JWEA 4E9LA 3MRGA 1H42A 4BN4A 1JQ3A 3TLGB 4H60A 4IJTA 1LK3H 1U0JA 3PQ7A 1CSEE 4JUAA 1T2QL 4AQZA 3BVVA 3VV3A 2JIOA 4QRRD 4ZOCA 3SVZA 1RM0A 1WKBA 2FT6A 4K0KB 4QWMA 4LCWE 3RAEC 4NWTH 2VITA 4DRXA 4HWNA 1W9XA 2Y0PA 3P4UA 4LNRA 3PNMA 4XWYA 4CLHA 4FC3E 1A65A 2XIIA 1OB1B 4HGKC 2ASVA 3KTDA 3WB9A 5BUPA 5C31A 2X12A 5EZJA 1XF3A 3FQTB 3B5HA 3STZB 2PJZA 5B1JC 4XPBL 4PZ0A 1QWOA 2YASA 1X7SA 1R10A 4UOW0 2KJQA 2GN1A 1A4AA 1KCBA 5I1HH 2QG9A 3OQOA 3K9NA 4IGEA 1H6TA 1U2CA 2PXYD 4HIXH 1QYCA 3BRCA 5KVQA 3MRSA 4E5YA 1GFIA 2GIYA 3Q6GL 3V6ZA 1JZ5A 2GF9A 3AEYA 2HWWA 3DD5A 4YQEA 4LJYA 3LSYA 5CG2A 4CLRB 1TEZA 1EMTH 1XKLA 1QSFB 4V24A 4A4DA 3EODA 4KQKA 3KG5A 1KJ3L 1BCRA 4P86A 1KCRL 2JB5H 1RP9A 5CEXB 5JYDA 5CN3A 3BLPX 4EN3D 1GPAA 3ZU6A 3LV8A 4XUGB 2RGUA 5LQAA 3K6JA 4ELKB 1GGIL 1YI0A 3C5ZD 4YIHA 3MRDA 1TCAA 4KZCA 1J0EA 4HC4A 2JHPA 5FUXA 1NUPA 5IVPA 3O4FA 3U4IA 1BFOA 3CZ4A 2YK1L 4BXOA 4N2OA 4TWRA 1L5HA 2ZX7A 2NTSP 4NUQA 4GRDA 4OM7A 4XAQA 2YIVX 1J23A 1FZMB 5L88L 4JE0A 4L8CB 1RD4A 4OX9Y 4DGIL 4XC3L 2RGBA 3QI9B 3TU6A 3QY9A 3ZQ6A 5CHNB 4AEHH 4JJZA 4NKMA 4W7HA 4KKQA 3ETNA 3G7SA 4KV5E 4NO2B 1DDHB 3WG9A 1ADFA 3LIIA 4EA9A 4WEEA 1S7QA 5DZAA 4AP5A 4YZWA 5AJTA 4FXPA 5EIIG 4H7EA 2P77A 1VQ1A 3MF4A 3HN2A 2GXAA 1QX3A 5T4HA 1TJ4A 1GYUA 4AQ1C 2OJEB 1OARH 1KXQE 4XLZA 2IIPA 3TBTB 4YPGA 1KYWA 4F24A 2DC1A 3DOSA 4R81A 4YB8A 2CAKA 2AMLA 2HDOA 1D2HA 4CV3A 2RTTA 1S9YB 1Z7BA 1HOTA 3Q3JB 3QELA 1RABA 2Y67A 1E2JA 1WZ1L 32C2B 3BK1A 4KI5E 3ULVC 3L7EB 4Z1MD 3G17A 4LARH 4O4HB 2ZUTA 1M5RA 4JITA 2NLJB 4XRCB 1ENOA 3RYIB 4GX5A 5M7QA 3N2GB 1NCCL 5GS1A 1GD1O 4YRQA 2HXSA 3TZVB 1JZGA 4IOIA 4TYUA 5CSZB 1Y37A 4BKOA 3D39D 1OOEA 3D48R 3U0VA 4D44A 4EIWA 4JZJA 4Z78B 2MKWA 3DTTA 4AJ1A 1PNDA 1LYQA 1UAGA 4JGUA 4RGNC 4TLUA 1IBHA 3IB6A 3TLKA 2ZROA 1XB3A 1KLUB 1HYBA 1ZBQA 5FFMA 3VH8B 3ER9A 4X5WA 4UKDA 1OGSA 4C1NA 2X8LA 2WLMA 4IQ8A 3BIOA 3GZPA 5KOYA 2EBFX 1KAQA 3HVRA 4YBRA 1DGQA 5BSRA 5ARBA 2Y2UA 1QVOA 4HBCL 1WZLA 3FUJA 2PYDA 3LZPA 3KK0A 4D9NA 2F48A 1OSNA 4JZOB 4XVUA 2JLBA 2WPDA 4AG4L 4UU9A 3NHZA 3OKYB 1I7RB 3GCGA 1NP6A 2CCGA 1G2OA 4HK3J 3P9IA 3VAAA 1OX5A 5D1ZI 4PXSA 1W6LA 1C7IA 3O7MA 5TJWK 3AETB 5DS1A 4JLSA 4GRWF 1X7XA 1XU4A 3QU9A 1I9IH 1JILA 3FPYA 5HI4C 4Z9KB 3VNQA 2I07B 3KIPA 4GMHA 1U8CB 2NRDA 3HUJA 5ENVA 4XP1H 4QBKA 4JR9H 3STYA 1ZJJA 1HDEA 1HYSC 3U5ZB 2ZUUA 4P5PA 4A7TA 3DZHA 5I4KA 4M3NA 1OYYA 3ZY3A 5JHDD 1GQFA 1DIGA 3T8MA 4E9VA 1W4CA 3UHFA 1C5DB 2Y07L 4XMKL 2VDNH 1J1ZA 3IELA 4FUTA 1N10A 3DLBA 3OZWA 4F7PA 3GW8A 3TWCL 3BJMA 4PTTB 3R9IA 4HKZA 3PX2A 3E3QC 2VRBA 5F98A 3T95A 4YCJA 2C3YA 3EFBA 1CVRA 3MS7A 1YMME 2D1YA 1EJBA 4PMFA 1NCNA 1YFJA 3GJ3A 3INNA 1E69A 3G5MA 9PCYA 4WN3A 4ZAGA 3FB5A 5IS2A 1WY5A 4Q03A 4YDJA 4K9KA 1QPGA 1IU1A 1OAKL 2J6WA 1BVNP 4TF4A 3ARDA 2JJWA 1TJXA 3L3HB 3IBCA 1ODUA 2ZK7A 2Y1LA 1NX9A 5GRWA 3BVNA 3TVMC 3E81A 1CLYL 3Q8WA 2F1JA 4E5XA 4HHEA 5C3IA 1I3GL 4L3WA 5EO9B 3NC4A 3MHZA 4XMWA 5CILL 3DTXB 1XRLA 2QIPA 5MP6L 4JFPA 1PJAA 1RERA 2VP2A 4Z7WA 3L3JB 2BC9A 4ES9A 3M1YA 4E31A 3C3JA 4FN0A 3KQHA 1NCAH 3C8DA 3H5WA 3PEEA 4HXAL 4MNQD 1Y5RA 3LG2A 3IQXA 3M7FB 4PTUB 5ELIA 4ZU3A 1ZLXA 3TIEB 4LOVA 4TOYH 2G1JA 2GTWB 2G0AA 4GMSL 4S12A 2ZSKA 2QSUA 1E79A 4R1PA 4HV8B 2CLSA 3UBXG 2GWRA 4JOSA 4BBJA 1QQBA 1A7BA 1DHTA 1V7NH 5B2EA 2ZI9A 4JELA 2XQYK 1YVPA 2Z4TA 2F19H 4MA5A 4EBBA 4E30A 3QEMB 3ONFA 4UDXX 1MDBA 2R6AA 1JAXA 2J1ZA 4KNUA 5HKKA 5EHGA 1ACLA 5L7YA 1EESA 1WPRA 4MQ5A 1GR7A 2RARA 2XRFA 1ACZA 1DJPA 3A31A 3LB6C 5K03A 2VM9A 3K2BA 2H9YA 4H08A 4KHZA 5HF9A 2DI7A 1T83C 3HE6A 5ELMA 1TSHA 3GMSA 2WWVD 3T7DA 4PY8I 4MJ3A 1K7CA 1WD5A 1VPLA 2ECKA 2BJVA 1DXOA 4G5XA 4JC8A 5CEZH 3DUHA 3G7TA 2Q76B 4OZ4B 3SY0B 3TQSA 2NNCA 3TNYA 2XUJA 3HCNA 2V4LA 1P75A 1MFAL 5TMDA 1BO6A 2IP4A 4LB8A 5K59F 2VW6A 3KBPA 3LKRA 1VZHA 4M36A 4UAGA 3RVWD 4K6FA 3GGDA 1EP1B 1FNGB 4L95C 1NZRA 2ZP1A 1MJ8H 2F8VA 4WFGD 1E2NA 5EORL 3V34A 3OTWA 4IDDA 2AFVA 2MPVA 5AEAA 1A9SA 1O4WA 2YJGA 3EXIB 4WHCA 3WL7A 2AJ3A 4AQ8A 4ZTZB 3EPRA 4WL0A 3LPLA 1LC3A 1YOVA 2VJPA 5L9DH 3DARA 4RSRA 2P3SA 3S1AA 3ZCTA 5AZUA 4Y2NA 2YFHA 1NGSA 4XCEA 3DW1X 1ZJWA 3IODA 3D8UA 4BAGA 1C8PA 1PX3A 4XVTL 2PMWB 4JI7B 3ZE2F 4Z77B 2PSDA 3FH7A 2R4RH 2FSDA 1OIWA 2X76A 2O5YH 4DN3L 5EP3A 1RM5A 4FCCA 3B9AA 4B6PA 4J3OH 2O72A 5AD1A 4AE1A 5FYDA 5CEZD 4GB9A 3KTAB 2OAGA 3IC5A 2HNBA 3OIVA 4KLCA 3DZKA 5INDA 3IO3A 4XQ9A 4WW1B 1NFIB 1J33A 3P26A 1OM9A 2QZ9A 5JYEA 3MCKA 4MA8L 3FCUB 2VBCA 4G0UA 1WPQA 2ERYA 1EWRA 1OFGA 1IAIL 4GEKA 3CG4A 4G65A 1JIQA 2EINB 3DOIA 2X0DA 2NP6A 1YN6B 2H32A 4JFDE 2QT9A 2BGMA 1A2OA 1OI7A 3TECE 4NYLA 2WLIA 2P90A 1MJ5A 2E21A 4ER3A 1SULA 5LU9A 2Q5QA 4RAUA 3BGVA 3KOOA 1PAMA 3QGVA 3H5LA 4BLUA 3GNTA 1SMDA 1JJAA 2FMXA 2BFBA 4GLJA 4B3RB 4TUKL 2HO5A 5A3IC 1U8TA 3R7RA 3KR0A 2P9GA 1HT6A 3LDGA 3TA3D 2VHXA 2FX9H 1PFCA 2IBZX 3PEVA 1IAII 5IZCC 3O6MH 1E60A 3MJ7B 3ADCA 4BMVA 4DDVA 1H9BA 1H2WA 4GINA 3NIGB 1UM5H 3N2YA 1GT6A 2HVJA 3PKIA 1UR5A 4CDGA 1PJTA 4R26L 1HC7A 4Q6WA 1C12A 1YAHA 4XN9A 1I3RB 2QP3A 1OQAA 3OF6A 4ZOEA 4MUXA 3S29A 3HC4H 4EZIA 3TR6A 3HBLA 1JL3A 1D6SA 3DXFA 1BF5A 1OTHA 1DV1A 4OL0A 3WEMA 4QARA 4E41D 3EPLA 1EFLA 1FYWA 3AIIA 4BFJA 5IQ9A 4ZOLB 1YEIL 3AHFA 3P4YA 2ATCA 3DDHA 1C16B 3QLTA 4BQSA 4KK6D 4OU3A 4Q4CA 2XLCA 1U9CA 4XD7A 2K1MA 2ODWA 2B4KA 2ZT9C 4LSQH 4QRUA 1Z6TA 4PO3X 1XEWY 3AF0A 3BVPA 2RGSA 5FYQA 4JWTA 5GGRB 4CADB 3HCVA 3B9DA 3FAZA 2GNAA 1ZLUK 1LD9A 3O8LA 1Y18A 4NAVA 1Q0RA 3IDSA 1TUEA 3ZE6A 5IV2B 4CMCA 2R6FA 3QYMA 3H5TA 1TYRA 2HF2A 4IIJB 2HA0A 2OA9A 3FB1A 5HHPB 1E1MA 1IZYA 4I2NA 1GFZA 2NW6A 3ZHXA 3FPKA 2QD5A 4YMTA 3ZGXA 4IXNA 4EB8A 4KKCD 2FPKA 3LPMA 4LXXA 1JUFB 3QPQC 1NVKA 1FP4B 1GG2A 2OM6A 2C8LA 3LEXA 5HDRA 5AW4B 4JFFE 2ECPA 3QUXB 3JZAA 2WOYA 3CF2A 3EGVA 4KO1S 4PJFA 1J12A 4U1SB 4BBAA 1L4IA 5T6MA 3K5IA 1HEZA 1KF0A 1Q11A 3I42A 4PJGF 5IMOA 1PLKA 5BW8A 4EUPG 2NZ9D 2CBTA 3AKZA 1C5BH 3WHPA 2YLHA 3HY6A 1EFUA 4JG0L 5HEKA 5EJ6A 4BQ9A 2WJIA 3QZBA 4DLAA 5EFZA 4Y0AA 4V1CB 1DANT 1E6OL 1TYEB 1BBDH 3ZYCA 3VU2A 1L7XA 3MNZB 2E5FA 4Y7DA 4YT2A 4X71A 4PY7A 3QLUA 3AL0C 3ULUE 4DFIA 3QRWA 3LFUA 4NFSA 4GSXA 3RIAK 4DR3B 5IVOA 3LVQE 3PCTA 4JL8A 1XWIA 3KEMA 5EEWA 2JKNA 2P49B 1FL5A 4RO0A 4MD5B 5FUOH 2XZPA 5GJTH 4DLKA 3NB0A 2I54A 4Y6PA 3NC1C 1RMQA 4TYMA 2VQTA 4K7JA 2AMGA 2FR0A 2ZUVA 3OFVA 2Q1EA 3QJFA 5K8UA 2XN9D 2OP0A 1NM9A 4XI9A 5AOVA 4Y2QA 2BFVL 2C29D 2H48A 3ARGA 3G6JB 3CFQA 2W2PA 2C42A 4M54A 5B4TA 4G8AC 1YEWA 2XXAB 3DSNB 3RUIA 3QEQD 1ET8A 5C7XH 4GL4A 3SKMB 5JQIB 1A9ZA 4QDXA 4G0QA 1X7GA 5I9BA 4WAFA 3K6IA 1I14A 3HG3A 4PLKC 3BE4A 3VMPA 5ANMA 1M2KA 4KHXL 4PR5A 4Z95L 2QN6A 3CSBA 3W5SA 3VSCA 4G72B 3SZGA 5H16A 2IYQA 1S3KL 3NHLA 4M7LH 4EZMA 1JDTA 3OE7A 2PRIA 3I1IA 3G5LA 2GEDA 1RWWA 3EIEA 4MKHA 1GYCA 1XMEB 4BXSV 3B83A 1E58A 4XMUA 4S2SA 3FTEA 4E46A 3TNMB 2CFIA 4ZANA 4GP8B 2CNNA 4EMBA 3LU1A 5E94A 3T1TA 3ESUF 4HBQA 4TNFA 1SQSA 4OQYA 4O9HL 4GEGA 4UM7A 3ECAA 3JASB 2I2FA 3ZD7A 3HUJE 4BZWA 2WB2A 4EVNB 5CDYA 1HHGB 3VJ6A 1DSFL 1E9RA 1AI1L 2C4XA 3AXLB 3WKDA 2EG9A 5F5XA 3WMQA 4OGYH 3LQFA 3DYBA 4URZR 1QK4A 1H4SA 3MNFA 4LI3X 2J30A 4PRNA 5IHZB 3QKRB 1L9KA 1U4NA 2OMUB 5AWFC 2E3JA 1CBVL 1ZAKA 1XAGA 2CZQA 2NR6C 4AMXA 5H37A 5T3YA 2C4KA 3LQKA 1OAUL 2V7TA 1X7HA 4HK4A 2GZRA 1KBPA 1SXGA 4PRPD 2E82A 4YCCA 3QCUH 1Q7BA 4E94A 3NZSA 3O4JA 2OPBA 4QEDA 1P4JA 5DSCA 3NK3A 1K8XB 1KVTA 3WN5A 1SFHA 4GP6A 4PRAA 3RSCA 4I81A 4HC1L 4G9DA 4P7BA 4WIAA 4IBZA 5F52A 3HNSL 4NQEB 1Z74A 3UAVA 1P1JA 4LHWA 4P9HC 3A24A 3ARBC 1BWRA 3EE6A 1XEAA 2VUOA 5E2TH 1DOAA 1A6AB 2IANA 3CPUA 2JAOA 4QXGH 4HLUA 3VXNA 1T36A 8ADHA 1ULBA 1BC5A 5L45A 3NHAA 4LYFA 1YB2A 4R2GC 1B43A 4UDTA 4PLWA 1IHDA 1F11B 2C9UA 2BUCA 3QNYA 1MJJB 4LSWA 2F54B 2BKUA 3MYJB 1AKWA 5FB8B 4FJ0A 2HG0A 1VHJA 2BZSA 4QJ4B 3MRFA 1KWGA 2QL1A 3X43A 3EJYC 1BCIA 2O8FA 3SZMA 2UWEB 2AN9A 2PUTA 4K9PA 2Q1XA 1OWMA 4AX8A 2QRUA 2IXDA 3PXHA 2G3ZA 3C87A 3IOYA 2O6CA 2VAAB 1NC4A 4X7TA 2CN1A 2WXPA 1GRRA 3M4ZA 2SBTA 4HEQA 4YHBA 3PFGA 3KWFA 1UC9A 2YN4A 2IHKA 3PS9A 1Y8AA 4LCIH 2ZCLL 4JFUA 5HGAA 4RZSA 4LJLA 2JK1A 1QJ4A 3TZLA 4YRKA 3STWA 4JY6B 4XO9A 4PZ9A 4LE8A 4ZMLA 2B94A 4UC0A 4AITA 4KZPA 4AIEA 4RX1A 3U3JA 1OCOB 5C0RL 4QPCA 5TVKA 4MUBA 2E9BA 3QIBA 3UUWA 3OX8B 4RORA 2XHEA 4DANA 3EAGA 3FY4A 5AKHA 4HWKA 5L6MB 3UV7A 3BMVA 4GMTH 1QFWH 5KNBH 3V0FA 4PRKA 1K66A 4KO7A 3GMRB 1ZEAL 2A9RA 3OKLA 3BUTA 4DGIH 3Q9UA 1TJPB 2GCEA 4ZI7B 2JIBA 1CJMA 4ZS6D 4OF3A 5CJOH 4DLSA 4NOBA 3HKFA 3NQKA 5HGBB 4C5BA 1RNLA 2A6IB 1GCFA 5AVYB 1NAMH 4EO4A 3PRYA 3EA5A 2CLFB 1Z2CA 5I1KL 4EP1A 1QH1B 3TEMA 4D0SA 3C8KA 5LBSA 5C71A 4JI0B 4Y1RA 3KEGA 4EIBA 1U9YA 1X44A 3PD1A 2JFWA 3FNKA 1W0VA 4B85A 4HPOL 3MRIB 2VISA 1J1IA 1OU4A 1RDFA 3HJFA 4ZYZA 3BRSA 2RSLA 2PQ2A 1YNTF 4PJXE 1ZU4A 3GWJA 1NLDH 3UDWC 2B4TO 2IS1A 1D2GA 3CN3A 4EUFA 4BUGA 1OCWL 2YJQA 3CMCO 2GK0A 5F88A 3V8EA 3EYOB 1KO4A 1P9MA 4XVSL 2WWIA 3MAJA 1MWAH 3LF1A 2I8CA 1CXEA 2Q6WA 3ZY2A 1IDN1 5IMMA 5ECGC 1EA5A 3SJZA 2WNKA 4MV9A 4L4VD 1PJSA 5IF9A 2EF0A 5K2OA 4B3FX 4RGMB 4FEYA 5IKCA 1V3MA 4WLCA 1LEKB 4NQSA 3BMNA 3KXDA 1XEDA 4TULL 5CW1A 1WEKA 2V6MA 2JKLA 2NY5C 1KCRH 3QXDA 1SQMA 1BZDA 2B9VA 4YHLH 1M1YB 5LP1A 2BIOA 4FZ8H 1Q9LA 1P7QB 3ENZA 5DBIA 3VR4A 1J0KA 3QUMA 3NHSA 1A9PA 5E6IC 3EOTL 1QIGA 2WYWA 3NZUA 2HDWA 1QIEA 4U9UA 3CQPA 1Y42X 3CF0A 1FZJB 4HIXL 4I99A 1H93A 3ZDZE 1NVVR 4ZXBB 4I8IA 1BU5A 4G9FD 1JHXA 3F6PA 3BPLC 1ZS8B 4QRQB 1SUBA 2QD3A 3L7AA 2DEUA 1SLWA 3F6SA 3GEDA 4RHFA 5ICUA 3V4OA 3QTLA 1CJVC 3GLQA 3O8XD 1G7QA 1DIAA 3MPOA 2Q7YB 2WQVA 1Z4NA 5J3HD 3Q9NA 4A8PA 1AHMA 1T1GA 1AYRA 4A2EA 5J58A 1KLUA 4INPA 5M7EA 5J0BA 3KW7A 5D1ZC 3ZGVA 2F5BL 1BM3L 1TUIA 4BYHA 4KQ6A 1SBZA 1MB0A 2EEAA 3NRCA 3D5QA 1B4LA 2HFEB 5HHXL 3VXKA 1BWMA 2IWFA 4C88A 3ESCA 3JVGA 4O2LA 1CC3A 2E4AA 5JXHA 2OW6A 3S3JA 4B6OA 1MH1A 1CRLA 3IAPA 5F7BA 4OF0A 3QIUD 2A9AA 3P2DA 5A4MS 2ENQA 4G8BA 3PU6A 4FULA 4H13C 4PW9A 4C4RA 1G7JA 1RLJA 1IGIL 1T03L 2JI7A 1MZVA 3KQUA 3ZDFA 1PL7A 4DH2A 5CPFA 5HIMA 2DLFH 3Q7PA 2J9FA 1YQQA 4HPHA 1UM5L 1WP9A 3E9ZA 2DOKA 4KSBA 3T8YA 5C8XA 1O08A 4WFED 4J1TA 4ZKDA 4JFXA 3RA7H 2WBJC 2GVZC 3WO0A 4ALNA 1R0CA 5IMKB 1LCIA 1N5IA 5HG0A 4AZTA 4W9LC 3SS7X 4L07A 4RJ2A 5CFNA 4ZCTA 3HB0A 3QKSA 4I0PB 4OIFA 3I85A 3JTMA 2QE6A 3JALA 3SYLA 5SX5H 1T8RA 3OZGA 3GPSA 3IIEA 5EKTA 4IDEA 5CKAA 2J33A 2NO4A 4TMFA 5DI3A 2DPHA 4NEQA 5L2JB 4G9EA 4ZT1A 5I8KH 2IITA 3VZPA 5EU5A 1RUKL 1E5TA 1U6IA 1NXTA 2O5YL 1DCMA 1EWQA 2DQFA 3QH3B 3GSNL 4G42A 3FMGL 5D84A 4G7VH 4JNCA 2FIRT 2YMLA 3OQNA 4K3HA 3WNPA 3RSOA 1KSRA 3AYXB 4E12A 1L5KA 1CDEA 2OG1A 5AW1B 2OYPA 3CVYA 3ETJA 4BZZA 3SC2B 5EA0H 3PQ5A 4Z9YA 4G25A 1JI0A 1BIIB 1QAMA 3DCNA 3KB2A 2OT3B 5E1AA 3IQEA 4P2QE 1VZ3A 3B9RA 3IIJA 4BEJA 2H1XA 1EFXA 5JJLA 5LCVH 1JFSA 3VR1A 3ZGHA 3FRUB 3QF4B 4NKDB 4UM8A 3ZJAA 4G5SA 3TT3L 4BC1A 5KTYA 1N5OX 3B5EA 2R1YA 3EK2A 4XC3H 2OSVA 3K7UA 2XXBA 2WHRA 3C2QA 6AT1A 5H37H 2FTKE 4DFDA 4N3AA 4FYTA 3UMMA 2YD3A 3MA7B 1WFOA 4KLZA 4WGFA 4MRSA 4FXGC 2E85A 3OBBA 3WIAA 3NJNA 3G1TA 4AYTA 3SJAA 5AKRA 4LWZA 4HGNA 1GQ2A 5JPNB 2ADJB 2P8PA 1AS7A 3MRPB 3RF7A 1RJFA 2HA2A 3H19A 1SCQA 1UBEA 1DQJB 4CQNA 2X2IA 4MWGA 5LP6C 1QBBA 5TSDA 1SJVA 1DBJL 3WUWB 2AF3C 5CZRA 3TXAA 3CLSD 5H5JA 1HQRB 1UOLA 3RHWK 3V8VA 3OM1A 4UEJA 4WQMA 4AJOA 2H3HA 4OIAA 4RETA 2PWPA 3JWDL 1L4MA 3OXSA 1R12A 3I8XA 1UYWL 2WXHA 1AG0A 4MHTA 2JJSC 1VZGA 4AENA 3QW9A 4CIVA 5MERA 3QFSA 1NY6A 3G88A 4UBDD 4XE5B 3IQZA 3BSYA 4KQ1A 2ROYA 3DBLB 3ZE0E 4MCZA 3QH4A 3NTLA 2MCAA 1HEZB 3SDAD 5AHOA 1ZAGA 5CEYB 1TAHA 1CS6A 1P18A 1UXLA 1E89A 2BMJA 5DJ0A 4PJGB 1EMDA 1IY0A 1G8GA 4NMWA 2ZCHH 1FXWA 3KHSA 3S8WA 4Q9KA 4DIMA 3UT5A 4JXZA 5JHGB 4X6FB 4KACA 5LZ7A 4GKAA 4I9GA 4X5OA 4PG5A 4ZPXA 3CFCL 1FL9A 2EQBA 4FE3A 1G17A 1P7HL 1KACB 1AHPA 1AHWA 1HFEL 1NMZA 3TLGA 4PPQA 3IV7A 4Y89A 4OHWA 1SQ2N 3ARDB 3W9EB 2QDKA 2ZB8A 5TH2B 1ZXXA 2E75C 2GJ6B 1XVVA 3KZCA 4IRMA 5C08E 2EDQA 1K92A 2OQVA 2RFLA 1OAKA 4L4UA 4WXHA 1X5KA 1XGRB 2LHAA 2VJOA 5HHNB 2O5ZH 2FPMA 4WZ6A 3BMQA 3Q88A 5TK2A 5CILH 1XNGA 1QFWL 1SOXA 1AGFA 1U94A 4M76B 3CZUB 4TYNA 2XRAH 3GPIA 1M73E 1G4UR 3QUML 2FX7H 4BNUA 3G5TA 3TNDA 2NUTB 2Y06H 2BWIA 4Q1BA 2JIXD 2Z8YA 4P2OD 1EAYA 3WMWA 1JDUA 1QB8A 1ESOA 4Q66C 4Y5VB 3VFGL 1OWRM 3JYHA 2R8YA 4KN5A 4PXYA 2H3EA 4P4KC 4DGVH 2QAGC 5IG2A 2HLEB 4N65A 3D3QA 4ZD3H 3CVWA 5GM2A 3T0EC 4OR1A 2PXYB 4Z7VF 4WSKA 1JUDA 1V37A 2EKJA 3E84A 4LPKA 3QMWA 2ID4A 4WHTA 2BJWA 2W8ZA 2WWWA 4NOFA 4DIFA 3U3RA 2EYTB 5C0JB 2PUDA 2H32H 1FSZA 3OB8A 2CA4A 5KTPA 2XYRA 3ZBTA 2J20A 4EO7A 4G8DA 4O3FA 5JYCA 4FADA 2ZKWA 4LPYA 1CJSA 3TLJA 2BW5A 2GI0A 2IBTA 2YLKA 1TTGA 2OCLA 4P3CH 3KL5A 1TO5A 1YCSA 4QTHB 1YFLA 4OHPA 3IEUA 4RAOA 2F8MA 5A4FS 1VGQA 4WFHE 3VTAA 4WO4C 2A9VA 3PL5A 3VUFA 5DW0A 4IBVA 4AQ1B 3CVIH 3JASA 3PUIA 2HLFD 5LB1A 3ZE1E 1UANA 2BCEA 2XKAA 2BSRB 4EO9A 5HHXH 4P2CG 2GKIA 1FUKA 5GGYA 2G4EA 4BH7B 5IARA 1HQRA 5LXVA 3FMOB 1E4JA 3VH2A 1FU7A 1MHPH 3JATA 3HNTL 4QGYA 2Y0CA 3PPVA 2IP1A 4FKKA 4KH1A 4IEFB 1XV8A 5JJKA 4PGDB 1X74A 1VDMA 3IUPA 3PDCA 4PGZA 1SJXA 2L82A 1JXGA 2Q5CA 3IMKA 1OPXA 4HTFA 3KYMB 3P27A 1XTBA 5DEFB 2ILTA 3ULVE 2APXA 2DIJA 1I7UB 4JM4H 4LKXB 4FLRA 3BWBA 4GRWB 4I9FA 3GJXC 3QDGE 4PLZA 4AKEA 2GPBA 1YEEL 1V3KA 3TZVA 5EZLB 1QYVA 2I24N 2GA9A 4C78A 4GM4A 4OCSH 2A6JA 1WKVA 1FV1B 1DN0A 5I28A 5IUNC 1RAHA 1X6LA 5IJKC 4W4OC 3BGOS 3ATBA 3R44A 3ZS9A 8OHMA 4GOMD 1XRQA 3FTQA 3ZQJA 3JTTA 3KQPA 4BJ3A 4E9YA 3O31A 5GTDA 2W91A 1C3EA 4PWYA 3N0WA 2X1LA 3UAOA 1A7PL 3EEIA 4WKZA 1DIOB 2O6DA 4I7EA 4R0LC 5JPMC 4JZOA 3WYAA 4P4NA 4D99A 1WCQA 4M49A 1JK9A 5TEVA 2UWEA 1OCWH 2CD0A 3R8BB 5DT9A 3QBJA 2NMVA 4KXWA 5K1NA 1TEYA 4P98A 5CVEA 1U2YA 3LZFL 2ZXEB 1KVUA 1LSOA 3ILXA 5ID1B 4ES8A 3IBEA 3TEWA 3VH4A 3AJDA 2YNMC 5DK3A 4GFTB 4XFJA 3K7EA 2CZGA 5IJ9A 5TE6L 2GESA 4R7DB 4EHJA 1MB4A 3LUAA 2WKOA 5I0YA 4QASA 1C0KA 2C78A 1XYVA 5DYIA 1ZHLA 3BXFA 4F1KA 1I3KA 3ZBQA 2OCDA 2QR2A 2QENA 3AO0B 1ICTA 3DSNA 3K0AA 2DTML 1OJLA 1DIHA 5DJXB 1T0IA 2IADB 5DQ9B 4UTAL 4AJLA 1XFDA 4MXQD 4C04A 4RTMA 4KTEH 4EWLA 5AK6A 4IDHA 2JB9A 4INJA 3KXFB 2V9CA 1EFRA 2ZSUA 3T08A 1WK0A 5DD0H 5C7IO 2HM7A 2CA3A 2W9DL 3BH9A 2DPKA 2Z98A 1MI5B 3L6EA 2E27L 3NKLA 5BOSA 4PC7A 1FNSL 4F80A 3EFFA 4YIKA 4QM7A 2ZONA 1TIKA 1BROA 1R24A 4BRVA 3FUHA 4MUEA 2XECA 3ARGD 1UADA 5D3ZA 3MPCA 1CQIB 4XCVA 2W4QA 1URLA 4F15B 5DXAA 3IAM6 4NBSA 5BUZA 4C3VA 5B1CA 1MX3A 1PBTA 4P80A 5FF9A 2EKDA 3F90A 4CTJA 1RS0A 2HCFA 1LA2A 4LEOA 3VDBA 4QUHA 4B4KA 4PZYA 4IHOB 3H18A 1IIRA 3A4IA 1K6MA 2B83A 1MG2C 2Y1EA 1L3BA 2BHUA 1RRKA 3H8WA 1K6EA 1Z0UA 4NYMR 2BSRA 2VEDA 5HGGS 2XUQA 3QLVC 4X6XA 1ZJ4A 5CPBA 5DRXA 1GSOA 1Z9MA 4RFNC 4X4KA 1NA5A 2ZOKB 2FGKA 3K2EA 3TQCA 4E4YA 1MFEH 1ACYL 3MBKA 4LDCA 2CXOA 1PR4A 4NNJA 3H0TA 1EGQA 2M8XA 3ZIDA 5IWLC 2D3WA 3P73B 3UFIA 3DX0A 4R6XA 3QFGA 5J2UF 1PF3A 4ONGL 3N39C 2X5NA 3S2UA 2LVCA 4N4YB 1GKYA 1NDUA 5I6NA 1VGKA 2QVCA 4PJBB 1QQAA 2V96A 2KW5A 2IZ7A 1N19A 2IL1A 3N42B 2FLVA 3GWGA 3I9FA 1BEUB 1LPPA 5KWIA 4HH8A 3CX3A 1FTYA 5EZLA 4K0OA 2P6MA 3ZJ5A 1SD2A 1MO6A 3ZRCC 4XIFA 3ZU2A 3GJ0A 1C1DA 4EG7A 3FF8A 1MMFB 1FV1A 2GSGB 3DPIA 3BDIA 3GRRA 1CE1L 1EQWA 4XFKA 3FPLA 2V3EA 5EZOL 3TM4A 1WMFA 1RFLA 5EE3A 2LCIA 2B3DA 3T0VA 5JXEC 3V0WL 3WXMA 3UTTB 4JC4A 2V37A 1CUZA 4PCKA 5CLGA 4LBEB 5T5QA 3TAXA 4MQXC 4K8RC 4RJKA 1M8FA 3SJVE 2JI8A 1VKZA 2UZYB 3HS8A 3EXIA 2OLJA 3Q8CA 4EBQL 1BVKA 1RR6A 5I7WA 1NYLA 2EUXA 1Z3GH 2AJSL 2ZQKA 4ZMWA 5FF6A 4IWXA 1U1DA 4XLLA 2PW2A 5ER9A 3I37X 1J9GA 3OBIA 1QW8A 3VFGH 2AFHA 3QUYA 2IYVA 2YUWA 3JSSA 3AM8A 2P7TA 1D2RA 4AW9A 1S3KH 3DOHA 2R00C 2BFDA 3O1JC 3VR4H 2UY6B 5ERWB 1LLFA 3H8VA 2E86A 4QODA 4PGAA 2WNSA 5FFFA 4P08A 5F7JA 1VAHA 3DRTB 4K3DH 4RELA 1CLEA 4I5FA 5CGMA 3T3ME 1DMRA 2FN4A 4X8HA 4LRIA 1I9GA 1P4BH 4YMIA 4H6VA 2TYSB 4WDRA 2EC5A 2EIMB 3K4DA 4ACPA 3GARA 3A10A 4QKTA 4YQXH 3G3EA 3V0AC 4JUBA 4UTPA 4Z8YA 5GJWC 5D1QA 2CGEA 1KVRA 1DAHA 1KGXA 2EFDB 3SX4A 2BHLA 3H9SB 4HDRB 4FQXC 2PYZA 2AW5A 4DV5B 3OZXA 5I0DA 3RP1A 2I6GA 4RA6A 3HWWA 3KJ4B 1OBVA 4CSZA 2EIKB 3FRUA 5L7XL 2R0ZH 4ZW3A 1MHTA 1XD8A 4EZBA 4FJ1A 2ZETA 2PMBA 4LAFA 1CQXA 4PPFA 2Z1MA 4GYJA 2QQ0A 1G5IA 4I1RA 3RR2A 5A3QA 4ODTL 2G8NA 1M6UA 1X9IA 5D70H 1GUAA 1NAMA 2O3RA 5CB6A 3JQAD 4DA0A 4V1DE 3QWOA 1EGAA 4HFMA 2GTZA 1QP7A 4HF5L 2HWUA 3U3KA 1X4YA 5FFGA 2RG7A 2W98A 2E4VA 4OIIL 4X3PA 4XDYA 4NJOA 4GW3A 2FB9A 4PZDA 1VLVA 3O03A 5FOXA 3IE4A 1ECYA 3OL2A 1EV2E 2QW1A 2NNFA 5DI9A 4ZOQI 2VTEA 4BMYA 3UCEA 2N59A 3RFTA 2L7UA 2AR9A 2O2CA 2MIZA 1PZSA 3RC7A 4X7RA 4UAOB 1IEBB 2IHZA 4H7JA 2XHZA 3C74A 2BFGA 2AXJA 1Z6JT 1V05A 2P8LB 3JR3A 4XJSA 1UXHA 4BMCA 3A47A 4LF3A 4YDNA 1MCIA 4NC1C 1I4WA 3BWCA 1WSWA 3VNVA 3DHNA 3UXFA 5AICA 4WY2A 3D85A 3Q8BA 4P3WA 3KX2A 4DP6X 2EG5A 1LO0H 4DNLA 4H8QA 3WXBA 2AHRA 4J75A 1E8XA 3LBFA 3HE7C 4L76A 3T5TA 4KAQH 3E6FB 3P9XA 1JL8A 3K9WA 3TOSA 2G7ZA 4BQCA 1EX0A 4FBMA 3OQVA 4IRSB 1YEJL 1FFCA 5INDB 1NC2B 5DGRA 2GK4A 1RPQA 4PLGA 1OAJA 2YRBA 5KDLA 3PNKA 4GG8B 5KNBA 5AALA 1YBVA 3SOZA 5DR5H 1KFAH 2OKCA 3F58L 5KQPA 3KLKA 1CY8A 2F53D 1DEEA 2W6CX 2K4WA 4YXWA 4R0MA 1PJRA 3I3SR 4PJGA 4FI7A 1A3ZA 3W9BA 1OU0A 2ZJSL 4ND5A 2X1XR 4PRDB 1NJ1A 1W47A 2VJCA 1IC5L 3GTVA 4XPIA 3RLFA 3TG8A 3VRIA 5KVVA 4HYYA 3LT5A 5CR9A 1E9OB 1CLZL 5E7JA 3FDZB 4S0ZA 2ATXA 5L95A 1RMFL 3MV11 4W7SA 2QEQA 1ZHNA 3RANA 3RFUA 3N8NA 1FFRA 1Q0ZA 2R5FA 2X4IA 3UADA 4AN4A 2B98A 3GD1C 3VXSA 1N5KA 4KKLD 4Z4GA 1ENZA 4EGAA 3F7LA 3CDGA 2ICWJ 4X6EB 3I6GA 2VISB 1YZGA 3QS2A 5EZPA 3PJEA 1LZKA 1ESDA 1UZ6E 4AMVA 4UZUA 5KAMA 5KX5F 7ADHA 1ECLA 4J8QA 5DYYA 1TTTA 4O1MA 5DWQA 1G6RL 4ALAH 1V3JA 1NW6A 3CNKA 1XB6A 3BWVA 3WGVA 3IBYA 4YWGL 4G5QA 4BEBA 4B50A 4NQZA 2P79A 3U6XA 5K4GA 2JCCB 3SDDA 2X9YA 3BMCB 1SQFA 3QE9Y 1YZYA 1GZPA 2QX6A 1W1UA 2WQ7A 2E9IA 4F15C 1Y81A 4OBSA 1J0IA 2CBOA 1CP2A 5JAUA 4BFUA 2W6JA 1QNLA 1OI4A 1MGPA 2RE8A 2FWMX 1ZA3B 5E70A 2XRAL 2P5ED 3JQRA 1XDTT 1N4XL 3AQYA 3QEHA 3Q87B 5IBUG 4H0IA 3QUTA 4QOGA 4YO7A 3BEOA 1NMSA 2Q7YA 1TUBA 2JGAA 4I3SH 4RXUA 1FMTA 2LLGA 4JYBA 1C3OB 1ILWA 3TCTA 1E3WB 3ZW3A 5B3SB 2IYYA 1BJ1H 1DE4A 3UKJA 4YY3B 4EJMA 1U99A 1KMQA 1RLWA 1KOGA 3ZJVA 1P53A 2Z9CA 4QRFA 3EH5B 3R0MA 3VRHA 3ODPA 1YEJH 5EZYB 5DHVA 5KOHA 4BA8A 4WD3A 2P9RA 4J7XA 2DWDA 3ZDAA 1I1AB 4UHCA 35C8H 4JHZA 5FNVB 3U7YH 4K6GA 2H65A 4M8KA 3GT3A 3W79A 4LCEA 2E9WA 4K9DA 3MRMB 1ETB1 1COBA 5E99H 1EWHA 3O3OB 1NGYB 4F4CA 4LARL 3JATB 4AK9A 3DUFB 4ETQB 2X4UA 3U3DA 5KYYB 5EYPA 3X1EA 3MHTA 1OIXA 2XGMA 2CNYA 4ZTEA 3TW8B 1GZHA 3V6FB 3V4PA 4Y4FC 3JAKA 3RFZA 4MVCA 1WHTA 1UHVA 3T0EA 3ZZTA 2IXBA 1I8KB 4EPXA 4LPXA 2F18A 2YV5A 3MLXL 4BCYA 1PQ4A 1RRFA 2BUAA 2H1PL 4RISH 4KJQC 3REFA 4GBXB 4AXBA 1Z0NA 5AL0A 4BH8B 1TQWA 4ZFOA 3LH2L 4K7PH 4FHGA 1IGCH 1K5NA 3EY4A 4MV4A 4BUHA 4D97A 4EARA 1MAWA 2BFOA 3W7VA 2EXWD 1RUAH 5FOBA 2EIZA 2WYOA 4OLXH 1DVSA 3HMXH 1SUSA 2K7QA 5TGBA 3ROQA 1OXBB 3SF8A 1CZHA 3A1FA 4RKEA 2IV8A 4JBLA 2NZUG 3ANSA 2NZYA 2GA8A 3OT1A 1PDVA 4ZZ0A 2JKRM 4LV6A 1QFPA 1Q9WB 1PFWA 4OD3L 2G4CA 2XWBA 4QHKI 3PQ8A 5K0FA 4BATA 1VG1A 5ETJA 4LBWA 3MGOB 2OAAA 3BB4A 3GT4A 3U4KA 4HJ0C 1J1XL 5C86A 4FG6D 4W9ZA 3IKMB 4P07A 2AG1A 5EJEA 3QK7A 2QRJA 1JGLL 5AKXA 3VR5H 1ZT7B 4UUBA 2QTVA 4M6NH 1XO1A 2M6SA 1ZA6A 4CCAA 1A72A 3ATAA 2Q5FA 4DJEC 2QYTA 2WNXA 3BCHA 3WNDA 3HNRA 1XZFA 1DSWA 1WZCA 2PKEA 2ZDHA 2BFPA 3A36A 5ESRA 4EGQA 5IJVA 1CETA 4V1DB 1OW3B 1MJHA 1QANA 1N7MH 2D74A 2RCYA 3TOVA 1MCKA 2H0RA 3LD8B 3KETA 1B3BA 3HUDA 4IOLA 2JJQA 5SZHB 3VJRA 1N92A 4ENSA 2Z93A 1D4OA 1SWVA 3AVWA 3DEHA 4OHCA 3PCYA 3RRJA 3WRXC 3WMFA 4N47A 2P5TB 1EIBA 1UXGA 1UDCA 5I8EA 4ID9A 3F62A 4MJ5B 3DV6B 1P9WA 4LLVA 3EARA 3H4VA 1K06A 4D9GA 2EDAA 1HE5A 5AW7B 2H0JA 3O6LL 3R3YA 2GTQA 1OTSC 2OVFA 2ROQA 4BM7A 1A6VH 2UYLA 2PL5A 2EKSB 5LDUA 3AG1B 4ZZIA 1IEVA 2GAFA 4K6KA 1TC2A 1SCKA 1FVCB 3UERA 3PWUA 1ZS9A 4M7JH 2Z4RA 1XNRB 4RZCA 3TD9A 3UPDA 4KN6A 5CD1A 3MCUA 2FYYA 4ZAYA 1G7SA 4FWTA 3WIIL 5D7JD 1J8KA 4AULA 4BFVA 4KXAA 1EZUA 2WZBA 1J0YA 3F12B 4YIQB 4JS7A 1NDHA 2P69A 4MQTB 2F58H 5AKZA 4JJ6A 5EEHA 2DWDB 1U3JA 1EZZA 5C53B 2Y7NA 1GUDA 4GAYA 3RHFA 4F2WA 1K4CB 4R5MA 4LRTB 2VO8A 3S2GA 4N7RA 1G7HB 4YO0B 3W1VA 3V1KA 4HGYA 1BAGA 2XV6B 4KYTA 4N5DA 1MY7A 5I3ZA 2ZRFA 1G6OA 2AA3A 2R1WA 3W5CA 3TFQA 4E5PA 2ICEA 1N5JA 1NF8A 2XNKA 2H7CA 1CRPA 2BSTB 5FQOA 2VR8A 4FZEL 2F9BT 3AWFA 4G1MA 2Q0SA 2POQX 4WMLA 3M89A 2R2BB 2APFA 2IEAA 4XN4A 3PL6C 1G1AA 4PV9B 1BWPA 2GD0A 4WXYB 1K2DA 3P0YL 4XNUH 5C0IB 2VT3A 2I91A 3L0YA 3G5ZA 1EXWA 3M9LA 3SQLA 5BZXA 4OY3A 3OEED 1F1GA 4X4ME 3RWBA 4BCDA 3QHPA 4Z3FA 2E27H 3VAEA 4UCXA 3OJ2C 1BDIA 4QRBA 3DHYA 5JXEA 1O8CA 2XN2A 3I09A 3UJJH 3WWPA 4XR4A 2MMXA 5ADHA 1AI1H 2YVQA 4D94A 4QTZA 2E6JA 3VPBA 2WUEA 1G18A 4JDEA 1T5OA 4DDMA 1UPBA 2B7BA 4EG3A 4F5CE 2Z6VA 4RMHA 3E7PA 1NY5A 4HKBB 3KP1A 1BD2D 1DKOA 3DGGB 3L43A 1C1DB 3VXMA 1A7OH 5TPWA 4X00A 4ZZ2A 4B71A 3FCBA 4PR3A 4WXEA 2GYYA 1YR2A 3GN2A 3L7FB 4YGYA 3K0EA 3P0GB 2RAMA 3AZPA 1ED3B 1M8PA 2XJ4A 1QSZA 4KX3A 1IM8A 4V3BA 3JYBA 1GNQA 4W9RA 4Y1AB 4BP8A 3ARUA 1EE9A 3BHBA 1G9HA 1EVUA 2F1IA 1IJ9A 2J7LA 2VXTH 3A3YA 5LBUA 2WIKA 4J3OF 4O2EB 3MQ2A 3JQ7B 1SPDA 2FSEA 4KL8S 4RTQA 1F86A 4A6YB 2O8EA 5BNFA 1UEXC 2J5XA 2BD0A 1JNNH 1D4FA 3PGKA 3IHTA 2FEAA 4GMDA 1QKZH 4LCYA 3ZBPA 4F5WA 4R3WA 2FHCA 2I4RA 3PUCA 2PA3A 3DVGB 5IJDC 2CLOB 2QA5A 2XYBA 4AP9A 4MQ7B 1UXOA 5C07E 2A5YB 4CL2A 1GOTA 4DUGD 1SHLA 4XNYL 4Q89A 4NBRA 4AIRA 1BFVL 3UA4A 4IDFA 3GLGB 2VNIA 2ECFA 5AI5A 2HKFH 2K2QB 1W0WB 5C07D 1NCTA 3GFOA 3LPCA 3TLBA 4CEHB 2I1VB 2R5WA 3WTCA 3RIFF 3ARFD 5BPPA 2RIKA 1NC3A 1YRKA 5CM8B 3G49A 1FTWA 2DJ4A 4Y4HA 4KI0A 3IDXH 4QREA 1H8SA 3EBAA 1V9LA 4LTDA 2HN7B 1BYOA 2CLIB 5HK9A 1AZSC 1EEQA 2CNWD 3HUJF 3RTDA 4A1OA 3AIMA 1MXHA 1SDYA 2NU6A 4MAUL 1SIOA 1U98A 2N4IA 3RBXA 1Z16A 5F1NB 1CICA 1H5BA 1LO3H 4ZUTA 1JHLL 3K80A 5I1KH 4JUCA 3HJHA 4ZFQA 4AJHA 1TA0A 5E1AB 4LT7A 4PRHD 1NPUA 1DUYB 2X1MA 5JZOA 2AOTB 4BNIA 4GNRA 4HDCA 1WQ1R 4C87A 2W38A 2QRZA 4MCMA 2J1WA 3BWMA 1XQWA 3RIMA 3WFIA 3CGTA 1N70A 3NIGF 5F7NC 4P3DB 1J39A 1KRHA 4PREB 1TGVA 1G7HA 4YO0A 3O8XC 4RJLA 3DROB 1Y8QA 1HM5A 3M45A 3LDBB 2HW8A 1F58H 1WUZA 3UMTA 4CG0A 1YCGA 2Q4DA 4BV9A 5AAWC 3SSAA 4EEXA 3ZIMA 4HRAA 1AGEB 1Y4SA 2A4KA 1E2KA 5CIQA 3PEUA 1JHQA 4Q1DA 3OURA 1E66A 4IIFA 2QPSA 1F06A 1T4KB 2BP5M 1D2PA 3TBWB 1MKYA 4YUYA 5K3CA 4BP9A 3U2QA 5JPCA 4XTRD 4F37K 3EOAI 4N18A 3QJOA 5FXCH 3RGHA 4JJHA 2BNRD 1WZMA 3COYA 4NYIR 1LDMA 2F3UA 5I48A 3OKEB 1GPOL 1YDHA 2J08A 4YDVA 5TY0A 4JXJA 1I0ZA 1BQ3A 1CF2O 1OTXA 2H45A 4MYCA 2NTYC 1XVSA 1Q90A 4D45A 4Z7VE 4CQJA 4X4XA 4PS0A 2KLHA 4IGIA 3H56A 1A6PA 3J81A 2DUWA 2BCKB 1L3NA 4ZPVA 1QIDA 5E56A 4M3KB 4EI5D 2WDPA 5SWSE 3GLRA 2I0FA 5BR4A 3GTTA 3PWLA 4FIZA 4WWPA 4P4SA 4M5YH 1G5HA 2D4FA 2OL3B 4TTDD 4YFYA 2JJUA 1A1MB 2J2ZB 1F2DA 1M6NA 1XVTA 2GT9B 3UJPA 4Y1SA 2JG3A 3Q3GB 4K5PA 4O63O 5CCKL 3RVVD 1US8A 2FR8C 1EA9C 1RWVA 2R0KH 2NY4C 2LCQA 4OKVB 1JD9A 2ZR9A 5A03A 2H6UA 3VXPA 4AI7A 7FABH 4IIGA 2YUIA 3M6MD 3W2GA 1S6YA 3KDMA 5TXGA 1Z0IA 4Z7NB 1FS4A 1DEEB 1MFVA 4IFEA 4JFVA 4E2WA 3E9DA 3FFDA 2XITA 3R6WA 4L5FE 3HG7A 3ZY4A 4IKOA 4COKA 3PHSA 2ZIGA 2BTEA 3QQ3A 2CHFA 4NBZB 5ISZA 5E7MA 3AB7A 4BB0A 1XCGB 3HE6B 1HPLA 5JA9A 2QWXA 3F58H 4ESOA 2Q9OA 4ZQCB 4XW2A 2O1SA 4IVNA 3IT8D 3BAJA 4BE4A 3UH8A 3P9MB 2FAXA 1LBSA 1B90A 1BU8A 2IYZA 2TRSB 4X1KA 1IAIM 2WFLA 3GWZA 5CA0F 4R4BB 1QOQB 4CETA 5GRUL 3LBAA 5JO0A 4DJDC 4MAYC 3FX2A 4PG9B 3SNHA 5IYZB 4Q1EA 2WUWE 4ZS6C 1TM2A 2QW0X 3T1VA 3CJRA 3PF9A 2R8ZA 1KZQA 1TTCA 3OKNB 2QVZX 2KI6A 3MRVA 4MA4A 2NYUA 2RQ8A 3KOWA 4JRXB 1XXFC 3CBJB 2VDMB 4QYIA 4PI2A 4M4RA 3SFTA 4LXYA 1KGUA 4O4IB 1P19A 1Q16A 1SKQA 1GZHB 4KROD 2NVUB 3WS7A 4LGYA 1FVFA 4ZAKC 4F8TA 4UOQA 2FPSA 4PJ8D 1PJBA 1C0EA 3D7LA 4C6SA 1HIMH 4PIBA 4RETB 1XGTB 4BQBA 1J5HA 4YPGB 1KGCD 3PPWA 3QDGA 3CLFH 4XN8A 5MI0C 3LRMA 1BXVA 1WFMA 3PFFA 1GITA 1H6BA 1I1AA 4P2AA 1ZGJA 4RVCA 4OLZH 1KXVC 1AN0A 1TVKA 4YFDB 3D9AL 5JD6A 4DBVO 2PUJA 1Y63A 4R97B 4X9GA 2YRFA 1UXWA 1UAYA 4AVIA 4MP8A 4J7AA 4B5ZA 4ANXA 2P78A 1MCFA 3KJXA 1EEYA 3REOA 4DCUA 2NDGA 2ZT6A 3L93A 3FTWA 4FG4A 5JATA 2ZF9A 4U0KA 4A7SA 3DBXA 3RVJA 1RT9A 1CCZA 3UG5A 4FINA 5E4TA 2HJRA 4OD2A 3LC7O 3ZHVA 4ZAVA 5HIAA 1EKXA 1ID2A 1CU4L 2PT5A 2VN7A 1OASA 3K92A 1SDDB 1P0PA 3LWNA 5I45A 1X8XA 1BBDL 1L7OA 3MV9B 1KEWA 1NGZB 4JKKA 1KGYE 5E0QA 1XE3A 5DYNA 4QOKD 2H3NA 5C07A 3NBNA 2XE8A 1F8FA 2H1SA 4EIGB 4UNUA 2PZKA 3GMDA 4U2YA 2OHGA 4LE0A 5DK4A 2ZJ3A 4POUB 3MRQB 3OZEA 2VSOA 1H3NA 2OB2A 1VZIA 4JFQB 3Q7JA 3L6BA 4A7GF 4EZLA 3QPBA 2QMJA 3NYRA 3L0SA 2P7TB 1U1IA 1ORSA 4XNQB 1UJCA 1QSGA 3RVTD 1CXLA 3AHEA 1YNTB 1NLBL 5ESVB 1WCYA 1VPDA 3H8SA 4HB0A 3P9LB 1SJEB 3LPFA 1FB5A 2HFGH 2JGJA 1B0IA 1OAKH 5ALCL 3U0PB 4CT4B 1WA5A 3GGSA 5DTIA 1U2EA 4GG6F 4G0WA 4AV5A 4CL8A 5FBQB 3ZXAC 1YECL 3N0RA 4P8QA 1GZQA 2DQFB 3QH3A 1B23P 1TENA 1NXOA 3WRVA 4RAHA 5CP7A 2EATA 4UHKA 4DGYL 1UM6L 3NDPA 1XJ5A 3MRHA 3HAEH 3RG8A 1ML0A 3GJFA 5CA0B 1M05A 2CDEB 1COWD 2R3SA 2PVCA 3I50L 2FWNA 1DQIA 1NDTA 5TIIA 1WXWA 2F4NA 4FQ1H 2CLHB 4EDXB 1GFWA 1XL1A 4ZAWA 4LSUH 2BGUA 3WLBB 2JF0A 2XCLA 2RG1A 2SEBB 1YYCA 4JFTA 3KFLA 4CKEA 3Q7IA 5FJJA 2QN9A 1KNOB 5T5NF 4ZHSA 4NHCH 2CT8A 3H11B 4BRJA 1ETZB 1FFOA 1HH6A 2MSLA 5DD5H 5DX1A 3VRLE 3M17B 5DVZA 1SNRA 1IEBA 1SXBA 4ERXA 4EUPB 1KSHA 2P91A 4O9HH 4HH9A 1K5PA 3S2IA 3KO8A 4E11A 5CLIA 1U91B 3UGXA 2BX5A 1H3WM 1Z39A 1JFVA 3L3KA 3ILQD 1PD0A 2PLAA 1IGIH 3RRQA 3PGXA 4OLVL 4IILA 1RBYA 3SR0A 4JRXE 4OSUH 4YV1A 4J1SA 3K8OE 2WZ0A 5F3HB 3CAFA 5AENA 2I29A 5G5DA 1M67A 4FQCH 2DUMA 3NIWA 3I2IA 5IVXB 1MV5A 4MBRA 4HWSA 5FB3A 1Z08A 3Q13A 3WFDL 3MV8B 3M5CA 1VBKA 3DS8A 1UA6L 1XQ6A 1C08B 5CK4A 2ZPAA 1S7TA 5KOJA 1NIPA 3IEPA 1CIPA 1BVOA 5F6IB 1AMUA 4FOLA 3VSAA 2OJZH 2EDTA 2HWZH 3B85A 3KLAA 1QHPA 1ETHA 4H0HB 3PA6A 1GZUA 5IR1A 3VYVA 3LL7A 4YVNA 1L5RA 4KUEA 3NGXA 2CR6A 2W4IA 3U1BA 3O9MA 4F58L 2DQZA 4YDQA 1T3HA 3B1YA 2CB9A 3GJ7A 1IEXA 3NTOA 2QKIB 4LY3A 4DKFH 4YX9A 1QHEA 2QV0A 4KRPB 1X5FA 2QN2A 1H2AS 2FDCA 3AU8A 5EN4A 5EKUA 3OJLA 3RNKA 1B73A 4KWTA 5I0ZA 1II0A 1E2ZA 1IGJB 1NJ9A 3I6GB 1OA0A 1CB7A 1JAIA 1CRZA 5KVDH 1PR9A 1W0CA 2I87A 1EVEA 3D8RA 5LG1A 1R64A 15C8L 1RZFH 4XXWC 1CUSA 1F13A 3O3AA 3PF2A 2ARJB 3E9EA 3CZQA 5K4HA 4HQFA 3Q3HA 5DZJA 1V10A 5ISZD 2YD0A 1JFFA 4NESA 1P4AA 5IHLB 4LY9A 3U6XS 1AKJD 4ZUVA 4ENTA 5CCXA 4KNVA 1ZTMA 3B3GA 3PWPD 4PIVA 1KERA 2EIDA 4OFPA 3QVLA 3X3FH 3F6IA 2X4QB 2W2LA 2DRIA 1TUBB 4QXTA 3T9WA 2QHRL 5B6PA 2C00A 3HXLA 4FR5A 2YEZB 3WY4A 4DQLA 5IM4A 4NPKA 1Y89A 4CUZA 3S4SA 5HYEA 3I64A 1P1RA 3HMXA 4JLWA 3MBWB 5F1SA 4NT6A 5EBGA 1J1UA 4MIKA 2QPDB 4XB7A 4CLEA 1PKOA 5G0VA 2VC2B 3AQ4A 2FJHB 3ASVA 2H2FA 4V1DA 1E2FA 4BNDA 3FFCA 3FCYA 1A7OL 2A9NH 3L9BA 4IGFA 2R1TA 2BEWA 4NCHA 3ZJUA 5TQ0A 3RSFA 4GXUM 5E6ZA 2YOAA 2WPDD 1R8QA 1DVQA 3GUFA 3G1UA 2AC2A 2Q76A 1PNVA 5ADVA 3L06A 3H11A 5L4FA 2OGSA 4BTEA 1G7IA 1QQTA 2PCPA 2X2JA 2BEVA 4JL2A 1DUVG 1G7MA 1W8OA 4KPYA 3G2KA 3D2UA 2E87A 4YPOA 4TKUA 3OJXA 1J5OH 5C3LD 2NPIA 5MENA 2OE2A 1J9CT 2XNAB 4ODWA 1NBVL 1VGRA 3Q3CA 5IMLB 2ERXA 3MV7B 4B9GA 1FFGA 5C52B 2UUDH 1VSQA 5JAPA 5FGBA 3OPYA 1WHSA 2CVOA 4QXPA 3OZFA 4NQVA