2VDNH

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnH02
3SCMC 3UYPA 2R0LH 5DRNB 2NNAA 4X7FC 3UYOD 4UTAH 2B39A 1XIWB 2HAZA 2IANB 2D7TH 35C8L 3LSOB 4KPHH 2X4TA 1XR9A 1BQHB 3ARDD 3V6OA 4UT7L 2ZUVA 2LU4A 3ULVH 1LO0L 1AGCA 1T0PB 5E8PB 3JWNC 2R15A 3GGWA 1NPUA 4JM4L 2DOCA 1BOGB 4YR6A 1REIA 4PRPB 1R5IB 2FZ3B 1E28A 1K5NA 3VFWA 2J6EA 3V6FA 3O2DA 1AO7D 1KSRA 5I15H 5FUZL 4IJ3B 3QNXA 3KPPA 4J4PC 2X5PA 1ZGLA 4NRYA 4JFDB 5DJ6B 3VGHA 3C5ZB 4XPGH 2DBJA 5ICXB 4S1RH 4KQ4H 2ZSWB 2ENYA 4X6CF 3RWDB 2VAJA 1RZ8A 2XN9A 4LCWD 4P5TB 5F3HA 4QHNA 4POZC 5TDOA 3UDWC 3FO2A 4OIAA 4ZUSB 1ITCA 1QSFD 3BQUB 2CKBH 5F6IC 1FPTL 3WD5L 3W0WE 4HSQA 3BDBA 3QEQE 1XF2B 3GHEH 4NQXB 2MKLC 2OR8A 4RFOH 3T2NL 3T0EA 4HGKC 2R4RH 2HG5B 4NJ9L 3ROOB 4UTAL 1DSFH 4XWGL 1NAKL 4H1LA 1RSFA 3HNVH 4A2LA 1KN4L 4ZPVA 1ONQA 3ZKNC 4D0CA 1WC7A 5JXAH 4FQ2L 5DZOA 4CN6A 5B22A 1Q0XL 2VR9A 4FQ1L 3CZFB 4EI5B 4WWKC 5A3ID 2ZNWA 5IIEB 3MOAH 1PLGL 5J3HC 5I1JH 4UV4L 2AV7A 4HWBA 5F7WC 4X99B 4M1DL 5FYKU 5I75C 5MHSD 4IDJL 4Y4FD 2AKRB 3CX5K 1ED3A 5D2LF 4ZYKA 4R26H 2X41A 3MNZB 3CMOL 4P5TC 1Q38A 4JO3L 1NGZB 3CVIH 4JPWH 1NCWH 2Y72A 4WGVB 5ESVA 1NGYA 1VFBB 4QRQA 3RY6A 4LLQB 5E2JA 5HDOA 2OZ4A 1CFTA 5HHOE 1FG9C 2Q3ZA 4EN3B 4GSDH 5IMKA 1RZKH 2HJKA 1A21A 3GJFK 2I9TA 4F7CA 2EDLA 4KQ3H 4ZOBA 4XI5D 3LH2H 1B6UA 1Q94A 3VRLF 2UYLA 3CFEB 4XBPA 5DK0A 4ZPTA 1ZXQA 5I8CB 4TNWF 4HT1H 5E2WL 4H88H 4JGUA 1AGCB 2ESVD 4Q9BA 1T66D 4NOBA 4R96B 1YA5A 3D0LB 3MROA 5D9SB 5JDSA 4TSBL 2WWKO 2R4RL 3SJVE 5JHDD 3Q3GB 5LQBH 3Q2CA 1WIUA 1NAKH 3HNVL 1D3CA 4NO2A 4BQ6A 2OTPA 5IGXH 2R8SH 3GMOB 1AGBB 1FP5A 3TPUA 1WTGT 5D5MA 5ANMA 4F7PA 4JPVL 3L5XH 1XCQA 1ZA6A 1T2JA 5D96C 2A6JA 3U6RB 1DVFA 1NGPH 2XICA 4TTDC 4XAWL 1U3HB 3O9WC 2VDLH 1WEJH 4HLJA 4M4PA 5FYKD 2BOBA 3DGGB 5GZOD 2EE9A 5I2IB 4TYUA 1INDH 4PRHD 2P8MB 4MNGB 2NY6C 4UILH 3QQ9C 4OGYH 4OZGE 4XPBL 4TN9A 5I76B 2DMBA 4ZG1A 5TGBA 3S34H 4P46D 1JNHA 2Q86A 5K93A 2PETA 4Y0GA 4PB0L 3WIFB 3V5KA 4ZFOA 2EDHA 4Q9CA 1LO3L 2RHEA 1UXSB 1GGIL 4EN3A 1S7VB 5DJCA 2QV2A 5IBTH 4G9FA 3RX5A 2NXZC 4W6YB 2BJML 1KTDB 1YQ2A 2I60L 1F5WA 5GISH 4ODWB 1FO0A 1QFHA 2XG4A 1XF2A 4NQVB 3CPLA 8CGTA 5IR1B 2VRAA 5DMJB 1MFEH 2YD8A 5CAYB 1WCBB 3IDYC 3NCFB 5D1XD 1BPVA 5DHYB 4LARL 3T0WA 3VD4A 4NQDE 3O3BB 4L4JA 1F8TH 2GT9A 4WWID 3WHXB 2OR7A 1GGCH 5LXGH 4XVUD 3NCBB 3SDAA 3GFUA 2ZSVA 1P2CA 3WFCH 5A2IH 1G9EA 3EHBD 4F3FA 3HRZA 4PYGA 3NZ8A 3C5ZA 3MRBA 1JK8B 3MCKB 4WW1A 4GAGH 3FRUA 4L3EE 5EIIA 3UTQA 4XAWH 4LGSB 2KPNA 2Y07H 4UOW1 5AUMA 1U42A 1HQRB 3SQOL 1IC7H 4JVWA 1FL5B 1K2DA 3H7LA 4EIZC 4AQ1B 5A16A 4YXLL 3FAWA 4P4RA 1ED3B 5H94A 4PFEA 4I1NB 5DA4A 5AZEH 4DVBA 5FYKL 3NCYP 2HFTA 4NKIL 3MCLL 5F1NA 5MP6L 5D7IB 1KIUA 4ZAKA 2VABB 2YD5A 5EIQA 1JI1A 1AHWB 3IDJA 5LCVH 3LKPA 4KAQL 4I3GA 3EBAA 3FB5A 3O45A 4PG2A 4ELMB 1XCTA 3TVMB 5IIEA 5AWNL 5HHMB 1KXQE 2FZ3A 4OJFH 3VFRB 3MJ7B 2I60H 1I9IL 4ONOA 5JPMB 3BH8B 3WKMH 3QDME 4N8VB 1RUAH 1MLBA 4PGDB 3BXNB 4K9EC 4JDVB 1U91B 2VITB 5D71L 4MDJA 4LARH 1IKNC 1XH3B 3O0RH 3D85A 4PJXF 5JPNA 1NBYB 4PREA 4XNQA 3WFCL 3WFHB 1U95B 4J3SA 4F57L 2HLFD 1MI5E 2Z93B 2WLYA 2NY2C 2WW8A 3O4OB 3DI2B 1RZ7L 3L5IA 4GXVL 1NGQH 1JPTL 3CC5A 4GMTL 4NBYB 3G08A 5BCAA 2FJFB 3ARRA 3U0PA 4LKXA 1LE9A 3KNBB 5LVEA 1CXKA 2JJSA 1G7QA 4XXDB 2R56L 1PFCA 1S9YA 3HLAA 3KLHD 2CQVA 1DLFH 3B8YA 2OLDA 3MMEB 3MRPA 3VGAC 43CAB 1KPVB 4WUUD 2HFGL 4YIQB 4Y5XA 2I27N 5F7KC 4DUVA 3PL6A 1UQSA 3QG6A 4D9RE 3MLPA 3VXOA 1KIQA 5LCVL 3GUTA 4JJ5A 4JHAH 3SCMB 1FNHA 2VC2L 4PLKD 1JF1B 3RZCC 4WWKA 1FBIL 5DQDH 3BPLB 3PNWA 3JTTB 1FIGL 3QQ9D 3WO3B 4Q0XL 2QADD 2KUTA 1G9MH 4D9LL 5M94B 3ZLQC 2YK1H 4M7ZB 3EKCA 1OSZB 5ETUB 2IQAB 2R23A 4WI2A 4X8JA 1NGYB 3K81A 4K7PH 3O0RL 1BWMA 4L29B 3CH1B 1DBBH 1FYTA 3FQUA 1NDGA 1NBYA 4PREB 4LSQL 3FN9A 2ARJQ 5ID0A 1MEXH 1OY3B 3RUGB 1MFAL 3BI9X 4UNVA 4JN2A 5EULV 3ZYZA 4F57H 2MWCA 1FFNA 1KCUL 4R8WH 4IOFC 1P7KB 1Z6JT 2Q7YB 4LPTA 4NBZB 4YHNB 2JJTA 3UTTB 4JFQA 4XT1C 1CXEA 3G6JF 5FDWA 4ISVA 4GMTH 3U4BH 3UTSB 2R2EA 4G8GD 4JY5L 4E42A 4KJQD 2F8OA 3UTZB 4DGVH 5AAWA 4LASH 2X7LB 1KLGB 3OJMB 4HBCH 4QHMB 2OCFD 4NUJB 4W4NA 2NR6D 4DUXA 3E6FA 1SBSH 3KJ4B 5FKAB 2R1XA 3VFOB 1MAMH 4N0FB 5CJOL 4GMSL 1G9NL 2CLRB 4UUJB 1A64A 4C83B 5DRXA 2GJ6D 4Z76B 3TO2B 3OKLA 2VR5A 3TIDA 3X14B 2C4XA 3LDBB 4HGMA 4PJDA 4BQBA 2IJ0C 1PEZA 2AJXH 1FIGH 5F96L 5L7XL 2CDEB 3FRUB 1G7MA 3TH2T 3ULVD 2VLLB 4ODTL 4JM4H 2PYFA 4ORZC 3V6ZB 1Z3GL 4PY8I 3FN0L 1CZ8H 1J5OH 1ORQB 2IQAA 3F6LA 3VXMD 3WE6A 4LSQH 5IJVA 3BT2H 4XMPH 4MJ2A 1YEFL 2A1WL 1BEYL 4LF3B 3MC0A 4ZTPL 5C9KA 4TTDD 2HP4A 3GHBL 4NN6C 5D2LE 5CWSB 3BKYL 3ESVF 2EDJA 3B9KD 1ADQH 25C8L 5LWYH 2ID5A 2W59A 4UIKL 1TETH 4U05A 2VXVL 3REWB 3BSZH 4UAOB 1QSEA 5I1CL 4XHJD 2ICWJ 5DJ8B 4PRHB 3HPLA 4HPYH 2DLIA 3TJEH 3SGJA 4DQOH 3STZA 4OT1L 3CFBB 4RMRA 3DYPA 4QYOA 1N7ML 3O3EB 4MDIA 4MNGE 2MCPH 1CF8L 4KTDL 4UU9A 1CXIA 2X4TB 2YRLA 3QUYC 3ZE1F 1F90L 2V2TA 2PW1B 2AXFA 3PNWB 3MO1A 4PJ9C 1FO0H 1KB5L 4QHMA 2H1PH 3QIWC 3H7BA 3NFPB 1V7NH 2EEBA 3W11D 5JUEH 3GKWH 4BZ1L 3JXAA 3ZKMC 5F7EH 4GKZA 3RVVC 3SPVB 4JFEA 5JXEC 4HIEB 4XPTH 3LCYA 4FQ2H 3OKLB 1QPPA 5D1QA 3OGOE 5C9JB 4ZAKB 1FZJA 4YDJA 1DVFD 4XXDA 3O3UN 3QUMH 4P5TD 3BESR 5EU6B 3NZHH 1RZJC 3MRIB 2O5ZH 4APQC 1SVZA 4PP1C 1TZIB 3QO0B 4MNQB 4OTXL 2R0ZL 3P4OA 1JPFB 3I3DA 3L3GB 3GJEB 5DJYB 2B4CL 3FQUB 5JOPD 3BQUC 4O4YH 1I1AA 2BVOA 3D69A 4TRPH 3RY5A 5EUKA 3F62A 1KLUA 1DQDH 1QVOA 5IW1B 3BKYH 4L9DA 4O2CA 4TPRH 5F7YC 3VFRA 4F33A 1FORH 2DMCA 3CDGB 4UBDC 5KVFL 5FYLH 5T3ZE 3ZTNL 3WFBL 5AG9A 2FR4B 3CU1A 4XNXH 5CINH 2PYEE 5HGAA 3CK0H 4UIMB 4D9QD 4QY8A 4NKMB 2NYYC 2Y36H 4L1HA 5FV2A 4PY7A 3FFCE 4JHWL 2DTML 5HYQA 4JFYB 4Y7MA 4WJ5A 4I4WA 4XPHH 5H35B 2Z8WC 3D18B 2HLAA 3BYTA 1T7VA 1YZZA 1LEKA 3PP4H 4NM8H 2APBA 2VXSL 2ICEA 2EO1A 3VXNA 3VXPB 3U83A 1IAIL 1QACA 3VGGA 1FNEB 4QTHA 4P48A 3K46A 1KEML 3KPLB 3UTZA 3GUTB 3QUML 1UZ6E 1KULA 1BFOA 1QSFA 5JPMA 1P84K 1YC7A 6FABH 3T8XB 1BIIA 4J3XA 2O5ZL 3FO0H 4ISVB 1CWVA 3UJTH 43CAA 3HHRB 1FJ1A 2E6JA 3EYQC 4QKXB 3DX9B 4WI5A 2MJWA 2DBLL 4D94A 5ESAA 5INDA 5J12B 3VMNA 4PRPE 3T2PA 3GSXA 1EMTL 1CGTA 2RQ8A 4BH7A 1X7QA 3MGTB 1RK1A 1ZS8B 1UJ3B 1KJ2B 3NA9H 3GMPB 3CH1A 1OAXH 4Y4KA 1IBGH 3OG6B 3OWEA 3FQTA 3QEQB 2M8XA 4PJGF 3QUZA 5DJAB 4YDLC 1EFXA 3LKSA 2G5BB 1C12A 2XOTA 5CGMA 1AI1L 2VO5A 2HT3D 1MHPL 3FT2A 4PJXA 3TN0B 4Y89A 1VESA 4JHWH 2XN9D 1GHFH 2WQRA 4UINH 1AQDA 4KQ3L 1HWHB 5KTEL 2AQ2A 1F8TL 3DIFB 3JUYA 4P23A 2I26N 1PKQB 1BGXH 1AY1L 1UQSB 1T22A 3QG6B 3W82A 3ULUL 4PJ7F 4GKZB 5CUSH 3SPVA 1XF5A 1N5AA 2VXSH 4H0IA 3PP3K 4KJPC 4NCC2 2JK5A 2NX5D 2H26B 2MNUA 2Q6WA 5KSBB 3V5HA 4BUHA 4ODVL 1I7UA 1UXWB 3K8LA 3P4LA 5DO2C 2FD6L 1P1ZB 5DFVD 1QYGH 5DVNA 1G7HB 4PGCA 4NO5A 1JHKH 4RAVB 3GIVB 4CKVX 3QDMD 4OGAD 2D4FA 2GQHA 5FF6A 5FO9B 1T4KA 3LEYH 3RNQB 2HA1A 1V7ML 3U2SB 2XI9A 1A3RL 3QUKB 3QXAA 4YHPB 2ADFL 4V1DA 2AP2A 3GI8H 5C09E 2G75B 3P0YH 1EZVY 2EC9T 5HYQB 2J2ZA 4M5YL 3IS0X 4KJYA 4LHJB 3FN3A 2EYRB 4RFNC 2X4NA 1AC0A 1PSKH 5ELIA 1JI2A 3ARXA 1Q1JL 4HUVA 5ADOL 1FE8H 4PRPD 4OCYL 2CDGA 5KSUB 3HE6B 5CEZL 2VUOA 4GRWE 1YC8A 3KPOA 2A6DA 5HI3C 5ESVB 3EFFB 1PX3A 4GOSA 3QJHB 5D7KE 4Z0BH 1AI1H 5IOPA 1F4XL 3BZ4B 4MB3A 1AR1C 1J1OH 2NXYB 4LOUD 5D71H 1GHFL 5I76A 5ECJE 1KLGA 5JO5A 4XB7A 5IBTL 1EVTC 2H6PA 2DQGL 4FNLH 4OF7A 4ENED 4HZLB 2AXGB 5ITFB 3HUJA 1MFEL 3RIFK 1WAAE 5EU7E 4XC1H 3CD4A 4ODVH 1AXSA 4PLNC 2EDTA 4K8RL 4X6EB 4PJEB 4MJ4A 1A6UH 2K3TA 3GMQB 2GK0B 4MAYD 3WS6A 3EOBB 3L7EB 1W2KT 4M7LH 3MBEB 4P4KD 5MENA 4DVRL 3ZKQD 2P5EA 3TNMB 1J88A 3T77B 3SOBL 3VWJC 3PP3H 4QO1A 4I2XA 4KUCD 1NC4B 2VAAB 3HI6L 5F3BA 4QXWA 4W4OA 2YKLL 4LRNL 3WE6B 4LLWA 5F7LB 1EA9C 3WS3B 3DMMB 3RU8H 1P2CB 5F89B 2YRZA 3S3SA 5FUCE 1FNEA 4HK3J 4JFHD 2GUOB 2EDWA 3RL1B 5IFJA 5EBGA 3D69B 3WFEH 4JVUA 2GITB 3KJ6H 4N90E 2WSKA 2F53A 3PHQA 3HMXL 4P4KC 3QO0A 1TZIA 1NSNH 1QPXA 5DQDL 5CHNA 5DJ6A 2D0FA 5TQ0H 3UJJH 4AT6A 1NGXA 3OXSB 5C6TH 5LGJA 2SEBB 1N8ZB 1IC1A 3RIAF 1S78D 3IU4H 3D39A 3GSVA 2OQJB 1T1XB 4RWYL 2E7HA 4JFZL 4BSVB 4HK3N 4UB0H 3VFPA 2DQGH 3N0PB 2OR9L 3MZGB 2CR6A 3QDGE 5F9OH 4HV8B 4P2YA 4ZUVA 2GSGB 1NDMA 1C7TA 5J6GB 1WBXB 1I3GL 1RPQA 2CIKB 4HLZG 5JLZA 4KJQC 3BP5A 1QHOA 4C56A 4HEPG 5FCSH 1ZGLB 15C8H 1S7RB 1BLNA 1MJJA 2ERJC 4X4MA 5DGQA 2ZUWA 4MNQE 4NPYB 3FQNB 4JLRB 2BOCB 2DD8H 3F8UB 2Z0BA 5D5ME 1ND0B 5ANME 4L3EB 5IMLA 2I9LA 1NANI 3M17A 2DLHA 1C5DB 3DMMC 4QTIL 4LRNH 2W91A 3QJHA 3WL9A 4OCLC 4ZDHA 1EO8H 1EV2E 1I3RB 5IESH 1DUZB 3W5MA 3RIFF 1SBSL 4HGWA 5DD3H 2BX5A 3V5KB 3EDJA 5TJWK 4LSRH 4LEXL 4OSUH 5GZND 3NCJL 2OL3A 4J6RL 5CEXB 5IBUG 4NN7B 4BFGA 5CGYD 3H7BB 2J5LC 2GAZA 3VFTB 3CLFL 1AFVL 3QDJE 4OAWA 2R0KL 4MXWL 1KENL 4OGAC 1OD7A 1IEAB 1I8LC 3H9HA 4ZFFA 1ACZA 3QHZL 2IGFH 1KIRB 1PQZA 1FBIH 5HPMA 4PJIA 2A1WH 3CFKB 1AJ7L 3DETC 4KI5E 2Z92A 5C0BA 4G80B 4JVPA 2CXKA 4LKXB 1CD0A 1BVZA 1I9JH 3MLZL 8FABA 5FUZH 15C8L 2CJUL 3P0VL 3QWOA 4WW2A 3JTTA 5D9SA 3H9SE 4YK4B 5I1GL 4KRPD 3TJEL 4RAUB 1YY8B 3RTQB 3RL1A 1F6AA 4M03A 4OLEA 4J1UA 3G6JA 3QEUA 3MJ9H 4XPGL 1HKLL 5EOTA 5DRNA 3X3GL 3HE7C 1T20B 3BN3B 3S37H 1CTNA 4MA3B 2FIRT 1I75A 1KJ3H 3PWVB 1FFPB 3G6AB 3ILQC 4K7PX 1WF5A 2P8PA 5DGRA 1KCSL 4K94H 4HGWB 5ACLA 1V7NL 4M6MH 1B0WA 2XZQL 2ZPKH 4JY5H 5KJRL 4X4ZA 5HDLA 1AR1D 4LCWE 3HTLX 3VH8G 1H15B 3L7EA 3LRSB 2EZ0C 4DKFH 1J0IA 1H3VA 1AXTL 3HZMA 3LIZH 3W11C 3B5HA 1EJOL 3CDYA 3BZDA 3IETA 1K8DA 4LIQE 1YDPA 2P5WE 2HMID 2X6MA 1CE1H 4HWEL 3NCYS 4LLWB 1KN4H 3ES6B 1M71A 3QNZA 4Z5RB 4E0RA 4M3JA 1CFSB 2X70A 1VFUA 2P7TB 5FCUL 1TFHA 3PUCA 1Q0XH 3PDGA 2IFFL 1EHXA 1AJ7H 2BOBB 5SWSE 2V5TA 4W68A 1AGFA 5DRWA 2C26A 4I3RL 1NC2A 5HHVL 3IB4A 2O5YH 4P3CH 1WJ3A 5TGBB 2DJUA 2APVA 1N8ZA 3LN9A 2AEPL 3CMOH 4X5WA 4L4VE 2WBJC 4LCYB 5A40E 5GGTL 1HKLH 4NQCB 1MI5A 1AXSB 3ULSA 5DMYA 2ZOKA 2H6PB 1JUFA 2VLME 4ERSH 2AVGA 2X4RB 4M1CC 2HVJB 4PJEF 2OSLB 3HMXA 4L4VB 1OAUL 1DQML 4OD1L 2W0PA 1AKJD 3EYFA 1T1XA 1WZ1L 5JR1L 4G9DA 3WFDL 4NO3B 2XKNA 1JRHI 3IDXL 2VLMD 4GW1B 5HPMB 1A47A 5A16B 4KKLC 5KSUA 4JEGB 3CVHH 3L3DB 4O2CB 4OCWH 5ESQA 4MA8H 1EJOH 1HH9B 1AE6L 5HHQB 4IRZH 3TO4D 3SE3A 1U8MB 3GKWL 1A02N 1QSZA 1JZ8A 4X4ME 1F11A 2DDQH 1MCWM 3EYVA 3UJTL 2Y7QB 4L9LA 4HEME 5FCUH 4G6MH 3KPNB 1IGIL 3RA7H 1XIWD 5GGVL 3VE0A 4IOIA 3TVMA 2VN4A 1P6FA 3ARVA 4RMSA 3KLAB 5EPMB 4Z95L 4QLRA 4NO5B 1WEJL 3ZKXC 3GMLB 5ADPL 2D0GA 4PJ5A 4X6FA 4OTXH 3QDAA 5DMGD 5E2UH 2HLAB 3QWRA 4OFYD 3VXUE 3O9WD 5C0JA 2A6JB 3IDNB 3QG7L 2HYMA 4KTEH 3T0EC 4PJEA 3JVGA 2CUMA 4D0CB 3BKJL 5GJTL 4XPBH 2FEDC 3QPQC 4P3DA 1ZGLP 2IAND 4HDIB 3B9AA 5EN2A 2EIZA 2X9XA 1OQOA 3C2SA 4PD4K 3EJJX 1WV7T 4MQ7B 1C08B 4LSPH 1MUJA 1RUPL 4FOMA 1HCVA 3RBGA 4M7LT 2B4CC 4Z7WB 1FLRL 1MJ8L 2N7AA 5MEQA 1A7QL 3CFBA 3I3EA 4FFWD 3CSBA 2XQBL 5JLZB 2VLKD 3NIFF 1MCWW 1Z9SA 1HSBB 4F33B 2XKNB 3QFJE 1CGVA 3MNZA 1T89C 4H1LB 2ZNXA 3S3JA 1QO3A 2E7MA 1MVFA 5EO9B 2XZZA 2BVPB 3V4PH 1L6XA 3FMGL 5DMIH 4I5BB 4LCCA 4X6CE 4JDTH 2HJKB 2V2WB 5FYJE 4U6VL 2GTWA 4AT6B 4E0RB 2DQCH 2XTJB 5EO1B 2NNAB 1J1XL 4OGZA 1OARL 2AJ3B 4MYWB 4YWGL 1IAIH 5GGVH 2W38A 1NFDF 4L8CB 3QDGB 3BKMH 3MUZ1 1IZKA 3M8OH 2IH1B 2F8XC 2H2SD 3HZKA 1JPST 3DGCR 2GJ6E 5CD5C 5IBUB 2WUBL 3IXAB 2FR4A 4BKLA 4KKBC 3MOAL 3LRGA 1P53A 1CDJA 1AQDB 1PSKL 1SYVA 4NN7C 3VXSE 4ZMAT 2AQ1A 5E2UL 3GNMH 1FE8L 1EEYA 2VLJB 5B8CB 3JSSA 2C3XA 3RIAK 5CEYB 1S9XA 4HWZA 3WCYA 2E8ZA 1QVOB 4LKCA 4F15B 3CVIL 4P46B 1A5FL 4LMQE 3FO1B 3FB7B 5FOJA 2OL3H 3CSPA 2X4RA 1MCJA 4MDIB 3O2DH 1QSEE 3UAJC 4AG4L 3EGSA 1J1OL 2F58L 4WW2F 4XXCA 1F6AB 2HKHL 4CJ1A 2F53B 3VXRB 4OI7A 4KK5D 3OKEB 3VXPA 8FABB 4M8QB 1J8HB 4NFCA 1L0YA 3EYOB 1TJHL 3BPOB 3IDUA 4HMDA 3QQ4A 4RFEB 4GG8B 2NY4C 3N9GL 1LGVA 4HJJL 4R90L 1N2RB 4C59B 3VFSA 5KTEH 3Q0HA 1L4IA 5DD5L 3J8F7 2H32A 3HAEB 3NOIA 3I6KA 5C0AA 3H42H 4Q9RL 1H15A 3LRSA 2DQCL 4JFEE 4PP1D 4FHBD 4UQ2A 4BH8A 1GZQA 4K3JL 3WUWA 1D9KB 3AFLA 3M1BA 1YPZA 2VISB 2ORBL 3TBWB 2C9AA 2YPVH 4P23D 1QYGL 1TCRA 1R3HA 2JJVA 2CKBB 4PGBA 1K3ZA 1NMBL 1QFUH 4M93C 5FIEA 4J2XA 3BWUC 3SN6N 2R39A 3WFEL 3V52L 1D5MB 4YZFE 1H3WM 3L5HA 2H9GA 2M26A 4LCIH 3T09A 3QIUC 4WVRA 5L8KB 5I1IL 4U2ZA 2OL3L 5CWSA 2BFVH 1XF3A 4FABH 4KVCH 4P9HC 1M6OB 4JQIL 4Y5VA 1LVEA 4KTYA 4APQB 1Z0NA 4KJWC 1W0WA 4JZJB 1P5UA 4NDMA 2P43B 4I2XB 2XYCA 4OFKA 4MGXA 2C3VA 4XBGB 5EB9A 1I4FA 3KHQA 4PJAE 5FHBH 1TJHH 3RWEA 4XNYL 1I3GH 4D9LH 3REVA 4KWUA 4X5LA 2W0FA 5C0CA 4KK9C 4YC2B 4BUGA 3TA3C 3SDDB 3IYLW 2EIZB 1RZFH 1CT8A 4YNYA 5GSVB 5HDBF 4OKDA 4TSCH 5DD5H 3BGFB 4KHTH 3AROA 5DEFA 4ELME 3QIWB 2FB4L 4R3SB 5GIRA 1JWMA 3DXAB 5T1KD 3VRLE 2BSRA 3MRRA 2BNQA 4JFOA 1YN7B 4P57A 2BY0A 4MLIA 3VI3F 1G1YA 1P1ZA 2ADGA 2F54D 2IPUK 1QRNB 1MWAB 4YHYB 3U4BL 3LS4L 4OBSA 1X7QB 5KSAC 4EVNB 4C54A 2W65A 1BD2B 3VFGH 4MD4A 4R97C 3HC0A 4DGVL 4LASL 2ADIB 2WIMA 1FVCB 1BAFL 5FYKH 3T4YB 4U3XA 2H9GB 4PJHA 4KK6D 4PJBA 3RHWK 4E5XA 4NZDA 3Q1SL 1AFVH 4OFYA 4V1DD 3SJVB 1KCKA 3QPXH 1RI8A 2PUQT 4X8JB 4OCRH 4Y5VC 4GMSH 5SX4I 4NM4L 4IHOA 3LPWA 1U3ZA 3L5JA 3B83A 3P9LA 4Z7VA 3LSOA 3GMMA 4WY7L 3UZQA 1UT9A 2IGFL 3GMQA 1X5FA 2I24N 2J7LA 3BAEL 4G6AD 1RUAL 3UJJL 3VXTA 1FN4B 3UTSA 1YUHB 4JPIB 2YN5A 4OZHB 1CZ8L 3R1GH 4JFQB 5JNYB 3UTPD 3SDXB 1E4XI 3GB7B 1MHHB 2ZSWA 3G5VB 5F8RC 1RZFL 1CT8B 4YNYB 3NFSL 2CJUH 3P0VH 5D7KD 4X7CC 3TP4A 5CFHA 4NJAH 1QA9B 4Y5XC 4Z7VF 2GT9B 3NN8A 4JJ5B 5IW6B 1QRKA 3BH9A 3BGMB 3JWDC 2YEZB 5D1QD 4U6HA 5C0CD 1YEDB 2WLZA 5DRWB 3V4VH 2DKSA 1JN6A 4IS6B 3K2MC 2VR4A 4X9IA 4WI8A 2WBWB 4U1KA 5DUPH 4UUJA 4ODSL 4P2CG 1CL7L 2GTWB 2P24B 2PR4L 3DV6A 1NCAH 1ZGLM 4N0FA 2WINA 3LS4H 4DQOL 5EZOL 1MRCL 1SMAA 1PYWA 1EFQA 2FGWL 3T3PE 2OXHA 4L8SB 4ZNEE 3T3MF 2ZCLL 1FIEA 3EYSL 2IH1A 3KS0H 2W07A 4I4WB 1EJ6A 5H35A 1L0QA 1BMGA 3EIFA 3A6BL 4ZUTA 3SJVA 3WXWL 4C58B 1AH1A 5J0BA 5FDWB 5I8OH 3MUGB 3N1QC 2PYED 5E7BA 5H2BB 4XWOD 3KXFB 3ULUE 4XPFH 4UQ2B 3ECBB 1F02I 3C6SA 4UV7H 4CMHC 1VFMA 1XGQB 4XP4L 5ERWA 3WUWB 4Y16A 1NUNB 1HIMH 3C6LD 3K8KA 1QFWM 2VYRE 4BZYA 3SDAC 1CDGA 1N0XH 4J4PD 4YXHH 1A6WL 1MWAA 3R1GL 4MJ6A 5GGUA 3PJSA 1TJGL 2CUIA 2O5YL 1FAIH 3N1FC 5I1HH 3L7FB 2VDQL 2Q7YA 5EOCJ 4FXLA 1TDQA 1TQCC 1N64L 4U1SB 5KS9E 4Q9QH 1ZHLB 3WL9B 1FAKT 1VGKB 4M61A 4U1NB 4HWBH 4IRSD 1SM3H 1DQJA 4RGND 4U6XA 3LKSB 5I1GH 1NCAL 3CFKA 1MCCA 4Y2DC 5C08D 2CLZA 1A7OL 1PG7H 1YYMH 4Q2ZB 2FGWH 3VG9C 5F1SA 1OGTA 4DKAA 4YEEA 3WFDH 4NCDA 5HHOD 2P44B 3GSQB 1S78C 4JANB 5DK3A 5EG6C 3IVKB 4NDMB 4A6YL 1J10A 4LP5A 1YEKH 2A6IA 1U3HC 5HVGB 4APQD 5IFHH 1C08A 2I07A 3DV4B 1KJ3L 4YHLL 3V5DA 2AEQL 4YHOH 2IANE 4D9RD 3FQXB 3MFFB 4U1LB 1GPOL 5EU4A 3O11A 1KCSH 4K94L 4XPHL 2EH8L 4M6ML 2HTKD 1WWCA 4G42A 3OJ2C 4HG4K 3VXOB 4POUB 5D6DA 2OMBA 1A7RH 2D9CA 4Z7OE 3HCVB 1E27B 1TZHA 1B3JA 1B0GA 1G7JB 3BHBA 3OHXA 4TNVF 3FB8B 1F13A 2UWEE 3RWIB 3EYOA 3RWFB 3NPZB 2VZSA 4KI5D 4PV9B 4R7NA 1PYWB 4JRYE 3TYFB 1KJMA 3D2UA 1UA6L 3DROB 4ELKB 1BVKB 1BLNB 1YJDH 3H9SD 5AAMA 1G1CA 3R8BB 1RIUH 1P9MA 32C2A 4UIKH 2NQCA 2X70B 1CLYL 1HWGB 2M2DA 2LU3A 2VWEE 3QQ3B 4G6FD 5DK0B 1JWUB 3MNVB 4PG9A 2LAGB 4DTGL 3STLB 4KVNH 1SHMA 1SYSA 4UNUA 3VXNB 3SKMB 1A7OH 3EDDA 3LEVH 4K55A 5FB8B 1I85A 3O9WA 2DYPD 1K8DB 2DS4A 3RJDA 4EUPA 3PABA 1Z5LA 4CNIB 1LO4H 5TE4L 5HGBB 5GRJH 2DI7A 5IFHL 3MBXH 2R9HD 1UM6L 5ILTL 4ETYA 4AM0A 1FN4A 5LBSL 4YHOL 3ZDYE 2B1AH 3OBAA 4ZUWA 1BP3B 1GPOH 5C08A 4K3DH 4UDUA 3WMSA 3FMGH 1D5IL 4F7PB 4L5FL 3CGTA 1JNJA 4RGNE 1HKFA 4JDTL 5INDB 1B4JL 5D1XA 2IBZX 5DDHA 5TDPA 2XXMB 5DHVH 2C1PB 3QNYB 5F7EL 3T1WA 4EQ2A 1Z0MA 3GZKA 3I50H 1ZT4A 5E8NB 4U1HB 5GZOC 4XPTL 4LRIA 3RGHA 3RUGE 4YWGH 4DK6A 4YAQA 4I2XE 4U0RC 4OCWL 4FXGB 3VXMA 3VGDA 4PJAB 3WO4C 2J88L 5H94B 3RWCA 1F4YH 3KYAA 5I0DA 1Y6KR 2D7OA 3B3IA 2VLRA 4XCCL 3WIFA 1G6RA 2VLKB 1MFNA 1JWSB 5L6YL 4TRPL 4MCYA 1BQLH 1JVKA 2DIAA 2ZCHH 1YJDL 5JW5B 1EFXD 3U0PB 1RIUL 4YFLI 1OP3K 4M5YH 5DS8A 1N3NA 3X13B 1JWMB 1IZJA 1DEDA 4I5BA 1M7DB 4AG4H 4X99A 5L8LB 4KMLB 3WFBH 4NWUH 2LFGA 1I85C 3O9WB 4QF1A 4JO3H 3TBSB 4JPWL 3Q6FB 4TUOA 1NC2D 2ZOKB 2G5RA 4MJIB 3V5DB 2P5WA 2FX9L 4PJGE 1IAKA 3N06B 1OAYL 1EXUB 1EUTA 1T0MA 4HJJH 3PQYA 4S1SL 3MO1B 1D5IH 4XCEA 4L5FH 1TQCB 2QSVA 4TOYH 2WP3T 1QBLL 4QRRD 4JFXA 1E4KC 4GKSB 4LNRB 3KPNA 4LVNB 4P49A 2E7CA 4HT1L 1LILA 2XNAB 2HMIC 3QH3B 3WO4B 4PRDB 4J3OC 3QNZB 4Z5RA 1NKRA 4U0RB 1KEMH 3P77B 2GFBB 2ORBH 3V0AC 1CICB 4D3CL 3EO9H 4R2GB 5HI3D 3WN5A 3I2CL 4QXGH 4PRIA 4U6VH 4F9LC 3A67H 3GM8A 5F1NB 1IAOB 1I8LA 1CG9B 2A9MH 3C9NA 1EEZA 1KJ2A 4ZDHB 3KPMA 3L5XL 4UMGA 4CUCA 1F6FB 1D5XB 4G7YL 2ZCHL 1XR8B 4GRLC 3BYYA 4FQQB 1OTTD 5I8KL 5FM8A 2GYSA 5DURB 1ZHKA 3MRJB 5E95B 3HKFA 2G9HB 5FEBA 2B1HL 3PL6D 4M4RA 3BRGC 4HAGA 4GLRI 1FFOB 3K74B 4J3WA 3C2AL 5FDYA 1T2QL 2D03H 1QFPA 4XVSL 5E5UB 4MJ6B 5F7HA 4MNHA 4JY6A 3TBTA 3T1FA 5SX5H 5LG1A 5E8EB 3X12B 2IALA 4MA1C 4CJ0A 3ZDZF 3EW3B 5C0BE 3OF6A 4NN6B 4MS8D 3MRGA 3NTCL 4RGMB 2XN9B 4P5TA 4TSCL 2BJMH 4L29A 1BGXL 4JZOA 3SDCD 5HBBA 4NQVA 5LJYH 1I8MB 5IMMB 4QHNB 5TDOB 4JFDA 5IT2H 3GM0A 3SE9L 4P2QB 4BFIB 2QKIA 2DQJL 4N0CC 3L3IA 1MY7A 4RIRB 1RV6X 5SX4H 4D3CH 1YPZF 1S9XB 3DETD 1Z9OA 1G6RL 1EEYB 2B5IC 2VLJA 4IMKA 4Z7UF 1ZLWH 1AD0B 3T2OA 4YO0B 4MAUH 1QR1B 3P11L 3DX7A 2EH7H 3BH8A 3E0GA 1EEZB 3U79A 1CQKA 2ICWI 3R8QA 1FFRA 2F19H 4P2OC 3TVMC 2OTWB 4U1IB 3HUJB 4NNYB 4UOW0 3QXUA 2ICWA 4AEIH 3MLRH 3UEZA 3E1F1 4G5ZL 3WN5C 4PRBB 1PG7X 3H0TB 1KF9B 5E4EC 3SQOH 3VFVB 5AYUL 4C4KT 1ZE3C 4JN2B 4WTZA 3MBEA 3VG9B 5ICYA 5ADOH 1XGTB 3SDAD 1NJ9A 3V52H 2YZ1A 1NUFA 4R4NC 3BIKB 4M6OH 4PIRF 4EUPH 3ARTA 3E2HC 1D5BA 4P2QD 1SJXA 3EGSB 3BQUD 2IALB 2UZYB 3ARUA 3ILPB 3LS5L 4X4XB 1BJ8A 3ABZA 4WENB 4OUUB 4EOWH 4Z7UA 2DWDB 4LLDA 5IBLC 4A6YB 2Z4QA 1ZT1A 1MREL 1GOFA 3Q5TA 4RGNC 1Y6MR 3SKNB 5GXBB 3G04A 5FHBL 4X7SH 3H9HB 4QRPB 4LNVA 4XNYH 1CCZA 3RNKA 4HULB 4B7LA 1H0DA 5DUBB 4CMHB 1PZ5A 4MMZC 4HZAA 3C60A 1KNOB 3MLZH 5IEHA 1M7XA 1VPOL 3MV9E 1A6UL 2OK0H 4NNXB 3WJJC 5IMKB 2OL3B 1U93B 3IU3A 4YHKH 4JGMA 5EORH 3S5LG 4JRYB 3HPJB 1K3IA 3ARFA 3P11H 2HTLD 4QRSB 5GRWA 5A1AA 3RVUC 3W9EB 4PD4J 5HY9A 4Q6YA 4EJ1C 1DN0A 2YKLH 1U8KB 3MFGB 5DD0L 2EEDA 1CFVH 4ZFFB 4I18B 2YZ8A 2LQRA 4NWTH 1UB6B 1UC6A 3PWNA 1GOHA 4HKZB 4R3SA 5GIRB 5IKCA 4FQXD 3A6BH 1S7RA 3A6OA 5F88B 1OSPL 3EYUL 1CGWA 3INUH 4J3UA 1PBYA 3IJYA 4FS0A 3SCMD 4F7TA 3P3YA 3K4DA 3U46A 1CK0H 4OZIF 2YEZA 3T3ME 4I48B 1NSNL 1A4JA 4ALAL 2YWZA 3TIDB 2AGJH 4HWEH 4B5EA 1RZKC 3WSQL 4FTVB 3LKQA 4OZFA 3IKCA 1UENA 5I1HL 1I1RA 2PYEB 1MVUB 4R6UA 1YN6A 4F58L 2VL5B 1MHCA 3VFSB 4L4TE 3KPMB 3KGRA 1YECL 4NUJA 5DDHB 4FTVE 4GT7A 4LMQI 2NX5E 4NC1C 2VL4A 5JOFB 3O3AB 1FO0B 3OAUH 3U4AA 3QDJB 3X11B 5C0IB 4AENA 3AMLA 1KPRB 4HKJA 1BVKA 2FX7L 2AEPH 4NZRH 1ZS8A 2ESVA 3H9SB 1R3HB 3L5WB 2VLRB 4XP6H 2PO6C 1Q94B 1OT2A 4YHLH 5IB5B 5IVXA 3NVQA 4GAFB 2VLKA 2EIBA 1VKXB 4H8WH 4LDLB 1WCBA 5IW6A 5IESL 1JP5A 4XX1E 5EZOH 5CIPA 2B0SL 2DJSA 3L6FB 3BPNB 4JRXB 1OSPH 3EYUH 3U7WL 4YHYC 1DZBA 4JRWA 3NCJH 4DCQA 4NO0B 4KKBD 1TTGA 5D5MF 3PGDA 3O6KL 4I3SH 1PZUB 4LKCB 1PD6A 2CUHA 4S1DD 1GC1C 4GUPB 4MXWH 1UM5H 2C1OA 2Y6SD 1EO5A 2DDQL 3V5HB 3WJLC 5T33L 2HT4D 5GRZA 5GJSH 4G6ML 5A43C 1KTDA 5E1AB 3IXAA 1LP9E 3DX9A 5FA3A 4M7KH 1AGEB 2F74A 4HS6A 4N9GA 5F96H 3RWCB 3S88H 4ODTH 2Q8BL 4YXHL 4G8EA 3B3IB 1XF4B 5ADPH 1JZ4A 1U0QA 2VDMH 5FOBA 5IB2A 1BHGA 3L95B 5T1MB 3RZCA 3KPLA 2P46B 3BKCH 4FQLL 4AENB 2DQTH 3O6ML 5I18L 1IGJA 2EYTB 3RVWD 3QCVL 2P7TA 1HINH 3W81A 4M3KB 5DQJA 4U1MB 1EFXB 2NY5C 4HAFA 3GMNB 1MJUH 1TETL 4HIXH 2WUCL 4WCYH 3MLSL 4UT6H 3VRJB 1A1MB 5HI4C 4MNQA 4ZFZA 4ORGB 4ONFH 4WDIA 4L4TD 1X6LA 2XQBH 3MGTA 2NY6B 4TUJA 1AXIB 3P30L 3GSRB 3ZE0F 2XY1A 2F5BL 4GW5B 2A38A 1IGTA 4IJ3C 2H26A 5DC9B 4Z0XB 3LIZL 1KB5H 1ZV5A 2BC4A 4PGZA 3F7VB 3MOQA 4PJBE 1A1NB 4WI9A 5DMIL 1FJ1B 3QRGH 3HAEA 4HCRA 4OIIL 2NTFB 2IBGA 4NKQB 1S9YB 1C5CL 4NZTH 4ZO9A 3RVUD 4V1DB 3VGEA 5C0IA 3GMOA 1R3IL 1BFOB 2GKIA 2MQCA 3FKUS 4M48L 5GJSL 1DQQA 4G43A 4OM0L 5IKCB 2W0LA 1ETZA 4HC1A 1LD9B 1MCKA 2JIXD 1BQLL 2V2WA 1BBJB 5BS0D 1H9VA 4JKPL 1U8KA 2CDGB 2ICCA 2DM7A 4JHZA 2BNRB 3K0WA 4OLUL 3L3OB 1CE6A 5MERB 2CLZB 2VDML 43C9B 5CBEA 3V7AG 3TEUA 1I7UB 3GNML 2B4CH 5K9QI 1BWWA 1HSBA 4G8GB 2DQTL 3O6MH 5I18H 3O41B 2G2RA 1ZA3A 4JM2D 1A5FH 3IFOA 3LB6C 5C3TA 3MA7B 5EPMA 1IARB 4G42B 5CLWA 2FX9H 3D6GA 4OM1L 4DTGH 4TSAL 4LSDA 5EBMB 3BXNA 4KVNL 5E00A 3OZ9H 1RUKL 1IM9A 3FT2B 4PJXB 3HZVA 4PUBH 4XNXL 3IDGB 3IDNA 4R0LB 4NQDD 2A6IB 4JJHA 5F44A 3AS0A 2F5BH 3SGKC 4NYLA 5F1OB 3QDGA 1P7HL 2A0LD 4O51A 1T83A 5FA3B 4PJXE 5EBLB 4NZUH 4D2NA 3CVHL 1CDIA 2HJLA 4JB9H 1B9ZA 5DC0A 4LHUD 3RWIA 3EJYC 4QHLA 3I02A 5D2NC 4URTB 2FSEB 3EZJB 4NQDB 2Q1EA 3D3VD 4WV1A 1C5CH 1I7ZA 3D39E 5DVMA 2EDKA 4Q9RH 4D0DA 1EHNA 2ESVE 3R0NA 1UVQA 3AVEA 3G6DL 3L5WA 2YXFA 4R2GD 1G9NC 3N1PC 2XPGB 5KBNC 1UM4H 5F9DC 4YR6B 1CFBA 1IL1A 2XZCL 3DVIA 4LBEA 5JORA 1LO2L 3K1DA 2EZ0D 1NMBH 3FFDB 1DFBH 2VLJD 2Z8SA 4KKAD 4KRPB 4RFEA 3MRLB 1T2QH 2APWA 1ZVHA 4R26L 3BRFA 3QCUL 2IANA 4V1DE 1CS6A 5DMGC 1M05B 4LCIL 3T65B 3VWJA 3EYQD 1R5WB 5T5NF 5KN5B 1UYWH 4WHYH 2XA3A 5F3HB 2VH5H 3B6SB 4IHOB 3V8CA 4JQIH 1IBGL 3BIBX 2A74A 1NJ9B 1A7QH 4M62H 4UQ3A 5SWQB 3LH2L 5JOFA 2IAMA 5BVPL 1JE6A 4LCCB 4R97B 3FL7A 5IJVB 1E6JH 4CW1B 4NNPL 5E2WH 5IB5A 5IVXB 4NQSA 1U8IA 3QEGL 3SGEI 1QNZH 5CEYA 1EEQA 5IROA 2EIDA 4IIQA 3WNMA 2HN7A 4PJIB 4G6AC 3RPIA 3HCVA 3OR7A 2WP3O 4C56D 3OX8A 1L7IH 2AERT 3DVGB 3QQNA 5A2LH 3J7HA 3NIDE 5IGXL 2PN5A 2X4QA 4XZUA 3E3QE 4JPVH 3QDMB 4HIIB 4PTUB 4WFED 1CGSH 1T5WB 3JWOH 3WFHA 3MLRL 2EEAA 3RL2A 1KUMA 1INQB 5IF0B 1TPXB 1DE4B 5AYUH 5C8JB 1JHKL 2FNBA 1VFAA 4E41A 4KKLD 3MRGB 1SEBB 2VZ1A 1DFBL 3E6FB 1OLZA 5T5FH 4LCWA 5D7JC 3C8DA 3LEYL 3KPQA 3LN5A 4OF5A 1DN0B 1ZHNB 3ZZ1A 4DFHA 3S34L 3SJVD 3I6KB 4M6OL 4UBDD 1WLHA 4N5EC 4PB0H 4PRNB 1JPFA 3HLAB 1DN2A 4XCNA 1CFQA 2LE9A 2BMKA 1JNLH 2NY3D 4S2SB 5DYOA 2ADIA 5JHDB 1CN4A 1RULL 3T4YA 2D03L 3QI9B 4HD9A 4L8SC 2IMMA 4WY7H 3NABL 4ODUB 5DFVC 2J8UB 1WAAF 1MREH 5E6IA 3F7QA 2QHLA 1IKFH 1I7RB 3BGAA 3U9UB 3VRIB 4KHXH 1FHGA 1ND0A 2W60A 5KANG 3GRWL 5TF1L 4PJDF 1X9QA 3DHJA 4NHCH 5LXGL 1L7IL 1XF3B 1QKZL 3MJ6A 3CH8A 5TE7L 3RTQD 4CVWA 3MRLA 3KYMA 5T1KB 2DQJH 3BIKA 1EAPA 3JV6A 4X6CA 4XC3L 1KGCE 3N85H 1CL7H 4L3EA 5IMLB 4MCYB 5DJ8A 2C3VB 1SEQH 5HGGS 1ZAGA 1LP9F 1WC7B 3THML 4KROC 1E4WH 4AY0A 4PTTA 3OPZH 4Y5VB 3QZWA 3NIGE 3QUXA 2WINB 5D72L 2BNRA 3BD5A 3HE7B 4J1UB 4QTHB 4JGJA 4YO0A 1UWGH 2PCPA 3VFUB 4IMLA 3TBSA 3I02B 3QUYA 5CMAB 3F12A 1MCLA 5F7FA 5F7DB 4OZFG 1KC5H 5FUOH 1D5ZA 1QUNA 3S8WA 4X9BA 4XP1H 2BOCA 5C2BH 3LKNA 4XPFL 1MH5B 1EERB 2A77L 4UV7L 4JRYA 3H2WA 1KTKE 4OF0A 2D31A 3I6LD 5LGJB 4RMVA 4KJWD 5SWZA 3V6BR 3OKEA 3FOLA 1OAQH 5B3NA 2OI9C 4QEGA 3V7AE 4Y8AA 3PQYE 1AIFA 4KHXL 3DX7B 1IGTB 1JBJA 3CVHB 3DGGA 3WDHA 4X0KB 2F54E 4KHTL 4NHCL 4LP4A 1UXSA 3VGBA 4G8IA 5FYJD 3CDGA 3D85D 3LN4B 2PXYC 3DVNB 3HRZB 1B0RB 1DTUA 1PDKA 4BSJA 2YPLD 3PG2A 1MCHA 1MIML 2E8YA 1RZ7H 4HWBL 4Y5YB 1KT2B 4GXVH 3IDJB 1NGQL 4Z78B 2JJWA 4CAGA 3IFLL 2V7NA 3Q3GA 2LVEA 4OZGB 3BP7B 3RVTD 4YPGB 4KV5E 2DD8L 5CD3B 3VFGL 3OKOA 3U7WH 2J3SA 5JQ6L 2R56H 4S11A 1XCQB 4IEFB 2Z92B 1YNKH 4DGIH 1TXKA 2AJVH 3L3KA 3O6KH 2YD4A 3T0DA 3RPKA 4NT6B 2QLVB 1UWEL 5DVKA 1QSED 4MNGA 1OP5K 4Z7QF 2QSCL 3PV6B 2Q8AH 3VJ6B 4BK5A 5T33H 5AUMB 3VDCA 1OM3L 2IG2H 5C0DB 1H0DB 1JNHB 2VC2H 5TQ2H 4F3FB 2JJTC 1MNUH 3QEHB 4PJFB 1IM9B 4FQCL 4Y2DD 2GAZB 3LQZB 5FYLE 4ZS7L 2Z9TA 4N0UE 3KYOA 2HFEB 2NTFA 5SX5K 5HXMA 4GG6B 1MCPL 1NCDL 5FGCB 3RVVD 5D7SH 1D9KC 2DWEA 5EN2B 2JCCA 1RJCA 3BDYH 4I0PD 5ESQB 1OW0A 4EEEA 3CPLB 4KKCD 4FP8L 1BREA 2WK2A 3QCVH 4ODWA 3L3GA 1YECH 5EC2A 3ET9F 5EU5A 3K2UL 3JV4B 5EUOE 2ENSA 2H2PC 3VWJD 3U0WL 2EDYA 2ITCB 4H20H 4IRJA 4ODSH 2YUXA 5I74C 3VXSB 1FNGB 3GMRB 3MJ8B 4JHBA 1U91A 3LEVL 3UP1A 3FO1A 1MRCH 3FQTB 3QEQA 3QI9C 4JCMA 5CJXA 4MHHI 1U36A 3G5ZB 2J12B 2N1KA 5D93C 1RVFH 3MBXL 2P8MA 4EN3D 1C5BL 2AK4D 4H8WL 1PX4A 2DQDH 3UTQB 1W0VA 4YFEA 1W0YT 3RVXD 4PV8B 3B9VA 5ICZA 4P46C 4NT6A 1UWEH 3WXWH 1S7TA 1B4JH 4HWNA 1NCBL 4ZXBD 1FDLL 1WT5A 2PYEA 3S36X 2HJFB 3WNLA 5FM5O 2R1WA 4PS4L 1DQJB 4U6XB 5EOQH 4NQUA 2NY1D 3QIBC 1AXTH 3HG1E 1T03L 4XP4H 3OAYK 1XF1A 2YMXH 3BPCA 4U1SA 1G6VK 3ESUF 4OLUH 3L9RA 3KYNA 2A2QT 3BDYL 1CI5A 1FAIL 3F65A 4RNRB 2VDQH 3D5OF 4TVPE 5L2KE 5MEND 4Q6IA 3JWDL 3ULVL 1IVLA 5HGBA 2XRAH 2CSPA 4RBPH 5HHQA 2FO4B 5KOVC 1A1NA 4U6HB 5DZNA 5HHVH 1JWSA 1NMCB 1X5IA 1YJDC 1KCRL 2HTLC 5J1AA 3W9EA 1AGEA 3B9KC 3HE6C 1T7ZA 3D39B 3GSVB 1PG7L 1YYML 1G7JA 1EBAA 4YE4H 5KAQG 2COQA 2X42A 5FA4A 2R2HA 4LVOC 2ARJB 3ZT7A 4U1GC 3NACH 1FGVH 4HIXL 2XG5A 2WUCH 4WCYL 2CRIA 5IUSA 3MJ9A 1YMMB 2AEQH 2HVJA 3DROA 1FO0L 3P2TA 3QR2A 5IMOA 2QQNH 1OAYH 3LAFA 4RWHA 1PAMA 1H8NA 1RHHA 4L3CA 4R4ND 3ETBF 4JFFD 1G7LB 4LIQH 1WZ1H 5JR1H 1RU9H 2EH8H 5I6XB 4WHCA 1NLDL 3D0VB 1GH7A 3G5XB 1LP9B 3RRQA 1B0GB 3IDXH 2P49B 2BMKB 5AG8A 5IR1A 4TTGA 1EHLH 5EOQL 3DX6B 2AJUH 1B0RA 4LK4A 4Y1AA 4HIHA 3BN9C 3B9KB 4LNRA 5F8QC 3BO8B 1P7KA 2Z31C 4PPTA 4MZ3A 4IMKC 4PRAA 1IT9H 5T3XL 5BO1L 3U1SL 1FNGA 4NRXA 3A67L 1LO2H 1HHHB 3DOSA 3E3QC 2R0ZH 2WWMD 1IGIH 5IWLA 4OM0H 5HYSG 4PG9B 1ZT4B 5E8NA 1U8QB 3MLVL 1RK0B 4G7YH 5DHXB 2YS4A 5IVXE 1KV3A 1LE5B 3KPRD 2GJ6A 2N56A 3VJ6A 1R6VA 2MOVA 4DAGH 3MLTA 4LU5H 3PIQB 3QXDA 4MLSA 4P2OD 1MI5D 1I1FA 4OLVH 4ZD3H 2H8PB 3P9MB 1E4XL 4KC3B 4DEPB 2FHCA 2ICES 4P3WA 4JY4A 2J5LB 4AM0B 5EH1A 4OV6F 4M62L 5KS9A 4YBLC 4XVSH 5ICXA 2IFGA 4U1GB 2ZUXA 2CDFA 3BUTA 1FRGL 3EFFA 4PJFA 3U30B 1LO4L 5TE4H 1FGVL 4RMTA 3VFPB 1VCAA 2FGZA 4NNPH 2PO6A 2O61A 4LSPL 4YDVA 1TJIH 1FLRH 4Z78A 3LN4A 1IKNA 4PTTB 3FFCA 2VDKL 3IGAB 1YY9C 4LIQL 4L3AA 1WVZA 3MV9A 4PJ9D 3BP5B 4QRQB 5T3ZL 4OQTH 1LP9A 4GQ9H 3I50L 4H88L 2FBOJ 4QGTA 1D9KD 5IT2L 2EYSB 3SE9H 4NZUL 2AJUL 1ES0A 3TN0A 4FFVD 1YMHB 4F8TA 1T7WA 2HWZL 1EAJA 1T3FA 5EUOA 1XGUA 2XWBA 4KKCC 1BQHA 4EQ3A 2J88H 4WHTB 1OGAE 2Z35B 6FABL 1T66C 3VGFA 1XAUA 1YMME 4P2RB 4C83A 4XCCH 3TBVA 3CXDL 1U95A 1I3RA 1K6QH 4JLRA 3FT3B 4JG0H 1NMAH 2XFXA 5J1SC 2Q87A 3QULB 3M8OL 1C5DA 2CDEA 4AEIL 4DAGL 3JUZA 3WBDA 2WUBH 5D2NE 3T2QA 4LU5L 3MRFA 1A6ZA 3B43A 3TPKA 4OLVL 1GAFL 2NW3B 1A6VL 1L9MA 1RULH 4P2QA 1YQVH 2JLLA 1N5YL 2GSIB 1F58L 4LQ1A 1I1AD 3VXUB 1MHEB 5L0QB 2SEBA 4YUEH 1VGEH 1RHHB 2R69H 4L3CB 2DMKA 5CHNB 1JTOA 4K9EH 1QR4A 3EDKA 4NN5C 4IM8A 5D1ZB 3GRWH 3NMEA 2YBRA 1QBLH 2R4SH 3QA3A 1AC6A 1H5BB 5HHPB 3RGVB 1XGRB 3MRNB 3QEGH 3OQ3B 1FNFA 3KPSB 3OGCB 3BEWB 1W0VB 3N9GH 3SKUD 4KMQA 3P9LB 3VA2C 4XHQA 1YDPB 5JO5B 1XGUB 2OK0L 3FO2B 4XC3H 5M7QA 2E9IA 4A2MA 4HF5L 3IT8D 3SKNA 1DBMH 1NDGB 5C0AB 3WDIA 1HHHA 2EO9A 3S4SA 4YDIH 1JGDA 4XP5L 1W72B 4FQXA 4F37K 1HEZA 4CVXA 3ZYOA 5FGSA 1LEIB 2XTLA 1AR2A 2OX5A 1SBBA 1OAKH 3I6LE 2D3VA 3L3IB 1UWGL 1JYWA 5KVDL 1Q1JH 5GQBA 4PTUA 4NIKB 5EOCH 3UPCA 4J8RA 4JAMA 3BPNC 1X4ZA 5DJDA 3S7GA 4WUUB 5DQ9A 1F3DH 4NRXB 2A77H 2BNQB 4OFVA 5L8JB 5KN5A 3D0LA 4PJHE 3I6GA 1DDHA 4BSWA 2Z91A 5B4MD 1MIEH 1S7VA 3IDGA 1F4XH 3OKMA 4YUEL 4ZXBC 2GHWB 3MRQB 4M5ZH 3BRDA 5I8CA 3QUYD 4W4OC 2A83A 1T6WA 1BZ7A 4E9LA 5GS3A 1NKOA 3OX8B 4EVNA 4NRZA 2ZCKL 3B4NA 1P6AB 2FJFA 4S1DC 3B2UC 3HZYB 1YEEH 1MELA 1T04A 3NABH 4F58H 2P4AB 1HSAA 4OF3A 5TH2B 5HYJE 1N5AB 3U36B 4QWWD 5GS0H 3DRQB 2DN7A 3LY6A 3MRPB 2C7UB 2BHYA 1KJMB 4LDEB 5CJBA 1MIMH 1BD2E 1NCNA 5ACZB 1IGJB 2EYTA 4N68A 1DBML 3HB3C 1S3KL 3ZDZE 1Q72L 3DX8B 4XP9L 1TITA 3L3JA 3SO5A 3KJ4C 2G5BA 2UZXB 4PJFE 1U8PA 2HTKC 3R4DA 3U2SA 4KY1H 4CL7A 5CSZA 3BO8A 4G43B 4QRRA 4L8SA 1YNKL 1NCTA 2X44D 4G5ZH 3WJJA 3T8XA 2VJXA 1QSFB 3C5SA 3LPFA 4LCUA 1SEQL 1BQSA 5C8JA 2NR6C 2Q6WB 3OR6B 4P4KB 5KVDH 1JHLH 2NW3A 4ZNEA 1NBVH 4PJDE 3KJ6L 3F7VA 3IFNL 5F1IB 3KPOB 5TQ2L 2QL1A 2Q3AA 5DSCA 3HMWL 5D7IA 2VXTH 4I3SL 3TJHC 4WU5B 5J06A 4ZS7H 3CSYB 5K9KA 1OQXA 3V0WL 3AS1A 1NEZG 4F37F 1G7IA 1WGOA 2X4SB 4M5ZL 4JKLA 1G0XA 1NCDH 1FNSH 1KEGL 4Y4KB 1IQDB 1PJ9A 3BP6A 2A0LC 4NKMA 5HTSA 2G75A 3GSOA 2DTSA 5A3IC 5C0RH 1T1YB 3P4MB 5TE6L 3B5TA 2X1PA 4M7ZC 2AEIT 3UBXG 5EUOF 4JQXC 1Z2KA 5GS0L 1QO3B 3SKMA 3K1KC 4L4TB 4YHMH 2Q8BH 2RFXB 4BFBD 5F9JB 5DJZB 2OP4L 3WYRA 4F7EA 4H1LH 1DBBL 2QADC 2APFA 4DKDC 5IOPB 3BKCL 3O4LB 2YA0A 4OCSL 2FBJH 3FFCB 4YHKL 5EORL 3BGMA 4P9MH 2CGRL 5D70H 3DRTA 5E6YA 4KY1L 4R7DB 2MFNA 2BSED 4X0KA 3LQZA 5GS2H 1OWRM 2FEDD 3QPQD 1CFVL 4HHAB 4JM2C 2ZUUA 1YNTB 2R1YA 2XWTB 4QRUB 3IFLH 3S98A 5JDJA 3DV4A 1DANU 1DBKH 4DVBB 1FC1A 3ARPA 2FWOB 3PWJA 1OPGH 5IEKB 3FT3A 1IL1B 3INUL 3D9AL 1L0XA 5T3ZD 4QXTB 5JQ6H 4LSRL 2ZCLH 3OJVC 5FF6B 2QQQA 4CU8A 3ZKMD 3IFNH 1VADB 3BMWA 4I77H 3TZVD 4WGWB 2AJVL 1I8IB 5D4QA 4X9GA 2AJ3A 1SJVA 4GAJH 3CLFH 4X7EC 1YEHH 5D96B 3WLBA 2R0KH 4D0DB 1KENH 1EH9A 3D85B 2A83B 2XNAA 2DM2A 4U1JB 3ARZA 4Z0XA 4HUUB 5I8EA 3WSQH 1A3LL 3KLDA 3MXWL 1U8MA 4ZFOL 5A2KH 4X80H 4MA7H 3G5YB 4MJIE 4KRPC 3OTTA 1A6AB 1SJHA 1X5XA 4MWFB 5I1LB 5TFSH 5JHDE 4WDIB 1TCMA 4TNWK 1PVHA 3OG4B 2RFXA 3WIHA 3O45B 1OP3H 4KFZC 3TO4A 3FOMB 1CIUA 3I9GL 2C5DC 1A6TA 4NNXA 4ZTPH 1MOEA 4X9HA 3FQWB 4XAKD 4X5XB 1ADQL 25C8H 1HDMB 3PXHA 4O5LL 3X3GH 1EX0A 4MHHG 4P3DB 1YPZE 2A74B 3BHBB 3BSZL 3CU7A 5LAXA 4DFIA 4G8GA 2EDXA 5GGSB 4X8XA 5D2NB 2NLJA 2WV3A 3SCMA 3OZ9L 3QXAB 3QEHA 2AABL 4XNQB 1RU9L 3BVNA 4NRZB 4G3YL 2B0SH 3DARA 4XH2A 1KGCD 2XKSA 4A6YH 3QUYB 5CMAA 5TH2A 2UUDH 4R0LC 5ID1B 3EDFA 4MXQC 2QHRH 5SWSB 3B2UD 2NXYD 2DRUA 4FQHA 2DQDL 5DUML 4KK5C 2ZJSH 1CU4H 1BD2A 1YEHL 3WLBB 5KSAA 3HG1D 1A1MA 4BZ1H 2AXFB 5CSZB 5BO1H 5C0FA 2DQUH 3QFJA 4HPOL 1UG9A 1XF5B 4Y4HB 4OUOA 3NPSB 1HYSD 3TCXA 1NEZA 3S37X 4JO1H 4HQQL 1T03H 1U8PB 3K7UA 2UV3A 2YMXL 4FQJL 1YN6B 3V4UL 5DJXA 2G60L 4ZUWB 5ITBH 1U2CA 3KXFE 5CP7B 5IVZB 2M1KA 1EBPA 2E6PA 1ZLSL 5BQ7B 1NL0H 1HHGA 2NXZB 1S5IL 1E4XH 2FX8H 3P73A 4R4BB 4PJIF 4G9FD 4YDJB 4MDJB 2GY5A 5K9KB 3U36A 2EXYD 4HKXB 3V0VB 3W0WA 3AGVA 3KWWA 3OKYA 1WBYA 3MRCB 3NBNA 2XRAL 3DO3A 4P46A 3NFPA 1T20A 4XPAH 1IEHA 2CIKA 1BOYA 4AEHH 1CLYH 2YOCA 1CDUA 3CSYA 3UYRL 3CZFA 3MX0A 1KCRH 5C6WH 4AYFA 4ETQA 2R2CA 5AD0B 5DEGB 1R24B 3UPRA 1F3JB 5IK3B 3OB8A 4U3CA 4YE4L 3LD8B 3MREB 1YEDA 5EZLB 5BVPH 3P30H 5CINL 1DVFB 3UROR 2V2TB 3CK0L 3NACL 3KPTA 3OJDB 3H3PH 3MLXH 1J8HE 1X44A 2W60B 4NQCD 4RMQA 1KTLB 2X05A 3MYJA 1QNZL 2B1AL 2QQNL 3BW9A 2DTMH 4ZO7A 1U8JB 4GRLA 4HJGB 5AEAA 1FVEA 3KPRB 3REVB 1YEJL 3CDFA 3QRGL 4YZFF 3PHQB 5DWUH 4I0CC 1YN7A 5IM7A 1F6LL 4YIQA 4PLJD 1XR9B 4CVUA 3PP4L 4NM8L 3QP3A 1NEUA 3KHOA 4GUPA 2JCCF 3VH8B 1OP5H 1R3IH 1HN1A 4NHUA 4ZSOA 5IEHB 5C09A 4JO1L 1NMAL 1LDPL 1QBMH 1BOGA 5C0NC 1L7TH 1JFQL 1NFDE 1UEMA 4XGZA 2D7PA 4Y4FC 2X09A 1JCKA 4WO4B 1ZVSB 1J0ZA 4UTBL 1JV5A 1H3PH 4UIMA 4RZCA 3ZDXF 3BVNB 3OKNA 2FJGA 5DRXB 3CCHB 4Z76A 2AJZB 1TQBC 3O81A 1NC4D 5CBAA 4DN4L 4PJDB 3BKJH 5C3LD 3HC0B 2E27L 1UKTA 5DI8B 2V5RA 3D25B 3VXRD 2EDQA 3BD4A 3U7YH 2OJZH 5F88A 5DR5H 4KGLA 2GJJA 4OZHF 1OF2B 5JMOC 1RUPH 1NAMH 4IRJC 3RWDA 3TIEA 1MJ8H 4PP2A 2GCYA 1QSFE 5DFTA 5J89A 3QFDA 4WUUA 1M71B 5E6IC 2FH6A 4PUBL 5ISZE 1WAAA 4X7TB 3VFVA 2VB5A 1HZHH 1P4IL 4S2SA 3H3PL 3PWVA 1FFPA 2P5WB 5IF0A 5I1LA 3DO7B 5EU6A 4TVPL 4X98A 3VWKB 4JB9L 4F80A 4G8IB 2E9BA 2BCKB 5C9JA 3QT2A 4HF5H 5E4EB 2PO6B 1AY1H 1QKZH 1OLLA 5CUSL 1U3HA 3W39B 1MWAH 2VDRL 4P2OB 4Y1AB 5IV2B 3NCMA 1W8NA 1EHAA 3BEVB 4XP5H 1U8NA 5DVLA 1N2RA 2YC1B 5GS0C 4U49A 3AY4C 2VLKE 1UM4L 2WBJA 2HKFH 4LSVL 3LKPB 1IGYA 2MMXA 5LGHL 1IC4L 2X1WL 1H3PL 1N6QH 2VE6B 1A2YA 2DLFL 1PZ5B 4NQCE 3DVGA 1HHJB 3F5WA 4HMCA 3RDTD 4HC1H 2RJMA 4MNQD 1U58A 3HNTH 4K3HA 4N8VA 1AKJB 5TDNA 2E27H 1GC1H 1MCQA 4JREC 1R0AH 2FJHA 4GRWB 4NC1E 1WFOA 3RI5F 2VDNL 2R0WL 4WU7A 1UYWL 4C4KO 1RZGA 3C5ZC 2NY2D 3VG0H 1HNFA 4HMEA 4PGEA 5BOPA 4RGOH 3SGEH 1FFOA 4MVBC 3V6OC 1PKQA 3BN9D 5IK3A 2ITDA 4XP1L 3GBNL 2HKHH 2YD1A 3CDCA 5EO1A 3K3QA 5DUBA 4DW2H 1YEEL 1A9EA 1HZHL 2H2PD 2C1OB 1K8IA 1FZKB 3TLRA 2FO1A 3CC5B 3SO3C 5I9QC 2BNUA 3BMVA 3AREA 3GSNA 5E08H 2D7NA 4LLVB 4QOKD 3WHE0 2EXYC 2VDPH 4I18C 1NH6A 5CGYC 3P73B 5EU3B 3WIHH 2R4SL 3H42L 3FO9B 4U3HA 4JO4L 4PY8J 2FLRT 4P2OA 4QOKB 1UXWA 1RK1B 4QNPF 4WUKL 5I2IA 2YPVL 4GAYB 4BKLB 5ESAB 4M7LL 1MLBB 4DVRH 4R2GC 5IB4A 1CICC 1U3HD 4Y4HA 2C3WA 3MACH 1A6PA 3CZJA 4E41D 1N6QL 5DVOA 1NBVL 4RGNB 2AS5M 4HWZB 1M4KA 2Q7NA 3S6CA 3HNTL 3MRHB 1ADQA 4MAYC 2BZDA 1N0LA 4LFHG 1ORSB 1CD9B 2DYPA 4D8PA 3RU8L 1WBXA 3UTTE 5K59F 4JQVA 4XMLL 4LSTL 1EAPB 1V3MA 4HJ0C 5I1IH 2BVQB 2BFVL 5JXED 4WTZG 4FABL 4IOFD 4H25A 1OOAA 2Y4SA 2Q8AL 5D7JA 5CKAA 5FGCE 2OZ4H 3VXRA 5C0RL 4Y88A 3HMXH 1JRHL 5FFLA 4UZGA 3E8UH 1OB1B 5JA8B 3WNKA 5JPNB 5C6TL 4ZTOL 4LPCA 5CJ8A 1UH4A 3TBWA 4C57C 2K9UA 4LLYA 5E9DB 2GIYA 1KYOK 2NY2B 5C0CE 3VW3L 5KAQF 3HFMH 4WO4A 4I8DA 2ZCKH 3RI5K 5E94B 5BRZB 4P5KB 3QQ3A 4JREB 1U8LA 5F9OL 1OT1A 2FBJL 2XZAH 4YHPA 1BZQK 3MZTA 1F3RB 4HKJB 4DWHA 1FVDA 2O5XH 3GIVA 4Y19E 3QUMA 4H20L 4P59H 4U6YA 2BVYA 4HX1B 5L2JB 1IAKB 1A7PH 5B38G 1Q72H 4WUUE 3T0VA 4LSSH 1BM3L 4M1GL 5EU5B 5I73C 2EECA 4WTXA 2X1XR 3S5LA 3E2HB 3P77A 4OI9A 4IBLT 5JQHC 2HFEA 1PQZB 5F9WC 4CNIA 3QBTB 1ULVA 4H8WC 5JW5A 1QG3A 5D72H 4PLKC 3TBYA 4LLUA 4GAJL 2FEEI 4WI6A 4EN3C 2MPAL 3O6LH 2FJGB 5DD3L 4FXGA 1KC5L 5FUOL 5FECA 3WN5B 4XHJC 4ZAKD 3EOYG 4NM4H 2HFFA 5B8CA 5IQ9B 4PS4H 4U1HA 1B2WH 4OCMC 4ORGA 2GSGA 2MQ0A 5BZWB 5FYKE 1MCOL 4ALAH 3U9PL 3EJZD 1G0YR 4PRHE 4ZTOH 4M43L 1H5BA 3RGVA 4QRPD 5HHPA 4ZO8A 3NAAH 1UCBH 4G7VL 4PJCF 3GMRA 1LDSA 2VIRB 3HE6A 4R7NB 1RZ8B 3NFSH 4OKVA 4I0PA 2Y9RT 4KRMB 3JWDH 1U3YA 3C5ZD 1RJZA 1AO7E 5T3XD 5IP4A 1XMWA 4KDWA 1NGZA 3HS0A 3W9DA 3S36L 4AK1A 1A9BB 1ZHBA 1FVDB 5E7FA 1ACYH 3O8XB 4WO4C 4MD0B 4JFEB 3UO1H 4RMUA 1T1ZB 2BNUB 3VMPA 3MLYH 2E7LC 4R96A 4LSSL 4GG6A 3LPGA 2DI8A 3VWKC 3MBED 1Z5LB 4MX7A 5B39B 2VUYA 4O9HH 2XN9E 3O2WL 1HH6B 4OFPA 3ARGC 2QHRL 5GGVY 3PWLA 4GH7B 1VKXA 5C0DA 2XTJE 2IWGA 1ZTXL 4NC0B 5E9DA 2UUDK 3ZDXE 4QOKA 5T1DH 2VERN 5HDQL 3P4OB 4M6NL 5HVFB 1T0NB 5I8OL 4JR9L 4HPOH 3F12B 3T3PF 4EBQH 4DZ8B 1OM3H 4ZOAA 2BP3A 5I1AB 2VQUA 3FB6B 3MJ8A 3VD9A 4I77L 4HQQH 2AV7B 2QSQA 5HHME 1CXHA 2RGSA 1CICA 1CE1L 1MCPH 3VXUA 1ZLSH 3U1SH 3O4LE 4L9LC 1J11A 4LPUA 1S5IH 1XT5A 1A3LH 2IFFH 1U8LB 5GRUL 4FP8H 5BMFH 4JQVC 4GBXD 5F6HI 1OGAD 1MF2H 4ZPVB 1E28B 1K5NB 3S36H 3ARSA 5K9JH 2Y1VA 4ZD3L 5I30H 3QIBA 5T1LD 4CRPA 3ZE2E 4F2MA 1KBGL 3SDCA 1MPAL 5DEZA 1Q9LB 5I9QB 2YC1A 3MLYL 2AJYH 3C5SB 4LCUB 3QXDB 4EIGB 1VADA 3RWGB 1QLEL 4K23L 1UCTA 5EU3A 5HHOA 1DEEB 1JYVA 4P0DA 4XCYB 1C5BH 4LLUB 2GCYB 4DOHE 3MV7D 5CZXC 1EK3A 4ODUA 2FIKB 2VLRE 5DWUL 2AABH 5DD6B 2HN7B 2IQ9L 2J8HA 3MODH 5F89A 3GSXB 1P9MC 1T89A 2P24A 5DFWH 5IVNA 3WEXB 1JYNA 3ZL4L 12E8L 1CIDA 4K3EH 5HHXL 5K59E 5DUMH 3ARGB 2IAMB 1VERA 3X14A 2JB6B 5HGAB 1X4XA 5J57B 4NZTL 4H1LG 2DQUL 2HLFC 3WFZA 1GL4B 2CDFB 1Z9MA 3AB0C 3CXDH 4Z7UE 3D0VA 1KCLA 1K6QL 3DHMA 5C0BD 3RA7L 3MRIA 5BOZG 2VZOA 4BSVA 4LCWB 5HI4D 5L9DH 3LVEA 3QWOB 1CG9A 3C9NB 5I71C 3QAZC 3D2UD 3V4UH 1HQ4A 1UJTA 1OD9A 1DANT 5DR5L 5B39G 5EUKB 4MJID 3FAXA 3TO4B 3UTOA 4DZBB 4D0BA 1N26A 1A6VH 4AL8H 3OXRB 3QUZD 3QG7H 2CXGA 5KSBA 1KIRA 5GJTH 1F45A 5F6IB 5JIIA 3NN8B 1F58H 5C09B 4XPAL 5E6IB 2AI0H 2HT4C 4TQEL 4PGEB 4MNHB 4LQFH 1WWBX 3DV6B 4PJHF 5D1ZD 2ESVB 4U0QB 4U6TA 4KV5F 5HJ3A 2NX5B 1ZVSA 4W6WB 3X11A 3CMGA 3JV6B 4KK8D 4X6CB 1N4XL 2FECI 1UH2A 3C08L 4KRLB 5MEPA 4HWUA 1AO7A 3ME0A 4YHIB 5JOPE 3QUKA 4ZS6C 1VB9A 4PLJC 3PWUA 3VFMA 3TWCH 5HGHB 3RVTC 1PGRB 3V4PL 5EZLA 1A7BA 1CLOL 2FYYA 5KSAB 4TUKH 1FZMB 4I9WE 4QRRE 2HKFL 1AP2B 3FONA 2A6DB 1AGDB 1QSVA 5DK2B 3VCLA 1B88A 3MUHL 4OZ4A 4YDIL 4JFDE 3U9UA 1OARH 3VRIA 4F7MB 1FVEB 1QLFB 2YXMA 3KPRA 4GFTB 3GSWB 3DPBA 2XQYG 5C0EB 1L7TL 3UDWA 1T5XB 3TA3D 3W0WD 1UEYA 2Y5EA 3QI9A 4OZIA 3FJTA 1ZLWK 2XZCH 4XX1G 3O11B 1O5DT 1K85A 2DICA 4GKNA 4HH9A 4WEBH 4NBXB 5I16B 4AL8L 4XRCB 4NWUL 5A2FA 5ENWA 2Z35A 3T4AB 1A4KB 2NY0B 4HZLA 4OLXL 3DI3B 4P9HH 1X5LA 3C60D 1LK2B 2VOTA 1S8DA 1GVIA 1F4WH 3ZYIA 1QTYT 4JZJC 1RZIA 4LPWA 1DBJL 4J8RB 5KS9F 4BFEA 3GSOB 3AU1A 5E08L 2VXUH 5D2LB 5INCA 5J4MA 3D25A 3TZVC 5BV7L 2YPLB 3RHWF 3NCEB 2CIIB 2YN3A 4JFFB 4OQTL 3GIZH 2CK0L 5BS0E 4WHTA 1P4IH 1I9EA 3VXTB 4QNPE 4EDWH 4P99A 5T5NG 1GRWA 3PWLB 3MNWA 1Q9OB 5FO7A 5GRYA 1W72L 3IF1B 4RISL 5EU4B 2YPKB 4BQ8A 3MFFA 4U1LA 3SGJC 4TUKL 3MJ7A 2GEEA 1SYVB 2EDNA 2V2XA 4HFWA 1S9VA 1P7QB 2OYPA 1QFWH 3MACL 2CD0A 4GG8A 5J3HD 3GMLA 4LOUC 4K3JH 4TVSa 3OKMB 1HHGB 2DLGA 4LAJH 4RAVA 3LQAC 4GW5A 4PJ8D 5DHVB 1G7QB 2E3VA 2B2XH 1INQA 2H41A 2DAVA 1WIPA 1ZHLA 4Y4KC 2X4PA 3SDDA 3EYVB 3DUHA 3CAFA 1YQVL 3O2VH 3EJYD 1KIQB 1VFOA 4Z7OF 5HVHC 2IPKB 4XI5C 5KW9H 2APTA 4RCAA 2BSRB 2VDNH 2ZKHH 1DBJH 4Z7WF 1B6DA 2VXUL 2HFFB 4MJ5B 5FB8A 1MCEA 3WLWC 3M1BB 4G8EB 3NTCH 1QFWI 4M8QA 3TF7C 4F15C 5L2KA 5CJQL 4LVHB 4PGDA 5SWZE 3DURB 3BP6B 4X4XA 1JGUL 3VWKD 1TTUA 4L8DA 1QP1A 1N6VA 2JIXA 1DL7L 3GKZA 3GDBA 2CKBA 4OKVB 2DQHH 3IJSA 1UACL 3WIHL 1NCCL 5DSCB 4F9LA 1G7PB 2HJLB 2F5AL 4P9ML 2OJEA 1DQQB 4ZSOE 2F53E 1D9KA 3STBA 2L7JA 2V17L 3TBTB 1IQDA 5JA9A 4PJAA 2V7HA 1HXYB 5B21A 1G7IB 1T1ZA 2UY6A 3TVMD 3SKJL 3VDAA 4PGBB 2BC4B 3LHPH 4FFYL 4XAKE 5TPWL 3MV01 4ZFGH 3IDMA 5GS1B 2OBGA 4HXBL 1ROWA 4L4TA 3QHTC 2AV1A 3OPZL 1MLCB 2VQ1B 3VXQA 3IFOB 1SYSB 3NGBB 3DX8A 1CDCA 3FQXA 1ZEAL 5DJZA 3UJIL 4LLQA 4XMLH 4JZNA 1GCFA 4NQEA 2FEEL 1FV1B 3QPXL 3GSUA 1LHZA 3HN3A 2YD6A 1X5AA 2ILLA 4KZDL 4D0BB 3ZE1E 3FO9A 3SBWC 2FLBT 5INCB 1DEEA 4EOWL 4OCXH 2BVUA 4O58L 4JFOB 4P57B 2P8LA 2WQ8A 5IB3B 1OP9A 4X80L 3REWA 3MRDA 4I48A 4IRJB 3ZKSD 4Y16C 5CBEB 3BAEH 5CJQH 1U8HA 4HH8A 4FFWC 4BM7A 2XWTA 4QRUA 1CLZL 4MA3A 4NQTA 4X7SL 3FB8A 3BGFC 5DHVA 5E70A 2DIJA 1GIGH 3U4EB 2VLRD 5ISZB 5BJTB 2ZUQB 2JIXB 2JCCE 3E6HA 1VPOH 4JY6B 1INEH 4YC2C 4MAYA 2PW1A 5I19L 4NSKA 3MA7A 4WTWA 3GRWA 4MWFA 3KPPB 1CXLA 4NJAL 1URLA 1LEGB 2Y06L 2F5AH 5KOMC 1ZA3B 1BVLB 5DHYA 1F4AA 3L9RB 4CN4A 3VD3A 3OR6A 2LVCA 2XY2A 4O9HL 1CD1A 1YYLL 3V4VL 2PTTA 3CX2A 5DUPL 3QDJA 2KBGA 4N8VG 4P5MA 1QFOA 2R0LL 1CFSA 2BY2A 3QUXD 1AGDA 1A7PL 4ZFZB 1O7SA 4XVTL 3BISA 2FATH 1BM3H 4M1GH 4G3YH 2QR0B 1WCQA 3WKNA 35C8H 2EICA 3K80A 3L7FA 1HE7A 3EYSH 4EBQL 4NKDA 5ICZB 3SGDH 3HC3L 5F71A 4D8PB 2DI9A 3RQ3A 2W0FB 5C0CB 2J1KA 3RY6C 5BRZA 1G0DA 2HT2D 3V0WH 1KEGH 3PV6A 1H3GA 4EI6A 1CBVH 5H8DA 1XGPB 3MCG1 3F7YB 2IG2L 2YA1A 3G6AA 3MV8E 4Q2ZA 5CGTA 5J9PB 2QQKH 4YJZL 1OB1A 2DM4A 1MCOH 3MGOB 3VXMB 1J1PL 3X17A 4RNRA 5ITBL 3CFJB 4YHML 5KS9B 1N0XL 4EI5D 1PG7W 4NQXA 1RUMH 5E5RB 4DEPC 3NAAL 5D7SL 3HI1A 3OKDA 3S35H 5K9JL 1RAMA 5IW1A 4F7CB 1XGQA 3OAUL 3W5NA 2ZG2A 4GLRH 2NY4B 1KBGH 4HUKB 1A7NL 3BPOC 1G7PA 4P2QE 1N64H 3ARFB 3KXFD 4QRSA 4KUZL 3FONB 4Y19B 1OF2A 1FL3B 3T65A 1N3NB 3X13A 3ZYJA 1QLRA 3Q6GH 3EOAA 2J8OA 1JPGA 1YPZB 4Q74A 5FM5M 3WV0A 1T1WA 4Y4HC 4M7JH 5EA0L 1WZMA 4GRLD 4Z7UB 1A8JH 3MUY1 1OPGL 5CLTA 1EGJH 4KRNA 2P5WD 3MODL 3DSFL 1NC2B 5D6CA 3AS2A 4EDXA 2C4FU 1TVBB 2V2XB 4RFNB 5I1EH 1JGLH 4P2RA 2GI7A 1R3JB 2WM0A 5MI0B 3U0TA 1ZTXH 2YBRB 3DBXA 4GBXB 2FL5A 1I1YA 1K4CA 4WV1C 1Q9WB 4GRWH 4ACPA 5ISZD 1NCBH 1Q9KB 3F7PC 4HBQA 1LMKA 1WBZB 2VZ3A 3DLQR 1AO7B 1E4JA 1JPSH 3RWHA 2YPLE 4NUGL 1BZ9A 2PCPB 2MQ3A 2X4PB 2V5SA 3AXLA 3D18A 2HRPL 3G5VA 1F42A 5L9DL 4MCZB 1BFSA 3HRPA 1JFQH 1TVHB 2XTJC 4JFHE 1S7XA 1J1PH 4GXUN 2NY1C 3EO1A 4OD3L 3ARQA 4PJ5D 2VIRA 4UTBH 1LWRA 3AREC 1ONQB 4ELMF 1EPFA 4LLVA 4UDTA 5GS0D 1AGFB 1IEBB 3LKOB 5FYJL 4Z7VB 5EOTB 3ARBA 1PEWA 1XR8A 4YGVB 4QRPA 2Q86B 1S9WB 3BUYA 3G04B 1YY8A 4RQQA 3M45A 1FL3A 4CMMA 4KI5C 5E4IA 2ITDB 2WMPA 3R0MA 4RMWA 2ATKB 1QQDA 1CR9L 2V5YA 3KPSA 3OGCA 1T3FB 3LZFL 5EUOB 2D7MA 2PW2B 4QGYA 2VL5A 1N4XH 5E56A 2VN7A 3QA3B 1QLEH 3QIBB 4K23H 5MI0C 4NZJA 3RGVD 1GGTA 5E8EA 3QCTH 4JKKA 4HS8H 4FZEH 1U8OA 2FECL 4YPGA 2VDLL 4I18A 4Y2DA 3KYMB 2ZJSL 5DRZB 1HK6A 2Z93A 3RWGA 1MCIA 1KT2A 2QQLL 2X7LA 1F3JA 2NZIA 3UXFA 2WAHA 2W9EL 3HNSH 4XBEL 2XTJD 3DMMA 3P9WB 4F7TB 1QEWA 4M48H 3RWJB 3SY0A 3GI9L 3B2VL 3FT4B 1FC2D 2HRPH 4JDZB 1LE9B 1NC4A 1IC5L 2BDNL 5IB4B 2Z8RA 5IBLD 1GGIH 1T4KB 4PRAB 1JJUA 3KWWB 1HILB 5CEZE 4JPKL 1U6AL 1NL0L 4N1CA 1VFAB 4G9FE 4LLYB 3PWPB 2FX8L 3V9FA 4KMTH 3OL2A 1NGXB 5GISL 4HC1L 1FL5A 1K2DB 3SE8H 1GC1L 4ESKA 1MRFL 3QQ4B 4HK0B 1HYRC 1PW3A 2X89D 4LDOB 4OV5B 4X4YA 5E8OB 4J7RA 4S0TD 4OM1H 5E0QA 1IE5A 1MHEA 2HRLA 4BH8B 5KVEL 2ATKA 4GG6E 2BRRH 4XTRD 1FRGH 2PW2A 2YD2A 5HYJD 3RUGF 1SY6H 2WBJB 4EDXB 3G9AB 4YQXL 1KYOJ 4ODHH 4EI5A 2XQYK 3MLXL 1ERNA 2KH2B 2KQNA 1NDMB 1TJIL 1W72H 4RISH 1KXTB 2OTUB 1V3LA 4S1SH 4QF1B 1IFHL 5DMKB 4QOKE 2X4UA 5ALBH 4OZGF 3MV7A 2OS7A 1UWXK 4QHKI 4YXLH 3EOAB 3ZDYF 3S96B 2E7BA 4POZD 4GQ9L 2ZP0T 4LLAA 3C08H 1BZ9B 3EOBA 1KB5A 3ARBB 5DJ2A 3V2AR 3ZE0E 2QBWA 5T1KA 4YAQB 2AXJA 1LDPH 3TWCL 3G6DH 1RUQL 4MMXC 5CD3A 3IFPA 3IJHA 3EO9L 4ZAKC 4Y19D 2CMRL 3Q5YA 3STLA 2MSPA 1BQHG 3MRMB 2HVKB 2XA8L 3ULVF 1S7UB 3BZEB 5E5MB 3MRBB 2FRGP 4WFEE 1I9IH 3W39A 4DN4H 1G84A 4MQXC 1FNAA 4PRID 4QHKJ 2PTUA 3WKML 4F2MB 3QJFB 2YD3A 2CO6B 1RD6A 1U9KA 5K9QG 3U7YL 1XF4A 5F7MC 3HC4H 4JFXB 5F93C 2D2OA 1I1YB 1K4CB 2RBLA 3RWFA 2CO7B 2IPUG 4HUVB 2B1HH 5HGDB 5D1XB 5EC1A 5HD8D 4PRIE 4WV1B 2EDEA 1QZ1A 3DXAE 4KZEH