2VDPB

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 125
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdpB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdpB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdpB03
4G1EB 2VDMB 1YVRA 1OAKA 1PCXA 4HQKA 4GZ8A 2NUPA 4JDUA 3FCUB 3QA3E 5KYWA 4F1KA 3OKWA 4HQLA 3K6SA 2WW8A 1IDOA 4F1JA 3IJEA 1L5GA 2NVOA 3EOBI 2VDNB 4CN8A 3EFOB 2WINI 1SSLA 5E6RB 3AFCA 4MMYA 1M1UA 4UM9D 1N9ZA 3BQNB 4MMXA 4WJKB 1CQPA 3IBSA 3M6FA 2VDPB 3K72B 3TVYA 2VDOB 2P28A 2NUTB 2XWJI 1U0OC 4WFQA 5KYUB 1U0NA 1YVPA 3T3MB 3VI4B 4G1MB 1FE8A 1Q0PA 3ZDYB 3HI6A 1QC5A 5HJ2A 5LN1A 1MF7A 1MHPA 5E6SB 2ODPA 3OKYB 2VDQB 4C2AA 4WK2B 1IDN1 4WK0B 2M32A 3V4VB 3BQMB 4M76B 5E6SA 3E2MA 3ZE2B 4K3JB 1M1XB 3EFOA 2O7NA 4G1MA 3PPXA 1M10A 1QCYA 3EGDA 3K71B 1RS0A 5KYUA 3OL2A 2VDLB 1L5GB 2XGGA 2NUTA 4HQOA 4UM9B 1YUKA 1IJKA 3GXBA 5KYNA 2I91A 3K72A 2UZYB 2ADFA 4MMXB 4Z7NB 1ZOPA 1RTKA 1DGQA 5KYXB 3NIGB 4O3TB 2ICAA 3VI3B 2P26A 2IUEA 1M2VA 5E6UA 1JEYA 3EH2A 4A0QA 2B2XA 5HGJA 4C29A 3NIDB 1SQ0A 3K6SB 1BHO1 3BN3A 3ZE0B 5KYWB 2VDRB 3OL2B 2X5NA 5E6UB 2VC2B 4NENB 1JLMA 3K71A 1M2VB 2NUPB 4CNBA 4FX5A 3TXAA 3T3PB 1AO3A 1M1XA 1MQ9A 1ATZA 5KYXA 4G1EA 4CN9A 2VDKB 3AL8A 1CK4A 1RRKA 1JEYB 3ZDXB 4FWWA 2I6QA 4IHKA 1PT6A 2ODQA 1BHQ1 1M2OA 3EGDB 1AUQA 1QC5B 1XDDA 4DMUB 4IXDA 2QTVA 1U8CA 4XW2A 1SHYB 3EOAI 3EH1A 1SHTX 3EG9A 1AOXA 1MQAA 5HDBB 3PPWA 1NA5A 1PD1A 1SHUX 1FNSA 4MMYB 4MMZB 2I6SA 4HQFA 5E6RA 3N2NA 3HXQA 3AL9A 5KYYB 3F78A 5KYYA 3FCSB 4O02B 3ZQKA 3ZE1B 3PPYA 4MMZA 1XUOA 1MJNA 1TYEB 3EG9B 3FCSA 4O02A 1OLZA 5ES4B 1RD4A 1UEXC 2XWBF 3F74A 1ZOOA 3IJEB 1N3YA 4UM8B 1DZIA 5BV8A 1JEQA 4NEHB 3HXOA 1LFAA 3NIFB 4Z7QB 1MQ8B 1V7PC 1T0PA 3TCXB 4C2BA 1U8CB 1JV2A 4HQNA 1JV2B 4BJ3A 3TW0A 3ZDZB 4O3UB 4PN7A 1XDGA 3EGXB 1ZONA 4Z7OB 4NENA 3Q3GE 1T6BY 3V4PB 3PPVA 1JEQB 1IJBA 1PD0A 3RAGA 4JX0A 3EGXA 4WK4B 4IGIA 3NVQA 3AL8B
chains in the Genus database with same CATH superfamily
3QUYD 4TVBA 2NUPA 4F1WA 4J3OF 2CJ3A 2F3TA 4PV9B 2NVOA 4X3PA 2YOHA 2GAAA 4WBXC 2CRMA 1G7HA 4MCMA 1H6EA 4FSXA 3ITKA 2OSLB 3QX3A 3OT1B 5I7SA 3EFEA 5D1ZD 3AEZA 5DIZA 1G21E 1WRFA 4G41A 1FFSA 3QUAA 4Z7NE 1SG6A 3K70B 3RUAA 2C8VA 3ARQA 3G0CA 2HJHA 3DR5A 1QNLA 4CLOA 1E60A 1JYVA 2XCOA 4QU8A 1QZ1A 5GJWC 1M7DA 4KJPC 1FYXA 1OFVA 4KDWA 2YAQA 4UOJA 2XMDA 4CM9A 3D4CA 4JOBA 2VATA 2NYAA 1J10A 4EO9A 3I73A 4PN3A 1UFKA 3WIFB 4TLTA 5LMNB 4FD0A 5I17A 4EDHA 1QIDA 4X80L 3TN0A 1JQLB 3OETA 1Y4SA 2P1RA 1T6YA 2O5CA 2AZUA 3T5MA 3IKCB 4MA7L 4F7WA 2A9AA 4EFLA 2EYTB 3FS9A 2EADA 1BMZA 3AXLA 3P71T 5CMAA 4Q89A 2A77L 3W9BA 1XXHA 5B7MA 1I3OA 3QXSA 3ZDAA 3OT5A 1H2HA 1JVOA 2XMPA 1P1ZB 1NFDA 1PL0A 4XXDA 3DPDA 3QVJA 3BICA 4RRPG 2X4IA 2QMZA 4RZ3A 1ISMA 2IBZX 1Q57A 3I1JA 1HT1E 2YNMD 3V2AR 3W2IA 4Q1CA 1ONPA 3SDCC 3N2EA 1B1CA 4A82A 1LSUA 1EWTA 3HJUA 3IAHA 2J7PD 3BZWA 1CE1H 2PCFA 5FA4A 5GRUH 1LKZA 5SYAA 3V46A 3AJ7A 1T1ZB 3C3WA 4OGLA 2ACEA 3UG5A 3RYFB 1I8IB 1NBYA 2JJQA 3E2HB 1AS8A 4MRVA 3L3KA 4G09A 2OBNA 1CDJA 1R4AA 3U7YL 4RJ2A 4CVXA 4U5XA 1H2XA 2VEDA 1HT3A 5FORA 3KPQB 4XXCC 2IDUA 4UE2A 2I6GA 3CUSA 4Y4KD 5HRUA 4W6YB 5AQ1A 1WBZB 2Y72A 2HU8A 3Q6GH 3B3GA 4M7LH 1W5FA 3D48R 1H8HA 3O74A 3QUHA 1KELL 4NM8H 5FUOL 3QPVA 2FTKE 2QNRA 3OIYA 1EFPA 1YZYA 4RY2A 4HMPA 1P6QA 1U9KA 2Y06H 4Q4LA 1YQTA 3CFDB 2FPXA 2VZ0A 2QSTA 1UDAA 5CYOA 2XIBA 3PWJA 4W81A 5CIYA 3PQ7A 5DJ5A 3K0AB 2Q1SA 4HIPA 1ECGA 5IKEA 4HCRH 3HN5A 1PU0A 1YMQA 1M8GA 4PJHE 1J2YA 2G1KA 4IIQA 5E8JA 5K09A 3SFTA 2QTFA 2KZWA 1A2KC 4HUCA 2G5RA 4IJVA 2Q8BL 5EP4A 1ABFA 1XA3A 4RTOA 2VBCA 3R3UA 4KH9A 4KO1S 2O14A 3MFFA 4PGFA 4EZJA 1A8JH 3DX8A 4P5KA 4DV0B 3L0ZA 1L1RA 3H9GA 1I9IH 3QUYC 1UFQA 3T0EE 1H2WA 1L0BA 1PYOA 4LDZA 3ZT6A 3FH7A 5D2NA 1IAOA 4KRPD 4RF3A 1Q0TA 4A0HA 4ZPJA 1SEBB 3VWKC 3Q41A 2EJTA 5EJ6A 3ENQA 5JUWA 1KBWA 1IM3D 1IM2A 1UWLA 4FABL 3AY0A 3KQWA 4K9NA 3O1HB 4OZHE 1EXWA 2B83A 2E55A 2GPJA 1CGSH 1AQLA 4AUMA 2DL9A 4G4SP 2YGOA 3RZCB 1ACMA 2R69L 4A15A 3JQ9A 2RQEA 2VAVA 2HJFB 4IUYA 1QFOA 2J33A 3LC1O 2L7UA 2NY3D 1SXGA 3OLGA 5KX5B 3NIDB 2EKZA 1PDOA 2LUOA 3DV9A 5H3HA 4HD5A 4N0UB 5LOVB 1VYTA 2AWOA 2QROA 1PT6A 2CO4A 4WN3A 3ZZMA 4MXWH 4KH1A 5F70A 4BQ6A 3ZG6A 2EBFX 2X23A 4M9ZA 1TVEA 3CX5K 4MV0A 3SXUB 5LUAA 2RCNA 3H13A 2PUWA 4PFEA 3KM1A 1PSDA 4C0SA 1GQRA 4LMBA 1E64A 3FI9A 4WFED 1CICA 3A1CA 1U6KA 2P2LA 2I7TA 4JHWL 3PGA1 3HUJE 2HKFH 3CFQA 5KVEH 4GXNA 3HVRA 4WHCA 1R19A 5AKYA 3PVSA 4L0CA 1W8NA 2JFZA 3PL1A 3IEMA 3QDMB 2CD9A 3QOFA 4JN2A 4M4SA 1T1WB 3AETB 1ND5A 2B16A 1QLRA 1RP7A 1INQA 1X5LA 5FBKA 5E9NA 4YHPA 1YE5A 4Q1EA 2ZCLH 4WOJA 3VKVA 1RWPA 2PCJA 2IV8A 5D7BA 3BLKA 4MAYC 1N8TA 4HVBA 4FYXA 2O7NA 4MWTA 2HV9A 5F51A 4UAHA 5KVGL 3TIXB 4OQ1A 4YR9A 4LVNB 4RLDA 5JATA 1PYWA 5DGHA 3O3AA 5TQ2B 2UZ3A 4JR2A 5EF0A 1SBBA 2OSWA 2XNCA 4RDHA 4WRLA 4QNPF 1X92A 4XVTL 4HNGA 4U63A 4JFEB 5F1IB 3MWEA 1JS1X 5TPZA 4X1IA 3BFXA 3K6FA 3W6OA 4OMFG 1WAMA 1WW2A 5IOPB 5MHSD 3T3EA 3AY3A 3VJ6B 4D4GA 1GAFL 3SE8L 3NHLA 1X6LA 2WD9A 4RY0A 1RNLA 3KLOA 2EUZA 5T8IA 1GGNA 1NQAO 1DLHA 1IQDB 1JMZA 2OJZH 1MRFL 5ICXA 5J4VA 3KTDA 5I7HA 5F1IA 2YBGA 3QQ4B 2VSCA 3ZE1F 1XZ0B 1E42A 3EYFB 2CDEA 5DMGC 1IEBA 4A2QA 2LR0A 1F8FA 2JCCF 3C6ZA 4HUTA 3EEFA 4QHPA 2IAMD 3FYIB 1LLFA 5HPMA 1XVLA 1U8IA 1A6PA 3PWNA 4TQIA 5J4KA 2Z9BA 1GY8A 4IRSA 2NYKA 3KH3A 4GW1B 4AWJC 3EJYC 4PAQA 1ULTA 3HJAA 3WDSA 3SVLA 3W2FA 1W6LA 2OJZL 2MPAL 5FGCB 1KAQA 1Y4AE 4L3FA 1RUAL 2VPIA 1S9WA 2P4AB 3LKOB 1ED3A 2OP1A 3A10A 2L7QA 2VH5R 3ZQ6A 3IMEA 4P4KC 4CMMA 1UCTA 1KE1A 4JG0H 1ZMXA 2J5QA 5BN5A 4NQDB 1JXJA 2OP4L 1G6Q1 1O6GA 2JLWA 3ORYA 5I0ZA 2VJOA 1AOZA 4BA0A 2HH0H 4NU8X 2UZIL 1BEYH 3D0LB 3HS8A 4MJLA 1MCJA 4NM4H 2PM8A 3MRNA 1NHWA 5SWZA 4F5ZA 2IADA 4E42B 1V16B 4BFUA 1J90A 3N53A 4LLMA 2AG1A 2JLQA 1KPHA 5B7EA 5JAIA 4UKDA 1FZKB 1Q2XA 2HG0A 4GKNB 3CG0A 1U8QB 1LO4L 3X44A 1NUPA 1Y1UA 3A4YA 3AWDA 4A2EA 5FM4A 2BSSA 1ZWLA 3TF7C 5KYGA 3H6JA 1A8HA 4L0YA 1JVNA 2Q5BA 1QO9A 3PGXA 4ECEA 5F88B 4MUMA 5DD1L 1VPLA 1HWYA 2Q0ZX 4F6CA 5BV7H 3ARFC 2XACC 1Z3GH 4B9GA 4KITB 3ZE2E 4BFCA 1VBFA 4LSRH 3Q7JA 5HHOE 3FF1A 4F4UA 1AMYA 2XRFA 1R4MA 5F2KA 1IUZA 1IAOB 2YD2A 3SDDD 3IDFA 4IIFA 3CYFA 5AW5A 4ZUWA 4D44A 3T8XB 5LXGL 3VI3A 3DFFA 4PYMA 2OMBA 1U8FO 5BWOA 5E9DE 4WZBE 3V2GA 3DX8B 2FGWH 1BXGB 5F93C 1AZLA 2BVUA 2IQ9L 1ISIA 3RWIA 4Q3BA 4AVYA 5AZEL 3I34X 2PS9A 2KI5A 2B0SL 5IMOB 4LLVB 5JTWA 1WPXA 1L5FA 3TZLA 2OHGA 4KI5C 4GPD1 1BS2A 3R20A 1PO7A 3ESPA 4XO4A 4MQ6A 1N5YH 1V26A 4B31A 3WSWA 4XX0A 1SRDA 3LEVH 1JPVA 3ZGYA 1DQTA 2WQVA 3I9OA 2EDKA 2XYBA 3OJ2C 1V41E 2GX6A 1KY7A 3KZ8A 4J0KA 2J88H 4MW1A 2P4SA 3QLEA 3EXHB 1ZJYA 3DVNB 4FLQA 4BFWA 1P2CB 4X8LA 3WAGA 4YCMA 1H6TA 1EQ2A 4FABH 4GRLC 3WGGA 5L9DH 2V74B 3PLRA 3WMRA 3OHXA 4NENA 5DX8A 2PRSA 3CJJA 4JJ7A 3KGTA 1BSIA 2A84A 4JE4B 1AGEB 1RL1A 3DGGA 3G7TA 3HIZA 3TFKC 4HJTA 1VCNA 2K6GA 1IL1B 2KJQA 4W9KC 1KIFA 2WMYA 2W9DL 5KTEH 2ORIA 3PUJA 2CHVA 1ODSA 3PGDB 4D0DB 4IUBS 1V48A 1I8IA 3KT3A 4U4BA 4XNXH 1UTDA 1ST2A 4KNWA 2BH9A 3ADOA 2HIHA 1S9VA 3GSNB 3TO4B 1D4OA 2XW6A 1HE8B 2J07A 5KYNA 2PWDA 3D3VD 2VW4A 2W94A 4KY1L 1NCHA 4OF4A 4PJAF 2OD9A 2HTFA 1BBDL 1AXRA 1KYIA 1TFHA 4JLSA 3QXGA 4AY5A 5TT1A 2EDFA 3GL9A 5JW4N 3HWRA 4EH1A 1PY0A 4CL2A 1TZ2A 4ZW3A 2VN3A 4DKTA 3VRLF 4NUPA 4ZV9A 5EF3A 1LMKA 2IP2A 2X0VA 4GRLA 1A4UA 3ARBC 1AHNA 1RURL 4YP0A 3UPUA 3R3YA 2XUPA 2AMLA 3QFFA 2BIIA 1QFWH 3L3HA 4YMUA 5FUZL 1VIYA 1NFAA 3EWIA 4PGHA 3ETNA 1J09A 4I9XA 1XR8A 4Z7NF 1R00A 2H26B 1TT6A 1JHXA 3DUFB 2FJGB 3RIFK 1U4OA 5DZPA 1JWMB 3FSZA 1V11B 5KG9A 1VADB 4NUGH 3QWBA 3STZA 1OTYA 2AXWA 2B5VA 3B5EA 4ZIRB 1MQ8A 2DEYX 4PC2A 3M88A 4GL4A 4BFLA 4E11A 4M5YH 1GMIA 4KO2S 4ODSL 1IE3A 5IQ7L 1ZGLP 3QR2A 4MQXD 4JFFA 3W8RA 1JGUH 4ZOEA 5DZSA 2ZF8A 1YUMA 4AJKA 2HPVA 2HBRA 1XIWA 3TO2B 4RKWA 3T06B 1E20A 3OM1A 2OSLA 1U0GA 2CF6A 1QLHA 3ZQ9A 2OW6A 1DUYA 1HNYA 3HS0B 3RTLA 1SCQA 5FL7D 1WMEA 1E7YA 1ZI6A 3S3JA 5CGZA 5EHXA 4PJXA 3T4YA 3KBOA 1JTPA 1WSDA 2HCBA 2OILA 1TKAA 2J32A 3BIBX 3UTPD 4ZVVA 4ZKEA 4JLOA 1DINA 2BFCB 5J6HB 1J9QA 2NY5C 4KI5F 4A7GF 4X80H 4FWWA 3E8UH 3K1TA 3FAKA 1GMEA 5EZYA 2AEFA 5E00A 2FR8C 5CVVA 2FK8A 2Q6KA 2BFDB 5A3RA 5BSUA 1CUHA 3E9NA 4U1IB 1MI5D 4CEJA 1Y80A 4PYKA 4WENB 3OICA 4YAFA 4LQ4A 2GSIB 5KVCA 4PIVA 5D7JC 4QATA 2WYOA 2F1JA 2O7SA 4TVPH 3U2JA 4YRDA 3HFFA 4R5MA 1D5XA 3LLUA 1NNI1 3V4OA 5DYFA 3KYIB 1AKVA 5TMEA 3KQHA 3GLUA 2WSMA 4WJZA 3E58A 1ZAYA 2CAKA 3B2DC 1M0WA 4R9HA 4DC9A 4B5ZA 4N8VB 2OHFA 1T0UA 2HFGL 1JZSA 1J0DA 5UKDA 4Y19D 2RD2A 4EMSA 4KPUA 4FA6A 5F7LB 1RC0A 2F43A 1TM5E 3WBBA 2A6DB 1P61B 4ISCA 1B0WA 3ZU2A 2I9TB 1IQPA 4BY9E 2EJBA 5E1OA 3CF4G 5FFMA 1QQBA 3P0VL 2BSBA 2BTQB 3ZVLA 2C8LA 2JJVA 4POYA 4KE7A 1RJ9A 2VISA 1VHPA 3QAQA 5C86A 3SF8B 2X6RA 4QYIB 2Z8ZA 3Q9QA 2IYUA 1SG9A 3MROB 4COOA 1A7RH 3V95A 5SX4H 2GSWA 1KTCA 1RUQH 2G3MA 1E2KA 2Q4BA 1C5KA 3AL8A 2ET6A 4GX1A 2WAXA 3I4FA 5E0FA 3QX7A 1R0SA 2W91A 1Y8QB 1HQDA 4E2FA 1R1CA 2WABA 1ZRUA 3C3CA 4TSFD 3U37A 4POZC 4XAWH 3CIFA 5E5MA 2J45A 4QRTA 1BIIA 4G8BA 1YR6A 4K6CA 2ID5A 4UAUA 4B76A 1AC6A 2BM9A 1HT6A 3FT9A 2ZRHA 4DDVA 5CJXC 2HWXA 3HJRA 3MNFA 2QM0A 3DMHA 1ZPLA 4BMSA 1QZNA 1GVHA 2FQFA 4HWEL 4UM8A 4X85A 1KI8A 4P2BA 5IVKA 4FLFA 5DYOB 2ACVA 1K4CB 1EJ6A 4LVOC 4KV5E 4I89A 3N7AA 2IGFH 2JGFA 1MAHA 5FGBC 4MNHB 1EEYB 4OI1A 1H93A 1XQXA 1JDZA 2QADC 4MWFB 4JANA 2GHRA 3Q2OA 5DZVA 3GAZA 2VR9A 3HCAA 4ACPA 4HI0E 2F8OA 2IF2A 2OV1A 3U4QB 2NTNA 1DJLA 2C3MA 3V80A 4QBFA 4PZ9A 2X6QA 3STLB 1M6NA 4MS1B 4PYQA 5CDHA 1KULA 4MLSA 4ZC8A 1SPDA 4G5ZH 3I42A 4B43A 4CNIA 2NZIA 1S78C 1KY6A 2VHQA 1ZT4B 2W22A 1BWPA 5DMKA 1SKMA 1DEEA 1CL7I 3V2IA 3AFGA 4K8RH 5JIPA 3P5SA 4NP4H 3K6RA 2ZIZA 1LS6A 5ESAA 5HP5A 1MCKA 2FPGB 3P11L 3M1CA 2OA9A 5DVZA 2FF7A 5I8WA 1CUFA 3IUJA 4ZYKA 2O5YL 1SC6A 2EYSA 3U1VA 1NONA 3K8MA 3PDOA 2W2PA 2HI0A 5KWSA 3B9KD 3GJEA 1MGPA 1U2DA 5IJDC 4D9QD 2MWCA 5HPOA 3QITA 1KQNA 1Z2NX 1SUDA 4O2FB 3D18A 4HPOL 2O0KA 2FNBA 1AKMA 2WGXA 2DUUA 4FGSA 2W0MA 4HIXL 3ZY2A 4A3SA 3H9YA 4OCYL 2CLKB 1KN4L 5FLXA 4ND4A 1TETL 2X9GA 4M1EA 3CXDL 4ELKB 1RIHH 3ZWCA 5EFIB 4D2NA 3K9LA 3UMFA 4W63A 1A9BA 4KLNA 3TNDA 5FOSA 5CKGA 5DEFA 3QFGA 2VNAA 3T35A 2RACA 3LV3A 3JAKB 2HCJB 2M1ZA 5EKSA 3K71B 4PC3A 4KKBD 2FN9A 5HQ3A 3DFUA 5GZND 1QO3B 3LZCA 2WWHA 4B1FA 1FTWA 4XRGA 5E1DA 4KFCA 1UPAA 1Z6QA 4B6OA 4P2QE 1H1DA 5KVMC 3ZK0A 2EZUA 5A2BA 3ELYA 3ZE6A 3WCYA 4ZTPL 4IUCS 4Y98A 1CT8A 1EMTL 1XF3A 1ZLWH 5D71L 2O2XA 1IC7L 3WS6C 5DYWA 2XU9A 2OR8A 4CKCB 3S4YA 4A8PA 4X6CA 2JGDA 3WK7A 2COQA 3LKRA 1F8YA 3VI4F 3AWGA 5JAQA 2A0WA 5IMBA 3LX6A 5CJPA 4MZRA 2Y7MA 5DQDH 4XPAL 4RVDA 1B73A 1RJLB 1X7WA 4OHKA 2HXYA 3GPBA 5JZOA 4LZWA 2JWHA 1E2UA 4XLLA 4U1MA 2JASA 4ZAGA 1G9SA 3INNA 4FNUA 3TQRA 3IGFA 1FJ1B 3JZIA 4KK6D 3Q3GE 1UACL 1PG7L 3TD6A 1A1SA 1R3LA 5D55A 3EF0A 1FDLH 3FYDA 2PN5A 2R1VB 2GPSA 4YS4A 1DVFC 3BJIC 3H9BA 4ZKDA 3QA3E 1TYAE 5GZOD 4HQ6A 1P4GA 3UK7A 4F4HA 1QRNE 4JCWA 5KVGE 3AGVA 4AC9A 4D7BA 4RD0A 4NRYB 4MNQB 2WVGA 3QUMH 1JYWA 4BFKA 3OJOA 3GMPB 4JN6B 1LNUB 2W6JA 3NXKA 1KVQA 1I7TA 4TM8A 4XN5A 5ITSA 4IRXA 4IIEA 3OHMA 3RJ9A 4YUXA 1B2WL 3ASNB 4CR8A 3U4EA 5EINA 5JWOA 2NTSP 4V38A 4JRWA 5I5RA 2AXQA 4QTHB 3UGEA 3KYMA 5JJ5A 2EJUA 2J4WH 2R5FA 3OU2A 4JS0A 1SJ9A 4LISA 1THCA 2HFEB 2AANA 5DTFB 3MQFA 2GH1A 2QQ0A 3IPRA 3G23A 3ZYZA 5CW2A 3CVHB 4CSPA 1OTSC 3FD8A 3VPCA 4IVNA 3S5LA 4V1CI 1JHTA 5JQ6H 3BKML 1C12A 3HC0A 4KH0A 3VNSA 3LH5A 5CEZD 4DZZA 3QNZA 1LPPA 3V0GA 1XEDA 3EFFB 3PFIA 5CX4A 4Q3CA 2B30A 4Q0XH 3FPGA 3K16A 4OB8A 5KSBA 2QPAA 1AS3A 3HFRA 1DFBL 1EUDB 2VSFA 3KTAB 3NHWA 1LX7A 1ZLYA 3D8TA 2DWDA 3N0WA 5CF3A 2HN9A 1WP6A 3EF1A 5T64A 2OKGA 5J2TA 3LH8A 1VB3A 4QARA 3KJ6H 4PTYA 1LP9B 4P99A 3S5LG 3RWDB 3UPCA 4GG6A 1ULSA 4YHNA 4JQZA 3PWUA 2APSA 3UROR 3CHRA 4DUVA 4OQMA 5KS9E 1G3UA 4PBXA 2NN3C 1E3SA 4OSOA 3ZDYB 1MUJB 5J56B 1X0VA 4PJ5E 2P42B 4LT7A 5FUWA 4MQSB 4YT4A 3L1OH 4BKTC 3PAYA 5CM8B 4X6XA 4NCJA 1JPUA 1I7RB 2VN4A 3ROFA 5LG6A 2Z4RA 3NSJA 1I30A 1U5AA 3DVAA 3IJRA 3FUEA 4ES9A 2HU5A 4R1QA 5A3ID 1PEZA 1E5LA 4P0TA 4D9HA 2R1VA 2ZCHL 4G1BA 3GO4A 2K5UA 4BUZA 3EOAA 4LP8A 5EU6D 4A8HA 3E4CA 2BEWB 3VO0A 5IW6B 2BSAA 4L9WA 3L9BA 3NZ8A 1RK1B 2FVNA 3H1TA 1T6VN 3WS3B 3L16A 3FMGA 2DV6A 3ALXA 2FEDC 4B17A 3OG4B 1CURA 5HYEA 4FNOA 3DMPA 4PV1C 1FYHB 4W4TA 3WO0A 2KLSA 3CH5A 5CHNA 3HEMA 4JFHE 1E1RA 4Y1AD 3C5JB 2CZCA 4RWYL 1N4XL 3PZRA 2X5PA 2ZDGA 2QHRL 3T6XA 2C0PA 4GVLA 4Q47A 3L4WA 4CN4A 2X38A 2PA3A 2QLMA 3MLRL 3QY0A 4TT3D 2J5LB 1SULA 3ZKMD 5LQAA 3RGHA 3BF8A 2WPGA 1HORA 4WKZB 4Y0AA 3ENZA 2B1RA 2FUG6 5E1MA 1FNGB 4HUNB 4ZGWA 2A74C 3LNFA 1E6JH 4KDTC 5HI4D 1ZCJA 5AAWA 2XN2A 1Y98A 1C8VB 3FJYA 5IT2H 2K7FA 3KWXA 4FX2A 5HHXL 1U2GC 4KGVA 1UINA 4GPZA 1NLBH 1OO2A 3TXXA 4LOAA 4GRWE 1NUTA 3AROA 2WGNB 3G2PA 1YUKB 4F3KA 3EDCA 4K03A 1LO4H 4O51A 1DNPA 2G1UA 5AW8A 1AH1A 4NL4H 2WAQA 3MV7D 3T77B 4TX1A 1DRVA 5E4EC 4NC2B 2NX5B 1X1AA 2SECE 2YKKA 2H6EA 1AHKA 5KTYA 4LDCA 3X1BA 5DURB 2DHQA 4G36A 4G5YA 1CE6B 5ACLA 2BUCA 3UN1A 1N36B 2KPOA 1N6RA 4N8EA 1J12A 3RPBA 4GT0A 1OTHA 1M67A 4CE6A 1FVEA 2J87A 4X4ME 2EV9A 1DVYA 4JEHA 3WSTA 1E0OB 4ZPVB 4GSKA 4CM8B 4Y1SA 4Q6IC 1CF8L 2PGOA 1T6BX 3OZEA 3UYRL 2Y99A 4NZYA 2VMDA 2XFXB 1PTJC 1NRIA 2ORBH 4F5DA 1RKRA 1SVNA 3EYVA 3SBRA 2DM7A 4BMNA 1XV8A 3GB7A 4KQ6A 4IVPA 5BQPA 5FCDA 1YVLA 4KXAA 8ATCA 3CUPA 3SYRA 5ES4B 4KVZA 2RONA 2WIIB 1OXVA 1XROA 1Q7EA 4GH5A 4R7TA 3MUEA 4GKZB 4PJDE 1UK8A 4OJYA 1L9TA 2B3RA 5KQLA 4WE3A 4P9HC 2XPZA 1U8HA 1ISGA 1IMOA 2QU7A 1P7QD 4KZ0A 3ZKSD 5EWIL 4PGCB 2O8CA 4QOJA 3B6SA 3H87A 3X3GL 5CJ2A 3MBOA 3WBFA 4LE2A 3GSWB 4FQXD 4PAOA 1E2QA 1WPQA 4PSUA 4YALA 5F7XA 2J08A 3JYCA 2FX8H 4ZOQI 3TLZA 2DWOA 3FWYA 2Y7NA 1E4OA 5CFPA 1WFJA 2YD9A 2XB6A 5I9IA 4K9EL 3AEKA 2PANA 3C5VA 5DXWA 4Y67A 1OT5A 3M17A 5CSBA 3NPAA 2V3CC 3TEZA 3H16A 4RTPA 3IELA 5EP1A 2F19L 2NY4C 3WNIA 3VH4A 3LVQE 2J43A 3F6SA 5C34B 1GTRA 1ET8A 4GXUN 1K7XB 1I8MA 5EEZA 3ORQA 5HIMA 4IKNA 4BV3A 1P5UC 4TS9A 3L81A 1E2WA 1NYQA 3U7HB 2OMYA 4L3VA 5E9JA 4BWFB 1WH0A 4N2EA 4WLEA 4RGVA 5AYVA 3VOAA 4OV5B 1CVIA 1CR1A 2X2EA 3QFJE 4NYLA 3RJZA 3DBXB 3E8MA 4KNUA 1Q16A 1XO8A 3PXUA 2FSIA 2KQUA 5KVGH 2CIKB 2ILTA 5GISL 4ANVA 4CVUA 2YMOA 2AMFA 3A6JA 1A7AA 2DUWA 4NBLA 1C7JA 3SC4A 2R87A 3UAEA 5J13C 1UOQA 1ZUNA 4K9EH 3PABB 1O5TA 3QDGA 3EPKA 5KJFA 3I84A 4J4PC 5I8PA 2NT1A 1SM3H 2EDAA 2ITCB 5KVEE 3GN1A 3MX0A 2NOYA 2Q2NA 4Y4HC 2YK1H 1NBHA 4C3VA 1DRWA 3EPHA 2P91A 1ZFNA 4F57H 3JRWA 3QKUA 2FX8L 1HTYA 2X6MA 3WN5A 1H2YA 2KQMA 3ROTA 3US9A 2RFLA 1H2BA 4JC0A 1JLSA 3NO4A 4HEPG 1OFTA 3SDXF 3JQCA 5I5EA 4E5XG 4OHOA 3GQFA 1I9RL 2G2NA 4QOKD 2OZVA 4UTZA 5I66A 3MRMB 3TH2T 1XGYL 2WXNA 2Q9CA 3TM5A 4ZEXA 2J3EA 3E15A 5LQKA 3I05A 3QEQE 3AW9A 1FL3A 1VL1A 4C0QC 5C97A 4PWKA 4RDXA 1UC5B 5LNK1 4Z3GA 5CITA 5F8RC 5JLZA 3BZDA 2PPVA 1GGBL 3EB9A 5IQMA 3MACH 3ZDXE 2AEPL 5DZJA 1E4WL 2JRCA 2OBXA 4F6LA 5FYJE 5F7MC 4D8YA 5IK2D 3FFCD 1MO4A 4RK5A 2VE6A 3PC7A 3VNUA 2O59A 4CCYB 4Z3DA 1AM4D 4KZEL 1ZOOA 5KNDA 2YO3A 3RL2A 4UOW1 1EXUB 3HPJB 4WN9B 4EQ3A 3QUGA 3OHXC 1EFKA 3FGZA 1XDTT 2WQ7A 2IYAA 4C56E 3QUXC 2Q2LA 2SNIE 4LJKA 3CN7A 2PXXA 4XTRA 5DO2D 3WJ1A 3NT0A 1T26A 2AJSL 3TLBA 5F7BA 5DRXB 5A3IC 3BD6A 4YRKA 3VYRB 2WB7A 3PWSA 4A2GA 3L4BC 5INDA 2Q8BH 2ZRQA 4PZPA 1RAAA 3Q0EA 1NJ1A 5KDOA 3WFIA 4ID3A 1N4AA 3SHVA 2XIJA 3BIKA 1QUEA 3PS6A 1N4XH 1J4AA 4LA4A 3UXYA 3R3WA 3WXVL 1TU2A 2TMKA 3P9RA 3NEXA 2OMXB 2BVQA 1RKBA 5EPMB 3MFGB 4QNMA 3L5OA 3C5XA 3HXPA 4XWKA 3DQQA 3FFAA 1LQBC 4QQFA 1HG0A 2CXRA 3SHFA 1JWMA 3DDWA 2D6FA 4JK3A 1NI4B 4G85A 3UGTA 1E4EA 1G5HA 1MELA 1W29A 3DUWA 5DDIP 5CFMA 1G2IA 5D7IB 3WX0A 4L37A 4A6YH 1N0UA 5AYUH 3C6LB 1DS6A 2O20A 4G59C 3T41A 1CYDA 4QGBA 4Y9UA 4LJRA 3CLUC 4XNQA 2Y9PB 3JV0A 2W8CA 2YA2A 4HK4A 3BX7C 5C0GA 5AVZB 3UC5A 3FRUA 3VX3A 1BM3L 3BVNA 3ND5A 2C1EA 1N2HA 1JBQA 3FZUD 4HG4J 4LYGA 2ABWA 1F2XK 1L5LA 1ZIXA 4ENVA 3G13A 2Y0SA 3EXFA 3HI5L 1CE1L 2A99A 2R65A 2W2XA 1XKTA 1T5XA 2Q1XA 4RH3A 4PJHF 1QSFE 4ZWNA 4V1DA 4OKDA 3RWOA 1N1GA 1UT1A 2IFTA 4QRDA 3SEZA 5CCEA 1CZ8L 2APBA 3QHTC 4IIHA 2VJXA 4IQFA 3MJ9H 4EYEA 3GN2A 2R51A 3NC0C 4J07A 4FQJL 4CMJA 1J0CA 5BSWA 5E8NB 3GGCA 4JGGA 4RPKA 5DEZA 5FH9A 2P3OA 4S1RL 1OTUC 2FJSA 1E1YA 3K72A 3F5MA 3G02A 3DGGB 1TU3A 4FNLL 1BYPA 4Z54A 4L5BA 1MCIA 3TA3D 4AQ1B 1AN0A 3TX4A 3GO1H 3X2QB 3IJSB 3I1FA 3IAUA 5T1KD 4WKOA 4HULB 4MQUA 4D0BB 5HVHB 3ARZA 1DC4A 1NJ5A 3BD7A 4MMYB 2ON6A 3KU4A 1EB9A 2WBXA 3LUHA 3VW3H 2DHCA 4IKLA 4QHKI 1U3GA 5EHNA 1YEHH 4R54A 3KYDB 1G7QA 2X7JA 1FFQA 2G8LA 1U0QA 1L3NA 1EIWA 4F92B 4MB3A 4JPSA 2OD2A 4OZFH 2XXMB 5IY5B 5HUJA 4BBAA 3FQRB 4O3FA 4JEIA 4GBXD 5B36A 4RIFA 4A2WA 4Z1MD 4FGZA 1Z4LA 2OBMA 2XMGA 2DY1A 4WTXA 3DUSB 3VMPA 3OG9A 4FQQB 4Z8FL 4AJ1A 1UFOA 3O9WD 4AUJA 1GAJA 4HDSB 4CU2A 2VAWA 4L95C 1KDYA 3DQPA 1ZK9A 4E5NA 5BUPA 4H1LG 1PFWA 4S10A 1Z12A 2A0LC 2CGZA 2GPBA 5BRZD 2D7TL 4Q4AA 1K7SN 5JPIA 3WG7B 1KMIY 3DSRA 2XWJI 4OH2A 2N1BA 1YEFL 2W59A 1GUYA 4LIQH 1N6OA 4F7PB 3IQWA 4QAJA 4RF5A 3EXLA 5HI3C 1IZKA 3OSVA 2MYNA 3IMTA 2Y23A 5DHXB 5ILTL 3KT6A 3CR8A 1OZGA 1CTMA 3EGDA 3K5RA 1YQ2A 5J40A 1PSKH 2BUBA 4EYOA 2ED6A 2VM9A 3L7FB 4GRDA 3C2QA 3LHFA 4JC4A 4ZDJA 4WADA 2IQIA 2L04A 3GMIA 1TYRA 2R11A 1FRQA 5C7LO 3NNSA 3OH8A 2N0KA 2IXAA 4XIJA 3B9BA 3B2QA 5JMWA 1C4KA 3RGVB 2A6IB 1QW8A 4K55A 3WKQA 2DPMA 4AM0Q 2UY7A 1B90A 1PR6A 1DBMH 4QDZA 3MLZH 3QPAA 3HY6A 4DQLA 1P8JA 1M76A 1J1OL 3W0WB 2EX4A 3F8TA 4I5BB 5DISB 3EG5A 3VGBA 1JGDB 4YRZA 1N26A 3GRFA 4E88A 5C53B 2PZEA 3Q6NA 5F9WC 1JEQA 1N34B 3C6SB 1DUIA 1DBJH 3TLCA 3IQXA 3FCCA 1JV2A 1CVSC 2PGLA 3K1KC 2C4MA 3FR7A 5EUOB 5C18A 3QOYA 2F1RA 4YBQD 5I2IB 3C60C 4OHVA 1D2AA 4Y4HD 1YK1A 3DSFL 5HTKA 5E8DH 4F7DA 3GJYA 1YEEL 4E36A 4BYGA 1QB7A 3ZYIA 2Z2JA 4MUNA 4R9NA 3F46A 3K4QA 5AJVB 4EG4A 2P9FA 4NPCA 4HS8L 4RPHA 3GXNA 4RDQF 4NJMA 5F0JB 4QPEA 3QCTH 4L1HA 3GEMA 4ASUD 2OTWB 2WJZB 2DF8A 2V58A 4FINA 4BELD 5GGVY 2XZOA 3OL2A 5KJRH 4ER0A 5KBDA 5GM2A 3FH5A 1ADBA 4J0IA 4L85A 4FJ1A 1F6FB 3EEBA 3P11H 1KBZA 1IZYA 2R2EA 3G8BA 3U7GA 1IHDA 1AZZC 3ZE2F 1X5KA 1WMAA 1JF1A 3P1VA 2DMKA 2NZJA 1MR3F 1OKKA 5IB3A 3PHGA 3P30H 3U5ZB 2WKSA 1ZUNB 4I4TA 121PA 2XR1A 4F56A 1AOHA 4WWPA 3DDOA 5ESVA 4ACTA 2PYFB 3TQHA 1ZE3H 4MCHA 5SWSE 3AR5A 4L3AA 1Z17A 3N3BC 1BZ9B 1K3TA 4EKXA 5GHWL 5GWXA 4U2GA 4GAJH 4O2EA 1CBUA 4PLGA 3GP5A 2KC0A 3KCWA 2P8SA 3GB9A 4JFEA 5AVOA 2Y7LA 1K4KA 4GYJA 4NQDD 1KYWA 5IUCA 4Z7OB 4KFMA 4M5SA 3RVXC 2J8UE 3DOFA 4DQXA 3MJ7A 1Z5YD 5FOUA 1YRYE 1F42A 2MNJB 3VI3F 4N48A 4WXRA 1LDGA 1BA9A 2WUDA 3A28A 5IDQA 2GEVA 4N54A 1JVKA 3KPNB 4FWTA 1XTBA 2JIOA 1L0XA 1IRIA 4IGAA 2H2HA 3G7SA 1QRNB 1DPGA 4JRXE 3TRHA 4YPGB 5FS5A 4OFZA 1CT9A 3D54D 1OSZA 4URWR 4L4VD 2Y69B 4J1QA 3IPAA 3N5AA 5J1SC 3B8EA 1KB5H 4DC1A 2BIFA 4P3NA 5LIPA 1G84A 4UM9B 2H8PA 4R8VA 4NRZA 2NY1D 2ZJYA 1DQVA 4X8MA 3ARSA 2QRLA 2NU9A 3CPJB 3CLEL 5HFNA 1WYJA 4NS1A 1CXLA 1BZDA 2OC9A 1L6RA 3FXIC 4ZCMA 4XAWL 1VJDA 4CSTA 3H04A 3N2KB 4TMKA 3CBKB 3KV1A 3DE0X 3WLPA 1LD9B 1JDJA 3U5TA 1UT8A 3E1KA 3FPLA 1FNHA 4XP5L 4RLSA 3K30A 5DLPA 4CMEA 3N07A 4EI5A 2WTOA 3CUPB 3CE6A 5JARA 3KD4A 2ONYA 2FW0A 3DX4A 4K6GA 3AYZB 3KPPA 5I9QB 3DX9B 1URPA 3ZD8A 4LGMA 1JD9A 3UAOA 3AW5A 3FOWA 4I99A 1PG5A 4CIYA 1GPWB 3KQKA 2ZAOA 1SEQH 3MRLB 5BVPH 1KC1A 3AUAA 4PX3A 1VFUA 5EPEA 2GCEA 1JMYA 5HI4C 1WA1X 4B2PA 5J12B 3ETTA 1QMGA 3EIOA 3I6IA 3TT1H 2UXVA 5CZVL 3W8DA 2E5EA 4IGBB 3ECWA 2TSYB 2Z4SA 4Y2XA 4ER3A 4X54A 4S2SA 2WM2A 4N25A 4QOIA 2CNDA 4EG5A 3NGLA 3BVDB 4CJ1A 4PCUA 1SEBA 4OZIE 5DEGA 1QX4A 1EDDA 4FMDF 3O3UN 5IBPA 3HWX1 3UMGA 5BSHA 3R3JA 4MA5A 4I55F 2EJ1A 2YUIA 4K94C 2QDXA 3N43B 1QANA 5TR9A 3AJRA 2XCRB 3L46A 1TZIA 5L6YL 2E37A 3HG2A 2XF8A 5EJIA 5JORA 4WUUD 3K1YA 5KVQA 1J0EA 3SKJL 4QXRA 2AOTA 4FK8A 4S1PA 4IIQB 1PGJA 2OI9B 1TAQA 3EH1A 5B38A 2ZX8A 2QVFB 2B61A 4BRVA 4UTNA 1KIRB 4W9CC 4FMCB 2O0JA 4KI5E 1JGLL 3LEYL 4G4IA 1YYML 3CFDA 4QRPE 3TOSA 1AY0A 4HJSA 4N65A 1C4WA 3HY3A 5IYZB 1LRJA 3IDGA 1Q1BA 4BO4A 5C7XH 1HXKA 4ZMQA 3G04B 3SJZA 3IFOA 2PZJA 5FWQA 3RG2A 1SZDA 5EBWA 3ZWOA 2GD2A 1FFDA 3MAJA 1ZKAA 2PO6A 4FHDA 4GLJA 3D0QA 1VSTA 2BEWA 5JXHA 1JGUL 2ZBDA 5AESA 1YECL 3DX3A 3QLUA 3W37A 1T0HB 4OQEA 3TIDB 1O6VA 5F3HA 1E79D 4O5LH 2Q45A 5M5BA 3PB3A 2PZAA 2HX7A 1V3VA 1GP2A 2GBGA 4QD3A 4J28A 3OKNA 1ZVKA 4R2MA 5D1QB 4R81A 4TTRA 4X9GA 1QP7A 4OV6B 2PCFB 5FA4B 3EVDA 3M1BA 4K0KB 3GQBA 2G40A 1YEKL 2I32A 1KYAA 1RPTA 5JEEA 1OLOA 3WUWA 2OZPA 4FTVB 3D59A 1F6AA 4GD3Q 3UTTB 2BOCB 4B6ZA 4Y2UA 1NMAL 2VDMH 1NFIA 2VQDA 3PFCA 4BP1A 5I8OH 1TOAA 1G5IA 5AW4B 5BZWA 2RDMA 4GS7C 2EXWD 2R9HC 1P1ZA 3I9LA 2X6VA 2WXMA 4GMFA 4NULA 1VI5A 2GPYA 3SBPA 4NQQA 4AG4L 1N6IA 1OIXA 5DR5H 3FCSA 3H0TB 3GRCA 4KB5A 2YIDA 1J8VA 3ZCUA 3BSZH 2WWNA 2YGPA 4QNNA 5ELXA 3SY8A 5CA0A 3O8RA 1GKYA 4JLRB 1W9XA 4KXLA 5CA0B 5F0MB 4K3JL 2WLMA 1MAWA 3L7DA 4O4LB 1LBQA 4I18A 3VTFA 1RPAA 3CIAA 3NVAA 1PW7A 2Y6TE 5JHDD 4KH2A 1C9KA 1KAEA 4EKEA 3SZMA 2Z31A 1JPNA 4ZW6A 3BRQA 4JI7B 2J1WA 2R2HA 3SDDC 1QOPB 4D98A 3ULUC 2CFSA 1FE8L 1VIVA 3IQDB 3OT1A 1OAAA 4UQIM 2LPMA 3PHQB 4JSRA 2XWJB 2FATL 3RS4A 4F2PA 5BQ7A 1JSCA 3VXPA 4HQOA 1ZA1A 2EJCA 1DJOA 4REQA 4TWBA 2I3DA 5EJ7A 4HCJA 3NCXA 1RJZB 2O4UX 2CV2A 1G0DA 1AMUA 3CMGA 3NDPA 3JV6B 4IIUA 3F83A 5JIMA 5A5DA 3U2SA 2HHCA 2A30A 1D09A 1N5YL 3SYTA 4NJ9L 2EUXA 3KXDA 3H99A 3QXXA 1OUMA 5I1AA 1LPOA 3EVNA 2FX3A 3HZHA 3Q5DA 1GZ4A 2VP3A 4B6JA 3BUDA 1COBA 2Z1NA 3T9AA 5CEXB 1ZS8B 2RGAA 2XTAA 4D8OA 5TS2A 5CU5A 2MHAA 5BQOA 3EPPA 1T83C 2XGMA 1WXDA 4F45A 1NCUA 1DP4A 2CO3A 1YNOA 5EBWB 4DG9A 4A7PA 2VXBA 4DM7A 2RALA 3C3AA 5LYYA 3FCUB 1J0XO 3MOBH 2R60A 4JM2C 1VKXB 4WI0B 5LP6B 1L9OA 4R2GD 4IOLA 1PL7A 4KQFA 4M5ZH 1A02N 1JSLA 3X1JA 1KIRA 1M7UA 32C2B 1ONBA 4LYDA 1FL9A 4I3SL 3P4OA 3RSHA 4N0FB 2DJSA 2X4OA 2ZR9A 3IVMA 2VZLA 4G8GA 3U44A 3LX5A 5BVGA 2AFIB 2KERA 4M1GL 3RI5K 2M8XA 4N3TA 3WBJA 2ZYIA 1HXYB 3ERXA 3UJDA 1VBMA 2HB6A 4BYMA 5AVRB 4P49A 3PFQA 1LLDA 4QBGB 4GI9A 4MNGB 5JW5B 4K94H 3BJLA 3V6BR 1SXNA 3NIBA 3FPKA 1ZGCA 1T04A 4P3OA 3PEFA 4U8HA 5LQRA 3BHNA 3ZDFA 1OZ0A 1PV1A 1BF5A 2DP4E 3AI1A 2P9YA 3IMFA 1JI3A 3HJTA 4R9VA 5MFZA 4RAUB 4ZAWA 3EWSA 2YHGA 2JZOA 3FCAA 3II3A 2DLGA 7REQA 5E95A 3LKNA 4QRPB 4C0KA 1VHLA 1MABB 4QEZA 2EVJA 5FYKL 1QZ3A 4UEWA 3ZXUB 2BMFA 1TKBA 5D5MA 3AVVA 1NN5A 5LLIC 5I1DB 3PV0A 2X1MA 4Q7EA 2WUCH 4Z7WB 2R39A 3F7YA 1DEEB 3VGHA 2FO4B 2A7QA 5EZYF 2WJ5A 1MCZA 1FEZA 5KSAD 3OX2A 4UBDC 1SJXA 1T10A 3AO0B 2NY5H 3ARVA 3I9GL 4YJZL 2OCLA 4C4YA 1EZLA 2FSDA 2YNMC 1ORSB 3QO0B 1XQWA 4JYAB 3R0IA 4DCPA 3X14A 5L0QC 5EWLB 5CGYC 2PV0A 3K2QA 2ODWA 1EZVX 1TK2A 4KDFA 3SPJA 5L88H 1GGMA 5EEYA 5D5ME 3EARA 4TMZA 2OW7A 2OK8A 4HFMA 2AL7A 1YEJH 2FPPB 1COWA 5CUSH 4X9BA 1T66C 2H4EA 3C2SA 3X43A 4KACA 1I36A 1AA9A 2VWPA 5DX0A 4MLPA 4LSUH 1DOHA 1Z4JA 1VAHA 1HU8A 4GSDL 3K0FA 4YIHA 1FL5A 2WM0A 5C81A 3O8QA 4ZAKB 1QMPA 4B4DA 5THKA 4L9RA 2AV6A 3U7JA 3RY6C 4QRRA 1A6ZB 1JNNL 2F53B 1RW4A 2GNOA 4F9LA 5EE0A 1DE4A 4QQNA 4U1GB 2Q5JA 3M7OA 4QWWC 3GH3A 1PWEA 5EOQL 2UXBB 4EB8A 1WXHA 5A4DA 3K6DA 1VSQA 4MCAA 1QGED 4WFGD 4AZWA 1ESDA 2A6JB 3L08A 3D3QA 4IV0A 2HMTA 4HIJB 2EEAA 3C12A 3FYUC 3PJFA 1FSKB 2R3SA 1UEXC 4W8OA 5FLVA 2P67A 3IDXH 1EJ8A 2HWUA 4BLQA 1ICIA 1KK2A 1IX2A 3VR3D 1DKUA 4XZ3A 4QTTB 4JFXB 5A6SB 5C9KA 3ECBB 3DZ8A 1TITA 1GCOA 3L4ZA 4XVUD 2ZSHA 4OW6A 2IGBA 1L1QA 4FG0A 4FCAA 2JIPA 2Y2TA 2R4QA 5SX4I 3P9YA 2EH8L 5ALJA 4M9PA 3EHEA 4ZSOA 1T22A 3U09A 3VD4A 3M33A 1MFAL 4OB5H 3NFSL 1PFUA 3HY4A 1LK0A 5EMNA 3GFOA 5GONA 1U98A 4CL7A 2DZDA 3IP9A 1NP6A 1IDN1 1OC4A 3US1A 2I9TA 3UF0A 1GKEA 2BCEA 3ORJA 1QBGA 4XB1A 4ODHH 3SGDI 3BN3B 2Y6SD 4LDLB 1V2GA 4R7DA 5KUKA 4O4LF 4TV9A 2R2EB 2O6EA 1K5NA 1HDMA 5JMPA 2QSCH 1B7GO 2XQKA 2V7QA 3GHEL 3U3ZA 5AVXB 1ITCA 1M5RA 4UVEA 3N2GB 2V5TA 1ID5I 1V3MA 1K2DA 2BEVB 3ZCXA 2JIBA 1FH2A 3LKVA 4LPYA 3WENA 2CFRA 1V45E 3H9SE 2ZIWB 4HDCA 4MW9A 3W6NA 1Z0NA 1ADCA 4K6FA 3KYBA 5K3SA 1XMEB 1MG0A 1QHNA 4M93C 2XTJE 4CDMA 2QX8A 4MICA 4ZHQA 4YRAA 2CLFB 4FG6D 5DJYB 3PNMA 3LD8C 4TTGA 5ABDE 4U3SB 2NY6D 1T9DA 2E56A 1UWFA 3L2MA 3LGAA 2EEDA 2C54A 1EWVA 2C7BA 2HSDA 2WBLC 1G2QA 1UWCA 1IFRA 4V1CB 2JKWA 3FHOA 2YLHA 1D5BB 2GIYA 2OL3L 1BVUA 1FMFA 2ZTMA 3Q3GA 4YJ3F 2FIKB 3ZI4A 3T7DA 2IVFA 4RGMB 3BXZA 3WYBA 3SCMA 4ZCLA 1DJGA 5LLDA 3SJCA 3PVZA 4FJ6A 4WLCA 4RF2A 2YJGA 2B14A 3FYSA 4JNXA 5EIBD 4F8EA 2BOBA 4XPGL 1PJ2A 4MYPA 1VHWA 2VAAA 4QC2A 5FBHA 3TO2A 4LIQE 3BCSA 2YSSA 4FGJA 5JI3E 1WK0A 3D8UA 3WEAA 1SIWA 1BRMA 5EWJB 4JI1B 4IJ3C 5DUMH 3ADBA 4HV8B 3ILVA 4D8XA 2ZR7A 1IM3B 3OF3A 4CM4A 3OKFA 4HC1H 2HSZA 2WQRA 3QWHA 3CBRA 4J49A 3L7FA 1Y5LA 1AKJA 5IFHL 3FBGA 1QO0A 1B6RA 2BWJA 3C6MA 1VENA 3HVDA 2WI8A 1Z4OA 1JXGA 5BNIA 2NSMA 5D2LE 3QI2A 1JDVA 3NH9A 2F2HA 4H7JA 3E9UA 4WI1A 1RZRA 2G6BA 3REOA 5JO5A 3VWJD 5IJ0B 1A14H 1QYGL 4XMLL 4Q4AB 4KY2A 5G40A 4TTVA 4TMFA 3HI1B 1KIMA 3AT1A 1EUQA 4B3MB 3AY6A 4N1AA 4X7SH 5F9OH 2NPOA 1OAXH 4D0LB 4DR6B 1EX9A 1NGYA 2DFTA 2HA6A 2A2ZA 3W5SA 2CXSA 2VT2A 2YXBA 4RE6A 1IVYA 2OCKA 1I4OA 5B6PA 3PIQB 2EXXA 3GP8A 1JYNA 3FPCA 1XZAA 5IQ9A 1XF5A 3R8BB 4B9CA 3ZZLA 2QLNA 2IHNA 1GZHA 4QJ4B 1RZUA 3N0VA 1G7QB 3O6FC 5JOQA 1N1EA 4TLDA 5LMCA 1PR9A 3SBOA 4M02A 1HE8A 5JAOA 1O03A 4YDZA 3EQ6A 3TO4A 4DUZB 5BPPA 1CFTA 4Q48A 4KBFA 4U1HB 1SXIA 3CO0S 1QFXA 3AKEA 1T8WA 1NLFA 4D0BA 5CCDA 3LPOA 4B3XA 5DS8A 3CZLA 2YR3A 2CXHA 1A98A 1CQKA 1B26A 4YRQA 2PKRA 3OIWA 2K9FB 1CFBA 4S0SD 3V5NA 4WZBA 2IFGA 1HE5A 3EGIA 1I4FB 1NC3A 1C2YA 5JADA 3LT0A 2O72A 3W4JA 3F7KA 3QJVB 4LLWB 4O5OA 3QYNA 3I6YA 4P38A 5B3JE 3C85A 3EXHA 2JELH 4EB6B 4P80A 4YUEH 1PWZA 2IY8A 4RBPH 5ED4A 5CEZL 5I76A 1Z08A 4PF1A 1R5BA 1W46A 3Q44A 2FXIA 4Q03A 1I14A 3CXUA 3RK0A 3UPDA 4OJCA 3NPSC 1R0XA 2ORYA 3QYJA 4WI3A 4Y16D 4EB0A 4FW9A 4YO0A 2DQDH 5C0GB 1V3QE 1GYAA 1UOEA 4ZCQA 3A6PC 4MVJD 1HG1A 4NXMB 3WJAA 3NP3A 4XQCA 4LVHC 5AW5B 4RESB 3NSCA 3PQDA 1E98A 4OI0A 1XALA 5D3MA 1PLLA 3QIWA 5EU7C 3FNBA 2MOKA 1AK2A 3GVIA 3O3DA 1SXJC 3IWVA 3OJXA 3PTLA 4ISBA 3VG9B 4X4KA 3WLEA 3C7AA 1K6XA 5J5CA 4JUAA 1J18A 3KKMA 2AABH 3NSYA 1P3Y1 1GIAA 2FH8A 4OZFA 4DZ8B 3IHTA 3WZ2A 2Y36L 1Y8CA 3U2IA 4H8HA 3G7NA 3BH8A 1M2VB 4OZGF 3OZCA 3BEWA 3C60D 4F8PA 3I85A 5IEJA 3BKJH 2YX1A 3KSMA 1PJ9A 3NM4A 2VO1A 2Y05A 4KK8D 3S2ZA 3PEUA 4EHFA 4QUEA 1M0TA 3ARFA 1NJ9A 3DDNA 2FCAA 1ZHFA 2H48A 2DR0A 1AQJA 2IPTL 2FKAA 2JJUA 2DMGA 1Q2UA 4YCAA 4ZD3H 3SVZA 4DC0A 2GJ4A 3MSCA 4D4LA 3GD7A 5AAPA 3VZDA 1AJ7L 1V7PC 2V7UA 2AH5A 4EGFA 1X4YA 4DTIA 3PFWO 1DVUA 2WIAA 4EPVA 4GXUM 2CUIA 3NFNB 1JRHL 3MR9A 4UVHA 3H9JA 3WL5A 5F3WB 1JE6A 3KB1A 3UIYA 4XTCS 1Z6JT 3KQVA 2CA3A 1Q7GA 4P84A 1Y6KR 2BFBA 3TC9A 3D4GA 1T5WB 3OEYA 2FEAA 3IBSA 1ORDA 2J6HA 3OTIA 3PDUA 4KHZA 5M7QA 3O4OC 3IMSA 5GGVL 4HXGA 5CB0A 1QYXA 1R0AH 1SEQL 4HCIA 1CF1A 2CLRB 1OANA 4RAVB 3IHKA 3OOYA 5I4BA 4TYPA 3NPSB 4JO1H 4MMXC 1J0JA 1UL1X 1QFUL 3O92A 4M22A 3RWEB 1I2AA 4CW7A 1H8OA 2PR2A 4ND6A 3NRBA 3ATAA 4PXSA 3T3OA 4NAQA 4MBOA 4Q7MB 3EYOB 2P41A 1IEBB 4CADB 3VYNA 1FP7A 3CPEA 2CDEB 1WDKA 3WSQL 3MRMA 1DLIA 3DUUA 3NAGA 5DQJB 2VR5A 3NCWA 1F6LL 4NZOA 5DHAA 4LWZA 1KKMA 2F5BH 4EI5C 1U92A 3N6RA 4OJFL 4HS3A 1T2FA 4BNDA 1NAHA 3PAZA 2PMBA 2GCNA 3MRRB 2XV0A 3V6MA 3I3DA 5JWRA 4MAMA 4A04A 4WUUE 3STYA 1WWKA 3TOPA 3CU5A 3CBJB 3BPNB 3ESXA 2IEGA 2OGSA 5E7FA 5JPMB 3MBKA 1VHQA 3GGGA 5FRDA 1CUAA 4PCAA 3SC2B 4JX0A 1OFGA 2COEA 4WSJA 4UMFA 1FZJA 3EZXA 4XQEA 2CUMA 4KQEA 2PCYA 1ZCFA 3EHBB 2G60H 3L5XH 2Q3CA 1JTTA 4OIIH 5ECDA 3GJ6A 4RYDA 4WWKC 4LVNA 2XJLA 1TJ4A 3QF7A 5EIXA 1I9CA 1UBRS 1IPEA 1KCLA 4CRPA 1B8PA 5I6XB 1H15A 4INAA 1A4XA 1CJYA 3VH8B 4Z9BA 4P83A 3KPTA 2X41A 4YK7A 2GSGB 5MGNA 2E7CA 3MXVL 5CYGA 1RC1A 4EI0A 4WUKH 4HLNA 3ZC3A 2WE8A 1KCVL 1INQB 1YR9A 3JWEA 3GC3A 1X7ZA 2HEIA 3TEWA 1USGA 4NBZB 3BEOA 5IZCA 2G06A 1JCVA 1MW9X 3I8OA 5FUVA 1NMQA 2XZCH 3M17B 5IBLC 1P2DA 3D8NA 3ALPA 4PIPA 3GK3A 1WQ3A 3X12B 4AG3A 4Y9SA 2AI0H 3UERA 4X5PA 5EN2B 1TXGA 3TZKA 3GWZA 5KYYB 2G63A 3UZQA 2NVBA 1FPQA 2JHAA 3ONFA 4MW4A 1C0KA 2DWEA 1ZVMA 5AXDA 2O8FB 3PG2A 3T1VA 4B8ZA 3UMNA 1O95C 1HI9A 4LXIA 3IMVA 1VI6A 4Y0VA 5E23A 2QV0A 4DKAA 4PYHA 5KJRL 1FZMB 3IFNH 3TV8A 5EI5A 1CDYA 1SZJG 2NNRA 4NAJA 2FSGA 3ICOA 1NZRA 4A68A 5DT1L 4HWNA 2CXNA 4UPVA 5CXSA 3ZQUA 4L9DA 2ZSWA 1VIDA 4MQ4A 4HSAC 4QLAA 2QVLA 2B4QA 4IQGA 1G21B 5I5IA 2DQKA 1L7IH 1HH4A 1V25A 5AK3A 1C16B 1ETA1 3CRZA 2H7XA 5B2FA 2JH3A 4F8QA 1P80A 2YFKA 1BE8A 3G9XA 3P0HA 2M32A 1X2EA 4AM0B 1YN6B 1N5DA 2NNWB 3TAHA 3A3YB 3EYSL 3ZUCA 2DW5A 2PT9A 2ZBQA 5F78A 4G80A 1T20B 3ZV7A 5BN4B 3CZ5A 4HFWA 3PITA 3LQZA 1EHAA 2ZRPA 1NT2A 1CNFA 1K27A 3B1KA 4N6QA 1ZLDA 4RFOL 4U9UA 3HAEG 4P5KB 1FFHA 5EO1A 3GT7A 4MQMA 4X45A 3HC2A 3THML 2WC7A 4LHVA 3NCHA 2UKDA 3AP2A 2DERA 4H18A 5E6RA 5J2UB 4TQ9A 3QRGL 2E4YA 1G0YR 2BVOA 1VFNA 3VQMA 2EJVA 4DNOA 1AFVH 3WNQA 4RU1A 4ZUVA 5I1EH 3AM4A 4G3YL 3UG7A 1XF4B 4DQOL 5CBPA 5G4LA 4C55A 4PLWA 3G5VB 2XZQH 3L1EA 5MEND 2QZQA 3SQWA 2HA2A 5GTDA 3AGWA 2Q3JA 3NZEA 1XEFA 5L0QB 3SMQA 3D4YA 3WEBA 2NSJA 1KNOB 2WTRB 4ONGL 5GGRY 4N0DA 1B8VA 1QTQA 1FMLA 2AKAB 3N6YA 3IP6A 2APTA 4F5EA 4JDEB 2IRWA 4JDVA 2QHLA 4UHFA 1VQ1A 2HMWA 2VPYA 3C5JA 4X6DF 2ATXA 5AHWA 2QVZX 1Y9ZA 3ILEA 3OCXA 4HLUA 4D41A 2I22A 2B7BA 2VHWA 4KNVA 2IEPA 1ZCRA 5FNVF 2A83B 2ZUEA 2XOKA 5KKAA 4CU8A 1JBJA 2H00A 2BW0A 1D5CA 4IEFB 3VGAC 1RZKC 1CJTC 2JJSA 3BD4A 5J6GB 1A95A 1NN0A 1PDWA 4BE6A 3WKAA 3ARGB 1XP8A 4R26H 3AS3A 5C07E 3C8KA 4PLZA 4K6OA 3OJDA 3DOHA 2YPLD 2Z64C 1M6WA 4WHYH 1KG0A 3HB3B 3U3DA 2PLTA 4EJSC 1L4FA 2XPGB 3CLTD 2CB9A 4KMQA 3B5TA 3IVXA 4Z78B 1LXMA 3EYQC 1O58A 3NYWA 4DUYB 5AEAA 5FFOA 2HLDA 4NQXA 3RLSA 5BS0E 5C9JB 5IIEA 2DMCA 4EA6A 4X6CE 4ZYWA 4DCCA 1ZVVA 3P52A 2JCXA 2LBPA 1ZHLB 1RM3A 4BFEA 1WTGT 3KDMB 2X8LA 3CMOH 3LA8A 3LS5H 2VLJD 4DESA 2X2YA 2JKNA 3R7FA 3VHXB 4ARIA 3O82A 5JR3A 2EYTA 3L6DA 3RWDA 5A7BA 3OY2A 3HCBA 3BXPA 5IW1B 3T65A 1E4KC 2PY6A 4R9RA 2K6ZA 5HVNA 4UNTA 3QU4A 4BVHA 4JPKL 5EV7A 1N6KA 3QCUH 2BINA 4RMQA 4WESA 5CX1A 1DCTA 3CZQA 2YQ2A 3MJ9L 1C7SA 1XH1A 4GECA 3NGBC 2VQ1A 3EBIA 4RA9A 9MHTA 4K9SA 1I5RA 3BUTA 3TCNA 1SOMA 1QF6A 5A7HA 2PAAA 2AQTA 4XGZB 5CH8A 2BVPA 4KR6A 1W9MA 1IM9D 2UZIR 5DI3A 3IAXA 3RB5A 4OCZA 4XSHA 5HZKA 5KPDA 3S5LB 2ZE7A 1A6UH 3QFHA 3R5JA 2V45A 3S68A 5IF3A 2GK0A 1N5MA 3O73A 4YJFB 1NP7A 4M56A 4ALAH 1OBCA 5DCUA 4Y16C 3HGTA 3U30B 4HPHA 1QQ7A 2OBBA 3F97A 5LXTB 2HFEA 3LUGA 1QKKA 3RRZA 2I91A 3O2SB 4MD4B 1TM4E 3RE0A 1LBEA 2PIDA 621PA 1IEAB 3ROEA 4KNTA 4G5HA 4GLBA 1BEZA 4RMBA 3LP5A 2OMZB 5GIRB 3EQ8A 4OM1H 3FTSA 1Z5VA 5HIAA 3U4EB 4CUJA 1Q83A 3B3FA 3CFCL 4OZGE 3O6FB 1F60A 1I9GA 2XZCL 4WSOA 4BIIA 3RS5A 4OP3A 4DUGD 4I0WB 2C5FA 2AJLI 4MD0B 4LC0A 4Z7UF 3S6JA 4C56D 3ZQ4A 1N2RB 1HMYA 1RYMA 4JDPA 2GYYA 3EQ9A 3B2UD 2HX9A 3GEEA 1J5EB 5DM1A 1DDHA 4RQBA 4DRXA 5JZMA 4ZZ3A 3I2GA 4A10A 4D0GA 3V0AC 1RD4A 5HMMA 5B7QA 1TPXB 5EHFA 3AL3A 2IS1A 4FXKB 6GPBA 2FHFA 2W2LA 1VFAA 2FE0A 4H8UA 1BYOA 2FTAA 1LH0A 1X9IA 4QLWA 4ZT2A 5DZOA 4BMCA 2WD7A 3AUXA 3UAJC 3DKPA 4DDWA 2OMTA 1XB6A 2VITA 4L02A 1BFVL 4ELMB 4E3ZA 4F2ME 4QRFA 2V7BA 5AB0A 4LDQA 4YXKL 3P2MA 1CDEA 2UXDB 4IDQA 4PBTA 3HKBA 5LUBA 5E94B 3HZYA 2DKFA 1GV1A 1EFRD 1F2TA 3UBXA 5DM70 5J13B 4MLZA 3VKWA 2W2VA 4F27A 5CLQA 5JR1H 2B9EA 4BU1A 4JODA 2GSDA 2VJKA 1R6XA 4JEMA 2X14A 1EDZA 2QDKA 1K2VN 4EMUA 2ESVD 3ZD6A 4GXFA 4DXAA 3MJGX 3CZPA 2C2OA 8ABPA 2C3VB 1QG6A 3BWXA 1C9SA 1UJ2A 2F5BL 4LVOA 4WLOA 3QS2A 1YMHA 1LBSA 3UWMA 1PEKE 1B6DA 1B9ZA 1SVBA 4OH7A 4D8WA 5C0RL 2X15A 5MEQA 4BV1A 3JD2A 2CL7X 5KYXA 1NXTA 1YDFA 5GQBA 4BCYA 2VQSA 1NTRA 3UJTL 4Q14A 4F3RA 5M04A 3JAKA 4DM4A 2Y5TB 1P2VA 4Q9QH 3DP9A 4YJGA 2RE8A 1MVLA 1BS1A 1ZCAA 2BMEA 4IYRA 4NUQA 2WZBA 2J8UF 5EXEA 3TLJA 1TMCB 1NBMD 4LL9A 1YN7A 3ZO0A 1UXGA 1E40A 1L9PA 4N76A 3OTGA 5JU6A 3RIEA 2ZS7A 1GD1O 1MRCH 3GYBA 4YRSA 1AGCA 4C2BA 2OESA 5DBIA 1Z9OA 5JOFA 4JEGB 5MN5A 2B36A 4JAMB 3EK2A 2Y1EA 1KKLA 4ODVH 4WK4B 4WKBA 2WUFA 3BXNB 3E1SA 3PIIA 5KNDH 2C58A 4D9EA 1G60A 3WGKA 2C3VA 1EFVA 2GM5A 3OZ9L 5ALDA 1DMSA 3EFOB 3DXXA 2J20A 1BM7A 2FSEA 4FG2A 3H42L 1H9AA 2F1AA 4E9XA 3ZN6A 2EZ9A 4W9NA 2HLPA 3C3MA 1X5XA 5HJBA 5H0IA 4ZMNA 4RGYA 2VAJA 4ENRA 3VOSA 1Q1PA 3HZYB 1D3AA 5AVYA 1NJSA 5ES3A 2OCDA 1GA1A 3VRIB 2XWQA 4AU1A 2XA9A 3BHBA 5D4HA 4XBEH 2C1OB 4V11A 4F8OA 1FFWA 2K7ZA 4ZXBD 4RD6A 1WXXA 1OXXK 3D0AA 1Z39A 2ARWA 4JQIL 1CVLA 4GQ9H 3N1FC 4WD3A 1RBMA 4XNYH 3GFPA 5K51A 1CRQA 5BWMA 2A94A 2JTYA 3O4GA 2I4LA 3IF1A 1QSZA 2HN7A 5AH0A 1E6UA 4JFTA 4QHMB 3LUKA 4HLZH 1NJGA 1HT2E 3AI2A 5D1ZB 2R1TA 4R4BA 4M7LT 4Z1PA 1OEZW 3ZIAA 3HXOA 2OZ4H 1NEZG 3DO7B 2DSTA 4P3PA 2IODA 2DIBA 4C78A 2YVAA 5KEZA 4MXDA 2MOVA 2NTVA 2H9GA 1JWSB 2BY3A 3BFOA 3N1MC 5ICCA 3U36A 3CEHA 1W4ZA 4CEIB 3AESB 1TTGA 2W2NA 4YLEA 5ILQA 1UCBH 2JFWA 4RH1A 4DRZA 3S28A 4OIBA 1SOWA 1R4XA 1MIOA 2MJLA 1OASA 4OXYA 1FRNA 1RRGA 1TTRA 1BJKA 5KO2A 1ZGBA 4F7MB 4I1SA 5ANRB 3U17A 1Q7CA 1X0XA 2KZBA 2DRIA 3TLAA 2UWEE 3GVPA 1ML4A 1W0WA 3HMXH 4HVAA 1U8TA 3ASUA 3MRKA 2UZYB 2VQ1B 4OZIB 2FT7A 4AQYB 2AXNA 2GPNA 3ORRA 2NY7L 4P2RA 3DBHB 2IALB 5MDHA 2E74C 4GPTA 3AMKA 1NXXA 1CD9B 4TSFA 5IDXA 4LJ5A 3A23A 1MZZA 3C43A 1VJ5A 3RU3A 2IV9A 2ZUTA 4E30A 3Q2CA 3WJLA 1D1PA 4LU5H 1Y6QA 3A4MA 3B20A 4YWJA 5AZ2H 2WFLA 2WXLA 4RSYA 5JS2A 3H9ZA 4OIFA 3OO1A 1W4RA 4ILEA 4FQ7A 5KVSA 3N3EA 1ZPDA 3H1AA 5M95B 2XTMA 4OSEA 2WJHA 3FAWA 2IH3A 3E7XA 3H3PH 2L69A 3L7CA 1UMBB 5DGXA 2WLZA 4G9GA 3GBPA 4K8RB 1Q9OB 3TTSA 5FHQA 43C9B 2CVPA 4JC5A 3IDMB 2FWJA 3ZRFC 5C8JB 4H8WL 4Z7UB 4DP9X 1YMMB 2IPOA 5EOVA 4ZA2A 5E4FA 4ZFOA 1IT9H 4J1UB 3ZKAA 1ZHNA 4U1IA 2WIBA 4Q58C 1HEZA 2Y93A 2AK4A 5D2LB 5TD4A 1IIRA 1HV8A 4PG6A 4B6SA 2ZCKL 5ECGC 4GUOA 2E89A 1P7WA 2ZKYA 2W65A 5DUBA 4JASB 3LIUA 3W7BA 1XWWA 2QJWA 1PZHA 1RYFA 3GJ4A 3WJJA 1JR3E 3RIXA 5IB5A 4NKDA 3IPCA 5L7WA 3W3BA 2A1UA 3JTBA 4AO8A 1V1MA 4UUJA 1NVBA 1Y6ZA 4B3CA 3ZKMC 4WV1C 3THWB 4LLDB 2PNFA 5C0DA 4BB9A 1DANU 2Y0PA 4F9GA 1K6MA 3OLWA 2EZ0D 4L8BA 2G70A 1LP9F 2EP6A 1QHQA 3F3MA 3IAEA 5GOTA 3G5UA 1AC0A 2E0IA 4MVJM 4IRJC 3Q0HA 3MRPA 5ICMA 4CL0A 3M1OA 3U4GA 4CDNA 2Y77A 2Z3ZA 1PNOA 3D1VA 3JQAA 5L95A 1SK8A 5FGCE 5EP2A 5CN3A 4B5KA 2W90A 3ANLA 5ERXA 1Z32X 4XVHA 4UD6A 5K8LA 1IOWA 1CD1A 5PAZA 1UJBA 1UOPA 2OL3H 3LCYA 4M0DA 2X9NA 4MX7A 3BERA 3H1EA 4JROA 1R0ZA 3VR6D 3AERB 4ZMYA 2FI1A 2NNLD 4AQOA 1U2QA 3L3HB 3BFKA 3KJ6L 3MJ6A 4HRVA 2BHFA 5GRYA 3B52X 2HMVA 4Q3EA 3ZV6A 4ARVA 3C5SA 3PVCA 2WXKA 2BKLA 4I6JA 4H40A 4PVMA 1YS1X 1N0HA 3LAFA 1H19A 1T9GR 3PHLA 4LJ8A 3I76A 4M4RA 5E4JA 5EMLA 1XZKA 4DA0A 5FP0A 2YEZA 3FT0A 5C07A 4OXIA 5BW7C 3FAZA 1U8PA 2HQBA 4FGLA 4HX9A 4RQTA 3SQOA 3GGPA 3UBGA 4DCVA 4UT7L 3DBLB 1TF4A 1NAIA 4U0RB 3BH7A 1GSKA 3LQAH 3KR0A 35C8L 3UHFA 4YAQB 1VC2A 3AYXB 2XNKA 3RJTA 5IX8A 5LDGA 5BV7A 5KYYA 4HG4K 3JXEA 3PFFA 2Z91A 2FWOA 4N2LA 1OQOA 2DJIA 2CBTA 4AC2A 1NVAA 4URHA 4Y1FA 1KZ7B 4DN3L 3KAKA 4QO7A 3JYPA 1RWVA 4N40A 3W9DB 2QRVB 1G7LB 4NKOB 1GM5A 1D6VH 3UJ7A 2Q0QA 4HP5A 3D39A 5BO5A 4YECA 1ASOA 4DJTA 4YRBA 5I1HH 4MB0A 3WFBL 2QQ5A 3V6FA 3B2PA 3GTNA 1T3LA 3KE8A 5A4AA 4MA0A 1GTMA 4TRRA 5DWUL 2H54A 3GXUB 4BMYA 3SGJA 1WJ3A 2XTJB 2C3HA 4UQOA 4P2OC 1Z2EA 4NC0B 1PLCA 3WHE1 4GEGA 43CAA 4NWTH 3V0FA 2E4VA 3KB2A 4BV8A 3EWAA 2I8AA 3DE6X 1T5IA 1BYUA 3IJHB 1YAHA 4NCXA 4BBWA 5ER9A 4X9YA 3HUEA 3RU7A 3HPLA 2WJ6A 5E6UA 1K89A 1TTUA 1AVTA 1E9PA 3ROKA 3NB0A 5JPMA 1U2CA 2CHUA 1UMDA 3DOOA 1EEUA 1KDZA 3NLLA 4BWTA 4PRYA 3N75A 3GRZA 4MGZR 3UABA 1U28A 3BYTA 3CW9A 3VSTA 1N1MA 2N42A 3TEXA 3OWHA 1PNTA 2GHTA 4DNXA 4D8UA 1V4BA 2PZFA 5IB1B 2DFLA 4BQQA 2ZP8A 5DURD 3A2MA 4PLOB 3NDJA 1J2RA 3IAAA 4Q93A 2PK3A 4DSZA 3L06A 4IIYA 1QRND 4WTWA 4HXEB 4R71A 3ZGHA 1INDL 5L7XL 5EEHA 4ALNA 1A97A 1OREA 3UMBA 3C6BA 3VFMA 2GN6A 2GYWA 3EYOA 3QXTA 1RFDL 4QOKE 1GJRA 1XGRA 5F7WC 2YWJA 3RGWS 1RE1A 4C0BA 3ZYOA 1DQNA 1JDTA 1FZKA 4BN4A 1K8QA 4YP9A 1IE4A 4C0HA 3QA9A 2XT1B 3GJ8A 1U9YA 1KYZA 4DL9A 1FNNA 1QGOA 3KLAA 2R5WA 4PJBA 4KNYA 1EV2E 3GPIA 3KFVA 3BN9C 1KPUB 1ORRA 4U7HA 3VOTA 2P4HX 1DVXA 4JBNA 2ZD0A 1K4DA 2FCBA 3I5MA 2VL5A 1ACYH 3WV0A 5CCHE 3CLHA 3LRKA 1SPBS 2P9CA 4QJIA 5D93B 1NOFA 3A05A 2IUYA 4U6HA 3FIUA 4EECA 4ENWA 4H0FA 3T3PE 4PCVA 3GW8A 1WPRA 2WVJA 4ZHQF 4RGBA 3I2YX 2OPCA 4CMMB 3WMFA 5K99A 1MJ7L 2EIEA 4INZA 5SWZD 2MOGA 5GRZA 3DMGA 1G4UR 2BTOA 4G4GA 4EJ6A 2XRMA 4I3HA 2Z2IA 2GCOA 1ED3B 2KBEA 4AM8A 1BXAA 3ELBA 1AZBA 5COBA 3NEYA 3QFJB 4Y2TA 3ZV4A 4GQZA 1GSOA 1KARA 2OGUA 1EM8A 1VL2A 1SQSA 2FQ1A 2Z35B 3C3DA 4I0PD 1ZINA 4RKQA 2YDXA 2IDZA 4WCVA 2J0EA 4WASA 3ZCPA 2D8MA 4D9KA 1BVNP 1I3RB 3KYCB 1OGJA 4LWPA 4G89A 2RI1A 4FOSA 4OHXA 1UFUA 3KLQA 5DHVB 2V9TA 1AXSB 2BIQA 1BBJB 1LK7A 4HLCA 3L0CA 1KN2L 4M21A 4UJ5A 4IKEA 2OP0A 3DCJA 2N56A 1PT7A 4LLYB 3BH8B 4B41A 2D7PA 3NX4A 3AWIA 1KXQE 3SE6A 2Z5FA 1HYGA 4MI9A 1GA4A 5EJ4A 3F01A 2D0GA 3SS7X 2A33A 4Q02A 2Y7QA 3WFJA 2IDCA 1VEPA 5HFJA 2B25A 4WNQB 3FRJA 1E7QA 3ARBD 2G6TA 4GLRI 4CILA 1X39A 1CEQA 5IULC 3RVBA 4X7CC 1L4HA 4RJLA 3WO4B 3HI6H 3E5MA 4LY9A 2NY6B 2JVUA 3A24A 2PMCA 4TXJA 4Q3LA 4X8CA 4X1IB 3ZCSA 3DGEC 3HCPA 2OYMA 1Z9SA 4W9LC 1UWYA 4NCNA 1GYWA 2UXCB 3VYUB 2J3SA 2QD4A 1N3LA 1IGFH 3ZX4A 4B3DA 1JVLA 3WG9A 1PG2A 2AFRA 2BNRD 3H86A 2XYHA 1VMDA 3U19A 1O75A 2ZKHH 1N92A 1GT6A 1SC4A 3WUWG 2DL2A 5G2OA 1ZUWA 1UVQA 3DLQR 3W04A 1J9SA 3L0PA 4EB6A 1S5HA 3OOWA 5EU4B 3HR5B 2D7QA 1Y63A 5DZLA 2P3LA 2P5EE 3ER8A 4LLWA 4CYMA 3F98A 1X74A 4L8FA 5M94B 3AVUA 2NZ9C 1EE2A 5JRZA 1TC1A 2MNWA 1EYZA 3AETA 3K9NA 1QPZA 5D6DA 4ZX4A 3JQGA 4WZBB 2WU0A 2MINB 2ZZNA 4KX5A 1SY6H 2AI1A 3F84A 4JDTL 5BW4A 4HPYH 4ND3A 3ZSTA 3FCYA 2Z91B 1MG5A 4J6IA 5TMBA 4KBPA 3T3ME 1Y1DA 2A5YB 5HYJD 1RLBA 1LWOA 5ALCH 3GRAA 1OQXA 1L7EA 1Z07A 1KIPB 4JJIA 4OAPA 3E0GA 4QJ4A 2QVGA 5AALA 2EICA 5IQ9B 1CY6A 5L2JB 3AVXA 1DQMH 5TE9A 4E5XB 3LW8A 1RI4A 2EDXA 2L8AA 4YLGA 2IYZA 3DKVA 4J43A 3TG2A 4HGOA 2HJFA 3QEQB 1VOTA 2VP5A 3KV3O 2GJRA 2ZOWA 3TM6A 2OFWA 1B16A 1Y4UA 4HT1H 2MCFA 2H1XA 1L4UA 2NY3B 1BX0A 3ZQWA 5U9CA 4YSUA 4PYGA 3GGDA 3JASA 4N90D 4FZ8L 5I7WA 1SXHA 4XO5A 1T1SA 1RMFL 1Z35A 1UQRA 2JGNA 2PFGA 2XMSA 3GS4A 3CVIH 3CSYA 1JNHA 3R1GH 3WNNA 3PQFA 2EDDA 2PR9A 1N0LA 3TD9A 4CF4A 4HKXB 1P0FA 1T0PB 4D9LH 4DGUA 1IM3A 1JXMA 4P23A 1K97A 4R41A 1SVUA 2CXKA 4KTDL 3WUZA 5B3LA 2QZZA 3QNFA 1EVYA 4MS6A 3EIWA 5AOZA 1YECH 3TBTA 2OORC 1L5SA 4YRTA 5GS0H 1HYSD 1S8OA 4M5YL 3ZQJA 3DRTA 2HXGA 3OCVA 4NEQA 1TX4B 3D8MA 1ICEA 3MUGB 1DJXA 2HB0A 3BRFA 4JRFA 2JQMA 4UILH 4OQTA 3ECVA 5DFWH 4JXZA 3ESZA 3IEXA 4AEHH 2WJWA 4IJKA 2YJLA 3DJFA 3FB5B 3SYNA 3KYKH 2P9GA 5DGRA 2RMNA 3F9RA 3JTMA 1QQAA 4DABA 2OSYA 3TYGH 4EY7A 4FYRA 1RMFH 3HW7A 4LRQA 3SDAA 4PBRA 5CTJA 1ZW1A 2MCAA 2BJHA 4LRNH 1LEGB 3KQSA 3ZW9A 1OCRB 4F4FA 3ZUNC 2RHTA 1SC3A 1A5ZA 4M6NL 4BCDA 4HSCX 1AO3A 4J29A 3EC7A 4FP9A 3VGGA 1GXSA 1W19A 4LFBB 1HDCA 2EHJA 3DRQB 1DEXA 4U3SA 1ZN8A 1BQ3A 2WJPA 1UEYA 1FBIL 3O2DL 3OR6A 2DN7A 3CUTA 4MIEA 1R3JA 2RKWA 2VUYA 3L7AA 3RVPA 3VCLA 2KT6A 2P5SA 1BCSA 1RT9A 4BZZA 1MHHB 3RREA 4HIEB 5JUEL 1ZMOA 1U7DA 3WMEA 3IU4L 1V96A 1QHYA 3EEQA 4RMTA 4GXQA 2IDFA 1QB8A 1N6LA 4QJ5B 4XJXA 3P2IA 3N44F 3GR6A 3QPXH 1BZYA 2YPVH 5A1JA 4YNYA 1SYSB 3L48A 3G0OA 1OX4B 5JQGA 1S4IA 4HKZA 5JD6A 5L2KB 1GG8A 3SF0A 4KJWC 3NV9A 4IXNA 3OR7A 4JFPB 4OTXL 5MN6A 3BWZA 3TT1L 3WLWD 1KC3A 4EXKA 1P4UA 1AGBB 1XXHB 2ZZKA 5J2TF 4UVGA 1H6FA 1KFGA 4BLOA 1M5UA 5D7LD 4B7LA 4DVRH 2QXYA 4CMEC 3LNGA 2Z7WA 2YWHA 3RHSA 2X2HA 1OXSC 2JI4A 3QFSA 3H2SA 1VCMA 1BP3B 1A6VH 4ZMVA 2VN8A 2FLMA 3NTVA 4RZCA 2GHWB 1ZU5A 1G8KA 3STWA 1DBBL 2J5RA 3FULA 4MVJI 4A8JC 4X7RA 4L57A 3VYOA 4NFCA 2JFGA 1G7TA 4BLUA 5F3BB 2J88L 4QRUB 3E9YA 4NTZA 1M7DB 2QG4A 4YMGA 5C0BB 3RFFA 4FX5A 4PB0L 5CHYA 4IOKA 1U8EA 4N7JA 2ZQYA 2VTFA 3VXSA 2FUKA 2AG0A 4TNGA 1WNTA 4BNXA 1BQKA 3IUMA 1YBAA 1JVBA 3EDJA 1X8LA 1Y48E 2FDXA 4GYYA 4E7OA 3BDXA 1T1XB 4MYDA 4P2RD 1Y7TA 4BZ1H 1DFHA 3PUIA 1ZH4A 5TDPB 3RSQA 1VLLA 4CEIA 4BDVA 5CH5A 4NKMB 1NULA 3E5HA 1WUKS 4LARH 4FHCA 1AX9A 1PZMA 4NI6A 2ICWI 1XRRA 1IO4C 3TZVA 3IRPX 1BZQK 3W1VA 2RJNA 5HBRA 4PBWD 5F0PB 1CG9A 1I8LA 1OAOC 1FRGH 1AXGA 1B41A 3ND7A 3IE2A 5D1ZA 1AO7B 4L2IB 2X1VA 1V8BA 5D7EA 1UYWH 3OO0A 5CURA 3SSAA 2REXB 3D8BA 1NUFA 4Q5IA 4HB3A 5DP1A 3ARXA 3K94A 4PGEB 3PA8A 3DEJA 1VLZA 1RVFH 2EDEA 5A40E 4IWNA 1SKUA 4EHJA 5FYQA 4MRMB 1JWUA 4ELMF 4GI8A 1O95D 1ILUA 5AVTA 3T5AA 3HL4A 5B6JA 2E9GA 4EBQL 2PL5A 3QM1A 2SKDA 4K3JB 1BEXA 2MTAA 4GAJL 4DUPA 5DRTA 1TZAA 1U9ZA 5F9AC 5DK2A 3VWKD 4WWKA 4Q7JB 1KR5A 4APQA 2WG2A 3OMXA 2GFBB 3T04D 2NSDA 3QEGL 3IGAB 4FS0A 4X4MA 3NEPX 2PGNA 3B51X 3OC0A 3JV5A 2VR3A 1E6MA 2WQ8A 4KTEH 3GSOB 1P5UB 3JWOH 4UNQA 2J6EL 1JK9A 4UQ3B 5IAGA 3QH3A 1Q0YL 3IQGX 2YA0A 3WIBA 3T5PA 1EFXD 1ZGLB 3L8EA 3O90A 2B8EA 3LKPA 3LKNB 4QRPA 4E09A 1J00A 2P47B 2YXFA 4GE0A 4YGYA 5HVGB 5MI0C 2O2HA 2K8QA 2C0CA 2YUTA 1MPTA 4NPYA 1GFIA 1B4TA 2FWBA 1WLHA 2AQ8A 3GFVA 2RAPA 4H0CA 2VXYA 2X3FA 4QUOA 2J8ZA 4U1SB 1B42A 2C5EA 2HT2D 1JEYA 3ZVNA 2WPDA 3BGFB 5E5LA 4GPVA 2YN5A 1SVMA 2Y1CA 4M0LA 1K5DA 3IN0A 3A0UA 3B7PA 1CQJB 2OZLB 3HR4A 4P82A 4P54A 2VXTL 5C3MA 4G5OA 2VK2A 3PQ6A 4OJKA 4DR4B 3HBLA 1TJXA 2OFQA 3ML8A 3U60B 1SUEA 4O4YL 1SOAA