2VDPB

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 125
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdpB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdpB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdpB03
3ZDYB 5ES4B 2I6QA 4MMYA 3EGXB 3OL2B 3OKWA 1AUQA 3BN3A 3ZE0B 1M2OA 3ZQKA 4C29A 3EGDA 1M1XA 3K72B 1CQPA 1PCXA 5KYNA 2NUPA 1JEQB 4JDUA 3EH2A 1SSLA 3K71A 3NVQA 1JV2B 4GZ8A 2WINI 3GXBA 3PPWA 1PT6A 2NUTA 3PPXA 1N9ZA 3IJEA 1LFAA 5E6SB 4WFQA 5E6UA 4IHKA 3ZE2B 2ICAA 1U8CB 3N2NA 1M1UA 4WK2B 4CN8A 1SHUX 1T6BY 3EFOB 4HQOA 1OLZA 1IDOA 2P28A 4G1EA 4NENB 3T3MB 1MQAA 1Q0PA 4MMYB 3EOAI 3ZE1B 3K6SB 2B2XA 5E6RB 1QC5A 2NUPB 4C2AA 1FNSA 1SQ0A 3NIFB 1ZOPA 2NUTB 4UM9B 4K3JB 1RTKA 4BJ3A 3NIDB 1XUOA 3BQMB 5E6UB 1JEYB 2ADFA 4FWWA 2VDNB 4PN7A 1QCYA 3V4VB 4MMZA 3V4PB 4IGIA 2XGGA 4MMXB 1L5GA 1PD0A 1RS0A 3TW0A 5KYXB 1PD1A 1M10A 2VC2B 4G1EB 2X5NA 1YVPA 4O3UB 1V7PC 4CNBA 3Q3GE 4F1KA 4UM9D 3HXQA 3VI3B 1QC5B 1ZONA 1ZOOA 1M2VA 2M32A 4IXDA 2VDKB 2VDPB 4NEHB 1RRKA 1T0PA 1XDGA 3T3PB 4XW2A 3EH1A 1FE8A 3EG9A 4F1JA 5KYUA 2VDRB 3EGDB 1M1XB 1NA5A 3TXAA 5KYWA 5HDBB 3K71B 4Z7NB 4Z7QB 3BQNB 2ODPA 3F78A 3TCXB 3EGXA 3IJEB 1MF7A 2P26A 1L5GB 3IBSA 4CN9A 4O02A 3K72A 3M6FA 1OAKA 1SHYB 1BHQ1 3EOBI 3ZDXB 3QA3E 3VI4B 1IJBA 1ATZA 1IDN1 4A0QA 3NIGB 5HJ2A 4G1MA 2UZYB 1M2VB 1SHTX 5E6SA 5BV8A 1TYEB 1IJKA 1YVRA 4DMUB 3EG9B 5KYUB 1RD4A 1XDDA 1MJNA 5KYWB 3TVYA 4UM8B 4HQNA 4M76B 4NENA 2XWBF 4C2BA 2I91A 1BHO1 2I6SA 3AL8A 3K6SA 5KYYA 3HXOA 3FCSA 4O02B 1U0NA 3E2MA 3HI6A 5E6RA 4FX5A 4Z7OB 2VDOB 1AO3A 4MMZB 1MQ9A 3OL2A 3PPVA 1JLMA 1YUKA 2XWJI 4G1MB 1JEYA 1AOXA 1MQ8B 4O3TB 1JEQA 2O7NA 3AFCA 4HQLA 1JV2A 4WK0B 3ZDZB 3AL9A 3OKYB 1CK4A 1MHPA 3FCUB 1U0OC 3PPYA 5LN1A 2ODQA 4HQFA 1DGQA 4MMXA 2VDLB 2QTVA 3RAGA 2WW8A 1U8CA 1DZIA 5KYXA 1UEXC 5HGJA 2VDQB 4WJKB 3AL8B 5KYYB 2VDMB 3EFOA 3FCSB 1N3YA 2NVOA 2IUEA 3F74A 4JX0A 4HQKA 4WK4B
chains in the Genus database with same CATH superfamily
2VNAA 8GPBA 3FPCA 3EPLA 3BQUD 2ZRQA 4LF7B 3T4YB 3KWXA 4KZPA 2JFQA 2X5XA 4FB5A 4A3SA 2R1WA 5SY6A 5K6AC 3ZZMA 5JQ6L 4G36A 2O0MA 2DLCX 1SYVA 2XKNA 1ZGLM 1N1DA 4JRYD 2AW5A 1D2MA 1AXTH 3FNKA 4L8SC 4JR1A 4MINA 4N5ED 5LWHA 2NU7A 5ANME 4ZFNA 4X8GA 3LWBA 1ZP6A 2ZRMA 4C55A 2NXZB 1FNDA 1K7XB 4INAA 5DI9A 5FOVA 1SBYA 4QUAA 5AW6B 1ZWIA 2VOJA 3KMDA 1PUXA 4LSGA 5AESA 5F7EL 2VRKA 3C6KA 1IAKB 1ZS9A 3Q11A 4UEQA 3VFTB 4J3OD 4C88A 1I9IL 1GZHB 2OO5C 2DEXX 4RTKA 2DTSA 2ZB8A 1T7ZA 2YPLE 4P6VF 4B3XA 1EIWA 3NZ8B 3ZLUA 4COKA 2DUMA 3GXOA 1OD6A 3FO9B 4PBSA 3DVLA 3OAWA 1GFIA 1S2OA 3QUZA 1STOA 4YI5A 1KH2A 3AVEA 4MNQD 3LB6D 3L7FB 1I5EA 5HRAA 1N57A 1EFAA 3UIZA 3EZ7A 4FMBB 3DMPA 2VJMB 5KJ1A 4CBPA 1L5VA 5TGBB 3AQDA 4CN1A 2VSQA 1CR2A 1LNUB 2OO7A 4D3ZA 3MROB 1VEMA 3L1KA 1FZKB 5LGYA 1KOGA 5DUML 4ZUUB 3CCCA 2JI9A 3OLCX 4NUJA 1RLBA 1CUUA 3K16A 3ZQKA 2Z04A 4NAHA 2WXPA 3I53A 5EN3A 1T04B 1PZAA 1R5VA 2M1XA 1VE6A 1YDPA 1ZANL 2FFQA 3KXFA 1CFTB 3ZK9A 2W4IA 4BVJA 3R8FA 4D6XA 3QF4A 3OH8A 1EVYA 3S2GA 3D4OA 5CGTA 1EFTA 3VO9A 2XBLA 3BXGA 3O8QA 4N3TA 4RY0A 3TZQA 4GBXB 4MD4B 3MRKB 12E8L 2FWUA 3IFSA 4F7MB 4MGYR 5BNTA 1A1OB 1S9XA 2Q76B 3C5SB 1FSKC 5LBTA 1OFTA 4AZ3B 5B53A 1P7KA 4TMTA 4UQPA 4LOIA 3F2LA 2MFNA 3BW9B 2VRCD 4AGMA 4BGLA 1FJHA 1BOGB 1J18A 2WNXA 4RBPK 1H6UA 2QKIA 4HGWB 1I9RL 4WBNF 4MK4A 2ANBA 2W93A 3KPLA 4KRGA 2EG5A 4BNWA 3ES6A 1JIKA 4KIWA 3PI6A 3T34A 5IKXA 2WYOA 5AUNB 2JF1A 4BB5A 4FS8A 2HFTA 1SCIA 4PSRA 3SIWA 3FHEA 1DKLA 5AAWC 4O25A 3X1ZA 1M42A 2PUAA 4JGMA 4NZFA 4ZHQF 1MEJA 3HVNA 2CLDX 4MB0A 4ZFOB 4OM1L 3LIPA 4I3SL 1IV8A 4YMUA 2NU9A 3TR6A 1PG2A 5ESRA 4OMCA 2BNRA 2V54A 1H0DB 2JGJA 2PH3A 2C9DA 1IGTB 2IOHA 2IYYA 1Q20A 5FBHA 2HGZA 2XAUA 4FFNA 3PWNA 1MW0A 2XXBA 5JZSA 2O4EA 3R4VA 3OPUA 3Q5EA 3UAEA 2Q5EA 3RVDA 3QO1A 3UWDA 2WIGA 3Q8WA 1N9ZA 2EEZA 4HCRA 5C3MA 1NR5A 5EJIA 5K4GA 4C56A 4M99A 1P9RA 1XJ0A 5KVEH 5DD1H 1J1IA 4PLTA 4GRMA 1YK1A 3VI4E 5KNCA 2AG6A 1OAJA 3U7HB 4NQDD 1SJ9A 2NZ9D 2PGXA 1SFHA 1ZITA 1CDYA 1SOXA 3QUYC 3KCWA 4TL8A 4GSLA 1PVVA 4LQFL 1XCPA 4ONEA 2EKPA 2JJSA 3UXMA 1KB3A 2EZ4A 3HBQA 4AOFA 3AC0A 4KJXA 2IMMA 1NUGA 1U3FA 4HPWA 2NY6B 2WZ5A 5EWLB 4EECA 5BV7B 1F4WH 1F4HA 1B6GA 2ZI4A 1MX5A 5F7MC 3QIUB 1DEAA 2QYSA 3EYQD 1HDIA 4OO3A 2RG1A 3ARBB 4NV3A 1JHQA 5IJVB 3S5LG 4L07A 5EIHA 4HUNB 4OF5A 1OC2A 4D82A 2GO1A 2WGNB 5ITBL 7REQB 1RACA 3IP9A 3QCVL 1CY7A 2FBJL 3R7RA 4YT4A 1LPPA 8OHMA 5AK5A 3OIUA 4GMSH 2A99A 3ZWDA 1XCMA 5C92A 3CF2A 3FAWA 4ZDJA 3KJIA 1RURH 1EFXB 3VMPA 4BVKA 1GRCA 3DGGB 3HB1A 1NGQL 1Z0KA 5TDNB 1UEXC 1MN4A 4PW3A 2GJJA 4UAUA 1FNCA 1D0SA 1NLYA 1X8KA 1TTBA 4UT9H 5KKAA 1XXLA 5JYMA 1PWXA 3FBWA 5IHPA 4YC2B 1JLLB 3A10A 3FMGA 5A2IH 1N5JA 4PRHE 2PAAA 4QTIH 2UYGA 4Z2AA 1YPZA 3KLDA 5KZCD 3HDGA 3JQBA 5AICA 2WUBH 2V9TA 3OJDA 4X45A 4KXYA 2C0PA 2FN8A 5EOQH 4UM7A 4JI0B 1J1ZA 2R59A 4P49A 4LIQE 1VP9A 4XMUA 5AIAA 2UWEA 2DR0A 3DM5A 1WF5A 4N8EA 5A6SA 4GXFA 3BQVA 1LP9E 1OB1B 3GIZL 5J9PB 2HF7A 2ORBH 3UUWA 3IKVA 1U1IA 4WCFC 1P1VA 4Q3AA 1NOAA 4E5UA 3AM8A 1TU3A 2KBEA 4B3IA 3MWDA 1WDMA 2EP7A 5C1OA 4PYOA 2FN7A 2ARWA 2WNWA 1AD9A 3CLWA 4IBYA 4TULH 1A88A 3M8OL 3UAWA 3K5WA 3IIIA 4NNXA 1CURA 5JS2A 2AJ3A 1OI4A 1XF2B 4FJ0A 3ORQA 2HSDA 1BQEA 2ZSEA 4HQNA 1AIZA 1WR8A 2CXPA 4ED9A 4OLAA 1L4BA 3D4IA 4KFCA 4YZFF 3W77A 4G9EA 2J43A 2P5EE 3L6CA 3KUCA 4M0CA 4Q9DA 2Q6IA 4DC9A 1MRFL 2IBZY 1M9WA 2J6EA 4QAMB 5HHME 2H1PH 2CF5A 4FEGA 4AZSA 2J31A 4DXDA 1QONA 3PZBA 3CNBA 3TC9A 3EVGA 4R5VA 2WLIA 2XBUA 4F21A 2XV0A 1J1OH 2CXXA 5DH9A 2Q1YA 1YCHA 4WUKH 3E38A 1VKHA 4IL5A 3ULKA 3WNCA 4PJCF 4RWHA 1BBDL 1MCQA 2H2WA 4PJEA 1PUIA 3ZH9B 1UT2A 3W6OA 3I9V1 1WZIA 3LHFA 1CJKC 3ZWVA 1NC3A 4FFYH 3AW9A 2P8LB 3OJVC 4BZ2A 3LUBA 4J7AA 1EEQA 5SWSE 1P29A 1HT0A 4M6WB 3WEXB 4HNQA 3VWKA 1HFJA 4D9BA 3QKWA 1VMAA 1YZQA 1SVBA 2GQHA 2WP3O 32C2A 4EIZC 3ARDD 1YB1A 3PR1A 4PS1A 2V8BA 3NJNA 2CFCA 2SKEA 1OAZH 3FH0A 3GSNA 5AK4A 2QGFA 2VUHB 3ULVC 3IKKA 1XWIA 5FORA 4J0DA 2N3ZA 2Y6SD 5J7CC 4PD4J 2GY7B 1X4XA 4LOVA 5DMJB 1WXQA 3ZQXA 4YJGA 4LJLA 4UB0H 1R50A 1QBLL 4ZS6C 2C9YA 3VW3L 1G0OA 1H3NA 2F7OA 3HLAB 3CX5K 3OEYA 2XB8A 3KPJA 3KBOA 4MMZB 4BUGA 1LPBB 3VFOA 2F17A 4WI0B 4A0GA 5L0QC 3FDIA 4UWQB 4TSBL 1NQWA 1HJCA 3GIDA 5TPWL 3GZNA 3F67A 4A55A 1WFMA 1OY1A 5GRXG 2Z8RA 2ENPA 3VX1A 2WHXA 1JHLL 2WNIA 4WJ5A 4PGZA 4ANXA 4WERA 1WX1A 3RWCA 3N3AC 1PRYA 3SJCA 1FZJA 5G4KB 3RWHA 4OV6B 3SGDI 2DRIA 3RRJA 3OECA 4BHUA 3DX7A 4G8EB 3A58B 5TQ2L 4HUMB 2PYZA 1HLFA 1XSKA 1W87A 3RFTA 5I1AB 1CFBA 3OZBA 2VHWA 3ULUD 3ZKWB 4ZT3A 1ESZA 1WWKA 2FDXA 2NXNA 3K8LA 4LSUL 3RVKA 3WEAA 2ZIEA 1KEEA 4E9LA 2BP0B 3LIZA 4DK5A 1Z5NA 5D71H 3OAZH 4ZYVA 3B9KB 5AKZA 3V8VA 1Z0UA 4NZUL 3EOBB 5ENWB 1XSEA 4XC3L 4L5FE 4DCUA 3FUEA 2O8CA 3M70A 4QGYA 1EDYA 3VR5A 3SKJL 1KB5B 4TYUA 4GPAA 3WIIH 3CZCA 4OI9A 3MA7A 1E0JA 3CONA 2FX5A 2GHWB 1DIHA 1FQOA 2YKKA 4HFNA 1CIVA 4PGGA 2XRZA 5IR1A 2C2BA 4L48A 4EA6A 5AI9A 3I73A 4LVEA 3T0ED 3GUCA 4NLHA 4XO8A 4L29B 3AUJB 2EKLA 4L74A 2D4AA 4L50A 2NIPA 4XGIA 2G4VA 3RIYA 3CF6R 4C89A 3E82A 3LGSA 2Q2OA 2ZRDA 3CRRA 4K7FB 2RBLA 2GI4A 4XXDA 2HSGA 5DRXA 4QVGA 1VEOA 2PTTB 3WO3B 1A5SB 4N7RA 4IDQA 1GOGA 1OF2B 4ZYZA 3AFOA 2V7HA 4M4SA 3SO3C 3TPKA 4M1DH 3EAKA 1P2UA 1EA5A 2Y1VA 2QLLA 1KOFA 1RJ9A 1LBSA 1L1RA 2C54A 2QADC 2IE8A 3BWCA 3T1TA 1KIPA 2XDWA 2PMKA 2II6A 1N0HA 4K3VA 2BOBA 3ELYA 3CSBA 3KUUA 4M88A 2AN9A 5J43A 4MV9A 3ISJA 4TTIA 1IN5A 3FH8A 1YYCA 5HMLA 3HM2A 2UUDH 1PZ5A 3MT7A 5FOBB 2RD2A 4I9HA 4IX1A 1IZ9A 2PZAA 3FOLA 4CQJA 2A9NH 5IFKA 4ALIA 3PV6A 1O6TA 2ZXGA 3PB3A 1JSCA 3VOTA 5DC0A 4JZJC 3Q9SA 2BP5M 3DRTB 4HWGA 1A3RL 4IV0A 2MYTA 4J16C 5FA4B 3WBFA 5C18A 1L9OA 2Z92A 1YEGH 1PEZA 3JZDA 1ABBA 1UOQA 4XWGL 4LI0A 4IRMA 3ZCXA 3L1IA 4J2HA 4LMQE 4P1ZA 1EHXA 3BH8A 5CN3A 4BM7A 3RG1C 1GGTA 4QBGB 4M7LT 4MQ7A 3AGWA 2BEWB 4IDHA 2AK4B 1WABA 3FO1A 1Q15A 3Q44A 3EH5B 5EHQA 2VYVA 4J49A 3RJ9A 4X9IA 3EJYD 1SOUA 2W9DH 2EABA 2O0HA 3UXYA 1X3DA 5B7MA 2JLAA 1TO2E 2XQYK 1G21B 2UZYA 1NYQA 4WNJA 4JY7A 2FGKA 2BAGA 1C3VA 4F2HA 4NCNA 4I77H 1U9YA 1N92A 1Q2XA 1RTKA 1JPGB 4F2DA 2H2PD 3SDDD 5ICFA 1MFEH 2A1UA 2LVBA 3QI9A 4NMHA 2ESVD 1G43A 4GRLD 5C1BA 3OR6A 4DIFA 2EVJA 1FQ9C 5EJ7A 1U04A 2AK1H 5ALJA 4Z1MA 2NNXA 4MULA 1D5RA 1RFGE 2FJPA 1SLWA 2HT3D 4NS1A 1M2FA 1C0LA 1VIMA 2FPIB 1ACYH 3HRPA 4QOKE 2FIKB 1KXZA 5JCJA 5GJTH 1A7NL 3UNXA 4AQ8A 4JY6A 3CZQA 1AGBA 1DE0A 3U7QA 2VDOH 3FXIC 3VXKA 3AP2A 3CV3A 4G5RA 4FYKA 1NAMH 1Y3CE 2ZREA 3BT2H 5GHWL 4UQDA 3C09C 5I3ZA 5EBGA 3OHMA 1Y8AA 4GIPD 3Q5OA 3A1UA 1HHHB 1X92A 2AQIA 2Y1FA 3H2WA 1FNMA 2QTVA 3U3MA 2PCYA 3FUFA 5K0FA 5B38B 4ACAA 4OFDA 1TZCA 2GZ2A 3EFFA 1UK9A 2O2SA 4XNQB 4WKCA 4F4DA 4KDTC 4GL2A 5F1SA 1K5WA 3ZR6A 1D2CA 4JDUA 3LRTA 2WBJA 2JXMA 2ZJ3A 4WNIA 1UM6H 4MLCA 4BFSA 1PR2A 5J3HD 5D1XB 2Q3HA 1SXJE 4ND8B 1NTRA 5J4KA 5BOSA 5KJ7E 1YY8B 5EMYA 1Z4LA 4CEIA 5JCPA 3NIFB 4AGOA 4M9ZA 4YDKH 2ZIGA 4JS0A 4LGVA 2Z3FA 2GI7A 4LYEA 4HFWA 3KHSA 5IGXL 2IAMC 2WVTA 2EKSA 3WE1A 4P3NA 1DIGA 3ORHA 2JK5B 5I18L 1EX1A 1IWPB 1CJBA 1HHGB 3G8CA 4RFLA 2ZSKA 4WI6A 4AZVA 3INTA 2XE6A 4XNMA 2R7EA 1B9ZA 3B78A 4JQVA 3WXMA 3CCBA 2AEWA 2XNAB 5AKIA 1G20B 2BZDA 5T5QA 1QU3A 3WLTA 5LU9A 1IZKA 3S6CA 1QNFA 2VHQA 4LDOB 5DOVA 3CVYA 1UFRA 1NDGA 5LC1A 3WGMA 3HE6B 4MKIA 4CMJA 3WFIA 1K6QH 2IYXA 4EA9A 2O5EA 4D02A 2JKXA 5DHAA 4XR9A 1L7EA 4Z7VA 1JA1A 1ZI6A 3FI0A 1KFJB 1JZ6A 1RK7A 4X5WA 1TJ4A 5JECA 4G01B 4OOEA 3FTGA 1LH0A 1LEGA 2VUTA 4CM5A 3BX1A 3MLUL 3FQUA 1RP9A 4CF5A 2GPBA 2W2KB 3DSRA 3NKVA 1ISGA 5EEHA 1PTZA 2C9XA 1TNNA 5KVFH 2UZIR 2BI4A 4YBRA 1TUPA 4KPGA 3PK0A 4Y6GB 1AHPA 4P33A 1ZHOA 4GB9A 1K8DA 4XX1G 2ZWYA 3DDNA 5CHEA 1U8QA 4FIZA 3RYCA 4JO3H 3WFHB 1PZUB 4P35A 4NXKA 3Q9UA 2R1XB 4D1YA 5DS8A 4TUOA 3ZOKA 4TL6A 4BEBA 4CIXA 2H3NB 2CNBA 5D4HA 1H3WM 5DDHB 2VN4A 4ZW5A 1Q38A 1ICTA 1H3FA 2QD5A 2X5NA 1XQ9A 1G0DA 4RM3A 4C5AA 1FK8A 1RRKA 5B55A 2PYEA 1QE5A 4Q24A 2IBZX 4HCFA 4DDWA 1Q90A 3KB6A 1TKCA 1Z33A 3L8HA 3SM9A 1RQXA 1YZHA 4MA5A 2GK6A 3REVB 5DEIA 3WQBA 1C7QA 2R29L 4P83A 4TQEH 2AMJA 1VI2A 3EA4A 4ZPTA 3NJMA 4TPRL 1S7QA 5BYAA 4PV8B 4U1SA 3IKTA 3P32A 5DC9B 1OX4B 2QT9A 2OFFA 3HBGA 2GUGA 4CQMB 5C09B 3ZW9A 3A22A 3QUCA 2AK3A 3NABH 4LFHD 1PKOA 1S6NA 2JGDA 3NHSA 3FT3B 4RAUB 1NKVA 3DE4X 4HIJA 4P3OA 2O1XA 1KOLA 1MI5D 1X5XA 1SBIA 1T8PA 3OCJA 3CJJA 1LGYA 3MSCA 4WQOA 5HYSB 2FFBA 3OLQA 3DTTA 4FYQA 3SZLA 3M49A 5TE7L 1HNGA 2LOEA 2FWRA 1RWQA 4ZFGL 3CEMA 2CZQA 2OS7A 3QEOA 1U11A 4WADA 2WJGA 3KUDA 2CO1A 3TF7C 5EEWA 2PUCA 1MHPL 1ODSA 1G8FA 3MLTB 1XC7A 2PUFA 4GOJA 2WHRA 4M38A 1GT91 5M04A 4P2RB 2NSYA 5JRJA 3BXNB 2AS0A 3ORRA 3NFNA 1P5UB 1B6DA 1S4IA 4JFWA 5DOZA 3FZQA 4CKEA 1Y6QA 1LQUA 3WKPA 3FC8A 5HS4A 3ARED 2IUYA 1JSLA 4WFKA 4BQQA 1DR9A 4MCHA 2G2NA 2HMUA 5TQ0A 3TBYB 4U05A 4M6ML 3H0EA 1VACB 4LLVB 3AXLA 1UPCA 1KYDA 3GJ7A 2AOTB 1CZRA 4LOUD 3C3AA 1LBTA 4Q1EA 4P5DA 1JSXA 3LKRA 2RJNA 4ZCIA 3BXXA 4EG6A 2J0EA 5CX4A 2ZTLA 2YY7A 2VR1A 2RH4A 5KAPA 1RWKA 5JSFA 2VQ1A 1EAQA 4D9FA 1F86A 3MR9B 4G80B 4BQ6A 1MIEL 4PNPA 3HS0B 5JW3L 5IWAB 3BKCL 3N76A 3RIAF 3NCYS 4RL6A 3TR0A 3G7SA 4TMPA 4MGZR 1A4RA 2QN7A 3CW8X 1W4ZA 5IHBA 4QJ4B 4UTAH 3USZA 2PKQP 3EMVA 1LK2B 2VP5A 3DO4A 2DLEA 3QWNA 2NNCA 3T6ZA 1DLHA 1UZGA 5EBLA 2EW8A 1WHOA 3PEVA 4MB1A 4U31A 4NENB 3ZI0A 4FFDA 4AMWA 2BFVL 3OKMA 4YRQA 3HC3L 4AV4A 1KCKA 2IDKA 4WQMA 2VG8A 3GHYA 4EVSA 3Q40A 2B2XH 4L0ZA 2OPBA 1J12A 1XF9A 1PNCA 1CUGA 2IH3A 2FRVA 2H4JA 1BWPA 3DMMB 1H8EA 2VAPA 1MB4A 2ZR9A 2EUWA 1PMYA 3UYOD 2JQAA 3K2QA 2WWWA 4N20A 4LF3B 2BMKB 1MAWA 1W6LA 1SVZA 3S97C 3DAFA 1GQ2A 3VOBA 1D5XB 4Y5VC 2ZVDA 2AC7A 2XV3A 4RX4D 3H6JA 5DRZB 1OZHA 3FAXA 2J3IA 5IESL 5EEZA 3C3DA 4WJLA 2R56L 3NPAA 1H3PL 1VMKA 3QDGB 1RHRA 3I2CL 5TMDA 3BGFC 3D39B 1XHLA 1Z5UA 4GAEA 5JPNA 2PKWA 1U0OC 5C3UA 4Y9CA 5BR7A 4DW8A 2VPTA 2ZYSA 3FB5B 1NF9A 1A1VA 2WWNA 4NQUA 4TLDA 1K3FA 1PE0A 1RQNA 3VSVA 3C14C 4F45A 2R1TB 3GMPA 5IVXB 3G5VB 9GPBA 1BS9A 4B44A 2Q28A 2J33A 3AFNA 3PDHA 4NC1E 1ZK2A 3G9ZA 5E56A 2Y06H 3WK8A 2QJRA 3QYNA 3OT1B 2XN9E 2MYUA 1U8HB 4DP7X 1GIGH 3ROKA 3ROGA 2PWBA 1O4WA 2CR6A 3A6GA 4A7QA 5IK3B 1JR4A 5LBUA 2KLBA 1A6TA 3KSDO 4HHGA 1CUZA 3RL1A 4WH0A 1GZSA 3ZHRA 3P9MA 4FEMA 2CPUA 1I0IA 3E7FA 5C35A 3MLSH 4NHCL 1YZVA 1JLSA 2LIPA 3UBGA 3OZWA 4L1DA 4M1GH 1IGCH 2YN5A 1I7RA 1ONOA 1PT7A 4Y2HA 3UB2A 5TGTA 4JT8A 3K2MC 3JR7A 3HH8A 3Q8XB 3AESA 9ATCA 5C8DA 4O4JA 1CLOL 1A9PA 5HI5D 3IEIA 3UT5B 3MRQA 4LLQB 4MGKR 1L7XA 5EIVA 3D05A 3LCMA 4PGAA 1BVUA 2NUBA 4IVNA 1A97A 1G63A 5D3KA 1T5KA 3GJ6A 4EDWL 4OLUH 2HT6A 3H2QA 4LEOA 3JQFC 3LLVA 1XQVA 4R7XA 2TMDA 3NGMA 3IX7A 4XYEA 3MCLH 2AN1A 4AJJA 3L16A 5HGDB 3HKFA 1L7BA 3OF3A 3OY7A 2R86A 5AW0A 2ZI7A 2FR8A 5E24E 1HLPA 1YZGA 5DHEA 3VRLF 1OYWA 5AXBA 1KDIA 3CC5B 2ZBRA 3FSJX 2QDVA 2B94A 4HFRA 3EO0A 3VV2A 4YR6A 1FC2D 2OJZH 2UZAA 2XVAA 2A3NA 1JNXX 4J4BA 2GUOA 4ZPJA 3ARGD 4PXSA 4PJHA 2GEVA 2EGUA 1FDUA 1GTVA 5AJXA 2IWHA 4V2CB 4NMLA 1MVNA 1WFIA 4ZIRB 2IOQA 5KOYA 4I48A 1UACL 3QNZB 5CG1A 3JW8A 1WS6A 1V96A 3UG3A 1KRHA 4B0OA 4CF6A 2JIZA 4UT6A 3TLEA 3Q3EA 1UP6A 4DLBA 2EVHA 4JPKL 2D3TA 1YNSA 1TMYA 5T1LA 3L13A 1U2TA 2WTUA 3MUNA 4H8HA 2FJHA 1IKFL 3A36A 5JDSA 2IEYA 5E9DB 2I7VA 4GKSA 4OZHB 2F1IA 2PW1A 2ZX6A 4HQLA 1R9NA 4GLRI 4D0GA 1OV4A 3AUWB 4MDHA 3FQNA 3AHJA 1FI8C 3P7MA 3ABSB 3OKOA 3BIBX 2HRCA 4ZQHA 4XN5A 5T7BA 3V4OA 2HUPA 1N8KA 5HCUA 4C3UA 3CFBA 4PV9B 5JLZB 5KVEE 3QDAA 4IDLA 1UC5B 2PSFA 1ZRSA 3FUWA 3DV0A 3M1IA 3VRHA 4GMKA 1Z4KA 5GS1B 1RP7A 3QRWA 2OZEA 4ZT5A 4GW4A 1WGVA 4DYHA 4ME6A 3HG1B 4DYDA 3L6DA 2PUVA 1CR9H 3C08H 1KKUA 3EFEA 4C1NA 3RSCA 4YRSA 5CU7A 1BDYA 1MRNA 4RSMA 5C37A 2VLJB 3V8BA 1I7ZA 1BBJA 4HLJA 4AEFA 3ILXA 3CVUA 5I5MA 1SKYE 2XB4A 2X05A 2AJVH 2CGZA 4OCYH 5T57A 3S5UA 4WZBA 4HXBH 1A1NB 3OCCA 1F1JA 1U5AA 5IM5A 3LN5A 2WD8A 2XKAA 4W4OA 2Q2EB 1NBZA 3ULVL 1U0SY 1BD3A 5IJ0B 4NO0B 5I7OA 1OW0C 4NRYA 2OFXA 2VZ9A 2QPSA 3KSRA 3UYRL 3AM5A 4FUTA 4BYHA 4GRAA 3E27A 3WGYA 2VR6A 1ZXXA 1R47A 1KVUA 2O23A 4NRDA 2J73A 4H1LG 1X42A 2DV6A 4M6OL 3D2UB 1YVLA 3LVRE 3O83A 3NP9A 3HJAA 1W15A 4Q9AA 3LXXA 2GKIA 1KKMA 4C04A 2P35A 4FQXC 5KTRA 5FUZH 4M36A 2FHFA 1N7GA 5DM60 4S04A 1SJEB 3EPKA 4XBGB 2P8MA 4HNAB 4MRVA 5HZGA 3OHPA 4DESA 1EK3A 4Z1PA 2TSYB 4ZV7A 5G0WA 3Q8FA 2Q8BH 5ICUA 4RRPG 1SM4A 3F5DA 1MCNA 4RD3A 3S81A 1IVYA 5JDIC 1POXA 1Z12A 1F5WA 5E2UH 5C7XH 2HWXA 4WY2A 3QELB 1W88A 4F15C 1QR2A 3K6OA 2FW6A 4PJ8D 3G5ZA 1LJ8A 1A8UA 2YPKB 5CA1A 1FG2A 4QY8B 2QR0B 2VUUA 3GRAA 1TVKA 4HO1X 5ICEA 2WF6A 4YDRA 4MTCA 3O6MH 4WO4A 2EUZA 5AOIA 1E2NA 5B38G 4PNHA 4YXHH 3VSAA 3OF2A 1E4KA 1SIOA 3GUFA 1Z2CA 3TLGB 3MCUA 4OU3A 5LBGA 1XA0A 4PTTA 2QA5A 3UTCA 2HRPL 3F04A 3GMLA 1B4DA 3GSVA 4KO8A 5LOVA 2B4CH 1UPBA 4PB9H 5C1MB 1PSKL 2R6GA 1A4CA 2VHYA 1Z16A 4YHLL 2X86A 4OM8A 2XWJA 3NP3A 2OCPA 2GCIA 3S44A 3UO8B 1YY9C 3QXJA 4BNFA 2X5KO 3OEED 4HVAA 4HIXL 5HP5A 4JS7A 1DWQA 2ZSHA 4KXMA 4X98B 1WHSB 1T25A 2BNQD 1MTOA 4JFRA 5KOVC 5FA8A 2JKVA 5IBTH 2GXAA 4IRSC 4RLDA 4B9YA 4F11A 4HNGA 5BPFA 4F2GA 5IT5A 2AT1A 1E40A 2ZJ8A 2UV3A 5C0EA 1IZ7A 2H54A 2B1GA 1FL3B 1AH1A 3BD8A 3QRGL 3OX2A 1M56B 3CX2A 1U7OA 4Y19A 4XMVA 4DHEA 1I85A 1UT8A 1YQ2A 1MAKA 2AYXA 3DYIA 3O6FB 5F98A 3BJMA 1Y7PA 2QW0X 1A6PA 3CH6A 5JI3E 2B37A 2J6IA 3QY0A 3B7TA 2I2BA 4IUYA 1XLVA 3HKEA 3LVTA 2YVKA 3SZ3A 5EU7E 4E0RA 4YPFA 3NGXA 3A7EA 1YIAA 1L1QA 3N43B 1ES0A 5EIQA 3RHWF 5BMVB 1OP5H 3CG4A 5IZCA 1SK9A 4RFNC 3HNTL 5D1ZB 2H32A 2YXWA 5E9WA 4NO3A 2EFEB 4U0RB 4KRPD 5MF6A 2CO6B 1V9SA 1A3CA 3ZLJA 1T1GA 3C98A 5E1BA 1XDGA 3AS0A 2ZPAA 1GZDA 5D7KD 1QV6A 1OAUL 5DS2A 4G85A 2CH8A 2BI7A 3CZPA 3ASOB 7FABH 3AEXA 5I1JL 1FTYA 1R5IA 4OGAC 2PKQO 4EUPG 3NMEA 2G60H 4RJIA 3ESNA 3TI7A 1QEWB 3MRHB 3P2EA 5G3ZA 4K81B 3AQ4A 3K1TA 3DROB 5JNYB 5TDPA 3EZ2A 3NT0A 1A9XB 4WOBA 3AFCA 4DZ8A 1ZUNB 4FIDA 2X2YA 3PRZA 4IRZA 5INTA 2QLMA 3AI7A 5KYXA 1ZC4A 3N3BC 4PO1A 2JIBA 3MXWL 2E4TA 2O54A 1QAOA 2EARA 1U9CA 2I2CA 5KBLA 1SXBA 3S3JA 3LRLA 4E41E 1RK1B 3HK2A 4Z54A 5I1IH 1VLZA 5J1SC 4MWGA 2EWMA 4A6YB 3CT4A 3EXLA 1H2RS 3CSYB 1ULVA 3NNNA 4BKMA 4MVJI 1XE3A 2HF9A 2CSUA 3FUDA 2PW2B 2XTJD 4L1HA 1KXQE 1AR1D 2HUNA 5HI4C 2PFSA 5GJCA 4RJJA 1N3BA 1NAHA 3CGTA 5C0CD 3INOA 2NTNA 3WJLC 5AW9B 2G9RA 4AYDC 2AXJA 3WRVA 3IXQA 2XGJA 3TOSA 2NMVA 3KQYA 1KBGH 3NTRA 5DJ0B 4E22A 4YJ3F 5CLQA 3S37H 1VL1A 3PE3A 1LO3L 5I9MA 1WP9A 3QR2A 4OCRL 2JKSA 3D6HA 3DCJA 4E9WA 5EZYB 2KBGA 3L0OA 5F8QC 2XAAA 1RD4A 1OAAA 3X2FA 2GJ9A 3MAJA 4XVTH 3MRLA 3ESOA 3DKRA 2XVYA 1I82A 2DPKA 1MRZA 3CLVA 5AVTB 3RVQA 2UZ3A 3N9IA 2YOAA 1T8YA 4WVRA 1F4XL 1ITBB 3SJ7A 4HC4A 4ZUWA 4QQKA 1JDSA 3OE7D 1GS8A 1WEJL 2QMJA 2H4YA 3RTCA 2JHGA 2HO5A 4Y2VA 3SYRA 4TXHA 2EYTA 4L9RA 3LSYA 4TKUB 2W2QA 4OGGA 2CR0A 2FJFB 2WA2A 3D69A 4V1CA 3EVDA 4GEKA 1C8BA 1LXCA 1Q0XL 4CEJB 3KH3A 5D96C 3CZ4A 3GCXA 3L1EA 1TT5B 2A1TR 4RMRA 2XPGB 2FWJA 4X6BA 3V4PA 2QX9A 1HE8A 3ENKA 2PZBA 4D6YA 1MPTA 3DGDA 1X38A 2V0CA 2JELL 2CHQA 1XV5A 4UFOA 1CIJA 4YR7A 3QG7L 3NSCA 1PAZA 1GUZA 1DBJH 3F6BX 4E2ZA 2XA8L 1V11B 1FNBA 3EUFA 2L4OA 3F5SA 3TA4D 4A6XA 4QDZA 4XB8A 1HQYE 1HHIB 4WY8A 4CF3A 5LDHA 1ONQB 4FP8L 4NN6C 4MUXA 3TMKA 4HS9A 2OZ4H 1P4HA 3SYLA 4B3FX 3VRLE 2BFPA 5E23A 3NHYA 1KULA 1UKBA 4PLFA 3I1FA 5AW3B 3U9UA 2F7SA 3KUKA 4NQEE 5JZ7D 5E7QA 3QFGA 5E2VH 4CMIA 4LY9A 1T0NB 4TYPA 2W42A 3LNHA 1FUKA 2DIAA 2FTKE 2HKAA 1MHHB 1F90H 3T9CA 1TRHA 2WAHA 2WZPD 1F4YL 1J9EA 4HKZB 2TMYA 1DBKL 2ZYHA 2ID9A 2X3FA 4TN9A 3UG6A 3E8UH 3MBOA 2K6YA 5I73C 5MI0C 2QN8A 1XWVA 2AF2A 4K9NA 3WKML 2BKXA 1ROWA 2N9UA 4M5ZL 5K6TA 1M2JA 3CISA 3QZNA 3ZGZA 3PVCA 3ZYCA 5LMZA 3DSFL 3L3OC 3DNPA 3T8MA 5F2OA 4FW9A 1XZBA 2VPIA 2XT0A 1T6BX 1D5MA 1QTIA 1SR8A 4Y2RA 3MV9E 3KQVA 2Y3NA 3DZHA 1SBZA 1NM5A 4PY7A 5DUBA 5J89A 3D81A 1JKXA 3QUAA 4PH8A 1JL8A 5I1GH 2BDUA 1HQRA 5LU8A 1RWXA 4PRIE 4LC1A 3QHZH 3SFTA 5I7UA 4KXWA 2F18A 4HYQA 3LYHA 4KROD 5D8JL 1EXDA 4J0HA 3SXUB 2E6PA 3M9LA 4FG2A 1CDDA 5BZWB 2ZRHA 3IE0A 4MR9B 4H7HA 2OMYA 3QX3A 4B3GA 3IJSB 5CIPA 5IMKB 1KZYC 3D0QA 1NJGA 1NLBL 1UOVA 3LEXA 1B76A 1HYRC 1ZXBA 3TLZA 3OQPA 3X1DA 3MEQA 3IOYA 3SF0A 2JATA 1I24A 3VTZA 2A73B 3GSQB 4P4RB 2Q46A 2FK9A 2IWRA 2TRHA 3WLSA 4I5IA 1PFWA 1NINA 3B5TA 1U9ZA 2NLJA 4UZUA 2J6BA 2CHFA 3RC8A 2HPTA 1MNUH 4X83A 4GRWH 4S0SD 4GR5A 2IO5A 4QHNA 5J5AA 1QBML 2RQ8A 3DE1X 1EQWA 3NIDE 3KE0A 4DLTA 1KH3A 2VYNA 2D0FA 2P6UA 3PA8A 1ZS8B 3QG5A 2EDCA 3ZWOA 3EGXB 1A95A 1T7WA 1E8MA 4JBXA 3ASWA 1MY7A 1PZXA 4BKPA 3TOCA 1LO5A 2QGNA 1J8HB 4IEFA 5FX2A 1D2HA 3R0XA 4JJZA 3D18A 4NV1A 3FG9A 3LPNA 2IPLA 2W5UA 4OQEA 3WLNA 2H5LA 5JW4M 4DJMA 1VKNA 5K3BA 1NMAL 3EYSL 3CVJA 2OXTA 4DY4A 1T22B 3TJEL 1RZIA 1T9GR 4UMEA 3QXGA 1XJWA 3A9WA 4P58A 2NUTB 3EHEA 5GGYA 5FPTA 2PU5A 2FB4H 1PYGA 1XTPA 3H05A 1DLIA 4IEIA 3OPXA 4QNMA 5LLSA 4Q7QA 3DOSB 1U7UA 1KTJA 3VXRE 3PJNA 5A7EA 3U6RB 1EEZB 3RJ5A 4JREC 1MCPL 1R8JA 1IM3D 2PIAA 3CR7A 2JIXD 4G9BA 3IC5A 3UERA 1B8UA 3HR7A 1DPFA 4LLMA 3OPNA 5LZ5A 3VCLA 4C07A 3I3DA 3RVXD 2P5WA 4Z0TA 5J0BA 2OL3L 1YJCA 4MDIA 5FWYA 2PLAA 5BQ7B 2JCVA 1FZQA 2PBRA 4PAMA 4FNLL 1YQTA 2BSSB 4QJ3A 3QQXA 1RBMA 4CVXB 3S3TA 1EIZA 4MXQC 4OBSA 4ZVLA 4Q9QL 4N2KA 1Q1PA 3M1OA 3LNCA 3VPBA 4YJ2B 3MLVH 1EBAA 1H4TA 3HN7A 3RQIA 5GS2H 3S27A 3NIWA 1DGQA 5AHRA 3LPOA 3KUXA 4FMKA 1C7JA 1YBVA 3M6IA 2VDMB 5JTTA 2QJDA 1WMEA 4R0VA 5KVFE 1Z2NX 5D4JA 1FDTA 3TM4A 2B3TA 4P54A 2PL5A 1SN7A 2YUTA 4WGWB 3B2VL 2OG1A 3UDWA 1GAQA 3KAPA 4XP9L 1GJWA 3OQBA 1R8YA 3EMKA 5GZNC 5JIPA 1O7JA 4N3AA 4PIBA 2XWBA 4OGFA 3QWIA 2Q9OA 4IMKA 3P0FA 1ZT1A 3T6WA 2XOTA 2V6GA 3MJTA 1WYJA 3VXME 4CRWB 2RC6A 4XXWC 4MRCA 4EUHA 1BOOA 3HCEA 4H0FA 4C4SA 1L9TA 4K9LA 2R27A 1R88A 4J1TC 2R9HC 3RAPR 5FAAA 4GNRA 3K0WA 4UMGA 3GEDA 2WIDA 4MJ4A 4PRBA 2W8BA 1WUJS 3H42B 2VHVA 3OXSA 3CMMA 3L3IA 1N4XH 4QRSA 5C5DA 4YDLB 5FNZA 4GAFB 1WISA 3MTEA 5LQNA 1OGSA 1K2VN 3GSOB 5ICMA 3ZV3A 4C4YA 2V4LA 1QS0A 3TD6A 1LEIB 3NBMA 3UAJA 2YWGA 4CUJA 4M2LA 4LX8A 1P7WA 3COPA 1U91B 3CFCL 3I4LA 2BGWA 2IT1A 2L82A 4G9FD 5A04A 1E4XL 3BLBA 2XNCA 2V7GA 2MIIA 4IJ6A 5CX1A 3H87A 3U17A 2DBYA 5F9JA 4RPKA 4YHMH 4BZWA 1QG0A 2ID5A 1X6LA 3W9SA 1AQNA 4CN4A 4RVFA 4AVHA 2RI0A 4G1UC 3BN3A 1LE9A 2XNJA 4B6SA 1TECE 2W6OA 2D5IA 4JFED 5A2FA 4XI5D 2GLXA 2VDUE 3G2LA 5DMIL 3OE4A 3RKRA 4V1DA 1TU4A 2FX9H 1UXMA 3D85B 1DUVG 4UCXA 3VO1A 4AL8L 2I29A 3HY3A 4XBPB 1UC4B 5TE4L 2OO3A 3TZ6A 4OYHA 3VZCA 1GGCH 1XR8B 2Z2YA 1S8NA 5IJWA 2X4QB 1CC1S 3QULA 2F4VB 3KVOA 1JFQL 2WKLA 4LHUB 1HDRA 3U4KA 2XHZA 4QYTA 1UZMA 3MNVB 4S1TA 521PA 5LL6P 1F97A 1CUEA 2M8XA 2QT0A 2EFGA 4KU4A 5G2NA 3N75A 1NCWL 4M00A 3MTQA 5JPIA 1A3LH 2PPEA 2DMCA 3DGCR 2LIVA 3PKIA 4OSOA 2D0HA 2C99A 1AA6A 4OH7A 1TM1E 1NY5A 5KSBA 4JFZH 2ODTX 2ZBUA 1FFNB 5T3XD 3OX1A 2GVDC 2CE2X 2Y36L 4OJCA 3LEYL 1TKAA 3LZPA 3M8KA 4OKDA 4O02B 1JSYA 4LTDA 3UH0A 2H0FA 1G0XA 2HWYA 3CVCA 3ZLBA 4QIRA 3GRRA 3V7AE 4UANA 4IHJF 3JQAA 3F3MA 3LC2O 1WXIA 3CFTA 1K6EA 4M5TA 5HVHB 2XMGA 4PBDA 2G63A 1Q9LB 4AEHH 1K7FB 1NMBL 1RUMH 4H7JA 4ER6A 1NFQA 4GT7A 5HKKA 1Z0FA 3RWFA 1PZHA 4NFDA 4EKYA 2P24B 4GG1A 2NUAB 2NY3B 4OF6A 5LQDA 1FSSA 5GGQH 1Z17A 1KZQA 3R4RA 3BO8B 3ZG6A 1SH7A 3IVGA 5B39G 5JW4R 4NFYA 4KX7A 2O8FA 2Y25A 2O57A 4FA7B 4ARZA 2ATKB 5KNBD 1X15A 3ZWYA 1EAOA 3MUGB 4KNTA 4DZBB 3K1DA 5BS0D 1OAYL 3E9TA 5BR1A 1CL7L 3K53A 1BX2B 1QPPA 3QISA 3VACA 1Z3CA 2HWZH 5SWZB 5K3AA 2VF2A 2DEWX 3RHFA 4P5MB 2HJFB 1OBVA 2P2ZA 2JCBA 4LBAA 2P7TA 1NJ9A 3HWSA 1KDPA 2DQHL 4HH8A 1OYYA 1NKRA 4INOA 2EFJA 3H0CA 1JS1X 2ZBQA 3JWHA 3SQOA 1D6SA 3V1UA 3DX9A 3WS3A 3IRZA 4E9VA 1JPFB 1JPSL 3NBUA 3PHGA 3OICA 2IL1A 3CTTA 1U92B 3T77B 5ILQA 4LSVL 1E3JA 4ZU6X 1P5ZB 4HDSA 2XPYA 3ZDDA 3Q12A 1K72A 4RH1A 4FZ8L 2HIHA 1Q1AA 1NVXQ 5JPCA 4PRNB 3P0JA 4PWEA 1K6XA 1E2ZA 3NIFF 3EQ9A 2WXNA 1A0QH 2WIKA 1DAGA 3SFZA 1UM9A 1ZHKB 1IY2A 2CZNA 2VB5A 1I8UA 1I53A 3JSXA 1PLLA 4G6ZA 1AHWC 4LTNA 3I61A 3W11D 4F7CA 4RGQA 4EUSA 4AWBA 3ANSA 3A26A 2GB2A 3HA0A 2ZXEB 1EWTA 4L8VA 1HH9B 2ISCA 2W6MA 3BMQB 4X1YA 5JCOC 1GL4B 3A4TA 2J59A 1SNYA 1XF1A 5IROD 1BJ1J 2AFIA 1DP0A 1E9DA 3KH4A 2QAGC 1UZ8B 4R97B 4J1SA 3QIWD 2VXCA 2A0LD 4LPYA 5BOJA 1VZGA 1ZUD1 5AQ1A 1ZA2A 4QYWA 4QTTB 1FYWA 3T1NA 4BBPA 4HT1L 3Q9NA 1W2HA 3INUL 4EGCB 4XNAA 5FFGA 2JAWA 1CFNB 4JI5B 1OXVA 3V34A 1HFKA 2PWEA 3WYBA 1VYUA 1NXPA 5IQOA 2V2WB 3O3DA 4PSKA 3JTTA 3LKZA 5C0OE 1XH1A 4L1LA 2I5YH 1E3SA 5LCVL 3NHJA 4K6MA 4RAVB 1N25A 3DPIA 4ZMWA 4X6XA 5DJ2B 5HIIA 1SBNE 3REQB 1DEDA 4B48A 2ZSUA 2HXSA 4ROSA 4UHDA 4HDRA 1SY6H 1FO0L 5I28A 5JS6A 4RGNC 2IPMA 3JWNH 3U6BA 1QHEA 3PKZA 4UDTA 2AI0H 4NBLA 2HT4C 4F1SA 2K6WA 4HIIA 1IMJA 1XCJA 3EZYA 1TCMA 2ZONA 4BAUA 3LH9A 3NG5A 1T4MA 2CHXA 1V7NH 2PR4H 3GCDA 3V2IA 5KSZA 5DCUA 5AM5A 3UHOA 4BLUA 3D2CA 1XALA 4E33A 2HU8A 1DX4A 4XCEA 3RE1A 2DQKA 1O97C 3IULA 4DCTA 5C0BD 2UYLB 4Q89A 5DIZA 4X3CA 3T3MB 4LCWE 2F1OA 1U3TA 1H5BC 1BE0A 1LPMA 4MDJA 4MKFA 1DJWA 4L4TA 1RZFL 4U9UA 4A37A 4PY2A 3KYBA 2VLRA 2E75C 2VRWA 1JMKC 4F58L 3UH1A 1BC5A 4HMCA 4QGGA 3N55A 4G0NA 3OQOA 2XEXA 4MNHB 1KC5H 3LRSB 4KR2A 2K70A 3IPAA 5A5EA 2DL9A 2ADFH 2JD0A 6Q21A 4KYTA 1Q8MA 2ADMA 1GLVA 3ZHXA 2X10A 5KSAB 3SQMA 1X7YA 5C3TA 3GLFB 2CR3A 5DZSA 2DY1A 2IDCA 4ONGL 3UJCA 1JGIA 4ACPA 4C03A 4AJEA 1FNGA 4AIXA 2FPXA 1IVNA 2VXQL 3UJHA 2GD1O 1W36D 3EF1A 3QORB 3IIJA 1RNLA 2YAFA 3AEZA 5E0FA 4DA8A 4PLWA 3P20A 4MAZA 2BEVA 4MAAA 3I3BA 1LTQA 3X2EA 3RHTA 2DWPA 4LQ4A 1QUNA 2ONZA 3M1BA 4N18A 4AY0A 1E60A 3GBNL 2INGX 3QFJA 5IFHL 3BQUB 1QH1B 2IV3A 3ATDA 2VDWB 2FHSA 2PJDA 5FNVF 1ZSVA 3AHFA 2ZK7A 2X0JA 2ARKA 4P06A 4YGYA 4EYGA 3I9OA 3U4CA 3IERA 4JRYB 5AVUB 2ZWKA 3O7MA 3RNOA 4JCWA 5AOVA 3D8TA 3ZGVA 4WWID 1RC1A 2NPOA 4DVGA 4P31A 5JJLA 3O9VA 1CR1A 6NULA 4AH2A 1ZAKA 2E7HA 1EZVX 1D5ZB 4P0PB 3ZE1B 3CFDA 4IIYA 5FQOA 2FT7A 4ZTPH 3DMTA 4D42A 4KSCA 3SEPA 4M7RA 2BGJA 2E6JA 2GTHA 5L2JA 2I62A 4QRTA 2IEAA 3ZMNA 4UTBL 3G0GA 3UCEA 3ZKAA 3Q2IA 4OT1H 2PFKA 3WIHL 1TM2A 1CULC 4MAMA 2JMRA 2D73A 1SG6A 4DT2A 3MYYA 5A0VA 1G17A 4GRWF 3T54A 4PGEB 2MDTA 4U2FA 5CYGA 1QA9A 1XD0A 3QPXH 1TFHA 3UG4A 4MNQB 2XDQB 2UZ1B 3BTUA 1T1YB 1IXRC 3MLXL 5FD8A 3JQ7B 4FABH 2DL2A 3NYIA 1M2VB 2BHNA 3EDFA 3ML9A 4LB8A 2Y2TA 2BVPA 3P5SA 3WHLA 5FO9B 3TA3D 1FYTD 1T9ZA 5IW1B 3N40P 4UUJB 2OMXA 1G7QB 4WFGE 1CW2B 3B5IA 4JI4B 3GLIB 4KG7A 1LMKA 1TCBA 2ILLA 1Z9BA 5IVNA 3Q7TA 2H0RA 4Z7WF 1AGFA 4RPIA 4TTGA 4PG6A 5EMJA 3HP4A 5IB3A 2R23A 1NQUA 1GRVA 1B0WA 3DUHA 1L7TL 2A0XA 3GGGA 4LWPA 3O4LE 3LRXA 5HWSA 1P4RA 2R1UA 2AA3A 1NCBL 2VR4A 1N32B 4IDGA 3BPLB 1R3LA 1SVMA 2HK9A 2BZ0A 1R8XA 4N9GA 3MJHA 5E0QA 3BUDA 4NE2A 3CXUA 2KW5A 2DQ6A 4Y9EA 5JUEL 4ENSA 5C8XA 5DX1A 5CB4A 4AF6A 5KOHA 4GMGA 3AU1B 3M46A 2DLGA 2QTAA 4OZGB 4BRJA 1VXOA 4L73A 2VZSA 1ZJ6A 4DA4A 4RWYL 4WZAE 2J7PA 1KH1A 1FFDA 2VH2A 2VWQA 1UOOA 1XRNA 3CNEA 3CLRD 1T6XA 4QREA 5UKDA 1E9QB 4JFYB 1OANA 4EFDA 3RODA 2LDXA 1EYZA 5IVXF 2ENJA 3S70A 4W93A 1NI5A 4RCYA 3LVFO 3GA7A 4F8YA 1WD7A 1F41A 4YZWA 2X1WL 2XRAL 3NOVA 3N2KA 4B75A 3C2QA 3AVPA 5EU6B 4AVYA 1EI9A 2PXCA 4QMEA 3SDYL 2AK4E 1D4AA 4KAFA 5C3LD 4NWIA 4GSRA 4G82A 1YMHB 2WSYB 1BJTA 3NAMA 4HDKA 1JPUA 4KXDA 4R4NC 3TNYA 2CVQA 1BVYF 1JZ2A 2VJXA 3ARYA 2CDFB 4HIHB 1WPRA 2CCWA 1CF8H 2J41A 5T5FL 1RK0B 1TU2A 3RT7A 3BIXA 4EARA 4MAFA 3OLVA 1BFOB 4NQDB 3ZBUA 3FYCA 1G7JA 2P47B 1A50B 1UR5A 5T3UA 1XOIA 3O3CA 3E9DA 2OYPA 1OD9A 3CFMA 4U1LA 5E6RB 4FFVA 1AURA 1V3UA 4R3SB 1Y1DA 5TK4A 1TJPB 5BW7A 3G85A 4XX0B 3BSZA 1XAUA 2E74C 3KYJB 3A3KA 4N86A 1I4OA 3GJ5A 4AUJA 2XVMA 3MLZL 2P9CA 4JPWH 4CTOA 2ZOLB 2AFRA 3G5AA 5CK5A 1QYVA 2QKYA 4AKHA 3EJJX 4XP1H 5A9TA 2D9QB 2XGOA 3RX8A 3D3VD 2QRLA 4P46C 3WS6C 5EE9A 5EFIA 5G53C 4QGTA 2G7ZA 4EIWA 5KHOC 3STLA 3IQWA 5F0PB 5KOIA 2AFHE 2NYYD 4IP0A 1OGAA 2VDKL 3NCJL 3S88H 4JO2L 4EY4A 3H9SE 4PGMA 4ZAYA 5CBPA 4DP0X 1LM8V 1RZRD 3MWEA 1SOKA 2P30A 3ONDA 4YJFA 5LJIA 4HEPA 1OLLA 2OSLA 3U7JA 4A5SA 2W88A 1E5LA 3C1UA 1PW7A 1EPUA 3H9JA 4M87A 2R51A 4I13B 3AU9A 3WHKA 1GZQB 1O6BA 5H37A 3FQTA 5AZ2L 1EGHA 1G6Q1 3FDZB 5KZCB 5I5JA 5J1AA 4XCCL 2YD7A 1ZW1A 2WOJA 1QH0A 3UTSD 5K0LA 2C97A 2YJQA 4J3FA 4W1RA 5CDGA 2W6JD 1R5OA 3IVXA 2F1RA 3L0PA 4P9HL 2JBAA 4ENWA 1R0RE 3MUUA 3W5NA 4IM7A 2C9SA 3TJMA 2WE8A 4PLJC 1QWHA 3A23A 5E38A 3RTEA 1UH4A 2G9HA 1RZKH 5L3SA 2EWWA 4LASH 5A0FA 4JC4A 2J5LB 1DVFC 3WSQH 4FCWA 4OZHF 3IBEA 2HZHA 5EKTA 1IC7H 5KEZA 3AKCA 3MS7A 4CM3A 5TPWA 1K4YA 3KEHA 3BGWA 4LJ7A 4IMRA 2A9CA 1W0CA 3TBTB 2Z2KA 3G9AB 5HRUA 2YIMA 5KKNB 2HRBA 5SWQB 4FWBA 3PIQA 3UWKA 5DTQA 3PJRA 2EJUA 1GRRA 3I1YA 1Y8QA 2ODAA 2LT9A 4KL8S 3BZUA 4JA0A 1JTPA 5EXEA 4Q97A 3Q0IA 4MWSA 4LHUG 1V7MH 4ANKA 1X7HA 1TQUA 5TQ2A 4UCQA 1GU1A 4MYSA 3ZL4H 2ZS7A 3G6AB 2W59A 4YSCA 4MR7B 1EEYA 3FKSD 4UNUA 2R6DA 1Z15A 1EIBA 3PQFA 1X5AA 5AM4A 4BIKA 3MGTA 4KTYA 4CU5A 2WWIA 4KQKA 2IIVA 1NWPA 1UIMA 1VXRA 4HK3N 4LOFA 1D03A 3ZD9A 5B1JC 3LUJA 3M1AA 5LGJA 2X9ZA 1YCDA 4RGOL 1VJ1A 1XF5A 2ZOSA 4HGMA 1GNVA 3D34A 1JJUA 3SQBA 2F67A 2AEQH 2PDAA 3DO6A 1HEZA 2CNYA 4PAQA 5KJEA 1EAYA 3GAZA 5E9AA 5CAEA 3HBAA 4RYDA 3ARDB 5LXVA 1DKMA 1ZT4A 3GT6A 1C08A 3L4BA 2QLVB 2QX8A 3VWJD 4C7XA 3G2JA 4WEMB 3SBRA 1KJ2L 5C46F 1BGVA 1UXGA 1N0VC 1P1FA 1W6UA 3BP4A 2ZGVA 4LPKA 2BFEB 2FHCA 4X50A 4MCYB 2FEJA 1P7BA 3TSWA 1HKLH 1G0NA 4XJXA 2FSUA 4KGDA 3OHSX 2QV2A 4YWGH 1L7DA 3ZKXC 4K40A 2YJZA 2Z9DA 1I36A 3FFWA 1WS7A 5IBLD 5IK2D 1NOFA 1YACA 2HA2A 1ECBA 1WTCA 4ENUA 2P69A 2YAOA 3V8MA 2A78A 1PEAA 4QAWA 2XE4A 3L49A 4IGBA 3VDAA 4HY3A 4GYWA 2VLKE 2HEIA 3BHMA 1VIYA 4F20A 1N2RB 3LM8A 3EXFA 1INDH 1KI6A 5LA6B 3UJ8A 1LO2H 3THYA 2PHZA 3UKJA 4WECA 2BMJA 4JJAA 3IR7A 1O96B 5ALRA 2X9WA 4YV7A 4GIAA 3P4YA 4C59B 1K98A 4UTOA 5TH2A 3PG5A 2C4VA 1Q9KA 5F4ZA 1DN0B 5FWAA 4OR1A 2Z31A 3JQ8B 1L9XA 1ZM2A 2BGNA 3GEWB 4ZI2A 2YQGA 4G5GA 1YR7A 1KEGL 3EYOB 2D2OA 5C0AE 4TUKH 3TBSA 1Y63A 3R5SA 1TYZA 3GD1C 4DV4B 1RYBA 3H3KA 1P9NA 1N67A 3VQ2C 2Q3ZA 3E53A 4XWGA 1EE1A 1E9OA 5EC2A 2IV2X 2YJ5A 4G97A 2AVFA 2FZ5A 2IPKA 4GXVH 3QFHA 1R0LA 1FPMA 3ADKA 2DLFL 4FWTA 5J40A 3RB5A 5AFAA 1BIIB 1IHOA 5HQTA 4L1TA 4Z4CA 1ADBA 2FEDD 3FCCA 3RU8L 2P27A 3PE9A 1BVHA 5E6SA 2OW6A 1PNOA 4IIQA 3V95A 4XWOC 5F89A 4GRWE 1E7YA 3OURA 5L4IA 4EY6A 5ALSA 2AFVA 5BMVF 1RI5A 2CJ3A 2EJCA 2WFMA 3OL2A 2J9YB 4APQD 4PREA 1AXSB 2PRZA 1F3JB 1V41E 4JOBA 8ADHA 4GMTH 2JA2A 5GGVH 2LAGB 5JHLA 2C7OA 3CCHB 1KYOJ 4NXNB 2J7LA 3W38A 1RFDL 1BYPA 4C4KO 4NZYA 4M6AA 5G4MA 1IL0A 3A47A 5E6UA 3VRJB 4C01A 5E08H 5DT1L 4N2OA 4OCXH 3MYJA 5A03A 1JHZA 1F3LA 1I7PA 2HX1A 2NACA 5D5MB 2OZLA 4C43A 5TQVA 2PT7A 1HJBC 3DC2A 3SF8A 3U9PL 4Z7WE 4DK3A 3D4ZA 3S1LA 2QU7A 4NO2B 5DRWA 1S3FA 1ZZGA 4ZHSA 3NCYP 4JZNA 1NBEA 1GSIA 3MAWA 3GOHA 4BE9A 3NONA 4G0WA 2R1VA 5JS8A 4BKTC 3O8XA 4M61B 4Q6KA 3TN0A 4MPRA 5KBMA 4W81A 1QTQA 1TZMA 4OL0A 2PPVA 1V1JA 2HA5A 2CUTA 2NO5A 1GXSA 3CX8A 1V48A 1WSAA 2QP4A 1MABB 2OA9A 2C5SA 1PGOA 3TNMA 3VFPB 5BOVA 2JCWA 5EVJA 3FDXA 3E84A 4UJ3A 4G24A 1YTLA 2MINB 4FFZH 3VJMA 1I6KA 3LKOB 3NRQA 4L7QA 1OYVA 2VZ3A 4ZO4A 1DEKA 3VUAA 3DKKA 3L7MA 5FYLL 4MXWH 5J12C 3O92A 4PZPA 2WTBA 2J71A 3VNYA 3CH8A 1CQIA 4MZ3A 2V5MA 3E5HA 5A4FS 1U8PB 2GJ8A 1E59A 4YXFA 4YI3A 3GMOB 5D4IA 4OZIA 3ER8A 1BFUA 4HJGA 3V0WH 5FHAL 3PL6A 1XN4A 3OQIB 4PV1C 1QYXA 1FS6A 2NVUA 3PP3K 1E1RD 2IDUA 2GCOA 2F6RA 1F18A 1NIEA 4PD4K 4N3BA 1QBGA 4QPJC 2BVOA 1ARZA 3VGAB 4Y4KD 3UP6A 1A04A 1UVQA 1PK7A 3B53X 5FI1B 4HWZB 1GPAA 5EZYF 2NX5D 4YEFA 5FJJA 2ESVB 2BKAA 4HHWA 1Y7HA 4ESOA 1MCSA 3F3YA 1NBVH 2IOIA 3WLWC 1Q74A 1Z4NA 5MN4A 3O2DH 3V4VB 1QB7A 5D3MA 4NZNA 1UYWL 2A6JA 1C1YA 3GGWA 2PM8A 1QIJA 3LPGA 3I04M 4AC4A 2Q4EA 3EG9A 1YSOA 1WAAA 4M55A 3KCQA 4N7MA 5IN5A 5L4LA 4LKRA 1YEWA 3OKDB 1CR0A 4R1UA 2P9EA 3QWBA 3B9VA 3B1JA 5I6OA 4FI3F 1Z5LA 3FOMA 4Z95L 4F33B 4DMUB 3E3LA 3ITNA 2QAIA 4M62L 4J3OG 4RIRB 1V16A 4LDLB 3EZFA 5KYVA 1GZVA 2FU5C 4OYYA 3NBZC 3KYCB 1PYDA 5D3ZA 3QUXD 1IEAA 3K7UA 3AAZA 3X43A 3V0VB 2GD0A 1XPUA 3KPQA 3Q87B 4GI9A 3FNEA 5KANG 3UTPD 1UJMA 3WJAA 1EVKA 3FPHA 5AZEL 2R68A 4IIJB 4F72A 3A24A 1JF5A 3GTVA 4ZRMA 1M05A 3MFQA 4IQHA 2ATPB 5DD6B 2G25A 2E9SA 4DC1A 4OD0A 2IQIA 4ABUA 2OHGA 4H1LB 3ROLA 4GFXA 1JEDA 3LFTA 3IEMA 5K3CA 4TVSA 4S1QH 1NGYB 4A39A 4R26H 5JQGB 5C80A 4GW3A 2R29A 5HGAA 2ZKWA 2Q8AH 1K97A 5DYIA 2X4OA 4J3XA 1OT2A 4TXVB 3N1QC 3RLSA 4QUIA 1XSIA 3ZQUA 2QLFA 1IEVA 4JJKA 5KSPA 3ARTA 3O1IC 2LWIA 2E55A 1KMQA 4JBGA 2CK2A 2QD2A 1TIPA 5E4AA 1RWPA 1RVFH 2ODPA 5LP1A 1NJ6A 5HJ3A 1FDSA 4HB4A 4JLDA 2RGDA 2ZSBA 1OH5A 3AR3A 3ESAA 3IBCA 1S7GA 4KH1A 3C6BA 4BQ8A 2EU8A 4BMNA 4DV1B 3CB4A 5K1JA 5E9DE 1MFBH 1Z75A 5F7XA 4M1EA 2VCEA 2RHRA 4LPWA 2HC9A 3DR3A 2H6OA 3CKKA 1RQ5A 2D7TH 2JJVA 3VMNA 2ATAA 3BGSA 1WLSA 3EZGA 3IDIA 1VG8A 4L8SA 2Z2XA 5K7SA 2JLYA 1MHPA 4I55A 2BSED 1AKRA 3ZU2A 3RZCC 3ELDA 2I7XA 5I15L 1YNTF 2IHBA 3W5SA 1QGUA 1R9FA 1RBQA 3AR8A 1R3IH 3KPNB 4S2SA 3P0YH 3JPWA 4D8PB 4GP7A 1NZRA 4BRWA 3B1KA 5IVDA 2ZCVA 1AGDB 1GL3A 3OJOA 3ZS9A 1NVEA 4RLSA 2HBRA 4HDMA 1CRZA 3R0QA 3PGCA 3Q2WA 2X8AA 1HX7A 3OFNA 1MIMH 3FDFA 3HEAA 2DFPA 3ECQA 5BOZG 3D8RA 3BMCB 1YA8A 2VLJE 3KYMB 2PRJA 2ZUXA 4N0UB 5LR6A 3QQ4A 4OLZH 3KLHC 4NJAL 3DE6X 1C5CL 2V6BA 4DQOL 3MJ9L 4BLSA 5B21A 2X8WA 1P5VA 3PWPA 1E3TA 4ZOLA 5BT8A 1UQSB 1XQ1A 2HY7A 5F71A 4GZMA 4OHCA 2ARJB 4TLAA 3EJRA 4PC1A 2VAAB 4U3XA 1U3GA 4JFXB 4ZQEA 4U7SA 3VFSB 4FYYA 1Z6QA 3N2IA 5C6TH 4QGHA 4HK0A 4PJ5D 1WXHA 1EDDA 4TV8A 3FPKA 4NT6A 3LZFL 2WB1A 5CCKH 2N47A 2RCSL 3TEUA 2FXIA 4XN8A 4ODUB 3PR2B 3C5EA 4IJ5A 2HYIC 3TIDB 4PRDB 2VJBA 5HIMA 3T9EA 2WD9A 3FFOA 2C3MA 1SXJC 2R6AA 3UBXA 3QVVA 4B47A 4AITA 3W5JA 2P43B 1XD2A 1RJLB 5KWIA 1CK0L 1XMXA 1BZ9B 3MW8A 5AOLA 4YZFE 1FNLA 2G5RA 4Y6SA 1LBEA 2AAAA 3KLSA 4L1BA 1KSGA 3MBWB 4M0MA 1XNHA 1SCDA 4EUPB 4QVKA 5LN1A 5CYFA 4DUVA 4N0EA 2HJLB 3ONVA 3ETBJ 5KYGA 3MV8E 3LBNA 3DB1A 4PJXA 1UD3A 1MI5B 1NAIA 1BE1A 1IE3A 3E1ZA 5A4KA 3O2QB 2WR8A 4E36A 5CJXC 2L69A 4GLJA 4PPYA 2I78A 4I9GA 3TYGL 2HV8A 1V2GA 4D92A 4PJCE 4I4TA 4FCHA 4BK4A 3C60C 4IDNA 5I71C 2MSLA 2QMOA 1XXHB 2OX5A 1XGPA 3FMOB 5D1QA 4TKZA 3LKVA 4JL6A 5CHNA 2CWDA 3MOSA 2QJFA 2H5UA 3PGJA 3KVPA 4P4KA 4B6PA 3O95A 4FLSA 1NDMA 2OXHA 4AWJC 1FFOB 3WDIA 1JZ7A 3ME0B 4R2GB 5LAXA 5DVZA 3TH5A 4PI2A 1NMEA 4QX6A 3DT9A 4HADA 3PQYE 3WADA 5AOKA 1NG1A 4ZA2A 1RMFH 3AREB 1CQJA 4YCLA 1H9CA 4P04A 4YONB 3QYPA 2QLBA 3CC8A 1YEIH 3A1EA 5JU6A 3LHKA 4UINL 1EK6A 4BMZA 1E5CA 4J4PC 4TQHA 1I8TA 3G8DA 1R6AA 5JC8A 5IHLB 1N8NA 2JHAA 1BW9A 3L3BA 3L3DB 5IHWA 2IYZA 2G5BB 2B59B 1G8YA 3C5ZD 4E94A 2QROA 3C48A 2BRUA 3I04A 4WZ9A 2ZE8A 4PIVA 5I8OL 3JWNE 3WLBA 4N5NA 4PRPD 1WE2A 3L2NA 5E8DL 3LC0A 3TW8B 5FUOL 3FCEA 3IWUA 2H1CA 2IPTL 1C9YA 3PABB 3UEQA 4RVHA 4NOLA 1QNZH 1EUDA 3KHUA 3N74A 5JSZB 5DQJB 1S0UA 2CBGA 2I55A 3CFEA 2NY7L 1W0WA 1F6WA 3WK9A 4Y0NA 3H85A 4PO8A 4X6EA 2QD3A 3DKIA 4CLXA 1RKRA 4PTUB 1K2WA 5JHDD 2FJ0A 3R7AA 4G9GA 2XQJA 2O07A 4MQ6A 3GUTA 4Z78A 2XGMA 1W4LA 4TRPL 2NNAB 1YDGA 4U6VL 2AHOA 2QEQA 1BVKB 2X0NA 3MS4A 1KAOA 1EQ2A 3HLTA 2CLOB 3EBPA 5J13C 4XVCA 3FTFA 3DI2B 4MUIA 1RZ3A 2JI1A 4OU5A 4QXGH 5I9TA 2VW4A 1BRTA 2R44A 2DCUA 4FQJL 2ZWOA 4BN4A 3UTTD 1UA3A 3FU3A 2Q7XA 1L8XA 1HZKA 5BN3A 1CXIA 1A7OL 1E3QA 5TEVA 3MINA 4OYLA 1X77A 4GOSA 3LW7A 4M93B 3KFVA 4X8JB 2G75B 1XTVA 4M0KA 3UQZA 1OHZA 4XDGA 1E5DA 1N1EA 5ALUA 4FE9A 1LNQA 4U1MB 2LCFA 4QXOA 4C7OB 1WWWX 3LAFA 2VQDA 2F8MA 2ZOKB 2KERA 3DC0A 2HHAA 2AWOA 1UOPA 1NT2A 3DCNA 2O48X 1BAWA 1HNWB 2G8NA 3PX3A 4WK4B 1NCDL 2EW1A 2CMRH 1RZ8B 3TCLA 3ND8A 3RAFC 1RRCA 4O4LF 2J25A 2BH9A 1JJFA 3TVMC 4HPHA 3GJ8A 5J6GB 2YN0A 4N5HX 5LP6A 4EJFA 4QDTA 3KEQA 1M1UA 4C3ZA 4KJYB 4YBQC 1AQIA 2EJTA 3FGOA 4JYMA 5BV7H 1YNLL 1Y81A 3QEUB 4PAWA 4GG6F 4CR6A 3OIFA 3Q9LA 1VCIA 1PJWA 1IATA 4ZANA 4GI1A 1TF7A 4ARUA 5LBVA 2FUG6 1FP4B 4EGAA 3SBXA 4NM4L 5BVPH 1JQJC 1VGKB 4K07A 4N8UA 4GR9A 3ISVA 4IOFC 4OSUL 2DR3A 1USKA 3I9PA 3MSPA 1T5DX 2QTBA 1BEUB 3L7JA 2ITDA 4NIKB 3DZCA 5DWPA 1A9YA 4MQTB 1NBHA 3G2OA 3P4NB 1U2GC 3A11A 1A6VH 2GBPA 2C8KA 4A8JA 3N0XA 4AJ2A 2DIJA 4N1CA 4Q02A 1AQKH 2DUJA 4U7PB 3RTAA 4TNFA 3O45B 5TX7A 4BLPA 3FCSA 1T1WB 1WBXB 2B21A 1NW7A 4YSAA 2AJBA 3MXTA 2RIRA 2F4NA 3JQGA 4IS3A 2FEEI 3FTNA 1YHPA 1TEHA 4MQEA 2FW9A 4AM0A 2Q2NA 3RR2A 1MGPA 1UOEA 2G80A 4D4GA 3JVFC 2HG0A 4P2OD 3JQQA 1H05A 2FD6H 3CKLA 4KX5A 2GPAA 3BD9A 2WTRA 3PPWA 1Y6FA 1H4VB 4YXKL 3DARA 4Z3HA 1JZDC 4QRPB 2ORWA 3GMTA 1Y1RA 1R18A 4OQFA 4DKTA 5GZOD 4ZT7A 5DJDA 5I0XA 2IXFA 4BN5A 1MOPA 3PC4A 3AVOA 2JB6B 3EZ6A 1D1PA 3DWGA 3I9FA 3ARGB 4NSKB 4HWUA 1AGPA 4A2MA 1CQWA 5KVSA 3UMGA 5JAOA 4MS3B 3WWZA 2Y4SA 5F5LA 2CFOA 2V7QA 3BD7A 1A2BA 3TGPA 1Z63A 3N58A 2MRYA 4NBUA 3TRDA 4Y4HD 1I3NA 4JUCA 3EIHA 2H5IA 1LTXA 4HRVA 4FQ7A 4BAGA 1II8B 4YPOA 5GGXA 3LJKA 4TZ6A 1HMPA 4UBNA 3VXQB 1REQB 1KAQA 5A71A 5BMFH 3MRPA 5BRZD 2M6LA 1FL5B 4AJNA 1KAHA 1R7RA 1JALA 3SGLA 1ZA6B 1F4PA 2VXUH 5CZVH 2ZYTX 2WQWA 3W4JA 2BPBA 1ABFA 4NH0A 2DH2A 4NC1C 3RS3A 2XUGA 3WNQA 5COBA 1U3HC 1T4CB 2YINC 1U8EA 2BP7B 3NJHA 3EX7C 3CZFA 4EIGB 3F85A 3O93A 2OP4L 4CNIA 4MIKA 4YXLH 1DBWA 1EFQA 1Y6NR 4H7EA 3HJGA 4OK3A 4DF3A 2AR0A 2IVFA 4ILDA 1M34E 2ZNXA 5BZXA 4JQSA 4A67A 3ONFA 4HLUC 1V1RA 2FRDA 5IXYA 3H1FA 3ET4A 1KB9J 4TX1A 1AMUA 1KMHB 3ZPXA 3WNJA 2YHIB 2GZRA 3I01A 1ZMRA 2O4CA 5WRFA 1EVQA 1OZTG 5BY2A 1F2UB 3N41F 3OSKA 13PKA 4ZFFB 1T6BY 4I4WA 3D1JA 4R1SA 1CS4C 1NL3A 1QUEA 5H68A 4E51A 1UOLA 2VTDA 3RL2B 4N8VG 4HHEA 4ZUVA 2FMIA 4NBSA 5JNLA 1NSTA 1G5FA 1PGPA 3VDXA 2PT6A 1UUSA 3ZN6A 1CZ8H 5TY0A 4L9LC 2WVVB 1NA8A 3KLPX 4R2KA 1E5ZA 3I2GA 3OP1A 5IF0A 4YRJA 5E4TA 2IHUA 3CEJA 3MUY1 4KBPA 3FPBA 1K4DA 3BLKA 1KCRL 1X5FA 1F13A 3T65A 3OEHD 5KQMA 2C5EA 5LDDC 4LMPA 3TIEB 4JA2A 4A23A 1RVDA 4GBED 3P0GB 2JGRA 4JRFA 5LWYL 4EKXA 2Z57A 1E79A 1JJVA 4NR0A 5D6DA 1Z73A 1XLTC 2DQDL 3DYOA 4J7XA 1JU3A 1KUMA 3QQDA 1Z88A 3T3MF 4G4GA 1BEZA 3OQJA 5DT2A 4OI8A 2PGDA 4NG5A 3LY6A 2R96A 2CKBL 4OV5A 2O7VA 1FNHA 4HYTA 4CZ2A 4U6HB 2D7PA 3UC0L 3VU8A 5HYJD 4FNOA 5LM3A 1UXSB 1YIOA 1EVZA 4JWTA 4KIFA 4RIFA 2AVGA 4FUQA 4XOIA 1V0JA 2HKIA 5TGZA 2E56A 4XAKE 4ZQKB 3PFKA 2WQ7A 1XGYH 5AYUL 2OOSA 3BIOA 3EYFB 1JEOA 5D7LA 5C8VA 5A5VA 1KO1A 5DTRA 4JLRB 1E1NA 1MKYA 1OX6A 3G5YA 1VA9A 4OUKX 4PCAA 4UOJA 4DKFH 5DMKA 3FT4A 4MW2A 1XMIA 3EADA 2YYAA 3CDGA 4Z7AA 1DJZA 2YDXA 3PDGA 1CE8B 3GARA 2NW6A 4XPGH 1P84K 1KB5H 3TLBA 5HQ3B 3WDJA 1LDGA 2WIBA 4C7JA 2B2CA 1HESA 5A2QA 4IXDA 2NQ8A 4M56A 3B3QA 4G5HA 1ZHFA 5FW7A 3PXEA 3FB7B 4E2XA 1K3IA 1A96A 5THQA 3RYMA 2BNQB 4KNVA 3NO4A 2AABL 1ZHBA 2ZM5A 3UJDA 3S7GA 4BQOA 4CIBA 3DDUA 4QRFA 2XV1A 5I1LA 1PEYA 1VIVA 4PMEA 4XT1C 3F4BA 4JPIA 1TGVA 4RMIA 2R65A 5F3DA 5A2BA 2O05A 1R0BA 1EZUA 2BTQA 5B3AA 4P9MH 1RWOA 2M1KA 1GZ7A 3V0HA 3ZE1F 1NPDA 4QXUL 1MCWW 4A8HA 3MRIB 3R3SA 1I7QB 5JXAH 4JE0A 4HZLA 2BTOA 1NF2A 3KYNB 1Z0IA 3A4IA 3A6LA 1DE4B 1XB3A 1Y82A 1T1XA 2R1YB 3P73B 5GQSA 1A7JA 3V7MA 4NXMB 3AY3A 1Y3AA 4HUWA 5C2BL 4OH2A 3IDQA 4A2DA 1OWLA 1EJ8A 1YHNA 3KJHA 5FYDA 4F2PA 3EWIA 5JJCA 4QHLA 3D4GA 2HADA 2DWEB 2YMQA 4KMRA 4UTPA 1JBQA 1ENZA 4KRPB 4LSPH 3MRDB 4LBVA 1IBHA 2CJUH 5EMLA 3V4VH 4PG8A 1W85B 3C6LD 1P0MA 2Z4QA 3AWGA 5KU1A 3BCFA 1QVOB 4P8QA 4HOXA 3KKPA 4M1ZA 3BAEL 1GFWA 5FDFA 1F8TH 4MXVF 3AP3A 4P0DA 3AVQA 2CHZA 4OLWH 4G8GD 4P53A 1E1YA 4QFBA 3BP6A 4NQRA 5B39B 2WYUA 3NPZB 3ZZLA 3EGSA 3CGGA 2I9TA 2FZCA 1CU4H 1VIAA 3CXDL 5ABPA 4KDTA 4LSTL 1F6AB 2V7NA 4HIPA 1LHZA 1U8YA 1CV2A 1OD7A 3GU3A 1G94A 4Q4CA 5KDDA 3OOSA 3KWWA 5DHVB 2H08A 2VTEA 2O5YL 1ZXKA 3WMGA 4OW6A 4EUEA 4XR8C 2FPSA 3GLAA 4OZGF 1DYZA 4P4TA 4X3PA 4KKQA 1Q7CA 2XB2A 3U79A 1U7XA 4OVKA 2IAMA 1ZHLB 4YRCA 5CWSA 5JJIA 3HVDA 2WG1A 3WN6A 1JTOA 3DJTA 4H1LH 2BM0A 2JLCA 1NCAL 2IHKA 1TFRA 2XTJB 1MNQA 2VLLB 3EY4A 3JD1A 1AR1B 4JRWA 4KI5F 4GMFA 4RF4A 2HOQA 4HS3B 1E9PB 4UQBA 3LT2A 1I7UA 3RI3A 5EBWB 4L5FL 4OGYH 4LFHG 1BVRA 1CN4A 1FFGA 3EXHA 2VHTA 1NPJA 1XTUA 4FU0A 3DBLB 3MRJB 3HLKA 2GD2A 4CGZA 1UB5B 4DPLA 1ZVMA 1EP2B 2WIJA 5TPZD 1FTNA 2IU4A 4HF5L 2NQTA 4NYJR 1USGA 3VHXA 1P31A 4GG6E 3PXGA 3S2FA 4PLVA 4MDRA 1L5ZA 1NGXB 3H7BB 2OESA 4J1NA 1F02I 3QUGA 3BGDA 1TTGA 5GXBB 3HYSA 1XKLA 1UMCA 4MJ6A 2IXBA 2B5OA 1BDJA 3VOAA 5EU7C 5MHSE 1ATIA 5E1GA 4F9FA 1ZNYA 5AUOB 1XVIA 3JV5A 4DF9A 1LF5A 3CUSA 3FRPA 2XZOA 1UM4L 3IMRA 3A6ZA 5B4MD 1OI3A 5ELIA 2BIIA 3CLUC 3KL0A 2WW8A 1J7JA 4F9PA 1XTBA 4EN3A 3DV2A 3WISA 3EJ6A 2ZXBA 4MA4A 1Z5HA 1A9SA 3MODH 5KBKA 6CGTA 1PJZA 3KE9A 4EG1A 2G9QA 1D1QA 4D3XA 5C08E 4N8CL 3AROA 3WHIA 4XWYA 1GITA 3GZJA 1KXTB 1JXQA 4ZGGA 3FTUA 2H6EA 3BVPA 1NVWQ 5CU5A 3DT6A 3HZYA 1G9MH 1VLQA 5CP7B 4I08A 1ZRMA 4CM4A 3UFXB 2XADA 4DIXA 3FOCA 2B5WA 2ZYRA 4OIMA 5FO0A 2RKOA 4BGVA 1CJMA 1FRFS 1F58L 1Z4OA 1RCUA 1LGVA 2VPXA 1NC2D 2EZ0D 4GUDA 2QFRA 1ZEJA 2ZI5A 4EMSA 3FZYA 3O9WD 4GECA 1SHMA 3K09C 3QX9A 4A0SA 1NF3A 4WFHE 3ZHYA 3NZSA 1V26A 3OF6A 1JR3D 4LBEA 3Q3HA 5DMGC 4P57B 3HNSH 1QFWI 3EOTL 1AHMA 4TVBA 3WYFA 1NEZA 3JZ7A 3FFCD 5HE9A 3GBVA 4WV1C 4Y16C 3WBKA 4ZPVB 2HDOA 1FU8A 5C52B 2AMFA 2EIKB 2GM3A 4OATA 4QSMA 1ISSA 3ZHVA 5KQRA 4EUPH 5GGUA 2A1IA 3TQQA 4FZEL 3FOWA 2BK8A 1IBZA 1Y6KR 4JY4A 4EJMA 3HPLA 1MFZA 1LE5B 3AOEA 3CN4A 4AI6A 2XF8A 3VZPA 1H6DA 2XZAH 5GADl 2E7BA 5BT9A 4HWRA 4LLUB 3E5MA 3H84A 4IXMA 5EWJB 2BY2A 4TPKA 3SDAD 1Y6JA 2NTYC 3WMPA 5GGTH 1VDMA 2D03L 1PT6A 3GFRA 4S0ZA 2FSVA 3PUKA 5T4FA 4Y7MA 3D33A 5MGBA 2OL3A 3HC7A 4ER5A 4Y8DC 4ZMQA 1UK6A 2EXWD 5IKEA 2ZITA 5JORB 4KROB 1XDTT 1PGQA 4GVPA 5KG9A 4DV3B 1BSIA 1Q3TA 1JIXA 1EGQA 2YRZA 2DQ4A 3KV1A 2XD4A 1O6GA 2GF0A 5EYPA 4DSNA 4IJKA 4FKMA 3UB4A 1TZ2A 3HHMA 4YJHA 2VXBA 1IKOP 2A4EA 3G1TA 1SJHB 1ZCAA 3SICE 4UQ3A 3W5DA 5IB4A 4BZ1L 1KJ8A 1HHKA 3BUSA 2ST1A 3H2GA 4YRNA 5CDHA 4K9SA 1IX2A 2JJYA 3B83A 4Y5YC 4HSEA 1P0QA 5SV4A 3H3JA 1N3IA 3NTXA 3UMCA 3UAAA 1IUNA 4S1RL 3W7AA 4QAJA 4L37B 1ZH8A 5DJCA 2WSMA 3U9TA 1A8JH 1JZ4A 4GT1A 4C4UA 3MSXA 4DCQB 1U8JA 4RZUA 1HL5A 4NDMB 3V1TC 1JRLA 1QVAA 2VBGA 1GCGA 4AW7A 1KBKA 2NY2C 3U7WH 3T3IA 2MMCA 1OM3H 3CV5A 3TXXA 3QYMA 1OT4A 2GN0A 3PEUA 2YD5A 4DRZA 3LXUX 2YRLA 4WWKD 2YO3A 1IAIL 3L4ZA 4Q05A 3OQMA 4B3BA 1A7QH 1B6UA 1GAFL 3LS4L 3EVZA 1E90A 2QZSA 5IVZB 2O20A 2G82A 3K73O 5DHTA 1PR3A 3QDJA 2OBMA 4F60A 3ID6C 4OFYA 3QEQA 3IUEA 4Y5VA 3DOIA 2NQ3A 4YDVA 5FM5M 1M1SA 1IXSB 3O94A 5FA6A 5KYTA 1ZX1A 1RM3A 1QC5A 2BE9A 1WW3A 5JMWA 3QXTA 1SCJA 4US0R 3OIDA 3O6KL 1QSEA 2QYTA 3KU4A 5AHXA 3MMZA 4OFZA 1IM3B 4HAGA 2JIXB 3RYHB 1FNSH 1C14A 1GSOA 3IT2A 4OREX 4R1NA 4RBPH 2IU3A 4Q4JA 4NHUB 1XK6A 3FGPA 5U9CA 1RI2A 1NXOA 4GXUM 4QXTA 1KJQA 2WZBA 4DMLA 2HRZA 2YLKA 2ASEA 1NATA 4NAUA 3R7FA 3D5OF 5DK6A 3QJFA 2FZLA 4X1KA 4D9NA 1MJ8H 1V7ZA 3AO0B 3WWEA 4TV9A 1SIUA 5JH7A 3E03A 2FSHA 1W9MA 5J23A 4ORGA 3NBAA 4NZDA 1J99A 1QNIA 4Y5XC 4WLVA 3A32A 3MOAH 2DOKA 1KTCA 2V74B 2A2ZA 3TT3L 2FJUB 1GQRA 3F1LA 4BK8A 2VPYA 3ULUF 3CVHB 2OR9H 3BVDB 3IIMA 3KZMA 4YHPA 4LXTA 2CDCA 1TEYA 4PYQA 4K1XA 1ZD1A 1XU7A 3HC4H 1ZIAA 4RSVA 4E68A 4TF4A 4G8FA 5E1OA 4ADJA 3HI1B 2EBHX 1B3RA 1N2IA 3HG3A 2OXGA 2J8ZA 3SVZA 2QV7A 1NGWA 4MGXA 4MUJA 4G7YL 3T09A 1K5HA 4Z8FH 2GKOA 2KHZA 5FWQA 3ZE1E 4IFTA 1C1DB 3QIBD 3MRRB 1RJDA 2VUKA 5BUAA 1E6OH 1XCQA 4E7PA 1GTJ1 3ASUA 5IOPA 3IBYA 5F96H 2F2HA 4QHMA 3O26A 3IMTA 4AUYA 4AYWA 1SUJA 3BF7A 1ZLSL 4M1WA 3RIFF 4XM2A 4JC8A 1EZVY 5E8RA 4Z9YA