2VDPB

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 125
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdpB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdpB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdpB03
4O3UB 4O3TB 1CQPA 3K6SB 1LFAA 4UM8B 1YVRA 2M32A 2B2XA 2NUPB 3EFOA 4WFQA 3V4PB 3EGXA 4HQKA 5HJ2A 1SSLA 2WINI 1SHYB 1YVPA 1M10A 4CN8A 5HGJA 4C2AA 3IJEB 3EH1A 2VDLB 2I91A 1NA5A 3ZDZB 1JEYA 1U0NA 1SQ0A 4MMXA 3OKYB 2QTVA 1AUQA 3PPWA 2NUTA 1TYEB 2VDNB 4F1JA 1RS0A 1JEYB 3ZDYB 1IJKA 4K3JB 4HQFA 1MQ9A 2NUTB 4MMYA 3HI6A 1PD1A 4Z7NB 3EGDB 3FCSB 2IUEA 3N2NA 3HXQA 1QCYA 3E2MA 1V7PC 5BV8A 2WW8A 4FWWA 1U0OC 5E6SB 3ZE0B 4MMZA 1XDGA 4G1MA 1PCXA 3TCXB 4NENA 3OL2B 4PN7A 5KYXA 1FNSA 1JEQA 5E6SA 2ODQA 5KYWA 4WJKB 4Z7QB 3QA3E 4UM9B 3EG9B 4NENB 4XW2A 3OKWA 3VI4B 4C29A 5KYXB 5LN1A 3EOAI 1QC5B 1JEQB 1M1XB 2I6QA 2VC2B 5HDBB 1AO3A 1IDOA 5E6RA 1N3YA 1BHO1 3K6SA 3FCUB 3ZQKA 4Z7OB 1AOXA 3NIDB 4WK0B 1MQAA 1ZOPA 2VDMB 3TW0A 4IHKA 2P28A 2O7NA 4DMUB 4CN9A 3RAGA 1SHTX 4WK2B 1IJBA 3F78A 4IXDA 1RTKA 5KYWB 3IBSA 2VDQB 3ZDXB 3ZE2B 1CK4A 3K72A 1Q0PA 3NIFB 4O02B 4NEHB 2I6SA 2UZYB 1M2VA 3AL9A 3BQNB 3K72B 3NVQA 2ADFA 4O02A 4MMZB 1ZOOA 4M76B 3T3PB 1UEXC 1L5GA 2X5NA 3EFOB 5KYUA 2VDPB 5KYYB 1BHQ1 3NIGB 2VDOB 2XWJI 1M2OA 2ICAA 3F74A 3PPXA 3VI3B 1L5GB 5KYUB 4GZ8A 1U8CB 4WK4B 1JLMA 3AL8B 1M1XA 2XWBF 4IGIA 4A0QA 4JX0A 4FX5A 2XGGA 1MHPA 3GXBA 1MJNA 4MMXB 1MQ8B 4HQLA 1U8CA 1SHUX 1OAKA 3EGXB 4JDUA 3V4VB 3TXAA 3M6FA 3AL8A 1T6BY 4CNBA 4F1KA 4BJ3A 3AFCA 1MF7A 3IJEA 5ES4B 1QC5A 2VDKB 1JV2B 1ATZA 1RRKA 3BN3A 2P26A 3T3MB 1PT6A 2NVOA 4UM9D 2ODPA 2VDRB 3K71A 1XUOA 1JV2A 1N9ZA 3PPVA 4G1MB 3OL2A 3K71B 4MMYB 1PD0A 1IDN1 3EGDA 3ZE1B 5KYNA 4HQOA 3FCSA 5E6UB 1DGQA 1RD4A 3TVYA 4G1EA 3PPYA 3Q3GE 1M1UA 5E6UA 1ZONA 3BQMB 1OLZA 1FE8A 4HQNA 4C2BA 4G1EB 1DZIA 5KYYA 3EOBI 1M2VB 1YUKA 1T0PA 3EG9A 3HXOA 2NUPA 3EH2A 1XDDA 5E6RB
chains in the Genus database with same CATH superfamily
3WIVA 4EY4A 5JW6A 4OZ4A 3UG4A 3ZKMD 1CQPA 1KVRA 4F8YA 1W0JA 3NIWA 2PWBA 2F17A 4UMGA 5BNWA 1ZV9A 2BW4A 1FFXA 1TQ8A 3E9ZA 5EOQL 2J33A 1UA7A 3SHQA 4IDFA 4L0YA 5ADUS 2QR3A 3LWNA 2EC9T 2A30A 3OKOB 2ZRQA 4PC2A 4ARIA 3SIXA 2JFPA 4APQB 3U2IA 2WVGA 5KN5B 2VTBB 3FSGD 4YXLH 2RHOA 3HUDA 3AF3A 3FSRA 3ZV7A 3NIDB 3D7KA 2L0DA 4NZTL 4BK4A 1YEEL 2O2IA 1GTNA 1NZFA 3RRMA 5M04A 4OAWA 1NUNB 1R4NB 5L6LB 2BFBA 3NJIA 4FCTA 4HCRH 2EDMA 2J9FB 3B9KC 3BP7A 3GI1A 3RSSA 3O0DA 2G40A 2VDWB 5KX5F 2X5JO 1U4NA 4JFXA 2WBLC 5A3QA 2VP0A 2X6QA 2H0RA 3BUBA 4MNGB 1AXRA 1DMSA 2AZAA 1Q0YL 1G20B 5IIEB 1UP4A 4ES6A 3RNKA 4GKNB 1ZDMA 3QELA 5FPHA 3TD9A 3EO9H 3MJEA 4YDHB 2OK8A 1M57B 4M1QA 2R1VB 3D3KA 5JANA 3WGOA 1WIWA 4XAKD 1AHIA 4KFCA 4KXXA 2V96A 3C1OA 1IM2A 4E9RA 1TJIH 2IALB 2VZ0A 1MVFA 4NHEA 4E9WA 3SS8A 3FF8A 3GLEA 2QM3A 1BQLH 5EXEA 4QBTA 2KWIA 3DP9A 3SC6A 1E9OB 5LR6A 1LD9A 3P0RA 3FPEA 3K9QO 4HUWB 3JZIA 3UH0A 1HZHL 4G1UC 5KVGL 1U8MB 1LF5A 1YZTA 3GUCA 1KNOB 3HR8A 4G5ZL 1SFHA 1UA6L 3HXQA 3P0YH 1TCCA 4I2XE 3MWGA 1F58H 4ACBA 3ARFC 4Q9NA 5EZYB 4ZXBC 2Q3BA 1KELH 1TD1A 2O2SA 1IXSB 4C43A 4ZZ0A 4U2DA 4PJFF 4XC1H 1P5UB 1MB2A 4GR5A 5ICYA 4BNJA 2XHZA 3JD1A 1LO4H 3WLJA 4EITA 1DADA 4E5XB 3N2KB 1JSZA 3O03A 2EXTA 4BZ2A 4OB5L 1MCSA 4LGCA 3H2WA 2VAWA 4ONGL 5DD3L 1YCHA 1WV0A 3HYTA 1DX6A 3CX5J 2EYTA 2OXTA 3ZXXA 4X98B 4G8GD 1FFEA 2AX4A 2NZ8A 2YR0A 2O5EA 3E80A 4HSGA 2GF9A 4U1NB 1E28A 2EILB 3D33A 3FWPA 4KR6A 2K8MA 1SJEB 2QM8A 2P6UA 4JUIA 6CHYA 1E1RA 1T26A 4FXGB 1UXSA 3T1VA 2I2CA 3L95A 1QSEA 2WINB 3IJEA 1T29A 3HRZA 4WI0B 1XMVA 2VHQA 3EWAA 5AW2A 5F77A 4PONA 2VM9A 3W56A 3KB2A 4QF1B 1YR7A 4OTXH 4I5EA 1CDUA 3QDMA 4AJ4A 2R2HA 3ZKXB 5FYKD 3KWMA 1H3PH 4MGIR 3F3KA 4GAEA 5DJ8A 3EYQD 2YPLD 1A4KB 2XV3A 3F8UB 4DGWC 4ZANA 3OSVA 3FH7A 5EUKB 3CBGA 4EIZC 1GZPA 4KR9A 5IBTL 3FB7B 1CY1A 1UT5A 4J3OD 3QDGD 4LRTB 1UBOS 3U4EB 1Z28A 2BM1A 5AENA 3V4VL 1N77A 4UZFA 3OB8A 2WR8A 4S1RH 4WHTB 2C4TA 1NJ5A 1LDGA 1U30A 1G6RA 4NSNA 2ZJ7A 2A5FA 3DLTA 5K03A 3KLLA 1AG0A 1ZRMA 4DGIH 1TD9A 4HDOB 4RTNA 3QITA 1GIGL 4KRMB 3N2LA 2D74A 3DMNA 5TDOA 2CLVB 2WMYA 2XRAL 3MRMB 4L29A 2C04A 3TOVA 4AJJA 1N6PA 4NBVA 1R0AL 1ZC3A 2HFFA 5GVSA 4Y9CA 1T5BA 1Z8FA 4M7RA 4KTEL 3QCVH 4XIJA 3U1VA 3NFPA 3BKMH 4WN3A 4RETA 2HLHA 4HJ0D 2RCSL 1NBHA 2A83B 3CD4A 1UOVA 5I9IA 3F6EX 4YMGA 4Z1MD 2X0UA 1GRQA 3CSTA 3O3AB 2DWTA 3D2UD 3BE4A 2PR4L 5I0WA 5JRJA 2P3LA 1MXHA 4BQNA 5BWMA 1CZKA 1CUEA 3GXIA 1ADQL 3VMPA 5DVKA 4NT6B 1CFSB 3CDZB 1TFRA 4MQ5A 3ARDA 4TLEA 1I9RH 5F64A 2G09A 3NAGA 3LTNC 4C56B 2FHCA 4P2QA 4GOND 4WK6A 4YHPB 4XM2A 5I01A 1ILSA 3ZE2F 5FQNA 2PXYB 1XAIA 2Y06H 2PH1A 3QW9A 1INEH 2EGUA 1M1YA 4KZEL 2APXA 2M9MA 1VG0B 3MWLA 3KALA 2ATCA 3BWEA 2WTUA 4PJ5A 1E7YA 2JJ1A 3TZKA 5F3WB 1AKJD 2JE8A 1NFAA 5EP2A 2PF6A 1PR1A 3GLRA 4YMTA 3BG5A 5IUNC 3WLBA 3M8OH 5AYUL 1TT5A 3RC1A 1EZUA 3OQMA 1C3JA 2AFIE 5TT1A 1XD8A 3LQ4A 2UUOA 4UT7L 3WKCA 3MV7D 4QXUH 4P2OA 5HYJE 2FWIA 1TLTA 4RQTA 2GXQA 3QO0A 1DEKA 2M8XA 1N70A 3GDWA 5DEFB 2PKQO 2CLDX 3BP5A 5EO9A 1U8OB 4TVOA 1MHEB 2PMBA 1F02I 2Z6AA 1C0PA 3PX7A 1HJCA 4DE5A 2D6FA 3C3JA 4IFEA 1SXJD 2RKWA 3L7AA 1N67A 1J5OH 3AAZB 4EYOA 5KMGA 1Q90A 4AEFA 3ENVA 3VYOA 4ECAA 5H37A 1SHUX 3ZVMA 3IUYA 3PGVA 3AWIA 3WNLA 1QC5A 3ARZA 3SBPA 2GO7A 2GD6A 1M2HA 2FWOB 1F5SA 3K16A 5A2GA 4OGGA 4PJCF 3PJGA 5IT2L 2FYTA 2K6ZA 4S2UA 4MXWL 5B3JA 4GPEA 3PFGA 2AG1A 2DBZA 4JFXB 2XACC 1V11B 3S68A 4BSWB 1FNNA 1BFOB 3QE9Y 3ZK0A 2J3MA 2ADOA 1TCMA 4JRXA 2YHIA 2HJGA 4JFEE 1WZ1H 2D0PB 5CH8A 1KMGA 3LPAA 4WX2B 3SEQA 5JHDE 1TEVA 2QN9A 2Q86A 2O2JA 1H05A 3W9UA 5BR1A 2ZT7A 1ZS8B 2BISA 1QPGA 3A6OA 5B1DA 1GAFL 2R29A 4QHLB 4PSCA 4NEQA 1A1NA 3CFDA 2GY5A 1A6ZA 1VHPA 1H3GA 3CKKA 2JA1A 3EVZA 4KWEA 3ULUL 3ZNPA 2WFZA 1SD5A 3F4LA 3ETBF 3QR2A 1DQML 5JPNB 2GSWA 1OSPH 3KPQB 3LQ2A 2L7UA 4DQAA 1QFUH 1E0SA 4UCFA 2NX5E 2Y0DA 1BF2A 5EA0L 2AEIT 5G0VA 3TNFA 1T9AA 4BKSC 4BO6A 1FL9A 3DM9B 2YCBA 1E59A 3NJMA 4HMOA 3ELUA 5A4KA 1TQBB 3RFZC 1P5ZB 4Y67A 3EJSA 2HK8A 5KWIA 5CU5A 5IIEA 2GQHA 3DX9B 4LF5B 3N42B 1KO4A 1PX8A 3WK6A 3ZE1B 5AZEH 4GSYA 4LPXA 4HYTB 3KVYA 5EEXA 3NP9A 1T7WA 1HEJC 4PLOB 4FXPA 3NCJL 1HSBB 2WC1A 1UD2A 4P2QE 2JJ1D 5ERYA 3NK4A 5E6RB 1N2SA 1NUTA 4URXR 5E2AA 3MLPA 2OS7A 2Q2LA 2QA5A 4NC9A 1QR1B 5L40A 1X86B 1OTUC 1YMME 1K3ZA 1XR9B 3IJ8A 2KLSA 4NFBA 3RVXD 2WIFA 1X1QA 3EARA 4Y2TA 1GQQA 4BFXA 3L1VA 1OGSA 1A9TA 2UU9B 3EHEA 5L3ZA 5T5FH 4PZ9A 5C92A 1OI4A 4ZDHB 1NSFA 5TDPB 1G66A 4HIQA 3G17A 2A88A 2EDQA 1USQA 4YRAA 5F5XA 3RJQB 3QE0A 3T1TA 2QQEA 3EQ7A 3L7DA 5FFGA 3D50A 1DIOB 5J4MA 1ZD1A 1GGNA 3WMRA 4FHDA 4XNQA 4D8PA 1QXSA 4ZXPA 1ARZA 2HIGA 1A7QH 1OI2A 3N5AA 1MW1A 3V0JA 4B7IA 2IZ6A 3PJRA 4M4RA 1QMGA 1Y63A 4GUPB 2XRYA 4O2BF 3APCA 3VZQA 3W2EA 4MW6A 4RBNA 5FPKA 4Y5XB 4MD4A 2FECL 2G9QA 1TJ4A 5LBGA 3JRNA 1NDUA 3AM8C 4XR4A 4WWKC 3NBMA 4NQRA 4OH7A 1F2TA 4EN3A 1E9FA 1IHXA 4NQZA 3MT9A 3ETJA 4KGLA 4LCJA 4CT0A 1R4XA 5KX5A 1PMYA 4PO1A 5GSRB 1AZTA 4MXVE 2C4HA 3F9RA 5DJYB 1CL7I 4PG4A 2BSRA 1I4DD 1STOA 4OQLA 5MGBA 4DC0A 3ARUA 2BZCA 1LJLA 4JI6B 1YZZA 1WT5C 1O4VA 1IGCH 2W60B 4M7PA 1K9SA 4C87A 1V1JA 3RYCA 4KXCA 3DGEC 1H5BA 1DUSA 4KR0A 2CA4A 3GB9A 2HRDA 3AT1A 1CFQB 2ZAIA 4R3WA 3ROFA 3M2TA 1KY2A 3FDJA 4LRIA 2F6AA 3LXUX 4JRXD 4BZ1H 2ZP9A 3UIEA 2QSCL 4JYPA 3ZCXA 1QWOA 5I16B 3IQZA 2O19A 3JQGB 2LIVA 5IW6A 2FW9A 4N8VG 1U7TA 2CMRH 5LIPA 4C4KO 4KJYA 1V1RB 4EI6B 3FSEA 5EIAA 3OU7A 4P23B 1W19A 2BBWA 1V8DA 2CZNA 4YHYC 2HF7A 4HWBH 2YXMA 3JV7A 3I9V1 3VXSA 2WAXA 2WSIA 4CWAA 1FP4A 2KJQA 4EPXA 4BMDA 3D0OA 2Z0MA 5DDIP 2OZVA 1L5GA 4CKEA 4C0XA 5BWNA 3AVWA 5C07B 3MGOB 1T5HX 3AR4A 5GS0C 3QPVA 1J0HA 1TZHB 4FTDA 3E8UL 1EG7A 4DP6X 3IMBA 1LDYA 3MGCA 3FQ1A 2Z65C 3BVXA 1D5BB 2ODIA 1TYRA 1RYMA 5DHUA 4TYMA 4NOJA 1CY2A 4UQDA 3P2DA 1L6PA 2OMUA 3KBBA 4NN5C 1YS7A 2ZPAA 4ZCMA 3GKWL 4NUGL 1XEUA 2FSUA 5GGQL 3OMXA 1VPLA 5K8LA 1CV2A 2MTAA 1HQRB 1XNGA 1D6VL 1OZAA 4YP0A 4M3NA 2G25A 4V0QA 2VITB 1BQ5A 1CQZA 3VPDA 4Z4GA 1TJPB 4H18A 1LO3H 1PZ3A 3OKDB 4BQIA 2BNQA 5AUPB 5E9DB 3CSYA 3HA7A 4DADA 3EVDA 2E7CA 1THTA 5FFFA 4MJIB 4ZX4A 4JLMA 5KAPA 3U3MA 3V34A 5FBKA 4UT9A 3PR1A 1FJ2A 1HBJA 3MJ4A 1O7SA 5AHKA 3FFDB 4Q6BA 5TEVA 2H1VA 3DVAA 1KOGA 1FEZA 3ZR5A 2Q5FA 3HHMA 4DOHB 4I4IA 3THYA 3FKSD 2R4QA 1XSOA 2BCEA 1KXVA 3EAFA 5D6CB 3H0EA 5EJEA 1XCGB 5JSQA 3U7HB 5I9MA 2CXUA 4ZALA 3CR8A 3N8NA 1P62B 2HPAA 5AVYA 4HEMA 1AD2A 2X58A 3ONFA 4X61A 4K5NA 4PJAF 5MP6H 2PQ2A 3T4PA 2IYOA 4JE0A 3HC0A 1UBCA 5SYMA 3HWSA 3NIDE 4NKMA 4MRMA 3TLYA 2NUBA 2ZX5A 4PGAA 4OQDA 1TEHA 2QD3A 5FWQA 2QZ4A 4ZQEA 3T7RA 1AUXA 4KKQA 1U1CA 2ZUDA 3GS0A 2NU9A 1NAKL 2W92A 4HWTA 1BXXA 1MORA 4MYRA 4RHEA 2HBQA 3KPQA 2NNWB 2ZB4A 3BSGA 5I1CL 1F0KA 1E4KA 3CJTA 3P3UA 3LHFA 4XBGA 3QUXC 3JVDA 4K7JA 5C53B 5M2QA 4ZMTA 1GDDA 1ZT1A 5AD0B 2I4IA 4L4TE 1KETA 4N90D 4EG6A 1IBRA 1R0YA 1CY0A 1PKQE 4IRJA 4CL3A 3EDRA 4OFDA 4TSRA 3R19A 1R15A 5KSBA 1KI8A 3EIXA 4YRCA 1UP7A 3GBNL 1RAFA 3G0GA 3AEUA 4G24A 2W22A 1QK4A 3EDFA 3LXAA 3IDQA 4ICIA 4W99A 3IGKA 5HBGA 4HG4J 3CW2A 1JHTA 2JKWA 2LU7A 3TW8A 1E7RA 3NOXA 1E79D 1GGCH 5FKPA 4CDHA 4DKXA 4ZOQI 3F9CA 3R3HA 1YYCA 2RG1A 3VPXA 3KTDA 2CUIA 4XPHL 3GSWB 2X5OA 1KZHA 3P4MB 5G41A 2HO5A 1DANU 4DMLA 1ORSA 2RK4A 1KJ8A 3V6LA 3Q8EA 2UYYA 1T25A 3QKSA 2QRHA 4GMSH 1RKXA 1QDLB 3IUJA 2BF4A 4CMGA 4M7LL 2O8EA 3WHE0 4CTKA 3T5MA 2GTZB 1QOZA 2GCOB 1MWAA 2V7WA 2ZWIA 1MCPH 4ZBJA 1JYWA 3C8HA 3F3SA 1IWOA 1U8HB 2WVHA 2XWCA 4RAUA 1GTVA 5A5GA 3MGGA 2WXKA 1QGUA 2QV2A 4KI5F 1E1QD 3S5LG 4FQHB 4MR7B 4MYSA 5A9RA 2OT3B 1R6XA 2D7MA 2JI7A 3LLUA 4QXQA 3V6MA 4PY7B 4JPWH 1YYLL 3G6JE 1WZIA 1CIPA 5KYKA 5LQKA 2AK1H 2PX3A 4NIMA 3RK1A 3RK0A 2XDQA 4GVLA 3P5SA 1DE0A 3JTSB 3DW1X 5F7NC 1Q9OA 3P2KA 4ARUA 4LF4B 1GGFA 2YINC 5KZCB 4JZOB 3ZSSA 4C2AA 5HDOA 4X6CF 1QHNA 1ZD9A 4YR6A 2NY6B 1EVUA 2SECE 3WLOA 4OH2A 1NVWQ 3QFTA 4EG0A 1ZGLP 3OZWA 1QPBA 4PTZA 1NEUA 5EOCL 2ZRKA 1G8MA 4EENA 2PYED 4E5NA 5JY1A 2PN5A 4FU0A 1FC2D 1QI4A 3OLZA 1CE1H 1L6XA 5CA1B 4XW2A 3CUTA 3OKWA 2VZOA 4KQXA 4RQUA 3WIBA 5IC5A 1S9XA 1D9KA 5IM7B 3BDYH 3GXOA 3ESQA 4WI1A 5DD1L 3GA0A 2ZBGA 3HVHA 3IVGA 2IODA 2ONZA 1DQMH 4XOAA 3PWPD 2BK8A 4L27A 3SHWA 4GSUA 3C5ZD 1BVRA 2IHTA 2G8LA 2JC3A 1JQBA 3L07A 4JBLA 1ULBA 3PV6A 1NEZB 1CD1A 3DBSA 1E7WA 2JCCF 4O3MA 3KKNA 3ZLBA 1IL0A 1FGVH 3FY4A 4TWBA 3IMVA 2CKMA 2OV2A 5IB1A 4UE6A 3DV0A 4ZC8A 1CUVA 1P2DA 3G2HA 2ZKLA 4PIBA 4R0LB 5IESL 3ZGNA 1FFCA 4DGSA 4TKZA 1XSEA 5SX4H 2BV3A 3U7WL 4ETNA 3PWLB 3LL4A 3IAAA 3EPKA 1UZ8B 4X6FA 1SG0A 1XO8A 4BWWA 2CDEB 1JVBA 2OZPA 3Q3GE 5I1KH 3MRCB 1BSVA 3KOYA 1PR3A 2AW3A 3GOQA 2DULA 4XUDA 1V3QE 5DN9A 4ZV9A 1DJSA 4EY3A 3QUQA 4DMMA 3KJ6H 3CH5A 1H4VB 2JGIA 3V1UA 1FLVA 4K94H 2DT5A 5DO9A 3BWUC 3OQOA 3NJFA 2PKDA 3C6YA 3LUKA 2O7VA 5K0GA 4Z86A 5JMPA 3RSLA 4JG0L 5KINB 1OT4A 1BFTA 5KYWB 5KYTA 1N5KA 2IAMD 3IXAB 1FFDA 2GEFA 2EBHX 4A1RA 2L4OA 5BMVB 4B80A 2X7JA 3NOIA 1ETB1 1QRTA 2WZ0A 3Q1EA 4G1BA 1G0XA 4DIDA 3KXFB 1HV8A 5BNIA 1M56B 1Q0PA 2ECQA 3BMOB 1YRYE 5I7HA 1VGKA 4RVCA 1XL1A 2DAVA 1FNFA 3A1WA 4DKEL 4US2R 5SWZB 2I3GA 1OFHA 4KFMA 4LRIC 2J09A 1VGVA 1S1MA 2YJQA 3U7YL 1IIBA 4NPAA 3UJAA 2K3TA 5A7GA 1W88A 3GUHA 1AY1H 4RTQA 2J1WA 4IRJC 3ILXA 1YCFA 4DA0A 4HX1B 5IKPA 4ZO6A 5LQBH 3VSAA 3O4RA 3FNQA 4MR7A 4B81A 4IOSD 1A6AA 4F37K 3KYMA 1T0NA 3CVDA 1RPNA 1KJNA 1A4AA 1PGJA 2E86A 1IY8A 4B73A 1CDHA 4HATA 5EBLB 2E49A 4A7GA 1GPDG 4ECEA 4H3SA 2XNDD 4UM5A 4DANA 2J8UB 3N43F 3KVRA 4AYGA 1VLLA 4ZYUA 4X8JB 2YWEA 4UBDD 3MMNA 3DFKA 4DKFL 4OCZA 1HM5A 3IOCA 2QG6A 3BGIA 5EVJA 3QPBA 3TLEA 1FL5B 5D2NC 1ZYUA 1TPXB 2NV6A 4D79A 1HG0A 1Y48E 5TF4A 1Z4KA 4MR8B 1XF3B 2AN4A 2LOEA 1OTHA 3RHWK 5EUKA 3VXRE 2PVPA 4LB8A 3H04A 4JH0A 2DFDA 2HJKB 4E2WA 1J1XL 1I8MA 1LI4A 5LNGA 3H9QA 4PXYA 1A7NL 3EFFA 1MVNA 4XB1A 3DO4A 4WHTA 3QVWA 3FUDA 1RI3A 3WIIL 4R68A 5IF9A 1QH0A 1GL9B 4EY8A 4V1CI 1BZDA 3GLVA 2UUCB 3ZKWA 3QZNA 1IMOA 3G2PA 5F96H 3GJFA 2VG8A 1WF3A 1QFSA 1OW0C 1Z82A 2VA9A 3N59A 2YPVA 1EJ0A 4MQXD 3MRHB 1N5MA 4W1TA 3EJZC 1UXOA 4OK5A 2IPKB 1UM9B 1T5IA 5JI2E 4WKBA 3IRPX 1I8UA 4BCZA 4HTFB 4KLRA 4BE6A 1NH6A 2BD0A 3RWDA 4DB2A 4LSRL 1WFMA 2XXBA 4NZDA 4DSZA 3FT0A 3AGQA 4ZXFA 2Y6SD 1T7VA 4GOSA 1KJ3L 1S9WB 3QMVA 2QMUA 2QSUA 4X90A 1KYWA 1NOKA 4KITB 4NQXA 4FOSA 4OHYA 3PP4H 4K3GA 2PWFA 2OO7A 1AXTH 3B6EA 2QYTA 4I3FA 4NHOA 2P65A 1V8FA 1DCFA 4HT3B 2W43A 4ISVA 1MO3A 3QIVA 4HWBL 3P3YA 4TVKA 4LCIH 2TSAA 1ZJYA 5KVFE 2AV6A 4MA1B 5JAIA 1ZY9A 2C4UA 3IT2A 1QCCA 3D07A 5IMLB 2VDRH 5JLAA 5AVSA 3DKKA 4ZUWB 3T1YB 2ARKA 3CVVA 2OPCA 4MX8A 3SDAA 5EMMA 3OKKB 4MEBA 3PDJA 4HQ6A 3X13A 5T1DL 3IAM6 4KC0A 3ISYA 1Y8RB 5AO9A 4CIVA 5AUOB 2R5FA 3IR5A 3TBBA 3LUJA 4EB6A 2DM2A 3ZTNL 3P11H 5KQPA 3IN0A 1KGSA 4PVCA 2CBMA 3ZLJA 1GTZA 3CVHA 3WGTA 1PNQA 1P2TA 3BP5B 1RC1A 1FFQA 3WA7A 2XG5B 3NHAA 1U5BA 2ZX9A 2R2HB 2DD8H 3HFJA 4ZOLB 3KQYA 1MG2C 1B3RA 3EPHA 1I4FB 4UM9A 3UC0L 3UAGA 2ZWLT 3ZTDC 3RTQA 4NCJA 3EUFA 4FFDA 3N42F 1TENA 4HUVB 3ZKND 1YEEH 3PP3H 1EEYA 4IMLB 1YVPA 2BVUA 5FW6A 4IOFD 1AXEA 3IQIX 4RNRA 3U4EA 2XSKA 3LZNA 1MJ7H 4UUJA 4PJGF 2DQGL 4BAGA 1OW3B 5JLZA 3UGQA 4P57A 4MWCA 3W1VA 3SPXA 3KYOB 2VUKA 1XU4A 2CB9A 3RB5A 3CZFB 4YUEL 1YEIL 3OBIA 2WPGA 1IGTB 1O7DC 4G3YL 2AFHE 5CGZA 3GEDA 3UT6A 1NMBH 2CWWA 2DJ4A 4RX4D 5DBHX 5H9VA 4K9LA 1KOLA 4I0PC 3LHSA 3JVGA 4IG9A 1I80A 1JLRA 4WJLA 5CDUA 3TZVB 5CJJA 4HUXA 4ZICA 4TKVB 4FHCA 4YRLA 4KO5A 4EKDA 1I4EB 4KZPA 4XPZA 4F4UA 1USVA 3N6XA 1PQWA 3FWHA 4QRTA 2WXNA 3VCLB 1RQNA 2CLHB 1ZXLA 1AGCA 1WBZA 3MBXH 1TETH 1FA4A 1ZMBA 4I48B 3N6VA 1E3TA 4EDXA 4ZD3L 3GEPA 3VA6A 1BQEA 4HFWB 1CCWA 1OWOA 2E7ZA 1Z17A 5ITVA 3H42B 4MI9A 1DLFH 4ZOBA 3L3IA 4G2AA 1Y9DA 3BREA 2OP4L 3F12B 5FYLE 4Y6OA 4MCYB 3S7TA 4G37A 3S2EA 3UKJA 2VLRA 3EWNA 3C4QA 3QV1A 5T5NF 3AOEC 1ZH2A 5I1GH 2JGEA 3HDYA 1UXJA 2I9LB 4LBEA 4IIEA 2BMVA 1QYVA 2N3ZA 2I91A 5JW4Q 2RHMA 4KACA 1BVLA 3MCG1 5E03A 1VXOA 3I2CL 3NCCB 2WJ7A 4HSCX 3NZ8B 1V16A 3WS7A 1DTEA 1MQKH 1LW6E 4WINA 1M7XA 3PLNA 2RBKA 2NXZB 4H1LH 1SUWA 4L8WB 1N3YA 2PUQT 1PHPA 4BIKA 3M45A 5BPHA 3ANXA 3L0ZA 1BQLL 3QNFA 3DX1A 1FPTL 4NO3A 3I92A 2QR0B 3FT4A 3PL6C 2X4QB 2G1UA 1IUKA 3D5OF 1DE4A 4N8SA 3RKPA 4UPEA 2Y2YA 1RVFH 5AKRA 4OLXL 2CJWB 4GG6A 5AVWB 5C07E 2WJ3A 4DREA 3QJHA 2GRJA 3E7DA 4UTOA 4UM9D 3MJVA 2AVDA 1DCKA 3SGDH 4NV3A 1MCHA 5CD9A 4R2GC 1XZMA 3OZGA 1DAMA 3V0AC 3IXQA 4J43A 3SVZA 1UBGA 4PGCA 3GN1A 5F8QC 4NSKA 2B1JA 3E7PA 4HT1L 2VJPA 2JHAA 3OC6A 4PJAE 1ZIXA 3VNZA 3BZEA 4Q56A 1MOSA 1Q2UA 1COWD 2ATPB 1E99A 4H13C 4OKVA 4Y2YA 3DX6A 4NECA 2NM0A 1DIHA 1N78A 1T0IA 2XN9A 4DK3A 1ES0A 1PGRB 2CO7B 4NC2B 3I9AA 3U36B 5GS1A 3CIOA 1QHXA 5EXXA 2IIJA 1D8TA 4EDFA 3MZGB 1AZRA 5IQNA 3RWGB 2VDWA 2GJ6A 2O50A 1EQUA 5BN1A 3EXHC 4MJIE 3L8MA 3HKBB 2QT6A 3UK7A 1NGQL 4JO1L 4AZTA 1LKZA 3O3CA 2PR4H 1PWXA 4ZQBA 2QJOA 3NMEA 3MIZA 1IJBA 1ZNWA 2WWGA 4J16A 1T9DA 4MJID 4ENSA 4K81B 2C0PA 1PYOA 2JDID 2VBFA 1HKFA 3A2KA 4O02A 2L8AA 3MUGA 2QTLA 4TZ6A 3RTQC 2UWEF 3V0WL 1NGYB 3QPWA 3DMMB 2Q1YA 4AG4L 1KI7A 2F1JA 5KZMB 4GI5A 3JAWA 5AW3A 3FMFA 1MB9A 3ZW7A 3BB3A 4ZDWA 1P29A 3WYRA 4YDJB 1G2PA 3R4DA 1ZLSH 2UV3A 3DE1X 1Q92A 4TZTA 4JRYB 1JD7A 4HS3A 2YR3A 1AO7E 2BDUA 4FKEA 1EFLA 1IUOA 5CTAA 5DRXB 2FI1A 4KYIB 4Q34A 4PJDE 4ZCLA 3FPHA 1QPZA 2QX8A 1YFJA 1DCEA 3MGOA 4ETMA 2OAGA 3L7JA 3RAPR 3V4PH 3WGIA 4HPOL 3ZSTA 4U3CA 2AJDA 4HIHB 4O58L 4UM8A 2FEMA 4OK6A 3KUUA 3AB7A 3FT2A 3CBJB 4M4SA 1OCRB 2EH7H 4YECA 3NDJA 5EZOL 4EJSA 1X7ZB 2CPUA 3AXIA 4BZPA 4JJZA 4LIQE 3WNNA 3R24A 5BQFA 3HFRA 2OCLA 5G1PA 3LYLA 1CBJA 5KS9F 1L1FA 2IUUA 2APSA 2C9UA 5CB6A 4FQXD 3VSEA 5I45A 2YKLL 5F4BA 4OFKA 1LDMA 2JCSA 3O9WA 4A6YB 3DVLA 1RUMH 3DVGB 2ZYVX 1SYVA 3LC0A 1TMQA 4JP8A 1MW8X 2REOA 4CMAA 1MBZA 1EEHA 4P92A 3NFSH 3IJ7A 3CZFA 5DUPL 5AW7B 4WDIA 1H65A 3BAXA 5J23A 4PREA 3HNVL 2CHEA 3ILEA 2APTA 4CIAA 3HYCA 4OGQC 5EBWA 2LD4A 3FQXB 1W76A 3OVUB 1KPVB 4MVJI 2PW2B 2WHRA 1RKQA 4MP6A 1OAOC 4AQYB 1DQQB 4Y0AA 3K2UH 1VLVA 3AT9A 3BVTA 4U5QA 3RASA 3L3JB 2MYNA 5F3HA 3EFEA 1FNSH 4IRSA 5L45A 3TNNB 5KVQA 3HZYB 4U7MA 3D39D 4OZGA 1JAXA 2CK3A 1SWWA 2WD0A 3SY6A 3KEFA 1Z2CA 4PZ0A 2PXYC 4U2EA 2X70A 1PE0A 3EAGA 5BJTB 3ULUF 3FBGA 4JAMB 3BRWD 3MOSA 4YAQA 5G0SA 3NHMA 2FPMA 3SQOA 1XAGA 1N0WA 1MFVA 4PSRA 4UUAA 4H15A 2NUTB 1RVDA 3RVJA 4WW2A 5FNVB 3A70A 1VACA 2JWHA 1JBKA 2QBYA 2WZBA 5HKKD 2OAEA 1N3BA 1CUGA 2YQ3A 5AOKA 4CDRA 1G9NC 3K70B 2EDNA 4IZ6A 3AY3A 3GJFH 3I12A 2WJGA 4K9EH 1AS6A 2XITA 3MOQA 2R39A 5FM8A 4DRXB 5E7MA 3GFUA 3KYDA 2BTQA 2CFSA 1K4MA 4MNHA 5BPPA 3U6RB 1QLEB 3HN7A 2Z6FA 3LCUA 4LYGA 4QL3A 2ZT9C 4UEJA 3I74A 4C47A 4LL1A 2FFHA 2FW7A 1QQAA 2PVSA 1XFDA 1QRND 4MV4A 3H2ZA 4ILEA 1P61B 2O6DA 1DTSA 2X9NA 5D5QA 3C2AH 4RHCA 1ZAKA 4LJ5A 1DG1G 5JDIA 4MQUA 2ZWNA 2UZ3A 1JCKA 3T4AC 4OJCA 4JKMA 3CZNA 1FX0B 3C5HA 1WWBX 4D3ZA 3RS8A 2VDRB 1IQPA 4Y9RA 5BSTA 5DA4A 4MJLA 3IKTA 3V00A 3D6FA 4CVXA 2IAMC 3NGBC 3QF4B 2VH1A 1J22A 4G1FA 3DC7A 4JG1H 1PZ5B 2FMHA 2CPCA 1YVDA 4BPRA 5C1IA 1M1YE 2QLJA 2F19L 3NJLA 2QU7A 1ID8A 2VL5B 4TQ8A 5JAHA 1R8QA 4RAUB 1RFGE 2BIQA 5BV7L 4JJAA 3HZHA 3CVCA 2E5FA 1PG7X 3O94A 2AKAB 1EP3B 4J7CA 4LGYA 3EZ6A 4X6UA 2GTZA 4P9HL 2Y0BA 2NYZA 1G5HA 1NBZB 2JK5A 4AMVA 4RFOL 3UIZA 4PN7A 3MACH 4IM8A 4XO4A 2FD6H 4GDFA 3NT5A 2IHBA 3RF6A 1QYRA 2XDQB 1SU8A 3FCTB 4HZLB 1WW8A 3K6SA 3LY5A 3SDCA 3I4LA 3KIPA 3DPBA 3VDCA 4OAOA 1PYWB 1U1IA 1CE8B 2F18A 4PLJD 2JK0A 1W0VA 2VJDA 3DOUA 5I28A 1II8A 5ICCA 2QPUA 4G7SB 1YE3A 5F52A 4A39A 1VKNA 1BX2B 2B4AA 3VXOB 4OOFA 1ND0B 5E2TL 1JXQA 5EJ5A 4PLHA 4X0NA 4QUDA 3Q6MA 5EZYF 3NPSC 2MCPH 1PO7A 4IX1A 4RSGA 5B7NA 3BCFA 1BQSA 2CJUL 3NHZA 4FX5A 3U9UA 5ID1A 4KHXL 5LQRA 2M1KA 3WJ2A 3H75A 3BC9A 2FWAA 3AFCA 1LWHA 3CLUC 3MB5A 2E5EA 5ESAB 2EQ5A 1QW9A 1PT6A 1RQ2A 4JL5A 4NYIR 3W9EA 3TQIA 5AW2B 1I2CA 3V9CA 2IADB 1RU3A 1MC5A 3BMCA 5FGBA 5DLLA 1OJ7A 1X5KA 4H35A 3L54A 1U0SY 3DJTA 3D34A 2VLLB 1S9KC 1TYZA 4EF4A 4QECA 4Q4AB 2DYSB 2O2YA 4GP7A 4HWGA 2HVJB 1ZVHA 2XBUA 5D93B 1AUOA 3CM0A 5E1AA 2X4UB 1W4ZA 2D4AA 5LVAA 3FRPB 5BVHA 4M46A 2VQ1B 4QCIA 2V97A 2XN9B 2MYUA 4ADIA 1SXCA 5F5LA 2DLFH 2IVFC 4GAAA 1ED3A 3FUIA 1ZJBA 1K2VN 4DN6A 5AEAA 2C4XA 1V4VA 3GRWL 5GS3A 3DAHA 2W83A 5TQ0A 1OBVA 3NDZE 3IAS6 4F9PA 1G7PA 4ELMF 2E4AA 2HA7A 2X1VA 5K09A 2K3HA 3MU3A 4GMSL 3QXAA 1BEEA 3NUGA 1RPAA 3RZCA 2OP0A 4KROC 1XA3A 1SJHA 3P02A 2VXUL 3ZDXB 3O2DL 4ZO4A 2M2IA 5GZNA 4X7SL 4V2CB 4GI6A 4OHWA 4QRPE 2PCLA 3IXAA 1XSJA 3PFWO 1D6VH 2IH3A 4ZWNA 2VNSA 1OZUA 1V2HE 2EXWD 5BUSA 3JWNG 1P9NA 1H2HA 3C43A 3KLKA 4F20A 1J5OL 1G3IA 3DXAE 3B38A 2G2PA 2A73B 1XTLA 1SNRA 5J56B 3FONA 2JI2A 1ND5A 3CZKA 2ZI4A 2AKEA 3VVLA 4FDWA 1G55A 1VL0A 1DJIA 2H9AA 2GXSA 3KJ4B 1JU4A 1ZGBA 5L7WA 1QP4A 2DQHH 2Q3DA 4DZTA 4IOSA 4OCXH 4NFYA 3EW9A 3TH2T 3TZLA 1AANA 2ZKXA 2JWGA 4PMFA 3NAQA 1P91A 1ZM3A 2VN7A 4N85A 2D7QA 3WIFB 3SPIA 1CDYA 3BJ91 2EJWA 3MJCA 3E2MA 2RAMA 1X7QB 2VP4A 4FQQA 1LEIA 4XN1A 3VAZA 3CDCA 1TZ8A 3CVIH 1YAJA 2YPVH 3FTWA 1A9VA 2CV2A 5FHRA 5HFNA 2ADFL 4R97C 1KG0A 3I6YA 1XEFA 4LNRB 2OJEA 3VI4E 3ZDZF 4Z9XA 4N22A 2GFHA 3L0IB 3LIIA 1AACA 3OECA 2WXFA 3EH4B 4E7OA 5EO9B 4BFCA 4XTCS 1SYVB 1XWWA 1S3KH 3OMNB 1NN1A 1UKZA 4MJ2A 3S37H 4R26H 2Z34A 3ZZNA 5CVCA 4EO7A 1A8HA 3FO2B 4POZC 5GZND 1HQ4B 3BFQG 121PA 4RTPA 3VOBA 1QF9A 1AMNA 1HXMA 1M8FA 5EPEA 4CU2A 2XT0A 3JD0A 2JVJA 3V55A 1XHFA 2NY5H 2PW2A 1JWBB 1XWVA 1SB9A 2Z83A 1QKJA 4U7GA 4RTOA 5B39B 2NTYC 1JA1A 1MABB 3IJPA 4FGKA 2PXAA 1OSEA 1TIUA 1I14A 1JGDA 5C8YA 5KSWB 5BYBA 3VFVB 2UYQA 4LDZA 2DQEL 2ATIA 3SXUB 3SDAC 4G23A 5DYOA 1Z9SA 4P7FA 7MDHA 3LS5L 1X15A 3JR7A 1EVJA 4FEAA 2QAGC 3LB6C 5CZVL 1KTLB 3IIJA 3STTA 4CXMA 3DZHA 4NNYB 3UZEC 1B4JL 4OCNC 2OQRA 1U2DA 4PFJA 1J1PH 3DHYA 4AYTA 2FL5A 2CIKB 4WFED 4TRPH 4YAEA 4PRPE 2QBYB 5FM5M 3W5BA 3ROZA 1OSYA 16PKA 1IVNA 4Y1AB 2CBOA 1U8IA 3I6KB 2H7YA 3UJ9A 1DYZA 3B7UX 5FLYA 1E60A 3CK0L 4CN9A 3Q8FA 4QICA 5JATA 3BH9B 2EF0A 5D8JH 3WHXB 3HB5X 4BK5C 3A6CH 2GPYA 3U4KA 3PRYA 4HBCH 5K8IA 3ZCVA 5MEQA 3HYSA 1S8DB 5J2UB 3FZUC 1DKOA 4OKSA 1AQKL 3PNPA 1K5GA 4UIMB 4A8JC 3OCWA 1XIWD 5K3OA 1MPXA 1NMQA 1X6LA 3LDAA 5DRZA 4Z7WF 3ETEA 4NFHA 4I1UA 5CLQA 1GNQA 3EYVA 5BZWA 5MERA 2CV0A 3MGTB 4OGAC 3DEJA 5DD6A 3U4CA 1MQSA 3PT9A 4GWLA 1ZLVK 2DMRA 3JQBC 1N9ZA 4B95C 4FYRA 2C3OA 2Y9RT 4BM7A 5J1TB 2VDML 3NWBA 4G7YH 3VVMA 4JQIA 5EU3B 1ZEAH 3L5HA 4LF8B 4JFEB 2WIKA 1ZXKA 3I34X 3BGMA 5CILL 2IUTA 5HHME 3ZGOA 9LDTA 1UM4H 3FBTA 3KHQA 5HUQA 2ZB8A 4R4JA 2CGZA 1IBDA 3TINA 5AXAA 3BPCB 3ZY2A 3GDOA 2BFEA 5E8EB 2QUJA 4IY1A 4YFVA 5LP6C 2FKAA 4TSAH 1UXWA 4D9QD 3C60A 4J6RH 1OPXA 3ME0A 3ZE6A 4HX5A 1NVVR 5KOVC 4AV5A 4YFLI 3TBSB 3FTSA 1AKEA 1GOFA 2JLXA 3KEDA 4WGVB 1XZJA 3E4DA 5IROC 1MH9A 2XNAA 1JR6A 4QOFA 3STXA 1NBVH 3M4ZA 3IQDB 1MTZA 3MUEA 4PY8J 4K9PA 4KK6D 4U1HA 4XCNA 4B7AA 5DZPA 3SCMC 2O5ZL 1SVCP 3A4TA 2X40A 1I8LC 3DUFA 5LXTA 4IW3B 3M17A 1CHDA 1DKRA 1XRSB 4X93A 4OF3A 3ARSA 1RZVA 1QYGH 1PIWA 2DB3A 2GCYA 1QFMA 2C7RA 4GKSA 2WHEA 1O0SA 3KJ6L 3FXAA 1QZUA 1XKTA 4HGZA 1MCDA 4CVZA 4HWKA 5ALCH 1WPGA 4KP7A 4L4JA 2AQKA 4NI6A 4LEXL 4H1VA 4MJ6A 4QXPA 1GPOH 4JHXA 3E7JA 2AXJA 5HIJA 4EPVA 4XXWC 3CU5A 3WB2A 3EVBA 4ZAKA 5CFAA 2GHTA 2ZATA 2Q21A 3PFFA 3QZWA 4DV3B 2JV6A 6TAAA 1V45E 2UYGA 4EOGA 3AUJB 1JGDB 4PX9A 3DDGA 4ZUVB 5EWIH 1X8LA 4EG1A 2PWHA 5LQJA 3A32A 4FYJA 2DMGA 4PLWA 5K3BA 2VLJE 1KB5H 1UC8A 2W0SA 4KTDH 5EZSA 1YC2A 1H9BA 2HXAA 1GIGH 4ZMSA 5AW6B 5F2EA 3F49S 4RMUA 4Z7NB 3FYTA 4PLKC 3K74B 2GIMA 5CDTA 1Y9JA 1N0XH 6PFKA 1QR6A 4DVBB 1C5BL 3LPOA 2POQX 1E8XA 3QAZB 1K8XB 1P7PA 1N10A 2AJ8A 2WWYA 1MTOA 3HAEH 1UOPA 3GMOB 4GP5B 4JS0A 1IAIM 4DB4A 4CNIB 4JOQA 4EQZA 3E3QE 2VDLH 4N2CA 1OYYA 1IY2A 2R00A 3H1ZA 1U21A 3UJTH 4IJWA 5JW4M 2APVA 5I0XA 3T2NH 4F7MA 2ZYHA 3TTYA 3H84A 2DLHA 2IP4A 1I31A 5BVPH 3U1SL 3LN4A 2YPLB 3IDIB 4X66B 3EDYA 5I6DA 4HRYA 2A5YB 3MCLL 3ESCA 4GUQA 3GZJA 2INGX 3VJLA 2XXCB 4FFWC 4JB9H 5LIRA 3CRNA 2LFEA 4BJ6A 1UCBL 5HHOB 4WSJA 2E85A 2NZJA 4Q2ZA 3E3AA 3I9FA 3AH8A 4NEGA 1VYTA 1CC1S 3AM1A 2PETA 2OZ4L 4RSYA 2EXXA 3EG9A 1LLQA 4LC0A 3D8MA 5IPFA 2KZBA 4FA6A 2X0FA 5DNWA 4TTRA 4Y1TA 5AAWC 3R7BA 4CM4A 1OXBB 1GNVA 2G71A 4HXYA 3DX7A 4FYWA 1GQSA 3LZ6A 4P46C 2H6UA 4LOIA 5E8NB 4DCOA 2NZUG 2B5WA 2PUHA 3I0NA 4AUEA 3T09A 3CSYB 4JBWA 2HWUA 5EQFA 4LHUA 1C7RA 4JDPA 4QU9A 4XVTH 4HGOA 2NPOA 2WD7B 5TIIA 1Z6XA 2HU2A 5GRUL 2IPTH 3S70A 3GLTA 5I6OA 3IDNB 4KMTL 3BUDA 4XMXA 1RP1A 3QPKA 4AGPA 3LV3A 4AIZA 1GNLA 2CO7A 3L4ZA 3H3JA 3ZOAA 2EVHA 2C4WA 5EWJA 5D7SL 3PUCA 3RWFA 4PQRA 3MBXL 2Q9BA 1R0KA 3IL2A 1L0PA 4X0KB 2KBGA 2IH4A 5EUOB 4Z3OA 3Q7TA 3QHTC 1NBYA 1S7CA 3KGSA 3DTYA 1K8YB 2B83A 4TOYL 4KSCA 1O6SA 4P81A 3WFCL 2DQFB 3IEXA 3VRIA 1UGKA 3GUTA 4BYMA 1GRNA 2O61B 4LK3A 3QUXD 1U0TA 3WHXA 2V6JA 5HHVH 1LK3L 2VDKH 3QU5A 1UUNA 2D2VA 3QFFA 3Q3GA 4F4JA 3NDRA 4NS0A 1N9GA 3JAKB 2QZSA 3E4CA 5KW9H 1OAQL 4EAEA 3KLDA 2GKSA 2GT9A 4MINA 2J3JA 1TTHA 2YJ4A 2IBTA 4C30A 5DYWA 4LSPL 4LBEB 5B1EA 1X6NA 3AR8A 5IJAA 5K45A 2Y5TB 3REOA 2K45A 3SQBA 4HBGA 1G43A 1HDGO 3R8QA 2Y71A 4OJNA 1ZT4B 2RR3A 4PWGA 1WCQA 4WKZB 4PHFA 4O4JF 3A6BL 4GS5A 5BS0B 2ZRPA 2JVUA 2MHCA 4DSYA 2MINB 5A2LH 2GJRA 4HB2A 4LXYA 2V59A 6FABL 1HK6A 4UNQA 5FOWA 2PT9A 1KCKA 4GRDA 1IFXA 1M1XB 5D7HA 3T0AA 2FSIA 1BD2B 4KV9A 4QOKA 3GFGA 3E2HB 3E5NA 5C7XH 2EQBA 5TDOB 1U8IB 3I6KA 4LOUC 2AOUB 4PWFA 4JXJA 2PGIA 1P7BA 3CYFA 5ICMA 4EKGA 3HN6A 1X42A 4O2BB 2FXIA 4PBTA 4JZJA 3DBRB 3OX3A 3GK3A 3NSYA 2XDWA 3GL9A 4G07A 1U8LA 1QAOA 4ND4A 2YC1B 2PUFA 4XH2A 1VSCA 4RLQA 4QDXA 3EIFA 3LHKA 2CNDA 3PHQA 1MCIA 1TSRA 5EU7C 4QYIB 5B7QA 4INAA 4PG5A 3S55A 1NAMB 1U8FO 4RETB 1CI3M 5J9PA 2O57A 4P06A 5C9JA 4PWIA 4QHMB 2B4QA 1G7MA 2WIDA 2OCXA 4H40A 3OZUA 3U7JA 1OANA 1VKHA 3FTGA 3DZGA 4QPZA 1E27B 3GU3A 1F6DA 2Z93A 4B35A 3D2LA 4ZG1A 2NW3A 1JG7A 3E9QA 5LXTB 3RCBA 3VXPB 5F3BB 2NXYC 2MNUA 3AB0B 3AVEA 1UWVA 1Z8NA 1KWGA 1KWKA 4WF7A 1IGIH 2OK0L 2DC1A 2KLHA 5WRFA 2J5XA 2DBVO 1NDQA 3B8EA 3HG1A 1VIVA 3K6JA 3D85A 3VR5A 4WEBL 1S8NA 4M8UA 3KYCA 5FCSH 4RLDA 5FBQB 1YQGA 1O95C 1R64A 1JEJA 2H07A 3CA8A 4OMFG 4QTXA 2WOJA 3EF7A 2IAAC 1J4AA 3QJFA 1X44A 1JUDA 3C45A 5JMWA 2VO8A 1RXLA 1ZLXA 1JDUA 2FUG1 4PFSA 4CM9D 3AP2A 3R3UA 4YPGB 4HD9A 4FX2A 1GYCA 2VUHB 2Q5LA 2CUKA 1D2PA 2Y07L 1T13A 5M34A 4YDVA 3PNWB 2OORC 3HKBA 5LOVB 3TAUA 3WLKX 2HOQA 1XDWA 5TGTA 3UYPB 1XA0A 2CNLA 3F62A 4K23L 3DAPA 2AFIB 4GVPA 1E2LA 5FORA 5F9OH 4P2OB 4WUUB 3MJDA 3ZH9B 2OMKA 3WTWA 1U1GA 3TO2A 4U3XA 4O02B 3QYAA 3JVFC 1OKKD 4GRWE 3DEIA 2ADFA 3WO4B 2C0QA 2XTAA 4N6RA 3IU3A 4PLVA 1J2RA 3A3KA 3RY5A 2E75C 2PZGA 5LP6A 3EF4A 5CG1A 4YDZA 4QHUA 5GGRY 6YASA 1XYYA 3USCS 1NNSA 1J9RA 3Q9PA 4EDWL 4FE3A 4ZAXA 2QZPA 12E8H 3HJNA 2FO4A 4M1GL 2QE6A 2G4CA 4O2EB 1T3HA 1XK6A 1OILA 3EIEA 1JKXA 3KGUA 5FYJE 4DA7A 1S3RA 2N3JA 1X7TA 3ZW3A 1XG5A 5GJCA 1SA0A 1ONSA 2J67A 2QP4A 4PLGA 4FQ2L 3HN5A 5B6JA 2VJKA 3LO5A 3W6UA 4M7LH 4Y19A 5HZMA 4BNHA 2EEZA 3DE0X 3DVIA 3D3EA 5LBSH 3GRUA 2RDMA 1M3SA 4DIOA 3PJNA 1SXJA 4CTNA 3QUBA 4MNGE 5I7RA 1JZ8A 1XYGA 5HZHA 2ENQA 3QHZL 2V9PA 4QPPA 4UNRA 1NNLA 3H5OA 5FWXA 4M5YL 4QM6A 4XXWA 1WVGA 1RSYA 2GBGA 1XNJA 4L3FA 3SY8A 1N8ZA 1W87A 3NOQA 4JHBA 3FOMB 3PYCA 5KBMA 3P9RA 3BQUA 1U4SA 4B40A 1LPPA 3IJYB 4P2OD 4WWKD 1P9MA 3NHLA 4YHPA 1JZGA 3NIFE 3QRWA 3RV4A 3FAWA 1PU2A 4IKPA 1ZA6A 3D2AA 1A25A 4KHTL 1PW7A 3P2BA 5ARDA 3PITA 1NBZA 1SRRA 3B3IB 2HEGA 3PF2A 1C1XB 1AKJA 2Y8EA 1E3DA 1RFLA 4B3EA 3U6KA 2I7OA 3UUEA 1DN2A 4YV1A 3VKHA 2ZJOA 2JI1A 4P6VF 1W0JD 1N59B 1N3LA 3PGCA 1WZ2A 3VO8A 1PRYA 3KYMB 1PJZA 3P71T 1JXGA 2VP9A 2W95A 3QEHA 5IBTH 2B14A 4N5EC 1C3OB 4NQTA 3UM9A 3EA0A 4C01A 3ESXA 5HXAA 5LZ8A 4LCCC 4MZ3A 4UQ3B 4ODHH 1MMFB 1YWGO 4Z1MA 5F9DC 5GHWH 2OCBA 4PJ8D 3CUSA 1M7UA 1UMDB 1U3HA 1KR2A 3R8XA 3HY3A 1GAXA 3VG0L 3QJYA 4XBPB 4QLAA 5AK0A 4XJSA 4DRZA 1N5DA 1UWCA 5GZOD 2DHDA 3B9EA 4TWRA 4UFOA 3T9EA 2WJ4A 3HB4X 4JJ7A 3TK1A 3PCYA 4ZMRA 3DA0A 2VC2H 1XGZA 2EAUA 2J1LA 1FTSA 3W90A 2ZSBA 4LJ4A 3QUZA 1BFOA 1JZIA 3MCWA 3LSOA 3TGWA 5HHXH 1DOAA 5T3UA 2OE2A 3KNBB 1K7XB 3KXPA 1SIWA 3I62A 1MXFA 3PL6B 3WGZA 5LXGL 2X44D 3G7NA 4HPHA 1D4AA 4NC1C 6ADHA 1EGHA 5E4YA 1DSFH 3WTVA 3N6RA 4OOEA 4XCEB 3G1TA 1GOHA 4J0KA 1E96A 2AIRA 1ESOA 4LMQI 1UR5A 3OX4A 3Q8LA 4C4KT 4R5HA 5B3JF 5EU6D 1U3HC 1C5KA 3TBYA 1U8MA 1L9OA 3KB6A 3U1SH 4MYTA 3OAWA 4B9GA 1AZLA 1FN4A 2QMYA 5FV4A 3BRCA 3GGCA 1QI3A 2ITEA 5JWRA 4NZZA 5BV7A 2NMVA 4BLWA 5DHYB 1L7OA 2Q6TA 3D6HA 4O8CA 4YP5A 3OP1A 2B1OA 3GSOB 4FLQA 2O8DA 4IGEA 3Q3HA 3VZCA 5ESVB 3KZXA 1D1SA 5K3EA 4GPAA 2CVPA 4ACAA 3N0AA 4NR0A 3INGA 2X4PA 1C16A 2QGNA 3EXJA 1D03A 5IC6A 2I6GA 4HXFB 5I71C 1YL6A 4H16A 1KB3A 3BFOA 3D8HA 1WXDA 4L8SA 4LHWA 1G7QB 1FFOB 3TTXA 3TNMA 3ZMEA 4CSZA 1T0MB 3SKJH 2ORBL 1R24B 1BCRA 2IQ9H 4G5YA 2ABWA 3JQ7A 2F55A 1J21A 4XWOA 4ZT3A 2C5BA 4FNGA 3E61A 3PIQB 4DMRA 1UXKA 3BDBA 3DSFL 2WOYA 1X3SA 4FJ0A 1SHKA 4RAVB 3VNVA 2YN4A 2XECA 5LZ7A 2HV8A 4GKBA 1GN9A 3RJZA 2QMEA 3WDLA 3FN9A 1KXJA 2IV7A 3U62A 4QOGA 2ZOSA 4ZPVB 2ZSVB 1UCBH 2V65A 1WCYA 4IBUA 1Q3KA 4N76A 4W9JC 1MT3A 2RALA 1JQKA 3VZBA 1WAEA 4MKXA 4YCNA 4YZFE 2NTJA 2W9DH 2YK1L 3LDBC 4YJHA 1I1AC 1ST2A 4K6OA 4PVNA 5C0GA 3LD8C 3ZWVA 2OX5B 1SIOA 3OCYA 2WIJA 4X00A 3VSQA 2CWRA 1TJGL 5JS7A 3TL6A 3I05A 1SBZA 2Y7LA 1OU4A 1E4YA 5HVHB 3WXVH 3WRYA 3REVA 5ETUA 1M71A 5F1KC 5D1ZI 1FZJB 3GGSA 2JJMA 4MTLA 2DCUA 1Y8AA 3CTPA 4DUXA 5IBPA 2ZG3A 2VLKD 3I9GH 4HKXA 5I8EB 2I4MA 6LDHA 1BGXT 3WEAA 2IPXA 4S1QH 3RZCB 5JH7A 2LKDA 1W2KT 4MA8L 1CJTC 2R48A 4O2RA 1UJ6A 2OL3B 2PNJA 2QR2A 3MJ7A 2ZF8A 3CZRA 5HTSA 1JDBB 4JA2A 4GYBA 4QXWA 1E3MA 3GDHA 5F6HI 3H5WA 3S98A 2YAEA 4PQGA 1F3JA 1H93A 2I3AA 3Q7PA 5AMXA 4KPHL 3MWFA 3BESR 4YEEA 4U1SA 3ENNA 1HMPA 2Q0QA 1O95A 4BLTA 1MSPA 1R5VA 5CWSA 1P4LB 4YVUA 2YGQA 4QWMA 4AVJA 2Z35A 2DLTA 4ETQA 1AO7A 5LJLA 3KOMA 5BW6B 3MS2A 1VMAA 2NLJA 4IKJA 1WHSA 4HHEA 4JEIA 4LDCA 5JA8B 3VD2A 3VNYA 4AXXA 4PV8A 1YQVL 2WYVA 3OMAB 5DRZB 4IJVA 4R05A 3B1ZA 4AZ0A 3D4LA 2GB4A 4J0HA 4KIFA 3RVTD 4OD0A 1F0LA 5HGJA 3DKHA 4I5GA 4K7PL 3B1WA 5C4MA 4MDYA 3CS3A 2E7LC 3BUYB 3PDOB 3TNMB 1UEIA 1JDJA 5ES3A 5FWAA 5BR4A 3R3WA 5LWHA 3HO6A 1BJRE 3VD9A 1JMZA 3R5FA 2RGDA 3F2LA 1XF3A 2B8JA 2XMQA 1CD9B 5JFGA 1PDKB 1W72B 2JCCE 1QO3B 4W9FC 3P77B 1RHHB 1BECA 5J1SB 4EGQA 1EPFA 4TLBA 1Q2XA 4NE9A 3CUWA 2IAND 1AGFB 3T95A 1J2UA 1XRRA 1B1CA 4M89A 1U04A 4OQYA 4FZJA 4IRUB 3OIYA 2OM2A 2MPAL 4A8JB 2DM3A 5A71A 1UWGH 2RHHA 9CGTA 5B38B 1EDOA 1TYBE 4NDMA 5IQ9B 3AHEA 4PG2C 5FO9B 3OC0A 4B74A 4YAOA 3QCVL 3OR7B 1C7ZA 1BVZA 5IRCD 2WUDA 4BPBA 4X80L 2DTXA 3DKPA 1SD1A 1Q0LA 4FYVA 2QYHA 4XI5D 5AL0A 3GRVA 4BFGA 3IKCA 4N5DA 4NFSA 1YNOA 1HXYA 4AZ3B 1DJZA 1CGWA 5D1XE 1OH6A 3PLAE 1DCLA 5SYAA 1RUPH 1EFVA 5JW4R 4KG7A 1XF2B 1IBGL 2ZE7A 2ZEJA 1M33A 1RM3A 3MTIA 1CFVH 2YC4C 4Q9RL 3QZWB 3HV2A 1J97A 2HK7A 4DLYA 1J1XH 4H6WA 5JIIA 4QOKD 3KR3H 1JEQA 3ARFA 4Q66C 4PRDB 4NRXA 2NYVA 3KJQA 5CP8A 2QRZA 1IB5A 5JIMA 3LXRA 2FY8A 4OGYH 1UKEA 5KSAC 3OC8A 1P31A 3T06B 1HT3A 2FNWA 3EXG1 4X1KB 4C89A 4XSHA 4OL0A 1RXSA 4PR5B 2ZDQA 4LCUB 4M86A 1XXHE 1ECLA 5MEQB 1OPRA 4P4TA 4Z3KA 3IMRA 2F3TA 3W81A 3IP6A 2IPNA 3VISA 1IM9D 4DYHA 2J55A 3ELAT 2L7QA 3GLHA 4I7ZC 2NTSP 4TV8F 1RHKA 2Q2WA 4GECA 3Q9QA 3NGXA 1ZVKA 4UVGA 2EINB 3L4UA 3KJHA 2R7EA 1ST3A 1TK9A 2R7NA 1E4JA 3KQSA 1P9RA 1IAIH 2V6BA 3AY4A 1RRKA 2G83A 2DR2A 3OKNB 3PXJA 1ZNXA 4YRSA 1E1MA 3HRZC 1ICIA 3RURA 5DZNA 4XXCA 2G5PA 2B4RO 4RRPA 3VYWA 3O3EA 5LJYH 1JAYA 4JRYE 1S4MA 2RGWA 2ZWYA 1E3ZA 1BX3A 1T21A 4OQZA 4JYCA 3W8DA 1XGQA 5HJ2A 4RKYA 4IKLA 5I17A 1XZFA 4WU7B 1LDPH 1XE3A 1TMKA 4RFNC 5CHNA 5CXUA 2Z8RA 1OLUB 4OCWH 4XGIA 3VYTB 3RFZB 5CP3H 2WFLA 2PP9A 2HK9A 3W6OA 1Z3RA 3FTEA 3GSVB 5I1DB 3SE3A 5EH1A 3ET4A 7FABL 2B4CH 3UW3A 3I84A 4PRAA 2OGZA 2Z2IA 4LHZA 5GAJA 4OZFB 3O9WB 4A6YA 2VW7A 1P2CB 1KEPA 5KTNA 2I0FA 2JIQA 5CFHA 4JY5L 3RDTC 4O2AF 2APFA 1VBKA 3OWRA 1Y6NR 1OCZB 2GUYA 1EVKA 1KGYE 2GZ2A 4GFTB 3MMXA 1Q83A 1DELA 3VTMA 2GZMA 1ZGCA 3JQ6A 4HUNB 5IXSA 1UWLA 3IAS1 1M6EX 4XXHA 4RIEA 1R66A 1XTSA 1I24A 3Q8WA 2ADIA 4LHXA 4F60A 1IAOB 1AQYA 1N9KA 3QH3A 4ZQKB 3N07A 5B39G 3WBDA 2PW1A 1BQHB 3P4UA 4KRXA 3JV0A 3REWB 3SKYA 3BCRA 1UKTA 1C29B 4N6OA 4R69A 4KBPA 4C56D 3L6UA 4AEHH 4IVPA 1OXVA 3BJRA 2PO6B 4OZGB 1CZLA 3DULA 1MIOB 3TECE 3HE6B 3GCDA 2EP7A 4JC8A 4QOJA 4LGPB 4ETWA 4OFYD 2BSTB 3ZU6A 2WAAA 1SKAA 3KWFA 1J0DA 3HMWH 2IPUG 1N0VC 3H1BA 4A0GA 2L3BA 2PO7A 2NUTA 2OO5C 4M88A 3GRYA 4Z4EA 2AV1A 4Y16A 3L04A 5KBNC 2W65A 1XR8B 2Z1PA 5HI4D 3SDCC 4DV5B 3RHSA 4WUUD 3TW8B 3MWYW 1HSOA 3UMSA 3EO1B 2NVBA 5FNVF 2WXIA 2J08A 1HL9A 2I2WA 1X1CA 2FSSA 3SKVA 1FCJA 3JZDA 2IYFA 1W16A 1OFIA 2XWDA 3LAWA 3QBTA 5B7EA 3VH8G 5DHPA 3BFKA 1LF0A 4QHNB 5F3DA 4B4UA 3TZEA 1E50A 4DN4H 1RZJC 3LZLA 2PKWA 2XMPA 3VC1A 1SZDA 2A6KA 3VFUB 4O08A 4B3CA 1QIJA 2IX3A 4ODXB 1ZT4A 1SWVA 2V37A 4MS1B 1X5MA 4UTNA 3VJ6B 1OP9A 2HLPA 3WGNA 1Z5YD 2IU3A 5I1HH 2I29A 3UTSA 3S9DB 3GFFA 1OB1B 2C61A 3W5AA 3GINA 4L8BB 3NG5A 4NN7B 1DC5A 2O7QA 4YX2L 1YOBA 3V8RA 3SIWA 5JQGB 5CJQH 4GR4A 3PE6A 3EDJA 2QE7A 3H0KA 3H9SD 3KV1A 4EHKA 3CG8A 1T91A 2W91A 2JLSA 4YPOA 1BGXH 3LQFA 2FPXA 1THAA 1I8LA 4FG2A 4UU9B 4MJ3A 3LK7A 2RD2A 4CADA 4JJ5B 3FUJA 1O6ZA 5CUQA 1W4RA 3SQWA 4DIUA 3QKWA 1ZIBA 5FULA 4X4XA 3GT4A 3G5MA 5KQMA 4H7VA 3P4OA 2YD1A 1EFCA 1VIAA 3FJ1A 5TPZA 1IATA 1MC4A 1YHYA 1WCIB 4GMTH 5HGAA 3V4RA 8CGTA 1MQ8A 3ZU8A 1EUDB 3MA9L 4KUHA 4LZPA 4C4YA 2HLAB 2JFZA 2WMNB 3T6VA 2CYCA 3NUKA 2A9QA 5FB8B 2GM9A 1BX2A 1GSKA 3WRXC 1ZK1A 1Y5LA 5B37A 1VMIA 2VZLA 3INUH 1XPRA 2PYEE 3B1XA 4XNMA 3ILDA 1Y81A 3P9NA 4IBZA 4DV4B 2YA0A 2FSDA 1KB5L 2I62A 5M29A 5ANHA 3ORRA 3Q3IA 4K2UL 1UZ6E 3CLRC 4BRZA 2I2DA 5I5JA 4HEPG 4C56E 4HLUC 1ECZA 3FOLA 1P7VA 1E3WB 4P3DA 4BO8A 2PN1A 5I6LA 2GILA 2PKCA 1THCA 3CF2A 1SUFA 2CK2A 3A24A 1FMCA 1H2YA 5ISZA 4YCSA 3N85L 2XZZA 1FZOB 2HVJA 1VKXB 1VEPA 4NAMA 1OC4A 1ZVVA 4LLAA 1S5PA 3NHJA 3ETBJ 5AJHA 2NNRA 5EHNA 4F7CB 2CV1A 1YY9D 4D26A 4OW6A 3A1FA 3H56A 4ESEA 4YXFA 4J4PC 4IYRA 2YD3A 4LXIA 3PDDA 3M6VA 4ZYYA 1HFEL 1M8GA 3H7AA 1RI8A 3EW3B 2V74B 1JLLB 4HZIA 1PL0A 3T0EB 3UG3A 5DK2A 4WEOA 5HDRA 4PRPA 2EX0A 3ITKA 5FA8A 4Z1PA 5CCKL 3K46A 1ZVNA 2NY4D 4PRKA 2I6QA 2Z5VA 4XGKA 5F2OA 1IC1A 1ZSVA 4L9RA 4Q9LA 4OFBA 1I4OA 3QVAA 5IF0A 1P0QA 1SUIA 2R7AA 4E15A 3CIQA 2IOHA 2X4GA 3ZVLA 2YEZA 1O03A 1Y8CA 4R1TA 3K09A 2XCTB 2AEPL 3WY1A 1CJKC 1EVEA 1MJ7L 3CEMA 3S96A 2WVUA 2MSKA 3WRYC 5J9PB 4D46A 4I36A 5FPIA 3DOFA 3JU3A 1WDLA 3PAYA 5I3CA 2XYVA 4A67A 4G42B 1X39A 2I2AA 1P3JA 4OBSA 3VZPA 4HDAA 2R56H 2BP7B 2JGDB 1WZAA 1TPZA 2JD0A 3MQ2A 3IFPB 1TQCB 2Q7OE 4HOXA 4A2EA 1KGWA 3FCSA 1XO1A 2X77A 3O3BB 3O8QA 1OAAA 3D85B 1XEXB 1D9KB 5KBDA 2IMNA 4HS6B 2FJFA 3JYPA 3UK6A 5AOAA 4WFJA 4X9GA 3LUFA 3EADA 3SMVA 3M81A 1L8LA 4UV4H 3CO0S 2ZOWA 2HTKD 2Q76B 3N1QC 2MCPL 5JNWA 1XGQB 2P90A 1YZUA 5E4IA 4QUOA 2HRGA 1J5XA 5F7FA 4KXLA 3V8VA 4I4TB 3QI9A 4G8FB 5D7SH 3DMRA 5IEBA 2XYHA 4G0MA 1CD1B 1KIUB 3JWOH 1IM3A 3HE7C 3MODL 3N70A 1TUPA 4U1JB 4D9NA 2NTEA 4GQ9H 2OBLA 1BC5A 4YTEA 2UXBB 3H4HA 2O23A 1TU3A 5KYGA 2FSPA 5HM6A 2H4ZA 1EUCA 1VKZA 4HWEH 1A82A 4HNVA 2OILA 2IQIA 3GVHA 1WB5A 1KJZA 1SPXA 3M4XA 2W6OA 2EDBA 1QHFA 4O51A 1KEUA 2KH2B 2GK4A 5B30A 3A1SA 5MEOA 5FWYA 1H4TA 3LS2A 4BEBA 2Z92A 4FLMA 4OLUL 4XIYA 2VAAA 2EYQA 2ZSUA 4DGVH 1IARB 1URZA 4BUZA 5FX2A 2CXTA 4N2HA 3L3OC 4DLXA 1P7WA 3PIDA 3VI3A 3OKYA 1OTXA 5JY6A 4R3UC 3AREB 1NF3A 4LA4A 4GDMA 4XB2A 1I3VA 3ECCA 5K05A 3GRCA 4KAQL 4HC1H 1CUYA 3ZE1E 2CRIA 2XGOA 3FCGA 3CPLA 3VGHA 3ZGZA 3A1DA 3RU9A 4Z99A 1XGKA 2R0KL 1ZK5A 3O8DA 4MRNA 1PGNA 5DJYA 1ROWA 2J1YA 3ZE2E 3KM1A 3EH2A 1AXTL 2YKKA 5C18A 4R8LA 1S78C 1KCVH 4CPDA 4OF7A 1XOIA 4MW0A 1X87A 5CN3A 5D6DA 2HV9A 1E9PB 1TMCB 2WFAA 4OREX 2XNSA 3N40F 2QTBA 1QQDB 2C3VB 3P8ZA 2FK7A 2XUWA 1E2NA 3JQAA 1CS6A 1TYAE 4B75A 3L77A 3IVCA 5KBLA 2DWPA 3EF3A 3RZCD 3QF7A 3N6YA 4FABL 1E8WA 1OP3K 2R1XA 2XGMA 3KOOA 4IIHA 4K5PA 1JWAB 4GZLA 5IOPA 2VSOA 1BYOA 4GW4A 4X6CB 2IS2A 5L0QC 5JNYB 2ORVA 4BNDA 4XJVA 4BSJA 4O63O 4IIFA 5J4YA 4C6TB 2PIAA 2R23A 2VJ0A 2HA4A 1PW3A 1M5UA 2LR4A 1NL0L 2IDCA 1E9QA 2FV8A 2Y1ZA 3VFMB 1SK8A 3LPFA 4D92A 4C8XA 3NBQA 3BP6A 4XD7D 1XK7A 5JHAA 2PJZA 1DOZA 5JXED 2WJ5A 4XVOA 4AJ1A 5K0FA 4O33A 3TEZA 3U4GA 3NC1C 3CPSA 5JZBA 5K1JA 4Q12A 1XWFA 1WJGA 3ZY3A 1KLUB 4KTGA 1EVTC 5D2NA 1L4LA 4A23A 3PEYA 1I10A 2FGKA 1T4GA 2XSZD 1EVYA 4BNKA 3PD1A 1FF5A 1KJMB 3TBVB 1TVBA 3RUAA 3VNSA 1T6ZA 3F8WA 3K0SA 2CXSA 3MN8A 2Q7YA 2X9LA 2UY7A 4Z7VB 4X7FC 4JGNA 4DQUA 5U1PA 4NKOB 4F2HA 3RY4A 3R7FA 2E9WA 4C0QC 2Z3VA 2XKBA 3QIWC 2GJZA 4FXKB 3C48A 4N8CL 4QOEA 5HHMB 3OX8A 4WUTA 2OQ2A 4XSVA 3CQPA 4TXJA 3WFEL 1H5NA 1R3LB 2JVKA 3LC2O 4UV7L 4BINA 4P4GA 4WUKL 3ZKNC 2C7PA 2GBVA 3ABLB 3GJYA 1Y07A 4K94L 1C9MA 3WSTA 2R7KA 1BFDA 5IT4A 1DSFL 4UT6A 3P69A 1T4BA 1UK7A 2AJZB 3I8XA 5I6XB 1ENOA 1WFNA 3V6BR 4WY5A 1NC2D 3H19A 4ZEVA 2CJUH 3RUCA 4LDQA 3PQ7A 2PT6A 4CHGA 3NCJH 5A1JA 1SJXA 3GBML 4M6OL 3ATBA 1DO0A 4HV8B 2ECPA 4D0BB 3LC1O 4P5PA 4TXHA 4OXRA 3EUWA 2XWPA 3P2IA 5IFJA 1Y1KE 3APDA 1ODCA 3HJ0A 3SU8A 1P44A 3N2ZB 4KMRA 2RHDA 3SS7X 4MV3A 2FMXA 4KU4A 1F17A 5FUXA 3ON5A 4GL4A 4MA3A 2QRVA 2E4UA 3NCMA 2H06A 4EPWA 2AFVA 2ZE8A 4IQ4A 2P9ZA 3UPDA 1BHJA 1R8JA 1T2VA 1KYAA 3AUUA 1E77A 4PINA 4TVSA 1RQXA 2AJVH 5I0ZA 1GLGA 3JYOA 3E3MA 2HTKC 1P84J 2NZ2A 4JPWL 4CM8A 4NCDA 5EZ5A 3GD5A 4D42A 4DR7B 1S7WA 3FGOA 1GRWA 3WOVA 5KNCD 3N2GB 5D1XB 1MRDL 4L9DA 1HZZA 1HQDA 1TZ2A 2DMBA 4DF3A 5FKAA 2OLDA 2H4HA 4G0ZA 4FXTA 3IRZA 4NZYA 1PEDA 3TGXA 2XTJB 1I1NA 4XNXL 1FYXA 3UWPA 3IDUA 2GJAA 4XPAL 3NIGF 2ZKIA 4YQXL 5IEKB 4PR0A 3IFNH 1I7RB 1T3ZA 4JFHE 2V7UA 2HX9A 1SHTX 3MKKA 4ZFGH 2HSZA 3WUWG 5JHLH 1XMJA 2NY0C 2FUNB 5D7EA 5E8RA 3IT3A 3GX1A 4P3CL 1XELA 5IJKA 5EJFA 1AZWA 1OIWA 4FFOA 1OIOA 3L4BA 1S7GA 3OKDA 3RU2A 3GEHA 3H8JA 2VNCA 3D02A 3EFDH 4I87A 3E82A 2Q50A 3SHTA 1JNLH 1R4MA 3QXTA 2PABA 1URIA 3NHBA 3EVAA 5IDVA 1H0RA 3U3DA 1AS3A 4NCXA 4W9RA 2L17A 3IT8D 1J86A 4RA0C 5CGYD 4KLAA 2A9FA 2YIHA 3RS0A 2P5ED 3M70A 1QTNA 3WK9A 4BXOB 5TK2A 2YNMD 5ED0A 2F7IA 4PJ9B 5K9OB 1AGRA 1FU8A 1VQ1A 3ZGLA 1OHHA 2CRMA 3RJ9A 5MGNA 2PMKA 2Q49A 4QVIA 4Z0BH 2JIXA 1J56A 1R50A 3D5EA 3FROA 3K6OA 1W30A 5CS7A 1OCEA 3RI3A 1TA0A 4J23A 3QO1B 1T3GA 1R47A 4I4TA 3O9WD 2XG4A 3WKNA 2VPWA 4GNKA 5GGSY 1QLHA 5CB4A 3GJEA 4JFQB 3MHTA 1NCDH 2C8KA 4XI9A 2ZS7A 2X89A 4BA8A 2W98A 1O1YA 1X5IA 1U8XX 4CBVA 1EAQA 4ND8B 1X9IA 4MGKR 1WDWB 3BYYA 3INNA 1HOCB 2J4DA 2W81C 4ESKA 2ZRLA 1CNFA 3GARA 5I8WA 1XZ8A 1C1DB 3IVAA 1XMWA 1WLYA 3W7VA 3QWFA 4LPVA 4IYKA 4MGHA 2JKYA 1XH3B 3RWOA 3CFCH 5ENWB 1XFAA 1HXYB 1A3LL 4LY3A 5JLJA 4QT4A 4Y4HA 1P7HL 5D1NA 2XQYK 1L5VA 3B6SA 4KKLD 5CGBA 2VR6A 2WP3T 4G6JH 1E5LA 3RH0A 2LR0A 5KOHA 3HKZA 2LTAA 4Q3BA 4NFDA 3GAMA 2PO6D 1SC6A 1T3SA 4MUHA 1DHKA 2NT0A 3C70A 1CHNA 1XZKA 5TE6L 4CW1A 1E1CA 2G76A 1H2AS 1FVEB 1U9KA 4W1SA 3RX7A 3HAEB 3LNCA 4I9FA 5A9SB 3LBAA 1IBZA 3IQHX 1ONQB 4HIIB 2ZSWA 5I4IA 1XX9C 3TGPA 2NP6A 1TJMA 3HFFA 3DCNA 4Q9IA 1KI4A 3AY0A 1J0ZA 2WUBH 3PAUA 5M5BA 2OSXA 2HT4C 5DGTA 3DONA 2PP8A 1T2NA 4BJLA 1QE3A 4S1VA 1TTPB 1U93B 3BWZA 3MRBB 3HI6A 2E4FA 4DEYA 3U46A 3CX4A 4GO8A 3MLSH 2Q8BL 3PABA 3VHXA 1MEXL 5FYJD 1UM9A 1YC5A 3D6NB 1N5YL 2BFVL 3MJ9L 2QVGA 1NAKH 1S2EA 4CCSA 5D71L 4G97A 3QXWA 3M4YA 3FYUA 3F58L 1RJZA 1S8AA 3HYRA 1ODKA 3C6LD 4LDLB 4LKXB 3RL1B 3UROR 2ZIXB 4YREA 5H80A 1T03H 1XZ0A 2CO1A 3JCZA 2I69A 2V2XB 2IXFA 2QG4A 4TSKA 4UFPA 3A4EA 1PT9A 4D56A 3UTTE 3A7DA 2CCWA 1V05A 3QJUB 3ARBB 5KANG 1BXGB 1I5RA 3A25A 4KDRA 1TI7A 3DETD 3QA9A 3P94A 3RBAA 1BEYL 2F5AH 3U79A 3BA1A 3U0PB 1NUUA 1RWWA 2AJUH 1IC5L 4C5BA 4H20L 2UZ1A 4PJEF 2AEMA 3K71A 4MWBA 4KO2S 3D59A 5JQWA 4F37F 1T5OA 4NI3A 2MCFA 2PYEB 1P2FA 1LK2A 3CKLA 1NXVA 2HNKA 3CMOH 3PA6A 2DEYX 2F6RA 1DKNA 5AUNB 3IAUA 2IXQA 1HKUA 1T8SA 3VU3A 3A26A 2FSVC 3EUUA 4JUFA 1XB8A 4BASA 4OA8A 4DPCX 1A1MB 2B8EA 2J8UA 3MLRL 4OFQA 2WINI 1N2CB 4FWIB 4D8XA 2NTNA 2WG1A 1FRZA 3TP4A 2G17A 5B6IA 2BDNH 3KJFA 4UBMA 3U9TA 3DTXA 3P9MA 1T1YB 4X42A 5I9QB 2I3BA 2QJWA 4PX5A 2WW8A 4IU3B 1BD2E 5DXJA 1M34A 4FNLL 4E4YA 4OGAD 3OURA 4JREB 1JILA 1JLKA 2Q3MA 4N2IA 4PJGA 1JHUA 1TCRA 2YHGA 4X99A 4X44A 3O9WC 3UC9A 3O45A 1HCVA 2Z98A 3STYA 1JJ7A 3PFKA 1C1DA 1QYDA 5G4KA 1BJ8A 1JG9A 5CURA 5C52B 3AP1A 1I75A 1CQWA 2BWQA 4HJJH 2CE7A 2Z30A 5COBA 2I34A 5JSUA 1H15B 5JSZB 4YDKH 4I14A 1AJ7H 2YKGA 1ZSYA 3KWWA 4LZNA 1FOEB 1GUBA 1IHPA 1X9RA 3DARA 3BH7A 5E94B 1JYVA 3IKKA 2VYRE 1LU9A 4RWEA 2G70A 4D0DB 2MSWA 3N7UA 1C08A 1QHIA 1FRGH 1SY6L 4EJSB 4WZ9A 2I55A 2FEJA 4FMDF 3BRDA 3K5PA 5CIPB 5FYLD 4UU8A 4UTRA 2BAGA 1O7VA 4H0NA 5DD0L 2DR0A 3DDOA 4O2EA 1OVZA 2PY6A 3SN6N 3NRFA 4P3NA 1KBOA 2Y1EA 4HUXB 2EKJA 3DOCA 1I1AB 4D6PA 4UBKA 1X4YA 1B2WL 1FVFA 4FINA 3DPIA 3NVMB 4JFSA 3ESMA 2UAGA 4HVTA 3C4VA 3KLAA 1YQEA 1Z2DA 4YGVB 2P2DA 2IYEA 1NDTA 1NQOA 4KH2A 5DD1H 1E7QA 3I73A 5KVAA 4EI5A 2XN1A 4MS1A 3D7MA 3TO5A 5EO0B 3ZY5A 5CN2A 5CAEB 3VWJD 1Z2EA 2HFEB 4LLDB 1UC4B 1LEHA 4FNRA 3DIFA 3N2NA 4ZW8A 3AQXA 1A7OH 3QUGA 1E0AA 4DETA 4Z5RB 5G55A 3VGEA 2Z3ZA 4E33A 5CVTA 1KPRA 1YZNA 5DLDA 1LXCA 1HS6A 4DZ8B 2BOVA 8ADHA 1DDHB 4N68A 2P2CA 2B7DT 4UDTB 2JRLA 2VERN 3G88A 4Y2JA 3EJ6A 1VHDA 2V98A 4WOCA 5KG9A 4YMPA 4CLDA 2QNRA 1NEZA 2UZAA 3O3UN 4CQJA 3F8TA 3U3JA 5BQDA 4XWKA 5D1XC 2AZ4A 1VTKA 4N9WA 4HDRA 3WEOA 4WJ5A 2Z6VA 2PKRA 3JD3A 1KU0A 2E6UX 4LFAB 2C4MA 2BOBB 2XN2A 2P2NA 1YDGA 3KXIA 2CSXA 3ARQA 3ORYA 1B4DA 3G04B 3R3SA 1KORA 4AZ8A 3WQRA 3AG4B 1E2DA 3E58A 4H8WL 2LKCA 3IBOA 1JS4A 4WSGA 4FTWA 1IBBA 3BT2H 3I6LE 4XMUA 2XWJA 3JWOC 5E9NA 1ZONA 3LGXA 1RIHH 5D8JL 1RP9A 2VLJA 5E4EC 3AEXA 3WE6A 3LYHA 3TOXA 3T0XA 4BQ9A 2EIJB 1AS2A 2CO2A 1JFFB 1BH6A 2BMFA 3AUKA 3SSOA 1RYBA 3FUKA 1RLTA 4RYDA 1F3RB 4EPRA 3EH1A 2JTDA 3ABZA 3LBNA 1RYFA 2JIDA 5H81A 4WO4A 1L9NA 2JLCA 3A4VA 4YJZL 2XV2A 4FCWA 4XN7A 3HBMA 5J89A 4TRMA 3JV6A 3W2HA 1GO2A 3CJQA 2W6JD 2CDBA 4JFQA 3CPJB 3E9CA 5ITWA 4MDIA 2VHEA 1AQMA 1AU9A 3BZEB 5J1SC 3BGFB 1NR1A 4IIJA 4P0PB 3W4IA 2JB9A 1M2FA 1O97D 3EZXA 3RQSA 4RIGA 1NUGA 1RCUA 1DAOA 2AMGA 5DURD 5IW3A 1UM4L 1RK1A 4EI5D 2BGIA 4ZI3A 1ZLUH 3SEZA 2IU4A 2FZCA 2VSCA 5KYYB 4LBWA 4C0WA 4MLSA 4OKNA 4L2IA 4OY9A 1KNQA 3FYSA 1FJHA 2HLFD 4NRZA 4ZJPA 2H2PD 3FB8A 3H11B 3D52A 1AC0A 2D73A 4JX8A 1U8KB 1J8VA 3ZZ1A 5F3BA 2NX5D 3GRPA 1W0VB 1Z5VA 3QHAA 5J9FA 1FO0B 1NSNL 3U4HA 3ML9A 5KVMC 2G1PA 3LQZA 1NI5A 2QSVA 3OFKA 1WE5A 4N4YB 3U2JA 5EP3A 3HJEA 1V9LA 1NPYA 3HU1A 4KVFA 3OJLA 2CFIA 4I8IA 5L4FA 4JELA 5A6IA 2ANBA 3A4LA 2B30A 1XHLA 1B0RA 3FI9A 4FTVD 4CU5A 1HEZB 2K2WA 2YWJA 3IP1A 1GADO 4KQJA 3BJIC 4G42A 1USWA 4NC1E 1IZZA 4ZIRA 2RGUA 3AM8A 1EWTA 3NNDA 3MCAA 3F01A 4FZRA 2DWXA 2X9ZA 3OMZA 4MQ7A 3IOYA 5EESA 3VM5A 5JMOC 1A5FL 4FF9A 2I1QA 1CIDA 3L1GA 4PZZA 4DVJA 4DV1B 4K6FA 1Z9PA 3KSUA 2PLTA 2OCAA 3AMKA 5DMXA 4H8VA 3KDAA 4MCAA 1NAIA 1O7DE 1CFMA 1UBRS 3NGBB 4IVRA 3JPYA 3KZOA 3I9GL 2A3TA 1TOXA 1KGCE 5J6HB 3CWQA 3FS9A 1GYQA 4LCYB 5FO8B 3LN5A 3ELQA 3HI1A 3T8YA 3CHOA 3EZLA 1I1YB 1KYOJ 5DS1A 4IGFA 3SJZA 5DI3B 3HO8A 4BO4A 2LGJA 3QC5X 3K0BA 1HEIA 4WZ6A 2P67A 4E68A 1XLVA 4OB6A 3HKDA 3S28A 5HIKA 1ML4A 3T54A 3OQHA 3V6OE 2FPPA