2VDPB

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
total genus 125
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdpB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdpB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdpB03
3N2NA 5E6UA 4GZ8A 3NIFB 5ES4B 1AOXA 1PCXA 1SHUX 5HGJA 2XGGA 4HQFA 3K72A 3T3PB 1SSLA 1MQ9A 1MHPA 1IJKA 5E6RB 1NA5A 2VDLB 1M1UA 3EGXA 2XWJI 2VDOB 3F78A 4G1MB 1PT6A 4MMXB 3EG9B 1T6BY 4JX0A 2VDPB 4G1EB 2VDMB 4NEHB 3BQMB 4HQLA 5BV8A 1BHQ1 4WK4B 1MF7A 1ZONA 3V4PB 1SHTX 2ICAA 3EOBI 1CK4A 2UZYB 3E2MA 3F74A 1TYEB 4BJ3A 4K3JB 1DGQA 2ODPA 1JEQA 3BQNB 2I6SA 5E6SA 1IJBA 1M1XA 4MMYB 1OLZA 3K71A 2NUPA 1L5GB 3GXBA 3Q3GE 4FX5A 3NIGB 3VI4B 3FCSA 3OKYB 4HQOA 2P28A 3PPXA 5KYWA 4JDUA 3K6SA 2VDQB 3T3MB 4NENB 5HDBB 1RRKA 1LFAA 5HJ2A 3EFOB 5KYYA 3ZDXB 3VI3B 4WK0B 4WJKB 2B2XA 3OKWA 2QTVA 1XUOA 1CQPA 1V7PC 3HXOA 5KYNA 2NUTB 3PPVA 1RD4A 3RAGA 1AO3A 3ZE2B 1Q0PA 1U0NA 4C2AA 5KYWB 2XWBF 1IDOA 1M10A 1XDGA 1ATZA 2VC2B 4CN9A 4NENA 1YVPA 1AUQA 1JEQB 5E6SB 4G1MA 1RTKA 1RS0A 1U0OC 3AFCA 4O02A 1YVRA 1SHYB 3ZQKA 4G1EA 5KYXA 3AL9A 3HI6A 2X5NA 4FWWA 1JLMA 1SQ0A 3BN3A 4HQKA 3IJEA 2VDNB 1N3YA 2I6QA 2WW8A 5KYUA 3IJEB 1QC5B 5KYUB 1M2OA 1ZOPA 1YUKA 3EH2A 3TXAA 4WK2B 4MMZA 3AL8B 1JV2A 3EGDA 2IUEA 3AL8A 3OL2B 1M2VA 1MQ8B 3EH1A 2NUTA 2ODQA 4DMUB 4F1JA 4UM9D 5E6UB 1U8CB 2O7NA 3ZDYB 2WINI 1JEYB 1UEXC 4UM9B 3EFOA 5KYYB 4M76B 4HQNA 3NIDB 3IBSA 3QA3E 4C29A 3FCUB 1MQAA 1ZOOA 2I91A 2M32A 1QCYA 1N9ZA 3PPWA 3PPYA 4CN8A 4Z7QB 3FCSB 4PN7A 1BHO1 3TVYA 4WFQA 3TW0A 4IHKA 2VDKB 3ZDZB 4O3TB 3EOAI 1IDN1 3ZE0B 4C2BA 2P26A 3EGXB 1XDDA 4F1KA 3HXQA 3EGDB 1JV2B 1L5GA 4UM8B 3OL2A 1FNSA 1M2VB 1FE8A 5KYXB 3NVQA 4CNBA 2NVOA 3K72B 3ZE1B 1U8CA 4A0QA 1JEYA 3K6SB 4O3UB 5LN1A 4IXDA 1QC5A 1PD0A 1PD1A 2VDRB 3V4VB 1DZIA 1OAKA 5E6RA 4IGIA 1T0PA 2ADFA 4MMZB 1MJNA 3K71B 3M6FA 4XW2A 1M1XB 4MMYA 3EG9A 3TCXB 2NUPB 4MMXA 4Z7OB 4Z7NB 4O02B
chains in the Genus database with same CATH superfamily
1XHEA 3OCVA 1T4BA 3CDYA 3H84A 5F2OA 1SLVA 2HXSA 2HI0A 3GJXC 3ZLJA 5TE6H 2P9BA 2XY4A 2YUVA 5A2AA 5TE4L 2OR3A 1PSKL 1WVMA 1E6KA 4IRSC 2AJXH 4K03A 3W2DH 1LK2A 2IH4A 1AR1C 2OO5A 3A6ZA 1LDEA 4XNMB 4M0LA 2VNCA 4MKZA 3RIYA 5AW8B 5DHUA 3WGGA 3SKXA 4XUEA 3D39D 1M2NA 2WHPB 3WRVA 4E4TA 5ACMA 1X1CA 3ENVA 1OC2A 5KVGE 4KHZA 4OJKA 5CYFA 3G5YA 5A03A 1X0XA 2ZBVA 2D13A 3WTSA 4FQJL 1C0KA 4E6EA 2WBJC 1LYQA 4PNEA 5JR1L 1YEHL 3MLPA 1OGIA 1T2VA 5CHYA 3JWNE 3LKRB 1EWHA 1PR3A 3FGZA 3BMCA 4B17A 4X7MA 4L5JA 1IEHA 3EZYA 3OEWA 3U1PA 4OF8A 1MIML 3PFBA 4L0PB 5I1DA 1KUMA 4UARA 4Z3IA 1UAGA 5G3ZA 1A8JH 4V0ME 4UBDC 3FKJA 5FX2A 3JD3A 3FFCA 1PJTA 4YCCA 1ZHKA 5GGTA 5DJ5A 1GGCH 1M6OA 2XQYA 1ZSNA 4WTOA 1UANA 4J3OF 1EXDA 2GY7B 2JIZA 3U80A 3LNFA 3MGGA 4UHKA 1N18A 3X13B 3W56A 5A2BA 1IZ7A 5TE6L 4GUAA 4Y16B 2EW2A 1X5IA 4MWDA 4GAJH 5ECGA 5TQ2A 2JCXA 3UJNA 1XQ6A 4CXMA 3UZQB 1Z2CA 1ND0A 4KY2A 3FFAA 3M33A 3LKRA 1X1TA 4INPA 3K53A 5ESQA 3QYPA 3HE7A 1FP2A 5DASA 5AW7B 1NSNH 4Z76B 3HN6A 1B6TA 1TDQA 2DECA 3AH8A 1OE3A 4DA8A 5DD5L 2UYLB 1BW9B 1SPXA 2JCBA 5T8IA 4TN1A 2X4PB 5EZ6B 4OHFA 4OCLC 1BVKA 1DCLA 2OLEA 5GS2D 4BCZA 3M6VA 2PRYA 4PJ7E 4JRXD 2AI1A 2ZZMA 1RULL 3MRKB 3B37A 2PR4H 4C43A 4EJ1C 3HJUA 2ZX6A 2I3GA 3LGSA 5BW8A 4DMFA 4MJID 2P9CA 4PQRA 4EFMA 1MIMH 2ARWA 1NAIA 1WD9A 5AOCA 4CGZA 3VW3L 2IH1B 4OGLA 3AS3A 2CKMA 1V7CA 3CVJA 3L3GA 4S12A 2NW2B 4U02A 1P4AA 1O7DE 1C2TA 2QYOA 4AZWA 3PXUA 4HUCA 5SX4H 5HNKA 2P5UA 3FN0H 4D9EA 3NHAA 1H15A 1A7BA 1MDBA 2VWPA 1MQ8B 4BGDA 4J6RH 4JO1L 2WINI 2QYTA 3ZHDA 4TZ0A 1NEPA 5IHPA 3GSRA 1Y7LA 2Y4OA 1PR1A 2PL3A 3W8NA 3SYNA 1PK8A 1U92A 2WHQA 1Q38A 4CMIA 3HWRA 3F7NA 5KOJA 4I14A 5DQDL 3PNWA 4XVSH 1ULHA 4BBJA 1A9EB 3NRFA 5LBIA 4MQBA 5J43A 2P9JA 2QTZA 4U1LA 3LBNA 3L4ZA 3M3HA 5E9WA 4YHNA 3CK0H 5LN1A 2Y07H 2AK4A 1L5VA 1GZ4A 1G1KA 1DBQA 3ZOKA 2A3NA 4BXOB 4LSUL 2ERCA 4LIQL 5D1QB 1ZT1B 3EQ2A 4KXAA 3A14A 2DQJH 3PKZA 4UOJA 2YN3A 3O2JA 3OGCA 4C07A 1PJAA 1SUHA 3HE6C 3Q5YA 4UATA 3LC0A 4GOMD 3CVHL 5FIUA 4TV8B 4K7JA 4L5YA 3QBTB 3MLXL 3NH7L 1A04A 4KQMA 3U46B 5A3QA 3ZWCA 1TT5A 5DC0A 2C8VA 3PBKA 4QGYA 2NX5A 3TU6A 2XN2A 1S3RA 3TIDA 3KQNA 2WWKT 4AIOA 1N1DA 4I9XA 1XE3A 4V02A 5J6GB 2WIBA 3D3NA 3IJ5A 5T3XH 2IZ5A 2RK3A 1KFKB 1FFXA 2XCTB 3COWA 3UAOA 2I24N 4CU8A 4U4AA 4U6YB 3K0BA 1A4AA 4QPJC 4NOFA 1O9BA 3LUGA 1NP6A 3FE2A 1MO5A 4HX2A 3FCUB 5KNBA 5C0DA 1ISSA 3LKSA 1O96A 2DPGA 1EHLL 1YEEH 4O3TB 1BX0A 3OSUA 3V46A 3U46A 1C14A 3DBHB 2X7XA 4JL5A 2VDPL 1R0YA 4HN4B 3PDDA 5ELIA 4IGBC 3OLYA 1EE1A 3GLSA 5BVJA 4DLLA 3NVKI 3U3MA 5SYNA 1G9ML 1VB5A 5JPCA 2PGXA 1C16A 2QRJA 2O19A 3CONA 3A4FA 2P0AA 3ZBQA 3S5JA 4RPCA 3MSPA 2CKDA 4BE9A 2DYSB 5KJ6A 4AUUA 1QHFA 1UBEA 4B9PA 4TXJA 1HYHA 4DJAA 3PP3H 5F9JA 3T0GA 3AMVA 1OP9A 5F2NA 1A8IA 4L16A 4MVYA 3VMFA 4A7VA 1RE1A 2HVBA 1FSSA 1NM9A 1V3UA 4WUKL 4QPZA 1QO7A 5GHWL 2FE0A 3UMMA 1G5QA 2A6JA 4JXJA 3PTLA 2PSEA 1NOIA 4TTJA 4EWLA 1BVNT 4E5MA 4QY8A 5LGKA 4ZC1A 4WUUE 3LUFA 2C9YA 2AEFA 3OTGA 2A78A 3VD1A 4HAFA 4NHCL 1X1QA 5E1IA 4H5SB 1J97A 1G9XA 1NN3A 5LYJA 4UDYX 3D8MA 1VIMA 1SHYB 4CBZA 2ZJAA 2VL7A 4LSDA 5KKNB 1UK9A 1EAMA 3JQ9C 1NT2A 2R69H 1GZQA 3ROLB 1OB2A 4D3YA 5BRZE 1Y82A 2W81C 3KPUA 4JO3L 2IVFC 2Z5LA 1RPUA 2NOYA 2YAMA 4BA8A 4HKBA 2RGNC 3LKOB 4A63A 2OCXA 1KCBA 2I4MA 4OBBA 4XPHL 3QEHA 4B33A 1UIRA 2VPWA 3EGSB 3THOA 1UJ3B 1U2TA 4E2WA 4MVBD 4INOA 4O51B 4IP0A 5A16A 2CVQA 3ORFA 3JWOL 2GZ1A 4V1CI 3LO8A 5JROA 2GT9A 4Y19D 4Y1EA 5AG8A 3ZE0F 2H2HA 2CBMA 3SDAD 4Z7WE 12E8L 1YQDA 1RI8A 5ICZA 5L3SA 4XM2A 1BVLB 2JANA 2ZQYA 3NFNA 3RF6A 1DSFL 4O00A 4DVBA 2NY7H 1W36B 5DEOA 2J4WL 2ETWA 3SNKA 5TGDA 4IBWA 5DFVD 1VXOA 1RW4A 1W85A 1CLYL 5JJCA 4IS6B 4A0RA 1IXYA 2MKWA 2AZTA 4Y6RA 3IT8D 4I50B 2MIZA 4WHMA 3CZCA 1UXHA 2JLUA 3UG6A 2GTIA 1E5TA 2P5WE 4MAYA 1E2MA 3JQRA 4X5WB 3NJ8A 2R7KA 4AVKA 5L45A 2EDEA 1VE6A 4ZTPL 1TJ3A 4JX8A 5JIMA 3S2SA 5TGBB 4BB0A 1I7QB 4EK9A 3BD9A 4O4IA 4BSVA 1LK0A 3VFSB 1LRLA 2GB2A 2CDGB 1WEHA 2ATXA 4N47A 4ONGL 3JSXA 4AJ4A 5JSZB 3EHBC 4LEEA 1VKHA 4NEQA 4LVOB 1QBAA 1QPPA 2G07A 4LZZA 1TUBB 1YPZE 3CX7A 2WB2A 5I6NA 3RYCA 2ZG6A 3WKBA 4ZCQA 1KAMA 4ZTOH 3FTQA 1B9KA 2NYZA 1L5OA 4U9IS 4IBLT 4EDWH 4G0PA 1ZICA 4FRWA 3WFBL 2XCIA 2DWSA 1HRDA 4X8JB 4F4JA 2RGUA 4HOWA 4PZCA 2NY6B 3PC6A 1R5BA 5JJBA 5IARA 3LIIA 3LPCA 3SNHA 1ADQH 2A74B 4OI8A 1HN1A 5F1NB 5AUNB 5JXAH 5CUSH 2PZEA 3FBKA 4Y4FA 3EOAA 4DEVA 4TLLB 2J87A 3GSUB 5L7XH 2WLJA 4G9DA 5A9SA 2FUG1 1QSFB 1FLDA 4ARSA 4J4BA 1S3SA 3OKLB 3N9IA 2I9TA 1JHLH 4UV7L 4WFHD 4N6RA 1EUDA 3OUUA 3C4QA 4ZI5A 4KR3A 3AI2A 3CR8A 2DQHL 1Z6GA 3KPQB 2HMIC 4EUPG 1IQWH 3F2LA 3CURA 1D7DA 3CIQA 1HH9A 2PCFB 2G67A 3FW1A 4P9ML 4N0QA 4L8BB 5E51A 5BZZA 3H8JA 4V1DB 3LL4A 2CL7X 3ONNA 4YJKA 1GTSA 2A9BA 3H9EO 4RSHA 4BX0A 2WKPA 3BDYH 1KFAH 3L6RA 1P2CB 3D85D 3IAQA 2CHFA 4K6OA 2JFNA 3B2XA 5DULA 5I6KA 2BFCB 2HPHA 1FP1D 3E27A 3NDRA 5JJ5A 2Y23A 2Q7DA 1P1ZA 3I04A 1YY8A 1MNUL 4G8GD 1Y9AA 3AI1A 2JGJA 5JHDA 3PT5A 5E2AA 4HVAA 2JK0A 2Y93A 2ZUBA 2XG5A 2GHQA 4ZMVA 1SOXA 4L5CA 1PR0A 3WNIA 4JBGA 2V4MA 4CQJA 4QT5B 4J1TC 3BXNB 3ALXA 3INUH 3QWQB 1U8FO 3L79A 4K9LA 4I0PB 2QT0A 2FPGB 5B4MC 1GS8A 1LNUB 2PX4A 4IBQA 3X1WA 2EHJA 4DSNA 4M02A 2ZOSA 4DERA 5EKXA 2PO6D 2VWEC 2FR8C 3EOTH 4XAWL 3Q2LA 4X4ME 3QYJA 4QEZA 2EFJA 1DADA 4N76A 3LFUA 5JHAA 3NGXA 4TMKA 1UWYA 4U33A 1IFGA 4V0SA 3GCXA 1ZH4A 3BIWA 3ESYA 4DLZA 1KI2A 2XX0A 1S9KC 4OXNA 2JVJA 4DA7A 4NBYB 5EZOL 4WBNA 2JLZA 3ZVVA 2H32A 2VF5X 2BHLA 3FPGA 3P9WB 3ZWMA 1KFAL 4X6FB 5J6HA 1BOYA 1DCEA 2Y4SA 2G0TA 4GBXA 2QX6A 3DBRA 3KQPA 3LD8B 4MXDA 1ZIOA 2PZFA 3S2FA 1ETJA 5KTMA 1DJZA 3V2IA 1HDZA 1SBSL 3A47A 1NPUA 1XB8A 4F4HA 3BKCL 4DTGH 3WLFA 3OBIA 5I7FA 1T35A 5JIPA 4NMMA 2C9BA 3QYAA 2RAFA 3N07A 1IYZA 3C97A 2DQEL 3WDSA 4ZOCA 3PNMA 1KN2H 1R9FA 5D1XE 3UBXI 1OSEA 2DTMH 2DQTL 4DIMA 1FBTA 2GITA 1OV4A 4JO2H 2GQHA 3ZU2A 5KWVA 3TLYA 1QQDA 2AFIE 2VJCA 3X0DA 1QPZA 5FBHA 4G0VA 4ZAYA 2XPGB 2QSCH 2COQA 1FFDA 4EVNA 2P9ZA 4NS4A 3BSHA 3NJHA 4BXOA 3Q6FB 1ZK0A 2ORIA 2FGWH 4IIUA 4L4TD 2P9FA 1ZV9A 1FSGA 4KWCA 5B1CA 1CTMA 5TQ0A 4RMBA 2YGOA 1DELA 4JBLA 1FO0H 3RZCB 1GOGA 4P0DA 1D2MA 4J1NA 4A8PA 3SHTA 3O1HB 3UT0A 1J1PH 4KEAA 5C8YF 4N0FA 2OGWA 3BFPA 2YV4A 4CM4B 1ANUA 2BAGA 1T7WA 1PJ2A 2R2GA 2V7QA 4JKOA 3OCWA 4CQMA 4NBNA 3IMRA 3NIGB 3A9UA 1MFEL 1C3OA 5J11C 2NSMA 2H1XA 2QDXA 2Z65C 4HSAC 4JMXA 2NU7B 2FB9A 5MFZA 1C7JA 2HTKD 3Q3CA 1WUHS 5J5CA 3V55A 1OBCA 3EF3A 4EARA 3RR2A 2J6EA 4JFED 5JHLL 1OZGA 3SCZA 3O4LD 1BNCA 3UBMA 1NH6A 1J0HA 1E4YA 1QFSA 4PPTA 1GZPA 2IHJA 1IM2A 3MAGA 4Y2XA 5FQNA 3VDCA 4NP4L 1WZNA 1MZYA 1RWKA 3IR5A 3U30B 1JV5B 3MOGA 1O6ZA 1Y80A 3PPYA 5DMGC 1GARA 2PLNA 1IBKB 2D73A 4B8ZA 4LPXA 2WTXA 3FYCA 5D7BA 3V95A 4DBZA 2JCWA 3U48A 3ICPA 4QLAA 2IT1A 3VGEA 4I8IA 4U39A 3UWMA 2J4WH 1D3AA 4AKTA 3TOSA 5ICGA 1G4UR 1N2SA 4DK5A 2H11A 3CLWA 2EDAA 3I9LA 3PKJA 1YBFA 1XGYH 3R3YA 1FDLL 4WCFC 4MNGB 3D9AH 1UH4A 4XP1L 4YSSA 4Y16A 4DQUA 1ZLVK 8CGTA 1WWWX 2WZBA 3QEAZ 4P58A 3K6OA 4XNXL 3L5XH 1ONNA 3TKYA 3VNQA 3FNGA 3VXKA 1L6PA 2XA8L 2C7OA 4K9PA 2HWKA 3F97A 4DZ8A 3WSQL 2ZCJA 3QUBA 2ZOUA 4ORGB 1AQLA 3QFJE 1I7TA 1LO3H 1DBML 4FB4A 2G2RB 4CLOA 2YCBA 1KO7A 4M8SA 3DHYA 1T21B 2ZWPA 5FPSA 4B9CA 3WHPA 1NANI 1I8LC 1QTSA 1WOMA 1IIKA 4NSKB 3T3NA 1YNLH 3OIUA 4LLMA 2JEYA 3CZKA 2D5AA 4KZCA 2GZ3A 1BWWA 2C78A 3BXPA 5ANMA 5DO9A 3OAUH 3B82A 4LF4B 3FLEA 3QNYB 4FI7A 3H5TA 1XO8A 2OAP1 2HTEA 2ZB3A 5JW4N 3S35L 3ZTJG 4PJGA 1FW8A 3PQ2A 2PR2A 2F6RA 4G2AA 3IP7A 3D07A 2FYVA 4GKJB 3UTOA 5A7EA 2F7QA 1N70A 3ILQC 5E6UB 1RERA 1REQA 3EIQA 4CV0A 4GJTB 1IJNA 2Z5GA 3MJGX 5K8IA 1C30B 3CY6A 1DSWA 3WL4A 1MPAH 2EJBA 3GTVA 3ZYJA 3RGVB 1NZFA 4UUNA 2AX3A 2I32A 1PW3A 3WKYA 3VSBA 2NN3C 3KCWA 4IQGA 4FHDA 2OGSA 5IB2A 3GJTA 3WK5A 3MMSA 4WNJA 1TVBA 4D3XA 5HDWA 4BFYA 2WDPA 2OXEA 2OT3B 3VD4A 4Y2DC 4CGUB 3Q6MA 1W2GA 5IM4A 1VIVA 4JWKA 3TV3H 1I8AA 4V3BA 1O97C 2X4PA 3VNYA 3P4LA 4K2UH 3AG6A 1QAQA 3P4NA 4B34A 1ZL0A 5CCKL 3F8SA 2PXYA 4E5XG 4GPIB 4ND7A 1P91A 1EEZB 4R1NA 5D1QA 4LOLA 4C3VA 2AFRA 4WDQA 5CD5C 2PS0A 3ZH9B 4TS1A 2C3VB 5EPEA 4WW2A 2CUAA 3KWWA 3D39E 2CIIB 4TSAL 1D7AA 3AT8A 1VCOA 1TR7A 5CEZL 5E5LA 5I1DB 1Z3CA 2AJVH 2YINC 4MJ7A 1CUYA 1KGCD 3TVMC 2NPFA 1FIGH 5D2LE 3RU7A 2FSVC 2YZGA 2DQGH 3OHMB 4I5EA 3KG5A 3LRLA 2V5VA 4OU5A 10MHA 3I6LE 3GXOA 1H6CA 5AK4A 3PDHA 3NYIA 5B1YA 4X71A 4UBMA 3O2WL 2EZ9A 4GBXC 2ENQA 5KW9L 4LU5H 3ST7A 1IH8A 5IVOA 4ZAFA 4D0DB 4PMEA 4IYKA 3HPJB 3FYTA 1H0KA 3WL8A 4HN2A 2YV2A 5JS2A 4EYEA 4URVR 2VT0A 4Q0XL 1AB6A 2HRZA 3B7SA 1Z9PA 3B6IA 4OBEA 3LZCA 3SQRA 4TUKH 1QYGL 1BMDA 3QXHA 4MRAA 3T7IA 1Q1GA 4J0CA 2YMTA 5IDWA 1OKEA 4RFSA 3CRRA 1MRFH 2Y1AA 2EAEA 4XX0B 3QFFA 2Q4EA 3LT2A 2A1WH 5EU4B 4P4NA 1NA5A 2DBVO 1GDHA 4KFSA 1A5BB 5E99H 5EOQH 3A3PA 1T22A 4YR7A 2H4JA 1OPOA 1XX6A 3E3OA 3K81A 3BQNB 3MLUL 2J45A 4RLFA 1I6MA 4KH2A 2ZS7A 2GAZA 5HDBF 3PP8A 4FQLH 3ETBF 1NQBA 2XU9A 3UKDA 3AFNA 5FR1A 3VNBA 5D1XB 1HC1A 2ZWIA 2ZX7A 1XCPA 1NDQA 2X1VA 5ETUB 2WXJA 3ZRFC 1GGMA 3PNBA 2XJ9A 1NC3A 1FG9C 2P43B 2AZUA 1HCFX 2D3LA 2LU3A 2OBFA 4KI0A 1F38A 4XYEA 5B5SA 4Q0XH 5DM4A 1GU0A 3GVPA 4ENPA 3DBXB 4A0GA 4DY4A 1CP2A 1IKNA 3OX8B 3EOBA 4BFKA 1WU7A 5DURD 3NCTA 5JZ7C 1DT3A 4W7SA 4LDRA 4NHOA 3MSCA 2A0KA 3RPIA 3R7LA 2H48A 1S02A 3MWDA 2R0LH 4P38A 3CBKB 1XGTA 3EIOA 3QZLA 1Z0KA 4KVCL 5I6MA 4YJ3B 5J4YA 4RVSA 1KC1A 2JJ1A 2ISCA 4XGKA 5DC9B 4PBDA 2C5DC 5CB8A 1WJ3A 3VDRA 2RIPA 3CN1A 1G9HA 4Q9RH 3V2HA 1EEQA 3HP7A 5JANA 1VFUA 4JQVC 3WUZA 1AA9A 4B7LA 1IVSA 3GELA 4NE7A 5H9WA 5CFHA 1Z16A 4JPWH 1AQYA 4OQZA 2VO5A 2C9PA 4QXVA 2KH2B 1RADA 5ALVA 4ZMAT 1HYSD 1BDIA 3Q2OA 4GY4A 3DUWA 3WNZA 3RBVA 3T52A 1H8LA 4YDRA 2VJQA 5I2IA 2P7TB 4DEPC 3VGGA 4NHEA 3EFHA 4N4YB 3ILYA 2AXPA 3T0VA 4Z7OF 3GSOA 3MFGB 3EGVA 3BJMA 4AIXA 2L2QA 2E1PA 3V1KA 4WPGA 1FL9A 3M2TA 5H37A 1MMFB 4LGVA 3RJTA 4TVPL 3LOPA 3B3QA 3OZWA 4QLBA 1Z73A 1XKLA 3V32A 4M5TA 2ZI5A 3SVLA 1XZCA 3VFRA 2L0XA 3WBDA 4HQRA 4NC9A 3GHHA 1VGEH 1LS6A 4YJHB 4ZT3A 4AMBA 2C4HA 2OZLB 3SAJA 3QULB 4XOCA 3UH1A 3JZMA 1TEZA 4P3XA 1ODUA 4M6MH 1KJVB 1BVZA 1JXQA 2WI8A 5TIIA 2X6MA 3VZQA 5DU7A 3PTAA 1I7ZB 3ZZNA 3R0QA 4GH5A 4NPYA 4BDTA 3F7TA 4LGSB 4P9MH 4KC0A 1FNSH 2JK5A 4XBGA 3BMCB 1A22B 3GIDA 1ZXQA 3T8XA 2IH8A 3CQ9A 3I2KA 4YQYA 2XN9D 2XMSA 4A8HA 2QVYX 2PYFA 1YZFA 4QFBA 3ZKWB 3DQZA 1RZIA 2ZXEB 4GS7C 3JQFC 3NBKA 3NYWA 3RVUC 2K7PA 4J3BA 3M5PA 4ZEMA 1SVSA 3V0FA 2O5CA 2Q7XA 2KQNA 1UC6A 1VPTA 2FYYB 3JZDA 2W2KB 5IBUB 4C22A 3MV9B 5EOCH 4OLYL 4TN5A 2BRRH 4X5RA 2GYYA 1H23A 4HEA1 1SD5A 4M1TA 2C59A 3CH5A 1I1YA 5FT9A 4UXHA 4GRLB 1IRXA 1AD2A 2W9EH 1C81A 1T2EA 3W9YA 3F6RA 2XNJA 3TR6A 2FEXA 3JAWB 1SRQA 4C21A 3HRKA 3W0WD 2AS5M 1RZFH 3K6JA 4RNDB 5EIBC 3NR2A 4P3YA 4QRQA 4ZFOL 1HINL 1RZJH 1M6VA 5IV2A 2XDQA 3QYNA 1OGAD 1JLLB 3UB3A 1T21A 4KFMA 3A05A 1JDBB 2QJOA 1P4JA 1P7ZA 2IHBA 4FMCF 4LYHA 3KLDA 3LS5H 4M9SA 4OAQA 3MNWB 1XEFA 4FNGA 1A6ZB 4KI5F 2XGSA 3FHLA 3VFRB 2R66A 3WY2A 1YHZA 3LS4H 1I9IH 2Y7OA 2NT0A 5HKLA 2KI5A 4R1PA 4UU9B 4ZUWB 1CICA 3E5MA 4C14A 5A4JA 1KN4L 5D2LB 5C53B 1M6OB 5I7WA 3PCYA 4AJLA 5JT1A 3L3BA 2PXYB 5LNEA 4XI9A 2QE7D 5IQLA 2AJBA 1QTPA 3DX6A 5EH1A 1I85C 1TJNA 1GM5A 1MW1A 4F3FB 1MH5A 4J3OC 4PWKA 4WCFB 3MWEB 2L3BA 3FOZA 4U7MA 2ZZKA 5DFAA 1WUJS 4B7ZA 3SOZA 4LJ5A 3ESBA 3OG9A 5EC2A 2LCQA 4FNSA 3ARQA 3DETC 4UZUA 1ZCJA 3DUSA 2Z31D 5G55A 4YO7A 2G8NA 3HDVA 1WA1X 2PP9A 1FMTA 3DBRB 2E6PA 3L13A 5LU9A 4ID3A 1KWKA 1Z9OA 4XGZB 2OTWA 1R46A 4YMLA 4F1SA 3QAZC 5BSGA 2ZSFA 5K7SA 3E1GA 1YXMA 4X4YA 5BJTA 2PIDA 3D2BA 3FQNB 4NJMA 3AY6A 1NNEA 3V97A 4JFDE 2P26A 3VG0L 4EW2A 3I4CA 5F7DB 4K6FA 3CFIC 2GKIA 2O07A 4JKMA 4K7PL 5EERA 3KAAA 4AYGA 1A8ZA 3ADKA 4HLDA 4Q1VA 1BECA 3RYHB 1VA9A 1U2EA 4X8MA 2KMLA 1SHLA 2OFOA 3SHVA 1S2IA 2W11A 3TDNA 2XZDA 4YO0B 4YWGH 5D1ZA 3A37A 4KJWD 4M0UA 1SZCA 3NJFA 4OTXL 3RZCA 3QXJA 2DWEA 1NCOA 1HFWA 1K6XA 2BVQB 4FNUA 4UILH 4DIDA 1X7XA 1YTLA 1KQNA 4AJ1A 3KQMA 3PXAA 1P2CA 3J2PA 3H2HA 1XK7A 3BUTA 5H16A 3D39A 3ZGYA 1BVUA 2FHPA 2EYQA 4S04A 1K3FA 1JDJA 3TB4A 3K8KA 2R8SL 4AKSA 4HKJA 1C7QA 3VFMB 4M62H 5CXQA 1SJ9A 3IKLA 2EVGA 3O2DH 4RFEA 1NXPA 2C88A 1F5WA 2P45B 2VWHA 5HZGA 4PO1A 2R5NA 2ZWOA 1VBFA 4FR0A 3R7DA 4LAJH 3K80A 4E2YA 1XVSA 2WIMA 4R26L 3VXPA 2Z4SA 3GRCA 1YULA 1WQ4A 4RQTA 1EEYA 2P5EE 3KEFA 3D2UD 5CBPA 3KPRE 1EINA 1MW9X 2WQ6A 3WLOA 4E7OA 1EE2A 32C2A 4Q3NA 4GKNA 3C5SB 1UBMS 3K9LA 3QXDA 2J71A 2WG0A 2PWGA 2BBOA 1NN0A 4PJDE 1FFCA 5C4GB 2Q5BA 4JPWL 1N8ZB 2G88A 2Y1FA 3FUKA 2F6AA 4N2MA 1DU4A 3H1ZA 4XWKA 3W38A 4OLFA 4TVPE 4G6FD 1W5EA 3L1GA 2B1IA 4ZT5A 2A67A 4M0KA 3NETA 2JLVA 1G9NH 2W5UA 4ND1A 2ZUCA 3VXPB 3IDFA 2AW2A 2YZKA 5I1CL 2ICCA 3OQRA 2RD0A 3WNQA 1RZKL 3GNLA 5D96C 3P9LA 2CV1A 1DEXA 4JI8B 2CNYA 1GAXA 4JT9A 4ZP1A 4F12A 1KZYA 3ALPA 2OXGA 2WXIA 4P4GA 1V45E 3OT1A 2WT8A 3L3DB 4RPHA 3H0TA 3DVSX 4AF8A 2FG7C 5AKIA 3QY0A 4BO9A 4CSSA 4GAYA 3O4LB 4GYBA 4OXIA 5L8KB 3EUFA 2CUZA 3ZV5A 3CFBA 2B37A 3DWTA 3OD5A 2YEZA 4AGNA 1VHJA 1OGSA 1Q0XH 4ZHQF 3L3DA 1DZ3A 2HAEA 1T4CB 2W92A 4L8YA 1WLYA 1INEH 4APQA 2QUKA 1WO8A 1KVQA 5HKKD 3U79A 2CM5A 2YS7A 4QBFA 4JT8A 3QOXA 4EZJA 4HOMA 3SYMA 1TMQA 1T5SA 4YR6B 1V55B 1NEZB 4ZFZB 3NYQA 1ZO8A 1ST3A 5JATA 1THAA 1U2CA 1BKYA 1S5HA 4HX5A 5T33H 3RIGA 4XNZC 1HNYA 1MHPH 4AYFB 5CR9A 2ZSUA 2PF6A 1W29A 3WGJA 3MWJA 1JK8A 2WYWA 2P7TA 4DPAX 4KO8A 4S1WA 1FMCA 1OX5A 4RX1A 3IPAA 1TT5B 3ENNA 2WLIB 2M98A 3GDOA 3PJLA 4HDKB 1SXJA 4Q24A 1SY6L 3WHKA 3PQ7A 1T1SA 2XUKA 1VEMA 2XN1A 4K3DH 3JWNG 3WNKA 5T67A 5HCUA 3QEOA 1FFXB 5ANMB 3LQ4A 1JUFA 3A2KA 4GUPB 4WY2A 3PIQB 3R75A 2MCPH 1CN4A 2V9TA 3ASOB 1C3OB 1Z9MA 3VXUE 3VFGL 4QEGA 2EW1A 3QPVA 4Z3KA 1FAIL 2WMYA 1YY9C 1BAGA 4YEEA 1KYQA 4F8PA 5AAMC 5TK2A 2EQAA 2C20A 4JFFE 2E5FA 2D8MA 1UP6A 4UTBH 4O3FA 4YUYA 4I66A 1R8SA 2ZWSA 4M7WA 5ACZA 4L0CA 3JPYA 3D1LA 3RTCA 1LO3L 1UBJS 3RILA 1G7JA 5LCXA 1ETA1 4EJ0A 1KBGH 1XJCA 3Q8LA 3VYOA 4I50A 3N0VA 4L29B 3RWEA 5C6PB 4X6DE 1UP4A 3N2KB 1QGDA 4DR4B 1XYVA 3EYVA 3NFRA 3GA0A 1U1DA 3VSDA 3FZNA 3PQFA 3MRTA 4HWNA 4DDKA 5F7LB 1H6BA 1MIEH 2XDQB 3K0HA 3KOYA 4MBRA 3WNJA 3WKCA 1AOHA 2H26A 3CMOH 1E6CA 3CLUC 2RK6A 2PEZA 4RULA 5EJ2A 1FS5A 4Q3AA 1JWBB 3N70A 4HS4A 3GJZA 3B3JA 5A3VA 1RXVA 2VF4X 1Q1NA 1QLWA 1QGUB 4TVBA 5LP6C 2IDCA 1IM9A 4MW7A 1HMPA 3GZQA 2BEUA 2RH4A 4I89A 1EVKA 3H2IA 2EXSA 4BN0A 5KN5A 1BFDA 2HRPL 4WIQA 1RKVA 4HOZA 2IPKB 3AGQA 4TM8A 4AJPA 4DMMA 3SZ6A 1TVHB 3WRYA 4ZCIA 3L5IA 5C0IA 2D06A 3LHPH 4V0KA 5I4IA 4WKZB 1E3WB 1OZAA 5G1NA 3VI3F 2H1OA 2WYZA 1SHSA 3MOBL 3B12A 3OVMA 3WV4A 2DQUL 4AEIH 1BW9A 2UXFA 2PZ8A 2VAAA 5F9OH 1R00A 3VD3A 2O93L 4IJ3B 4Y4KC 3KYKH 1D5ZB 4ZUVA 3BMWA 1PNVA 2FJUB 4FHEA 5A2FA 2HYIC 3V52L 1LEHA 4C4RA 1PZ3A 3UMRA 1ID2A 1O6CA 3I1IA 4DILA 1FHNA 3FCAA 1JA9A 1OPGH 5G0WA 4RY9A 1C3VA 4WENB 3O90A 3FF4A 3SOBL 3SY8A 4QRUA 2ZR9A 2V17L 1V26A 2EYRA 4WI3A 2X7LB 1SD1A 5KTOA 1U9CA 1N4DA 2FNBA 2IKSA 4BQBA 1U3VA 2D3JA 2CIIA 5B1JC 5AAWC 2PLAA 5P8WA 5IDXA 2A0LC 3AUXA 3FPJA 4KWIA 3LPGA 1RI1A 4H7DA 4LSQH 3CF2A 1C12A 3A6OA 5KW9H 1EEZA 2EC9T 2YUXA 2JH3A 5EWMB 1HHKA 4MGHA 4UBNA 5H3CA 3CC8A 3LKZA 1PWYE 4L0QA 3ZEIA 4MITA 2DF3A 1I7LA 2VMDA 2ZOOA 4AAYA 2O3QA 2FH6A 3H55A 1R6AA 4RY0A 5C31A 3LQRA 2N3ZA 3RTGA 1ADQA 2MSKA 3IIJA 1LM8V 2BSSB 4MA1C 5EESA 3RD5A 3EO9L 2A0YA 4URFA 1MCFA 5EFZA 3FQXA 2PO5A 2GMWA 3KLBA 4Y19B 3LCRA 3FNQA 1MN4A 3D18B 3H2PA 4L1KA 2IIQA 3BH9B 4HCGA 2BSBA 2GUWA 5LN4A 1KK2A 1OGAA 1N3NA 5J6GA 3T2OA 3HO6A 1D1QA 1TCVA 4N2HA 3MTIA 1W8DA 2H9GB 5B4TA 3WKML 1BLNA 4A7GF 1EMTL 3T5CA 1NAHA 2UZ1A 1U8NA 5GGTH 3QVVA 5A5GA 1GYUA 3U44B 3S29A 2N59A 1XVAA 4CKBB 3C2SA 1S2MA 4FFBA 1QLFA 2ZI7A 3KLMX 3ISVA 5J13B 4XB2A 5KOHA 4RH0A 1GYPA 4H60A 3QFJD 2VSCA 3I85A 4D74A 1OX6A 1U8JA 1P1CA 5EWIH 1A98A 2O2DA 3WUWA 1JK9B 3UJ6A 1Y6FA 2UY7B 2ZUVA 1JIVA 3SPVB 2IQ9H 2ZG3A 4K3JB 3BVXA 3MRRB 2F3RA 1N10A 2UVPB 2BCJQ 1UVQB 1MFZA 4XE5A 2NR6A 4XN4A 2IY7A 4N2EA 1IB5A 5L8JB 3DV4A 2VP9A 2ZVPX 3CFCH 1TENA 5KI6A 1ISMA 5BT9A 1R8YA 3AFHA 2AL7A 2J7LA 2Y7QB 3SS8A 3DAYA 3IQZA 1N6NA 1GL7A 3IPXA 1YFZA 3RUIA 4BNGA 4PS1A 3T8VA 1NM5C 3KYNB 3F47A 5A02A 2C9UA 4XB6B 2OZEA 2W8BB 4EI5D 4RM2A 1HHIB 2QDVA 1RAFA 3ANMA 3C1OA 2A6IA 3WMSA 4Z4QA 2R1VA 5T41A 4G9BA 1UKVY 3KNBB 2JEZA 2QELA 5DQ9A 1TKCA 4FXKC 1IM5A 4AENA 2H32H 1NJ8A 4HC1A 3R5KA 4HUWA 3VG9B 2CR0A 2VLJE 1WBXA 2EIDA 5I1JL 4G5YA 4W9EC 3IILA 2M1ZA 3H56A 5COBA 4IQ4A 3W3AA 1YQWA 1R24A 2GPJA 2J1XA 5DX0A 1FSFA 4TRMA 4LLQB 1X7SA 2WSSA 3BMXA 2VS1A 1OALA 3APNA 1NZDA 3ESNA 5KSAB 2JLWA 1JD9A 3IS0X 3SDAB 2MJWA 3TONA 1PW7A 4J8PA 3R8QA 4ZAKA 3IC5A 1HNXB 2RHWA 2DWUA 4F9GA 3ERCA 3SXUB 1E65A 1PX8A 1ZSVA 3SYOA 4X1YA 1CF4A 3W39B 1CDJA 2VZEA 4TNWF 2TRHA 2BGNA 3GMOA 3O4VA 2KBEA 3LMKA 3R0IA 3TZEA 1JKXA 5DHVA 4IX9A 3RYMA 4GKAA 1RWXA 2RGYA 4NENB 5C08B 4N0MA 1SYSB 1R9NA 4Q93A 5DYIA 3MELA 4TF4A 1XUOA 4PJHF 2VMJA 5IULC 4WCYH 1J9CT 5K33A 3LXXA 2ZJ3A 3BT7A 5FA3B 3KOZA 1L7DA 2KUTA 3P2BA 5IMSA 1XL0A 4HDOB 3PV6A 1ZEAH 1P0IA 4WNSA 1AKNA 4HJGA 4DAGL 3AY4C 2YXLA 2GY5A 2EDYA 3CUSA 2FPWA 1W85B 4DR3B 2XG4B 4QWMA 2ERXA 5I8CB 1YEIL 2WUDA 4P2QD 4PJ6A 1F4LA 3O6LL 5HGHA 2O0LA 4BYMA 1IEQA 1S78C 2R8BA 1W0YT 1SCBA 3GMOB 1CTNA 2LU4A 4L9DA 1KULA 4NZOA 1EEXB 4R84A 4POAA 2M32A 4UTPA 3ZTJH 2DTML 4NBUA 1RQRA 1EFLA 1Q74A 4A92A 1DOZA 1EB9A 2Z8YM 2ZSJA 4H0FA 1V35A 1SOAA 1UZGA 1E92A 2C82A 4PYJA 3APCA 4MQEB 2A74C 3OZ9L 4XVTL 2CZQA 2I76A 4OAPA 3VXNA 1M0TA 4Y4FD 3V4UH 1TECE 5A0FA 4PJDF 3ZVLA 3H5WA 1A7AA 1IBCA 2YNMA 5AOZA 2E9SA 4IBVA 1EVJA 1X3DA 3VA2C 3CVIL 1BA3A 2MSDB 4JBHA 2GEVA 2J0QA 1W72H 2UZIL 1R5VA 5AW8A 1JIKA 5CVVA 4NNPL 5J4LA 3DHEA 3QC5X 5DRXB 3EGXA 4E42B 3V2UA 1I4FA 4JFVA 3RC8A 5HUQA 4JJHA 1OTSC 1IU1A 4L4VE 3GHEH 1IEBB 4DN3H 1C30A 2E0PA 1EFQA 5AO9A 3NJKA 4RFVA 5JECA 3JWIA 5C0JB 2IALB 2VJ0A 3E6HB 1WNFA 2J4FA 1DOHA 2DQUH 4FMKA 4AEIL 5GRZA 3DCNA 2NY4D 3U4GA 1Z0ZA 1LX7A 4EZIA 3P4OA 3DPBA 3SX2A 1WZLA 4Y2VA 2IFFH 2Y6SD 3GMLB 2C92A 2RG7A 1BQLH 1TPYA 3O94A 1E6JH 3IRCA 1DX9A 4TT3A 2HR1A 4HX1B 1NUSA 3FOMB 4K3VA 3QRBA 3OJ2C 3WL7A 1RYHA 1YKGA 4WI6A 3Q2VA 4OZIA 2QT9A 2ONCA 3WIHA 4WV1C 4RHTA 2VN6A 3PUUA 5GOZA 1AHHA 3PA6A 3EOTL 1Y9EA 1KGWA 3C6BA 2WBKA 3IXLA 3BDAA 1XALA 4PJAE 4Z4IA 1AYRA 2PCFA 4P92A 2JFHA 5IV2B 4MS6A 3QMWA 3WS7A 1U1CA 1BFVL 4UAOC 1N8NA 4NHUA 2MMGA 3DW1X 4Z7VA 2VN4A 2VTFA 1TQSA 2QVFB 1QHYA 4GGPA 1OF2A 3O3BA 3OVUB 5I6OA 1E7SA 3F65A 3GD1C 4GIOA 3DTNA 3KJQA 2DY0A 5E8EB 3HV2A 3PYXA 2NVBA 4NZYA 4JCCA 3WEAA 2PWEA 1OFUA 3EA5A 2YCLA 3ILPB 2HA5A 4I5GA 5IJXA 2C4KA 1CXIA 4NRDA 3VI3E 1DNPA 2K8MA 2C2WA 5JS6A 2DKMA 3TLGA 2IF0A 1P5JA 3VFDA 4N5MA 1EGHA 1E2GA 1IC6A 2ZSWA 3U17A 3RTQC 4C88A 1CC1S 1I01A 1U0OC 2YXWA 3I84A 2FRDA 1NL0H 4AP6A 4BNTA 3DI3B 2JCCA 5JCOC 4NQDB 4A6YB 1RRCA 1KI6B 2FQYA 4JO4H 5EU3A 3MWYW 3VVLA 3L7LA 4WV3A 2CT8A 3EH1A 2XD9A 5E5UB 2F61A 2EKBA 1R6XA 4G36A 4GOXA 2JK5B 5A71A 3EAQA 3WC4A 4B50A 3WO0A 1YBHA 5G4KA 2RHMA 1WJGA 1BZ7B 1PBTA 4BGLA 4P9NA 4FA6A 4ONOA 5EF0A 4D9HA 3UYKA 2J3SA 3RUFA 3TBYB 4IGBB 5C7XL 3AO0B 4Y5VB 5IQNA 2E27L 3KO8A 5T1DL 1AQKL 5GS3A 1A7KA 3BPCB 4J3FA 3UJTH 1T6VN 2WLHA 1GKUB 2FSPA 2WKLA 1K68A 1XZAA 2FWAA 3OKNA 2Q20A 3IMGA 4JG1H 5F0MB 2O2JA 3RWHB 4CYMA 5I1EH 3NABL 4KQ4H 4KPYA 4PZDA 1I7SB 3UAXA 2D54A 1LI4A 3AKCA 4IIGA 1ZW1A 3W34A 2FPPB 3TQSA 4P5TC 1OP5H 1E2DA 1JPJA 4LV5B 4NN5C 2PBLA 3PLRA 3ULUL 3THMH 3IOMA 2X44D 3CE1A 1DQYA 3GJEA 1PJRA 4R2IA 2BGLA 3C6SB 4U1NA 4OXQA 2RBLA 4G6ML 1HOTA 1T0BA 3O9WA 4JUIA 3I73A 1SYVB 2AEMA 4V0OA 3C3YA 4EN3D 2WY3B 3HS0C 4JDTH 3JARB 3O6MH 4RSMA 3IETB 3E9UA 4MNHB 1UD3A 2PBZA 2JFBA 1L9QA 4G9DB 1PLCA 3PJSA 2R27A 3Q11A 4NNPA 3SO3B 5JDCC 2QDWA 2X5OA 4C4YA 2B4AA 1KELH 2ICEC 3MCKA 4WQMA 5FUCE 3N43B 1HYGA 2QHLA 2PFKA 3PRHA 1I4EB 3FYUB 4QM7A 3TI9A 5J23A 2E3VA 2FRVA 1CUSA 1UB5B 1PLLA 5TB5A 4EZBA 3KNBA 2FEKA 4DIEA 2AJCA 2WFMA 1JV2B 5LOVF 2EILB 4RQAA 1THTA 3ZE1B 5F9WC 1IWBB 3CPEA 4IXDA 4DDMA 5I6XC 4WNAA 2IH5A 4KK5C 1C4KA 2JLBA 1W36C 3BX1A 3S88H 3SBXA 4JO5A 3FYDA 1PJ9A 1EZ4A 3RSFA 5I82A 1BKSB 3DE1X 3MAWA 4AE0A 4B6FA 2B78A 5EEXA 4K81B 4NN7B 4RA0C 1DAMA 1SZNA 2PN5A 4X7EC 1EWQA 4XH2A 1KC5H 4X5WA 2GOYA 2AABL 3IDMB 1KRXA 3LCMA 2NPOA 3MBOA 1H4VB 2QLMA 3H0TB 4U1SB 2PWAA 3SQOH 4L3EA 3VPGA 4NI3A 3NSCA 4OP1A 4TVSa 3E9TA 4XP4L 4E41D 4JG0H 3RVXC 4E30A 2YWJA 4N2DA 1FJXA 3V7WA 4JVSB 4OQ1A 3U49A 3UGJA 3T65A 3KV3O 3L92A 3QR1A 3EGDA 2J1YA 1ACJA 2HU5A 5HVWA 4AEHH 4P4LA 5HFJA 4X6FA 2LNDA 4N82A 1P1KA 5KANG 1S2NA 4GPBA 1RULH 4LCWE 4QHSA 1AFVL 4F06A 3F7QA 4YXFA 1BHO1 2INGX 4KXFB 2YN0A 3L9BA 2YFKA 4IHKA 5JLZB 3EGSA 3PXHA 1P77A 1DJLA 3RTDA 4N8VB 2V7NA 3EGDB 1P2GA 1EFUA 3JWDH 4HKBB 2WVVB 4HWBH 1JXMA 4I6JA 4HFWA 4XCCH 1UPXA 3FUJA 4C0WA 2QQNL 5C09E 3DRQB 4HGWA 4FKEA 3KJNA 3R9WA 1KJMA 3C60C 4HK3J 4Q4AA 4ODUA 2H6OA 1XCQB 5E1BA 1UBSB 7CGTA 2GTWA 1BS2A 2BKXA 2I78A 3FWZA 4LOUC 1WY5A 2XZOA 3LV8A 3FPCA 4RXUA 5H81A 1JEQA 3W1ZA 4FXKA 2GHIA 4P05A 1CIPA 3L8FA 3O73A 4JDUA 3MFFB 3VM7A 3ZHFA 2BKUA 1DAHA 1QRNE 2I4NA 1WBYB 2H1VA 1FX0A 1R18A 4MYPA 1L7IH 1H2XA 3VXUD 4WW2B 3LDGA 1VIWA 4PJHE 2NV6A 4DBLC 1ZT4B 5I0ZA 1FVDB 5BYAA 2BELA 1USQA 1WZ1L 4Z1PA 4DMGA 2OQ2A 5PNTA 5JY1A 2VDWB 5DD1H 4MJXA 1P7WA 3VQ1C 2X42A 3MXWL 5F7DA 2WN3A 2RKOA 1V5IA 1Q1AA 3CBGA 4WZAA 1KG0B 3HVIA 3OU6A 2BNUA 2DHCA 3BWDD 1YZ3A 1E7YA 4JR0A 4OCWL 2FLWA 2YXEA 4TQ9A 3KVPA 2JI6A 1YBVA 1O7VA 4LCUA 2FWRA 1R0RE 2AOXA 3QIWA 4M9QA 5JAMA 2QPLA 1CYXA 3B3BA 3UB2A 1PTJA 3M17B 3OL2A 1I1YB 1PFWA 1RYEA 3FONA 5DVNA 4XBMA 2HJLA 1X77A 5D70L 1MTZA 4OXXA 2R4TA 1KZHA 1YZGA 1JMXA 3TFOA 2J20A 3BGDA 3D3VE 2L7QA 2MSLA 3HG2A 4KQIA 4MWEA 4HNHA 3AITA 3KJHA 2VDNH 5MDHA 4OP2A 1DLJA 1SQ5A 3B9BA 2D00A 3SBWA 2JVKA 4AGPA 4NONA 2BEUB 4NP9A 3VBEA 1DC3A 3QPCA 1I85A 1V9LA 1PBYA 4XVHA 1XZFA 3OPZL 1G87A 1TFUA 2WLSA 1EK5A 1G9NL 3I9KA 1TITA 1W9HA 3GNSA 3QBTA 1O0BA 1PR6A 1BZEA 4Z0BH 3QP3A 5A3ID 2OI9C 1RC0A 4F15C 4PSAA 3DT6A 4ZXBC 3EWAA 2KMWA 1SBYA 3GU3A 1M72A 1XCTB 2RGXA 5CFNA 3ZX1A 3RUHA 1UT2A 1QGZA 4IKOA 5LQAA 2UZ4A 3EH4B 4V1DA 5DCUA 4MS3A 2DWEB 1IATA 3II6X 3H3XA 1YY8B 1VL5A 4I3SL 2OUIA 5I8KL 3MF4A 2F00A 3CC5B 4OT1H 5C9JA 3TEFA 4HC1H 4FS8A 4LSPL 1V5FA 1SUPA 4NOMA 1N0WA 3DB1A 4HJJL 3OKPA 3SSNA 3R06A 1N2ZA 2IZOA 1SBIA 2GN9A 3RG2A 3ARDA 5K39A 2KW5A 5K45A 1K5WA 4RIGA 3DK2A 4O4HA 1SBSH 4UOEA 2YW9A 1JQLB 1X7QB 1U8IB 5CP7A 3RV3A 3UAZA 5HKBA 4OJDH 5EULV 3M49A 1ZEAL 3U3XA 4X4YB 3LC2O 1WG3A 4X20A 1IM8A 1PFQA 4TPRH 4F37F 4DKFL 1BOGA 3QVGA 3QU9A 1UDWA 4TUOB 4G81A 2YAQA 4OF3A 3ID6C 5DM1A 3SVTA 3E23A 1BU5A 3M1LA 1L5GB 1T1ZB 2VYVD 3L7OA 3C5SA 3PD7A 4Q74A 2XLCA 3EQ9A 4L18A 2XKAA 2D3NA 4ZT1A 5J12B 4LVHC 3IVXA 4PGZA 3IMBA 1VBMA 4I1SA 3AM5A 4KQHA 4HUMB 5HJ7A 3GFQA 3VAEA 4APQB 4PVMA 1LV7A 5EIIB 1G7IA 3QG7H 3I2IA 3KGSA 3A4AA 3H2GA 5KJ1A 4MDEA 3ZDDA 5CRIA 1P60A 1XJQA 3VACA 1X14A 5GSRB 1SBCA 5H8WA 2JIDA 2A6KB 2H3XC 1T10A 1MSPA 4HJJH 4BRVA 1ZVJA 3A3YA 3C8UA 3EVBA 3VKFA 4PSCA 3GMSA 2BEVA 1JP7A 2Y0DA 4ALLA 3ROXA 1V47A 3ZR4B 2IH2A 2O0HA 1B4RA 4BFNA 2ZJ1A 2I7CA 3C7CB 3CU7A 3O3DA 2FLMA 1PEAA 1NFFA 2JHPA 3MNZB 2XACC 3AKZA 5HF8A 4NM8H 5J9FA 3WN5B 5D2NE 4R8WL 2XMGA 3CM0A 4KXBA 2OZLA 4DGYL 1QC5A 1PS9A 4ZWNA 4BNDB 4JM2D 3EVAA 3MRGB 2XAAA 1ZDSA 2NQ2C 1XR8B 2CLIB 4NZ8A 1QV6A 3QDGD 2FSHA 4RFNB 5CLJA 3HVHA 5IMBA 4TUYF 3RDPA 4QUAA 1N57A 1A3CA 3BAEL 2QLJA 2Q46A 3ICWA 1UKQA 1OE0A 3MCWA 4ODXA 5MFPA 3ELQA 4RVBA 3KYDA 4GG1A 4PUBH 4H77A 5E9DA 4PGDB 3ZY4A 2WF8A 3ZZTA 3U7QB 2QRLA 3CVHH 5C0AB 1P81A 2AKYA 3P3UA 3VC1A 3NBYC 2VNIA 2JTYA 1G63A 2X8JA 4XVQA 1HXMA 1T2JA 1DXQA 4OBXA 1Z7EA 3N42F 2UAGA 1G6OA 3E7PA 2NQTA 2EYSA 2PY6A 2VDKL 4N87A 2G75B 2PTHA 3G6AB 1ZMRA 4JFXA 2BTQB 1QLJA 3P9IA 3DDSA 1F2XK 3NATA 1S7VA 3IMFA 1F11A 2HYDA 3F98A 3GRFA 3EBHA 3HNVL 4RCYA 2NY1B 3PE6A 1JALA 1VTKA 1R6TA 2CLRA 4JFOB 5ILTH 2G7MC 4A4DA 4MQEA 5DQ9B 1MAKA 2X0UA 4M1EA 2IA5A 3LH5A 4XVRA 3MERA 5C1PA 4HIXL 1NG1A 4AZ0A 4MJLA 4XDGA 1CX9B 4AX3A 2GSDA 3M6LA 3ZHSA 2K45A 4E94A 4KQJA 1H6AA 2CJ3A 4UHJA 4N5UA 1NCTA 4PJXB 5CBEA 4U00A 3EOAI 3SJBA 4R8RA 5EZJA 2Z93B 1F18A 4NU6A 2Y1GA 3NTQA 1U21A 3CLEH 3FFWA 3L1VA 4R2WA 4GKKB 2AEQL 3THYB 2D3VA 3N5CA 1TQUA 1ZAGA 1P2BA 4MLDA 3AREC 4IXNA 1OB5A 4DCMA 4LC9A 2XQIA 3NIWA 3BCFA 2VSOA 4NCKA 3ESMA 2ODBA 1IVYA 3EQ7A 4R97B 1CMOA 4NDZA 1H2HA 4PSDA 3IU4H 4K88A 1RWPA 1DWOA 5DHVB 3ZKMD 5JNTA 3MA9H 2XB6A 5CN2A 5AHXA 1WICA 2O6FA 1T1EA 2VUTA 1Q0HA 5AVRB 4P57A 4BH7B 3BZDA 3D87B 4TWIA 4FADA 4Y7DA 3RL1B 2KHAA 4U7WA 3X1MA 4HTFB 2X9GA 4QR7A 4N26A 2EC8A 3D7SA 2DEYX 3TN0C 3WIUA 5FHBL 1RKRA 4F7EB 5CU7A 2QV7A 4ZEOA 4ZANA 4MYHA 1K4DB 3M82A 4YDVA 3A25A 1SHKA 3T4AB 1UASA 5ICUA 3STLB 2B8EA 1NW8A 4IDNA 2AXWA 3DG9A 1SXQA 3GSUA 5HSFA 3QFTA 3LC7O 2IGLA 3UMFA 1JRHL 1SU4A 3FTCA 4DGIL 2M6KA 3MCG1 3EQ8A 1U8KA 5AKRA 1MOSA 2CKBL 5TXGA 1LPOA 2BNUB 2BM3A 4R41A 1F42A 3OFNA 4TN9A 4R7GA 2VDWA 2DUWA 5IEHA 1XQ9A 2IFFL 2Z1DA 2N0MA 5AVJA 1E4EB 5EC2B 1TYBE 2HQ1A 3G5VB 1MHCB 4LVOA 5A6LA 2HIGA 4KN5A 2BHSA 5AVUB 4MO9A 3QDGB 4BUCA 1A4JB 1BGXL 1L9XA 3VO9A 5IW3A 4KJYB 1Z36A 2Y0PA 3WB0A 1CVLA 5HHOE 4AYBA 4C1BA 3D7KA 3MUY1 2QRGA 5C0BB 3TM4A 3VXRB 4AQ1C 1EFVB 1R3KB 2P6OA 2XVBA 3LUKA 3J7HA 4ML3A 1OOEA 2OMVA 2CLMB 3RB5A 3SXPA 4R6WA 2JZOA 2XFXB 3GJFB 4OMCA 1AGFB 2R23A 2Z35A 3QJUB 4AXWB 4HISA 3GMQB 2FBRA 4LGCA 3ACDA 3EDOA 5SWZD 4IUDS 4OLZH 4OKNA 2NT4A 4G2TA 3ARFD 4QHTA 2PQ6A 2G72A 3I8XA 1H3TA 5AYTA 1BYIA 2ZEJA 1TTUA 1A9EA 1IWPB 4NO0B 5JQ6L 4PS8A 2Y05A 4KJZA 4WLFA 2R1ZA 3B8SA 2PS9A 5GGRB 2ZRGA 4AC4A 2AR0A 4ENSA 1RPJA 3HHMA 4PP1D 3F7VB 1I8KA 5FW6A 4L3CB 3HYTA 2QGCA 3P0JA 1ZSDA 4QDUA 4U7FA 3RKSA 5GONF 3LRSB 2QU8A 2VJPA 4V38A 4LLYA 1CJYA 4MJJA 4PLGA 1RHJA 3LP8A 1MAMH 1CFQA 1CZNA 4YC2C 3IMVA 5C7IO 3G5TA 2BI7A 4YRMA 4HLCA 1VFOA 4KDWA 3P73A 4PCLA 4CCYA 3G04A 1SB8A 1NDHA 3U6BA 4MICA 3KSBC 4YALA 2O8FA 5DVKA 3M5WA 2JBAA 2NU7A 3FN9A 1ZM2A 4BFSA 5AI0A 1X7QA 5CP7B 3FFDB 4R96B 2A86A 4CIBA 1O9GA 1TGVA 4JIMA 4AF6A 2R86A 3EYSH 3MLVL 1J8RA 2Q5OA 4Q9KA 1WLHA 1QNFA 1ZNZA 2VG8A 5JC8A 4AQAB 1WV7T 1ZSDB 4US2R 1RFGE 3QCTH 5HKOA 2XV1A 1JXOA 2NT3A 1Z74A 3P11H 1T5HX 4WVRA 3OF3A 5DEIA 2FR0A 4JY7A 1X5KA 1T89C 2WWWA 2WZPD 2AQ2A 4L3EE 4K0RA 1Z0JA 2OPHA 1OYYA 5JO9A 1OAQH 2CMDA 4U1GB 4GG6E 3O2VH 5EIHA 3QC6X 2G25A 5LBTA 3NABH 1KIPB 5DRWA 2IZZA 3C9NB 4ALNA 3LWZA 2PO6A 1BCSA 4U63A 3L8ZA 4WI7A 3FC8A 2GAFA 2ZAOA 2K70A 3H53A 3KQQA 4EHLA 4KKRA 5AAMA 3WN5C 3PLNA 4CTNA 4GVLA 5D9SB 1SPBS 2A5LA 3ULUH 2XUFA 1EWYA 1W1IA 4B48A 4FXGB 4DIOA 5K5EA 3BP7A 5KVAA 4B7XA 3MZTA 5HDQH 1E69A 3ZDCA 2F0CA 4Z7QE 1MWAH 1V11A 4DMHA 5F3BA 2A33A 4GBMA 3TLAA 1Z56C 5IWLC 1CR9H 1RQLA 4FFVC 5KVSA 3S6CA 4S11A 1MF2L 5KUTA 1L7NA 4R5XA 1T3TA 1JZIA 1D04A 4CRWB 4KKBC 2HFFA 3CJJA 4PXYA 2F1RA 1DEEB 2EFDB 5E2TH 5F6HJ 3LNEA 3AXIA 5HHXH 3I3BA 5EMYA 4IKJA 3TJRA 1XDUA 1Y6MR 3DVLA 2ZP1A 1Z9SA 5T57A 3PXXA 5DO8A 1WSDA 4KQGA 4E41A 1IMJA 2I3ZA 4IOLA 2DQIL 5LZ8A 1ZK9A 3GSNH 3IAS6 1YU9A 1JSXA 5AQ1A 3KKPA 3HB4X 2YOFA 1ZLWK 1WHPA 5E9DB 3MAAC 3MRCB 4JFEB 3RNKA 5ITFA 4ABQA 5EE5B 3PC8C 2I54A 2PQ2A 2Q9OA 4NZTL 2WOOA 2H3EA 4W9CC 1EAYA 1Y4DE 4JG1L 3L2NA 1W0WA 1XR8A 3GZOA 4BKQA 1UKCA 4BY9E 4P8QA 4PRAB 4WTXA 4D9BA 4DZ8B 4ODTH 1KYOJ 5B8CC 4N5IX 4YDKH 1U8CB 1R4MA 1Z5NA 4QJ5A 3W2HA 2ZRPA 4HJ1A 4WAFA 1CZ8L 1YQUA 1SLXA 2Z92A 3WG9A 5DHMC 4N0DA 3D6JA 3F71A 2ZRCA 2BKLA 1FH5H 2IFGA 1IZKA 4QHLA 2LHAA 5DM60 3TR0A 4IMLA 3HKEA 1O6FA 4NKOA 3FUCA 3AUKA 1NAML 3QQ9D 4YMIA 3GLFA 2BVYA 1D5ZA 2K7FA 4KDTC 2JBWA 2IDUA 3T77A 2A58A 4LNAA 2E37A 4F11A 4I5BB 1NEZG 3QEQB 3ZR6A 4XTCS 3RF7A 1TFPA 3RLFA 1NSYA 1HEZA 3FU7B 3BRSA 2GZ2A 7YASA 4ZMPA 5B1JA 2B59A 3I9V1 4EF4A 3DV2A 3FRUA 8ABPA 1SCNE 4OA8A 5FB8B 3JATB 5LB4A 3Q40A 3SPGA 2FX9H 4XXHA 4TV3A 4H13C 3HUJF 4RYLA 2M8XA 2K4WA 1KJIA 3N44B 1RK1B 3U30C 2UV8A 4JHZA 4HDIB 2EYTB 4DSYA 1B6UA 3LEXA 2FPOA 2B59B 4B7AA 1Q15A 3IHWA 5KN5B 4N2AA 4XBPA 3L0IB 2C61A 3VKGA 2XT9A 2WTUA 1BKDR 3M7FB 3OUZA 1N5MA 3ZGVA 1NXVA 1SCUB 5C7OO 3DTDA 1LK5A 4HJTA 3IMWA 4AM0A 3PR3A 3X3HA 1WZEA 5JVDF 4Z49A 2DIAA 3OX2A 3HDQA 1FL5A 1FGVH 1GGYA 4LXTA 4AY6A 2B1JA 1RZKC 1U36A 3RK0A 2EJCA 4D0RA 5A2JH 3WHXB 3RSGA 4MV3A 2BHTA 3U4EA 1SWVA 5HJ3A 4AWJC 4QGTA 1IHOA 4JZJA 3MLWL 4CL3A 4IDDA 4PJCE 5CA1B 4Y7MA 5T7BA 3KZ8A 4DCSA 5GZ1A 1U58B 3EEQA 3WGUB 2GF0A 3WFBH 1R4MB 4KR7A 1BD2E 2RAPA 3VR5D 1P7PA 5CPBA 1QVOA 2X1XR 4AMVA 3SDDC 3EG9B 4XI5C 5F88A 4AS3A 3Q05A 1RZGB 1ZU5A 2RBEA 1IGJA 3HVUA 1JTPA 3ZW8A 5E6IC 4OB5L 4EL5A 3UAWA 2XWTA 2PO7A 3NCCB 4DVRL 5G0TA 4P2YA 2Z3VA 4KOBA 1T5DX 1BVLA 4NJOA 4OZGB 2M6LA 3G6JF 2IYVA 1GTG1 3O4OB 2QLLA 5T1LD 3FYIB 3CRNA 3FQNA 3WE6B 1ORQB 3KPOA 4X66B 1JZ8A 4Y1SA 3JQ6A 2HB0A 4H59A 1K8DA 4UTAH 4MMZA 3TW8B 2OTWB 2R3SA 4GI9A 5LQBH 2GCGA 2EDWA 5E08H 3ZJYA 1B93A 1ZOSA 3JATA 4JOQA 32C2B 2EZTA 4MS1B 2X12A 2B4TO 4IWNA 3GIWA 3ARWA 4QRBA 2ORBH 3HZYA 4DABA 2QMQA 2NY2D 3TNYA 3QUYB 3R4VA 1ESDA 2GUOB 3DYVA 1A95A 4X1KA 1A69A 4QRAA 4PR5B 1VJSA 5TQ0H 1GA2A 1DSFH 3ECAA 1AKMA 3DKHA 1URPA 1FLTX 1DLHA 3GUZA 3WLIA 3X1NA 1K72A 2CG9X 3JUZA 5LOVA 5CPFA 2ZPKH 1GEEA 3I30X 3US0A 2QSZA 3LVEA 1TM1E 4L3EB 4GL2A 4CN4A 5BUPA 1RAIA 1KIFA 2YK1L 3FRIA 4JC4A 4II3A 1HL4A 3ZLUA 4AI7A 4N5HX 4P81A 3GPEA 2AKAB 1RURH 3W7VA 5AALA 3QKTA 2EXYC 4HIPA 3FSAA 3ENKA 2WBJB 1RIUL 3VZCA 3ZL4H 1LBIA 3JY6A 1ELOA 1A6UH 3QQ4A 1B43A 2JD1A 3ARGC 3UV6A 4U3SA 1DE4A 4Z7NE 4OLUH 1A7RH 4MHHG 4S1SH 1NAKL 3HYCA 3LRKA 4YWJA 4BHUA 3WNPA 1UB5A 5DB4A 1Y8AA 3RWGA 3OKLA 4PLJC 2IV3A 1E60A 4OGAC 2B30A 8ADHA 4TNEA 1MENA 2CO4A 5MGNA 4DXHA 2QUIA 3L9WA 3L9YA 1FFYA 3CRZA 2DWDA 3STXA 1XG5A 3O74A 4FEEA 5B36A 1GQOA 4ZVRA 4G5ZH 3K74B 2R4UA 4ZQKA 3L6EA 4P4TA 4BLPA 4UNPA 4MROA 5JSHA 1MW0A 4G8FA 2W9LA 1OJLA 2Z4RA 3UTPE 4ZAKD 2XD4A 4QEKA 1UZMA 3FLAA 2WVGA 3EAFA 1PVVA 1IK4A 2ST1A 4HR7A 4M1CC 1QOZA 3WD5H 1TB4A 1OXTA 4CQMB 3KD4A 2NLOA 2GPAA 3GL9A 4ZT2A 2AYZA 3MT9A 3QHFH 2OTPA 1ET5A 3OE4A 1OA0A 3W0WB 4GEKA 4GS7B 4JY4B 4YI3A 3PFIA 2QVMA 4B6SA 3DZBA 4FGWA 1XA3A 4KROD 2G9UA 3PXLA 4NV1A 1RZFL 4GKZB 1RZJL 3A7DA 3OQPA 5HYSA 6PFKA 4GUQA 4NQVB 3I6BA 4NECA 3ZU3A 4DGIH 1N6PA 1GQQA 1Z08A 4RX4D 1IBGL 3GEGA 3O9WC 3LQFA 4QUKA 3ONVA 4UTOA 4QLOA 2P6UA 1OJ7A 2E75C 3O3EA 1NXQA 1YAIA 5JSFA 4JHUA 4Q7DA 3BDYL 4OI0A 3LIZL 1U63A 5AKHA 5ENZA 1F6AB 1JAZA 5P21A 1TJHL 1TVKB 3ZQKA 5B1HA 1BG9A 4IV0A 4QRRB 3MCAA 5CIQA 1CGTA 1GY1A 3SWWA 3J27A 2FPIA 4DW2L 2IALA 4ALAL 5EU6D 1QSFE 4ZJYA 3CW9A 4BVBA 4UEKA 2VJXA 1W0WB 3G8BA 4CQNA 1RVDA 5EEZA 1OX4B 4TXNA 2VRAA 2P67A 4LLVA 2BY1A 3CUVA 1H9BA 1TJ5A 1T7ZA 3KCNA 3GRWH 3VD0A 4CFZA 2H65A 2C26A 5D72L 3RWCA 4WXPA 4IO0A 4W63A 3RDTD 3WQRA 4YMSA 3GBNL 1WB4A 1XDTT 4MV5A 3ZDZF 4N2FA 3GRVA 2VLKB 2D03L 3MN8A 3KVYA 1JG9A 4RJIA 3ZKNC 1FW6A 1DLFH 3FCXA 1YV9A 3E70C 4XMTA 3MYJA 4NEHB 4OMFG 1YMME 3UBFA 1BRTA 2FETA 4JP1A 3WGMA 2NY2B 4UM8A 3OX3A 2QVXX 2H2DA 1O94D 4JC0A 5CH3A 2CNBA 2LOEA 4DKXA 5L9AA 3EMDA 2CA4A 4AMYA 1WS6A 4JCLA 1J11A 4JYAB 1CSEE 4GPEA 4IRUB 4UAGA 2A3RA 4XO4A 1I6WA 4QYWA 1Z0UA 2MSWA 2OQVA 3HMWH 4LSVL 1INDH 1NF3A 2FDBP 3IJ9A 4F6RA 5EG5A 4YQZA 4TOYL 5HVFB 4ZT4A 1K4KA 3DV9A 3TH4T 3HXKA 2EWMA 4J9VA 4AJIA 4XPHH 5TGBA 2IW3A 1OSPH 4YDJB 4MNQD 1SCKA 1L4MA 2AK4B 3OWOA 4HKTA 1IN5A 2EEBA 1NBCA 1JWMB 4P98A 4G8DA 5FULA 4LU5L 1E2QA 4X0EA 1RXLA 4FYTA 5T6MA 1KIRA 3E6HA 5AKSA 2JWYA 3M6UA 2YNMD 1MHCA 4H4DA 4MHSA 3EXG2 4AN4A 4FMCB 4TS6A 5CZKA 4TQ8A 4RGND 4Z18A 2XNKA 1U1EA 3V0WH 2J7KA 4B9FA 2ZBQA 1I4OA 1ZT7A 4D46A 1L0XA 2P79A 4XN8A 4X44A 4LP5A 4J3WA 2P1YA 2YFOA 2D7NA 3KS0H 1FJ1A 3C3WA 3IJRA 1OB1B 3AJRA 4G1MB 5ADWA 2CSUA 4IGAA 5JD4A 2GABA 1NDMA 5JD6A 2JJYA 3WHLA 5ITZB 2IC2A 4YFDB 3PHGA 1ZISA 1XEUA 5IVKA 2ZBRA 3UTDA 4MRBA 3EGOA 3A0UA 1DS6A 2NTJA 1MLCA 3PPXA 2B6HA 3QZMA 4KK6C 2BZ7A 3WZ2A 3AUFA 1PAUA 1P7QD 2QT6A 1Y4UA 2XYQA 5CDGA 4M5ZL 4YLGA 3PNOA 2GD0A 3UC5A 4Q9QH 5FWNA 1U8EA 1GU1A 1G8HA 1CRWG 2AJSH 1TL7C 2R8ZA 4LZOA 3UMYA 3CLRD 3OR6B 1JDPA 1RPQA 3O1LA 4NS0A 4NRYB 3CIFA 3ZMNA 4N9OB 4HRVA 4W8HA 3NASA 4EDWL 2W2XA 3E15A 1YA4A 2OXFA 1U2YA 1P4IH 4EYGA 3LPMA 3JQ8B 3AHCA 3GPLA 4RNRA 4AV4A 1IIBA 4JN2B 1HLGA 1YGPA 2JI9A 3SYLA 4TQHA 2PV7A 3QUMH 5IDQA 2AZXA 4UIKL 4NQSB 1QWHA 1U5CA 2JIRA 4LXGA 1DO0A 3TB6A 4M3KB 4EIBA 1E98A 1BZ7A 5A5DA 2DF8A 5I71C 2JL1A 1P6XA 2QRVB 3D02A 4LRQA 1JHDA 1DJWA 3D4GA 1H8NA 3JTSA 3K1JA 1KXQE 5HYJD 3ZIAD 2CDNA 2X3FA 1RWQA 5JW5A 5GSRA 5ESAA 3EXHC 3IWVA 2C34A 4QF1B 2MTPA 4HD5A 1Y3CE 4IVNA 4QOJA 4KJQC 3SXUA 2R29H 3UT5B 2NW2A 4YCAA 1Z2OX 3DV6A 2E8YA 4DJTA 1I0IA 2FXVA 3WLRA 4KXWA 4PP2A 4ARAA 5AG9A 3LQZB 3LQ2A 4LRNL 4AN1A 3H8NA 1W96A 4TYUA 2NY3C 1KZ4A 1CFVL 2IIJA 1ZWKA 1COZA 4X63A 3AFCA 5K3DA 2DSNA 3QIVA 3FFTA 3OJOA 1Q9WB 1WXEA 1RFDH 2CK3A 4QRDA 1Z33A 1XQVA 1ZI9A 1YLBB 3WLSA 4IDQA 1CUFA 3QUML 1FZOA 1A5TA 4APXA 1NVTA 1K7EB 1KIAA 2ENSA 3M89A 4UIKH 1H9AA 3VOSA 1WGOA 3KG2A 5AD0B 5K59E 3ETBJ 3N85L 4KNQA 4N0UB 2IPUK 1BAWA 4HHEA 5B7MA 1HX0A 3DDUA 5LZ4A 2V9QA 1N8TA 4QHPA 3C5ZC 4N2NA 3PHLA 3JRWA 2RGAA 3ROOB 5DGRA 3MRIB 5KSUA 4AO6A 2EERA 3O6FD 4K2UL 3C6ZA 5LA6B 5IFAL 2A99A 4I55F 1E6OH 1PS3A 4ZQCB 5AWNL 2WLNA 1TKAA 2ZB8A 4KDVA 2XUDA 4ROSA 3RT7A 2Y67A 3F7OA 1V8ZA 3ZD8A 4XCQA 5JSKA 4CMMB 3C5JA 3P9KA 2HT2C 4HLUC 3Q44A 4XPIB 2MCMA 4IIJB 1ERNA 4QRRE 1II0A 3I61A 4DUPA 4BC1A 3GK3A 4QPDA 5FBVB 3ZE8A 1I3CA 4LIQE 3BVTA 4BECA 1XP5A 1DMRA 3UAJC 3ABZA 5CM9C 1SD2A 3QJGA 4U7KA 3LLMA 4H17A 2FW1A 5EXPA 3QDJA 3HU3A 2GB4A 1K9VF 4L8SA 1RM3A 4KZ0A 4HCRA 1IM9D 2F8TA 4D9QE 1V48A 3WGOA 3SC6A 2WKRA 4L7VA 4MVJD 1GADO 3D3KA 5ALYA 4R1MA 1YZLA 3COVA 1GZPB 4KXYA 4B6JA 1AS6A 3DD5A 2E2WA 3SDBA 1TQ6A 3B56A 1Q0YL 3BRGC 2IEBA 3MG9A 2A74A 2QEJA 3SBQA 5BS0A 3TA3A 5CCBA 1DBPA 1W30A 2XWPA 3ECBA 2P68A 1RPNA 2G80A 4EKJA 1S5IH 4P46D 3IDNB 1FYXA 4XJXA 4Z2YA 3V8BA 2QGEA 4IOKA 3UT6A 3UAVA 3LMJH 3WGKA 4XGIA 1J5IA 2PXXA 4B09A 3JU3A 1GNTA 4FC6A 5F1IB 2QD1A 3D48R 2HB6A 2ZYAA 3RWCB 2E7LC 2F5BH 1MZZA 2VLLB 3O3OB 3VFTB 1EFCA 1L0PA 4F60A 2VDOL 5FYKU 3PG5A 3E84A 1G3QA 2ONJA 3T6VA 1PFGA 1HWGB 4QD3A 4BQNA 5L4NA 2IYNA 5JS1A 3VBCA 2A8YA 5D3MA 4GQPH 3Q10A 1I7TB 5AXBA 3MROA 3VWKA 4HAZA 3ITEA 4Y6SA 3SODB 1KMIY 3ARVA 5FI1B 4DY6A 4MDJA 3O0LA 3RRXA 2JHCA 5C0AE 1X86B 1XZHA 5AVWB 5IIEB 2A6DB 2BCGY 4HBCL 2Q4TA 3LNHA 3T0WA 1TJPB 4CEIA 4AGOA 5DVOA 4TTTS 4FI3C 3PV6B 2XYRA 4LY3A 2RC5A 3LN4A 3WWPA 1R0WA 3C6YA 1MXHA 5JXHA 3GJFK 2Q7NA 3N86A 4BWTA 3PT9A 2IYUA 5CB4F 2OUKA 2WYVA 1G7QA 4MH0R 3RS0A 1TAGA 1S7QB 2NNAA 4KQ3L 2V7GA 2PANA 3SQMA 5CD3A 4OSOA 4L5BA 1FDOA 4FYQA 4MK4A 3GLGB 2CA3A 5EORL 3JWJA 4D3CH 3GLDA 4LXHA 5L3SB 2CKBA 4BFVA 4OFDA 1A50B 2NAFA 3B1XA 4NT6B 4EKEA 3BI9X 3QPXH 3BESR 5E0KB 1CZOA 5IB2B 1E8NA 4PB0H 3ZK0A 4KKLD 1CD8A 5GONA 2XDYA 3BFOA 3OTQA 1XCLA 3NK4A 5A2CA 3W05A 3ARDC 3S2ZA 5J12C 3L7AA 2P5YA 3MTDA 2IIVA 1AZNA 1MAML 2EBWA 2VAPA 4KQCA 2BFDB 1N1EA 1NZJA 4BQEA 3RX8A 4N65A 3RVKA 4RIRB 1P7VA 5BOZG 3KR3H 4WKOA 3ZCTA 3ASVA 2AI2A 1AZZC 3FCTB 4CFSA 4JO2L 3PUWA 4BMNA 1YB7A 1LW7A 1Q0EA 4YHMH 2ZPTX 1H1DA 4AJKA 1C7FA 1TJIH 3GNQA 1MC4A 4OLVH 2GCNA 1DOAA 2JCYA 1QU3A 3X3FL 3VXUA 4X99B 5HHMB 1Y0LB 3B13B 1A64A 3S70A 1AO3A 4LJ9A 5KNCA 1YJCA 4HUNB 2ZJFA 1GYQA 2F1HA 3GWJA 4EUHA 2F64A 3NW9A 5IBPA 4MAYC 4HIIB 2R8SH 2I2AA 1PSDA 4TYQA 3LSOB 1I7RB 2ZTUA 1Z25A 2WB1A 3SJVB 2I80A 4BUJA 4BH8B 2P8SA 3RFUA 1A5ZA 4BE7B 5I8WA 4RPLA 1ZHLB 5HMLA 1U58A 1R3DA 4P2GA 5D5MA 1LLFA 4EVQA 2YN4A 3G79A 3CVVA 3PFQA 3U4EB 5SWSE 3QUYD 4ZX3A 4W9DC 2W42A 4PJIA 4AQZA 4AQEB 4BK5A 5JTUA 1RIVL 1KAHA 3VUEA 4BJ5A 5ILTL 5E9QA 2H5UA 4XLLA 1CRZA 1DVYA 3TO4D 3KBOA 1GL3A 3AIOA 5G1PA 2F1KA 3HN7A 5AD0A 4Z77A 5FECA 3X14A 2BIFA 3EHBB 4FFWC 3VFPA 4XIYA 3OPUA 2XYHA 1QZNA 4FP8H 4BP1A 4YNYB 2DH6A 4CKXA 4GLRH 1O58A 3R8XA 4DESA 4DFHA 5F7HA 5ULLA 4QCIA 4M8QA 2X6RA 4JP5A 3GEPA 3GK8L 1ZK4A 2EX4A 2Q0SA 4OTXH 4PS7A 13PKA 1ZGLM 5IOKA 5IM5A 4RIFA 4JM0A 1M4KA 2RQEA 3SEAA 4ZPTA 5EOVA 4PJ5E 4E5NA 2OYKA 1JFFB 1ZS8A 3MACL 4K5QA 2XKKA 4QQRA 1Q21A 4CDGC 4QUHA 4EBFA 2Q8AL 1NGZB 3IP5A 4NJ9H 5EE1A 4J39A 2PX6A 4PFSA 3BXNA 4N5LA 3F12B 3FJYA 5BRQA 1LDPH 1NJ9B 4JFFD 1RLJA 2OBMA 4JCMA 4LK4A 4UBKA 3E8UH 4KPGA 3QDGA 3VTKA 2Q7OE 3VOBA 4DQOH 3MV9E 2JI8A 5IHWA 1X4XA 3RWDA 1AQIA 4FP8L 3A9VA 5FFOA 5DVMA 2ID8A 3PYMA 3DMPA 4RU1A 1E4WL 2VHUA 4PANA 4PO3X 2FGZA 2X40A 2BSED 1ZYUA 1I1QB 1A14L 2JDIA 4G23A 4WAUA 4LSGA 4PNHA 2Y2YA 2R0QC 1DLHB 1EG7A 2YD2A 5I66A 4N18A 1M7XA 3GXTA 1X2EA 4GQBA 1IFRA 1BQEA 4CM9D 3GIZL 1U3DA 2ZSEA 3S2YA 1NJSA 2ZOTA 2DBLL 4OUUB 4M37A 4QHUA 1CUUA 3AUSA 1AC5A 1UDAA 3HUJE 3QIWC 4NZRH 4WCVA 4I3HA 3GI8H 4A6PA 4DO6A 5L2KA 1QXSA 3HI1B 1DYZA 4L50A 5C3IA 3I6LD 3DLIA 5A3RA 1TVDA 2BBSA 2XVLA 5D3KA 5L88H 4QHUB 4YP6A 1A9OA 4Z54A 2QL7A 4XH9B 4ZT7A 4NJEB 2OMYA 3DIDA 4XZUB 4G7SB 2WUCH 4GIPD 1BD3A 1BYOA 3U6XA 1V5WA 1L7TL 1PU0A 1ACMA 2LZ0A 1UBOS 2IK8A 1DJMA 4KO5A 2JB5H 3PX2A 4F7EA 1Q3HA 4UUPA 2Z57A 3R9XA 1C0IA 4PLOB 3TSOA 4JJGA 4ITUA 1C80A 2VP4A 4F5DA 5IB5A 1WPRA 4TLTA 4X7SH 3VC3A 5J7CC 3KUUA 4YHKL 4UJ5A 2LD4A 3DVGB 3V7AG 4F27A 3Q9NA 2I4TA 4YSDA 5GY7A 5F6IC 4NCNA 4KKCD 3EWSA 5CGBA 1S8NA 1WISA 2CMKA 5D7IE 2QMKA 2Y6TE 4YJHA 1YOVB 1UH5A 3D5QA 5E3JA 2GQ0A 3P40A 3CJRA 4YRCA 4XX1G 4PM1A 1FYVA 3QKIA 3KPJA 2VF2A 3TX2A 4NPJA 1SIUA 2H47C 3MLXH 4BX2A 2VTEA 3I32A 1G5RA 3JWEA 1VHDA 2E55A 4P49A 3FAWA 3OKDA 1QKIA 4M62L 1AQHA 4OI9A 3G9AB 5GJVC 4D0GA 2X1WL 2BY4A 4ZFGH 2GJSA 3OY7A 1MW2A 4MV4A 2ZANA 3OOYA 4MMXC 3HYRA 3QEUA 5T3ZL 2NSYA 2A7BA 2W0FB 1L9NA 2CLKB 2W2KA 2C4WA 1UYWH 4AW4A 3RWJB 1TW3A 5DJCB 4J7XA 1DDOA 3RY4A 3DLHA 3LO5A 1AR2A 2J21A 1FIUA 1TK3A 4JKYA 4ZMXA 2HTLC 2QI9C 3DOOA 3WJJC 3MV9A 2ITDA 3EJCA 2UZPA 1CZHA 4H6VA 4KLZA 2NDGA 3GZKA 2NW3A 4KDTA 3HK2A 2B1HH 3RL1A 4GQ9L 2X4RB 4L3CA 2PWZA 2YJ6A 4TMTA 1UWCA 1KFGA 1U9ZA 2DUUA 4NM4L 4EI5B 2ZVDA 4UB0H 1HSOA 2IQAB 1OLSB 1IC4L 4TLKA 1MPXA 3U2SB 4HIEA 2Z31A 4Y4HD 5TQ0L 1OHHD 5DGDA 1XR3A 4U2YA 4N7RA 3U1SH 4ZMZA 4QHKJ 3W5MA 2FEEL 2JKWA 3GLHE 2I5YH 4CLEA 2J0UB 4Q03A 1G4RA 4MYWB 1X5AA 5HDRA 4ZS7L 5AM4A 3QXVA 1IBHA 1CDZA 2OHGA 3C24A 3WVNA 4DZBA 3P45A 2V7XA 1N6RA 3OUTA 5SICE 3WGQA 4HXEB 1F0YA 4B8YA 5HS4A 3JAMA 3RVTD 3N28A 1CGVA 3BK1A 3V1UA 5HRCA 3HUTA 2X22A 2DM4A 4DDVA 4HWGA 1ZOLA 4TUJA 2HU8A 2ZSWB 4HBZA 5L53A 2CK2A 1KGCE 2DWYA 4LBVA 3W9BA 4U2ZA 1LTXA 4OXKA 3B85A 5IANA 3L3GB 2YPLD 1KTKE 4DA9A 4TS3A 1O77A 2FK9A 3KRTA 5FR3A 2QL1A 1W4LA 1GW6A 5EU3B 1JJFA 1JDDA 1KF9B 5DXJA 3HBGA 4RYDA 3GFSA 4E4RA 1SDDA 2AH5A 3KH3A 2CIKB 3LS4L 1PW5A 3SZGA 3QDMD 2FUQA 4QELA 3ZCQA 1W76A 4QYAA 4XWOA 2VN7A 4LLDB 2B5VA 4PS3A 3ITDA 1FVFA 2GBVA 1BZDA 3A5VA 2WUWE 5FCUL 1PD1A 1F3DH 1PL7A 2P5SA 2ITEA 4XGZA 2EP5A 5TPWH 3P1JA 3UANA 4FFVA 5BO5A 2HLAB 1LTKA 1OCEA 1B4TA 3E1SA 5A0VA 4L74A 1RYNA 4GMSL 4K87A 1Z5PA 2A9CA 4OF0A 3HFFA 4IBSA 4OB7A 1N5OX 5CVCA 1FXWF 2RC6A 4L37B 3MW8A 3PR2B 1XAGA 5HFAA 4EKDA 5ALSA 1A3LL 2B77A 1AU9A 1EERB 1CUHA 1FTWA 4TV9B 2MHAB 3WDHA 1B6SA 4IBUA 2YOCA 1Q83A 3RC2A 5FL3A 1K2WA 3UADA 4KE9A 4AWAA 2VW6A 5SY4A 1K8IA 1U6IA 2PW2A 2NUTB 3HVDA 4JLBA 4F4FA 3TRJA 4FLFA 1FG2B 5D2LF 5HXMA 3ESXA 3OM1A 3AREA 2DQYA 2Q1SA 4I0PD 2OWEA 2GK3A 4AT1A 1GGUA 4LMRA 1J2JA 1BV8A