2VDPB

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 125
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdpB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdpB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdpB03
3OL2A 1M1XB 3EFOA 3QA3E 4Z7NB 1QC5A 3HXOA 2X5NA 2VDRB 4UM8B 1SHYB 1RRKA 3NIGB 1RTKA 2B2XA 3IJEB 4A0QA 1M2OA 5KYUA 2ODQA 5KYNA 3AL8A 3K72B 2ADFA 1U8CA 2WW8A 3PPVA 4CN9A 1AUQA 1V7PC 4HQLA 5BV8A 3TW0A 1RD4A 4K3JB 1MJNA 3V4PB 4HQKA 1TYEB 4NENA 1IJKA 1N9ZA 3NIDB 4CN8A 2M32A 1XUOA 1CK4A 3FCUB 2VDMB 3E2MA 3VI4B 3F78A 1NA5A 1YVPA 1M10A 4WK0B 1M1UA 5E6UA 3M6FA 1SQ0A 4JDUA 4G1EB 3K6SA 2I6QA 1M2VB 3OKYB 1OLZA 3ZE0B 2I91A 1DZIA 5E6SA 4BJ3A 4HQFA 1RS0A 1T0PA 1U0OC 4UM9D 1IDOA 3Q3GE 1M1XA 2VDLB 3AL9A 4G1EA 1MF7A 4Z7QB 5E6UB 3K71B 4MMXB 3IJEA 3ZDXB 3EGDB 3BN3A 4IGIA 3PPYA 3K72A 2VDOB 2UZYB 3BQNB 4Z7OB 1ATZA 3BQMB 2QTVA 1IDN1 5HDBB 4F1JA 1JEYB 2ODPA 4CNBA 5KYXB 4MMXA 4C2AA 3ZDZB 1MQ8B 4HQOA 1SSLA 1ZOOA 1AO3A 3EGDA 1PT6A 1LFAA 3HI6A 4MMZB 4IXDA 1JEYA 3EGXB 4HQNA 2NUPB 1AOXA 1PD1A 2P26A 1QCYA 3GXBA 3TXAA 5KYXA 1BHQ1 3ZE2B 2VC2B 3V4VB 1JV2B 1JLMA 2WINI 4WK4B 2NUPA 1MQAA 1SHUX 4MMYB 1L5GB 1U0NA 1SHTX 3AFCA 1JEQB 2VDNB 1N3YA 1JV2A 1UEXC 4UM9B 1FE8A 5E6RB 1FNSA 4O02B 1M2VA 4FX5A 4F1KA 1PD0A 3OKWA 4O3UB 3PPWA 1XDDA 2NUTB 3PPXA 3EOAI 1OAKA 1MHPA 2XWJI 4O02A 3K71A 2VDPB 3EFOB 1QC5B 2NVOA 1MQ9A 3F74A 4GZ8A 3EG9B 3IBSA 1ZOPA 4C29A 5KYUB 3ZE1B 3AL8B 1CQPA 1Q0PA 1U8CB 3VI3B 4C2BA 3T3PB 4JX0A 4PN7A 2IUEA 3EG9A 2XGGA 3ZDYB 1PCXA 5HGJA 4MMZA 1ZONA 4NENB 3EGXA 3RAGA 3FCSB 4FWWA 4IHKA 5KYYB 4XW2A 2O7NA 4G1MB 3ZQKA 1XDGA 3NVQA 1T6BY 3TCXB 1IJBA 2VDKB 2VDQB 5KYWB 3HXQA 3TVYA 5KYYA 3FCSA 1BHO1 4M76B 1DGQA 4O3TB 4G1MA 4MMYA 3EOBI 1L5GA 2I6SA 2XWBF 1JEQA 5KYWA 4NEHB 3N2NA 5E6RA 1YUKA 5LN1A 3EH1A 4WK2B 4WJKB 3OL2B 1YVRA 5HJ2A 3NIFB 2ICAA 3EH2A 2P28A 3K6SB 4WFQA 2NUTA 3T3MB 5E6SB 4DMUB 5ES4B
chains in the Genus database with same CATH superfamily
5MERA 2Q07A 3MAJA 3LC7O 2XBMA 2Y25A 2RFXA 5F7ZA 2B1JA 1S3IA 2W2XA 1NBZB 2YCLA 3DFUA 2AK4E 4G4SP 5AVWB 3OKOB 2B2NA 1KCWA 1I6MA 2ITCA 2IHJA 2XEDA 2UWEB 3EISA 1UAAA 2YAFA 2J8UA 1OVGA 1UFKA 2R4UA 3RHSA 1BW9A 1V3LA 4OJKA 4PWYA 3T1VA 3JRWA 5EWLB 3U7QA 4I9GA 4QOJA 1TZBA 2FWLB 2BEKA 2ID8A 4ND7A 1G7HB 3E8UL 1LLDA 4A7PA 3ABRB 2RGSA 5AW2A 4J0GA 3VAAA 4P4KB 1WJGA 2QK4A 1XD0A 4P2RE 1IVTA 4RWYH 1YB5A 2JMRA 4CADA 2UZPA 1UT2A 3BFQG 4G6FB 1EDYA 3WR5A 2Z95A 4ENZA 4ZOCA 4MS6A 1QGDA 1BFVH 2YZMA 1BRTA 5ALLA 1ISGA 5CNMA 2L7EA 2ZKWA 1T1XA 5CITA 2Y7NA 4WCYL 2PX3A 4PRDA 1Y8CA 2EQAA 4G1UC 3QEJA 3PHLA 2ENJA 4CLOB 5GGTH 4MS8C 3HG1B 3GHPA 3DX2A 5JORB 2BVYA 1XAKA 1QQDB 4NWUL 4FZJA 1TNNA 5E1MA 1DQIA 1U2GC 2R1ZA 1GYPA 4TOIA 1RRFA 1MX3A 1YY8B 3L6UA 3BUTA 5FI1B 4UIMB 4J3SA 3WY1A 3LQ4A 1UATA 2QAGB 2GJ6A 1Y4SA 5IFJB 2BOCA 4AL8H 5DBGA 2J6HA 2JZNA 2GWRA 2YXMA 4V1DE 4X44A 4F8QA 2XKUA 2NP6A 4JFED 1MJJA 3VNUA 3PV0A 1AE6H 3KPQA 4OZHB 3UGKA 3ASVA 4PZCA 4HUTA 1X1TA 2X05A 5I8CA 5CKGA 1ZDSA 3BGMA 5D7IE 4OCSL 4N2EA 2QEQA 4UIKH 4HCRA 4RFVA 4WBNA 3F7PC 5IBTL 4PV8A 4QL3A 3QDGA 1S7GA 4QNPE 1AY0A 5FHBL 3MLSL 3NRFA 4BXOB 5BP7A 3EC7A 2WIMA 3R9KA 5DW3A 4NABA 1GJIA 3A2NA 1YH3A 3AWEA 1ETJA 2AVFA 2ICEC 4G2AA 2PTGA 2EGGA 4WNCA 1Z5YD 4YSOA 4KQKA 5I7SA 1OWPA 1DZ0A 5K5EA 4HJGB 3QY9A 2EDOA 1JTOA 4JM2D 3PWLA 4M6NH 1NVVQ 4Z77A 4YHOL 2NY2C 2WKWA 4MGEA 5DM1A 4WUKL 1I1AA 1UB5B 4WLFA 3HNTL 3N1GC 1IJNA 1KMNA 2PH7A 4EDXB 4R98A 1I4FB 2PJRA 3SN6N 2E18A 5B4VA 2F3RA 4RHXA 2JGEA 1FJGB 4PG2C 2JKWA 1P2CA 3QJ5A 5HIAA 4YSSA 4I8IA 3CSYA 5GAJA 1X4XA 5M94B 4Q2ZA 1KEEA 4LHUA 4HFRA 2ISDA 4BHTA 1XVLA 2PX0A 4GIOA 3OH8A 1K88A 3WWYA 1NCJA 4HDIA 1DSYA 1U8MA 1AA9A 2GITB 3YASA 1YEEL 3OJDB 4HQKA 2WC1A 4U1NA 4Q19A 4XJXA 3A4MA 3HCCA 4EMTA 4TKLA 4PAOA 1V3MA 5BRPA 2WF9A 4O5LL 1DKMA 2VEDA 3KBFA 2X9GA 5JXED 2DQIL 4OM8A 3ZGOA 1OLZA 3BN3B 1FYWA 4O4LF 1FBNA 4UNPA 5KNBA 3C1OA 2FWSA 1QIGA 2JAHA 5I5IA 3BAEH 2EQDA 2ZZNA 2G5CA 3OMLA 1KYVA 2FR8C 5FEBA 5F7UA 3DDFA 1L8LA 3MO1B 5CWSA 4ZPTA 2WSYB 3CDFA 4U1GB 4APQD 4RVOA 3LQFA 2WLYA 1AQ6A 1I85A 3SEPA 3VFVA 2M6LA 3K71A 1IZYA 5IEKB 2FPIB 4Y30A 1KVTA 2W6OA 4BDVA 4NKRA 3JYHA 4BVHA 1NTRA 4AYDC 1PG7W 2FL5A 3HAEH 3RWFA 5FFNA 2TMKA 4BKUA 5I0DA 4F97A 3DDWA 3HU5A 5EEWA 1T83A 1LWRA 1QE0A 4BNFA 5JECA 2ODTX 4P3XA 3QP9A 3OFJA 5KKNB 2WPDD 3FVRA 1MC1A 5IJ0A 3QJVB 1AURA 2FLBT 4K2AA 4KTDH 3HQ4O 3C60C 1CK0L 3ZDRA 2G7MC 2H65A 1TNDA 1AGFB 2OPHA 1YZLA 1VLHA 3D1JA 4NM8L 2FQEA 4Q6IA 3P5BA 4BKPA 3NBZC 2OTWB 3PL6A 2EIXA 3E4DA 1A6AA 1E4EA 1TQ8A 5BOZG 3ZIDA 1Y8ZA 2OCPA 1UD6A 2PLAA 2GJ9A 3CONA 3WKYA 4XX0A 5CILL 1EDOA 5E5UB 1GGYA 4WW2B 5KOJA 4QGBA 4HK3J 1BQUA 2AN5A 4CL0A 3EBAA 5HGHB 4KO4S 3WB1A 1IBKB 3WBFA 4JRXD 5CGYD 1OU4A 1ZCJA 2ATCA 3SXUB 4QXGH 1BQ5A 3AJAA 4ZV9A 2EDRA 1YEFL 4LOJA 1OT2A 3RG2A 1ZD2P 2OV0A 5G4OA 4XIIA 2CHUA 2VHXA 1KGYE 1T6WA 1JV2A 4DCNA 1GZUA 4Z7NF 3WNJA 5INDB 5CJXC 4XP4H 5HTSA 1Y0LA 1GZHC 2UZ3A 3QHFL 3RNLA 4E33A 3QI2A 2RHMA 5JHGB 5AVQA 3I75A 1F20A 4PH8A 3LZRA 1H69A 5JIPA 4JI6B 3BMOB 1NC3A 5ALBL 3QFCA 4YP9A 4KMRA 2EX4A 5I1JL 2VQTA 2ICWI 2N0MA 1H4SA 4LNHA 2B69A 4R9UC 4U6SA 1UBMS 4MJ5B 5FYQA 3H0TA 4O25A 3US9A 3OR6A 3I8OA 1R8QA 4K9KA 3L1HA 3SDZA 4KLAA 2OX5A 1U8EA 3U26A 1OTHA 4F3YA 1L0QA 1CD8A 2HT2C 1WPXA 4FLQA 3IX7A 2BSED 3I2IA 4AFNA 2XWXA 5DR5L 3NCCB 3RF6A 3SQLA 4FE4A 1TITA 4WLCA 1BD2E 4ZUVB 1G9NL 2DH6A 1ZWIB 3H1TA 4FFTA 2MQGA 3EH4B 2D4FA 4E36A 2K7QA 1TTHA 3ADPA 3WN5A 3J27A 3STZB 1UP7A 4KQMA 2VJ0A 3VD1A 2G1KA 4XZUB 1DTWB 1T0BA 4PR5A 4HMQA 5IF0A 1OXTA 1JHOA 3ZS8A 2G75A 3QVTA 1QO9A 4C78A 1FORL 3K5PA 4Q4LA 3B1XA 1Y9ZA 1N6LA 2OLEA 3TO5A 1Q0EA 5C0DA 3GY0A 5FUOL 2X2EA 3U0WL 1ZE3C 5FOJA 3LZ6A 3ZD8A 4DIKA 2ZTVA 1OREA 1QPBA 1GCAA 2GT1A 4F45A 4CSPA 4D9FA 3WKPA 1XZLA 3B9AA 5ILTL 3D2LA 4CL3A 4IOMA 4M8VA 1I8LA 1Q3TA 2YQZA 4K94C 2OFWA 2QJWA 2FEEI 3GBNH 1GL3A 2WM0A 1BZ8A 1P4IH 1WA2X 4OTXH 4IXWA 1RUPL 2IH1A 2VHCA 1RWBA 2APVA 1JNJA 2HDNB 4IOFC 2MYUA 3KMDA 1U2SA 2C26A 1E7YA 4M5ZL 4EIWA 1TC1A 8GPBA 4UZFA 2O6CA 4ZDIA 1HFWA 4PTYA 5KAPA 2O5EA 1I4DD 4EP1A 4QHKJ 3QHAA 1ZW6A 3ZDZF 3FCOA 5FW7A 3WEMA 5A2LH 1MIOA 2QE7A 4R83A 1SJMA 2C1XA 4NV0A 2R2HA 4BFGA 1SUWA 4Q3AA 2ZOLA 4LQFL 1KPVA 4ZJUA 1L9MA 1T4DA 1UBJS 1DHTA 2ZYUX 1ADQA 1X1QA 4WK0B 4PJEA 3OFVA 4F33A 3VSBA 4M7ZB 3QU4A 4UAVA 1AQLA 2CK3A 2GNPA 4AMVA 3QXJA 2MHCA 3FETA 5TFSH 1YV9A 1VM6A 1UODA 5DC0A 1I3KA 4FEGA 5IYZA 2YKKA 1NEZA 2ZNWA 1CZNA 4CM9D 3HXTA 2OB2A 3QEUB 1F4XL 1VL0A 5EC1A 2ZJ6A 1SKYB 3QSKB 1X7QB 4HWZA 1GZDA 3KKKA 4X4YA 2JH3A 4KKVA 5KPDA 4UUQA 1I4TD 8LDHA 1ZCAA 2NYKA 5DZOA 1OE2A 3BZDA 1JH8A 5HYJA 2UXTA 5EJMA 1JU3A 3PPXA 1RWQA 2TMGA 1V6CA 4K9RA 5CYFA 4ZD3H 1RQPA 2B8WA 2Y6UA 1NCGA 1PJ4A 1CTOA 2AEFA 1XIVA 5IVPA 4R2JA 3RJ9A 1J8QA 5FYJD 4ZVPA 2D0DA 1UXMA 5HD8C 4RORA 2Z64C 4MCJA 3ZHQA 1EAJA 5C07E 2I3BA 4R97C 4Q0XH 2FG5A 4A6EA 3OI7A 3H6AA 4IIDA 1C8BA 5KU7A 2GK4A 3WLWC 3K4DA 3ULVF 3CIFA 3N85L 2VNSA 4KQ9A 4LOLA 4MDIB 3SC2B 2WTOA 5EIQA 5I1AA 1NIEA 1OSNA 4CJ0A 4L0YA 4LF9B 5E8OA 2AQHA 3V80A 1N2BA 4J9VA 4DAGH 1VE1A 3AT1A 2IE0A 1M10A 1LWHA 1IGFL 1AGBA 5HDBF 3CLKA 3KUXA 1EX6A 4OHXA 4D0LB 4MVCA 4DIMA 1EBAA 3UMFA 5JPDA 1NC2A 2EKBA 2QDVA 2Y36L 3EWIA 4Y4KD 1XYGA 4R7XA 1TJ5A 4X0EA 5CCEA 1U36A 3EVTA 3WMFA 1SCUB 2HP4A 3DVSX 2E0IA 3FF1A 4M93C 4NCC2 2P5PA 4JK0D 2DWDA 3WQQA 3KZKA 5ALQA 2H00A 4KODA 5DRNB 1TMOA 4FEIA 3L0ZA 4AW4A 1V5WA 1I82A 2NX5A 2H3EA 4ZCLA 4TUOB 1FYTA 1X1RA 2O3RA 2Q2NA 4MV3A 2R69A 2PXYA 3NABH 1GYQA 3R06B 4MDYA 3V2IA 5F96L 2WNXA 1YUHA 4BFEA 4JBIA 5LLDA 3FJ1A 2VR1A 1GILA 2I6FA 4HSGA 4FB4A 2HBQA 2IZ5A 3M1BA 5DHDA 1UCBH 3LA6A 1IUOA 1I85C 1DO5A 3HL4A 2ORWA 4LG1A 1J9EA 3CJQA 2CMRH 2JHGA 1RKXA 4CPDA 2VLRB 4YI5A 4QBFA 1BS9A 5IKMA 1KSFX 4LRWA 4R9NA 3L1VA 3H3PH 1GAWA 4H5SB 4WV1B 5SWSD 4F5ZA 3FOMA 3UXFA 1RIVL 3RAPR 2I07A 1ZI9A 4O2BB 2XBDA 3TD9A 1MT3A 1IGTB 4FM9A 4HOXA 1JNNH 1T83C 5KTKA 4TVSA 3R7LA 4CF7A 1K4KA 4WU5A 3VD4A 4QF1A 5AVRA 2Q5QA 1B0PA 3MTDA 1S8DA 1BOGB 4HNQA 3CLRD 3ROPA 3U4BL 5CLLA 3DQZA 2BRQA 1GKYA 1RWPA 5EZSA 3GRRA 4KRNA 2ZUCA 1N8NA 4Q6IC 2FCAA 4H1UA 4HIEA 2V3DA 2KLHA 3MOQA 3TPFA 5HILA 3OBIA 4Y1RB 2C3UA 4YMVA 1SBZA 1FC2D 2A94A 5BN1A 4KAAA 1DE4B 3LPCA 3L06A 4Y1EA 4XMKH 5KBLA 4L48A 3W0WD 1KJYA 4PJXE 4V0QA 2O93L 4FWIB 4IRJC 1DLIA 3RLSA 4EFDA 2O48X 1GYCA 3QWFA 2XXBA 2R0KL 1QYXA 2BKUA 4CMKA 3DKIA 5DT1H 1A3RH 1QYGL 3FB8B 3KLHC 3D85D 2OR7A 4CIDA 5D5MF 4EPYA 4JNXA 1PR0A 2KHAA 1GPKA 5DBHX 2F19L 4AQEA 1KJMB 5LMUB 3TWCL 1XCTA 4M1MA 3I32A 2NSMA 4ZSOB 4NYIQ 2XNDA 3RWJA 3VV3A 1PV4A 4J3BA 4HZGA 2QZ4A 4UAHA 4P6VF 4JZNA 2WINB 4QYSA 4DMUB 3OF2A 3SJUA 4M7KH 5DLEA 4NJAH 4DEXA 3DCIA 3TBSA 3P2YA 4I55B 2OR3A 1XK7A 4IRSB 2A3RA 4U2FA 3D87B 3P77A 5H8DA 3NPZB 3TVMD 3UTSE 3LNGA 1CLOL 3CZMA 4MNQB 1NCHA 1JNHB 3W82A 5BVHB 1U0TA 3CGGA 4EHAA 2YIJA 3B3IA 2SICE 3KPWA 1AR1B 1LPAB 8CGTA 1OFHA 2WJ6A 1TZHA 1XMVA 3MERA 4GIBA 4E5KA 2EXTA 3A1SA 4HEME 3BQVA 2OL3H 3BD3A 1P8JA 2KPOA 5A03A 4WNYA 3VU2A 4CKEB 5C08A 3L3GA 2ZITA 4IUCS 4CVZB 1J9GA 1B74A 4FJYA 2Q3XA 4M3HA 4L4TA 1JQJC 1FL6B 4H0NA 1L5QA 4Z8FH 4C4KO 4N6RB 2OQ2A 1O6GA 3EVNA 5H16A 2IS1A 4DV2B 4NHUB 1YPZF 4DVBB 2F53B 4HY3A 1YQTA 2JLWA 4PAZA 1MXHA 4TLDA 1O96B 3E27A 1U3CA 2IQ9H 4Q4JA 2NZYA 1F8TH 3P11L 4FQQB 4R4ND 3R5XA 2VMDA 5DLQC 4M9CA 3RVVD 1E5XA 4PJCB 3NN8A 1E92A 5E95B 3B1VA 1LDEA 3U4IA 2XVGA 4IQ8A 3X1KA 4GR4A 1DEEA 4BVJA 1E30A 3OSUA 3DHPA 4YRPA 2QSZA 4J6RH 1PZGA 3I45A 1LDYA 4Y9SA 3TBWA 4I0PB 5FO0A 2H2DA 1WZMA 4N3UA 2G83A 1J86A 2OV8A 2IX9A 3UWKA 3BIWA 2RAFA 2HK6A 2YA1A 3SE9L 4JFQB 4YSDA 8PAZA 3EGIA 4JJAA 1VCOA 5FM5O 2GXUA 2UVPA 4HD8A 3WG9A 3GLIB 2WMYA 3RYTC 3I42A 3ATEA 2P2LA 1KJ2H 2VJCA 4BN0A 4WF7A 4FHGA 3BGDA 2DQHH 1H2RS 2GBCA 4J75A 5IVZB 3K8ZA 3OKKB 3B82A 3PQ3A 4RY0A 3N39C 5DIFA 1FRNA 1KI7A 4M3NA 4NQXB 3D9QX 3NDPA 1HTWA 1MG3C 5BVGB 5JSFA 4HUQB 1T3ZA 4PC3A 4W9IC 3HNRA 5EBGA 1DUZA 5AM1A 2QQFA 1TJMA 1SF3A 3RVQA 4L29A 2B16A 2PIAA 3LLVA 5BS0A 4MKHA 4AY3A 4JFFE 2BSQA 2CDGA 3ANMA 3T1FA 1AQKH 1TT5B 4OZIA 4J2QA 4MEAA 1R12A 3RAGA 4NKMB 3NTLA 1E59A 1QSGA 1E43A 1HHKB 5IH7A 1GGEA 3FSGD 2BWDA 5KMGA 5HGAB 4MIOA 1TTQB 4INPA 1GG8A 5F44A 2F54A 1ZZGA 2C2OA 1X8KA 1J5EB 4YFYA 4Q97A 4GP8B 3AZQA 1GA4A 4L08A 4Q4IA 5C2JB 4LLWA 2OO7A 5IQ9B 3WJJA 1AGXA 4AIOA 1T9GS 1MI5B 3WYGA 1BE8A 4DLTA 1ZNXA 1FLDA 1SOUA 1MJNA 2FIKB 4MB6A 4N40A 2A9AA 4MGIR 1UC8A 3Q01A 1YE8A 1NCAH 5KVFE 4CUZA 3NIDB 4R7GA 3ECBA 1XGRA 3DGCR 4OLEA 5FOBB 1YYCA 3U3DA 4G8JA 1FAIL 3CHYA 1SXSA 5DHYA 3PIRA 621PA 1SA0B 4O00A 3AHDA 2GSGA 3VFOA 5HJDA 2Q3FA 2XCOA 5IR1A 1OH6A 3F90A 3L4CA 4NAJA 1VRVA 4F57L 2DWEA 2A0WA 1XL6A 4RJLA 3DCJA 1JSYA 3ZSSA 5JNWA 5HCUA 4JKNA 3NIFF 4XH2A 3C85A 4HYEA 3CZEA 5GJTL 4HB4A 4M0MA 1NM5A 4BIIA 3KT6A 1XYVA 4Y1AD 3RPEA 4F1KA 3DE3X 4I5GA 2JFCA 1BYPA 3IUJA 4LHYA 2AI0H 3UWDA 1M34A 3TZHA 4CSTA 2WHEA 5IEBA 3GUZA 5I47A 2JJVA 2VZ0A 3ZVMA 1P2VA 3TPCA 1IAIL 3ALWA 1BVNT 1T4BA 3MTRA 3W5DA 4R96B 1R10A 4NRZA 5CCXA 4PPGA 3EIWA 4HGRA 3C12A 1CZ8H 2A0FA 3IPLA 4TUKL 2GBPA 3H9JA 3OKLB 3VQTA 5JY1A 1JFHA 3MRHA 5GS3A 1BKDR 4GOKA 4PJGA 2WN2A 3UQYS 5H4ZA 3QJZA 2HT4C 2PXYC 3HHSB 4FE3A 3CRQA 4O51A 1JAEA 3M46A 1RD4A 1WA1X 5D96B 3VWJB 1ZYUA 1F4LA 1MREL 1XTKA 3GSVA 2RE8A 2AOTA 3BUSA 3CX6A 3ICOA 4UJ3A 1SKAA 2H4WA 3BFKA 2GUOB 1XHHA 5HM6A 5D2LB 3ZKXC 5IJWA 5IOKA 1TSRA 4NQEA 2V55B 3FMOB 4QRUB 3DWFA 3JYPA 1NDHA 4N26A 1O0VA 5DRZB 1Y80A 2VLJB 2FY8A 1N7MH 3NPMA 4TMWA 1NX6A 3IIIA 2XUDA 4C56E 4YAJA 4MUIA 1Z15A 3AFMA 3OPNA 3CFTA 5CNJA 4FFZH 2DCUA 2M1XA 4N5HX 3FMPB 1OYVA 3O2VH 3FPFA 2Z5LA 1IM9B 4M6ML 3F6CA 1HAWA 3S55A 5MI0B 2W11A 2F5AL 1PX8A 2HBRA 3MLRL 3IU4H 1F8FA 2ZPUA 3OHMA 4KFRA 4A26A 5MHSE 4DHLA 1X8LA 1GL6A 2J57A 1E7QA 3NHWA 1EO8H 1LE9B 4LIQE 4QDKA 2XVKA 3MQ4A 2OGZA 3WJ2A 2P5WD 5FYKD 2NO6A 4M4PA 1H1LA 2CUMA 5LLTA 1Q0RA 1N2CA 3ZDCA 2D2CC 3HZRA 3ZDDA 3BF8A 3K0SA 4LDCA 2PV7A 5LNK6 3Q48A 1EAQA 3DT9A 2OMYA 2GPSA 4OAQA 3EXHA 3TYGH 3O3OB 4B47A 2GPWA 3TL5A 1VCNA 4HWRA 5HUJA 1IK6A 1BVNP 2ZYAA 2X58A 3QDJB 2ZI9A 3BGSA 1ZM2A 3LHAA 3FOWA 4GXFA 5CB8A 2PRIA 2UZYA 4OIBA 4CLXA 2AAVA 2ZXWB 2B25A 2PMKA 3GJFH 1XFDA 4PIPA 3IULA 1CDHA 4MD5A 2ZJSH 1JPVA 2EH7H 2LU3A 5JHBA 2H5EA 3PNRB 3ONDA 5IESL 2JLZA 4JUDX 4JHVA 3DKPA 3VXUA 3TEWA 2Q49A 4MWZA 3SYNA 1OAYL 4G5FA 4W82A 2WVTA 2VA8A 5JHDA 4ODHL 5EOQL 2NYUA 3ESZA 3ZUPA 3ZC3A 1A9TA 1SYSA 3P5SA 1UWFA 2UUAB 4UMDA 1XHLA 1RTKA 5C1BA 3IDXH 2BDNH 3ECQA 3L0SA 2JKRM 1W4ZA 4YCJA 3QF4B 4AYBA 2Q4TA 1N8OE 3I9OA 3SPCA 1T5XB 2DWSA 2FYVA 2NYRA 3P96A 2X4QA 1AC0A 3UZQB 5FCUL 2M32A 4OHMA 3OA2A 2PUDA 5MENB 2PL9A 2UYHA 2G1AA 4GEIA 1A3LL 1ORRA 5MF6A 2IYZA 5AXAA 4JJ8A 3SE4C 4WTOA 2CALA 2WHPB 4U6TA 1JK9B 5KVDL 3TOZA 4N48A 5CHEA 1KYOJ 2CXUA 3EYUL 4FQJH 1R6VA 3KPMB 3E8MA 3HCEA 3OQRA 1QDEA 4R69A 3DONA 4LLYB 2HTLC 1X5IA 5BV7C 5EEGA 1RYYA 1VLMA 1EWYA 3D3KA 1M5RA 4TSCH 2RQEA 4KR3A 1JPJA 5CLGA 4IUYA 1KGCE 1SOWA 1RUAH 1PV1A 1H5UA 3JZIA 1WAAE 3SQMA 3OB0H 1P9OA 4ZGBA 2GHTA 3JVUA 4NNJA 3PXAA 4M9QA 1F6LL 4O4JB 1LK3L 1A5TA 4RULA 3LRPA 2D4HA 2CM6A 2EIJB 3MUZ1 4CIWA 4LCWD 1SC9A 1ZT7B 3CINA 5EHIA 4PB0H 4I3RH 5I8OH 1JXGA 5D4JA 3JTSA 3EFFA 4IU3B 1UDBA 1MSPA 4A6DA 3HFFA 4FMDB 1Z7JA 3QWOA 3FFDB 4LEBA 4G6KL 3KPRB 1NVGA 4HULB 1KRHA 5CEZE 4KX9A 4YHKL 1XLTC 3T7JA 5FKAB 1PU2A 4ER5A 5GV7A 1I7ZB 5DLPA 3RGVD 2O6DA 1JAYA 4L4ZA 15C8L 2G28A 4EYSA 2BFCA 2ST1A 4EVNB 3T5TA 4AYGA 1RC8A 2P5EE 3WY4A 3U0PA 2QLYA 2H07A 4DCGA 2JFPA 3GW8A 5E9NA 4I1YA 4ODWB 4LHSA 2PWDA 1YY9D 1ABEA 3WJJC 1L4UA 3H2KA 2HPTA 1SUBA 2QQEA 1NBZA 3NWJA 2WJIA 3UENA 5AVWA 4IZHA 2WPNA 5A4FS 3S5ZA 3OKOA 2B82A 2L42A 1JL8A 5JISA 4RIEA 2P80D 1BHQ1 2GZHA 3ENZA 3B7GA 2UWEA 1P17A 1BBDH 3QVKA 5B1JC 2E89A 4M7LT 3K6KA 4HPWA 1G1YA 1YFKA 2DQSA 1E6CA 3KVPA 1O54A 3B3QA 1KCVL 1OAKA 1G7HA 3RVOA 1XF4B 2WJWA 4FVTA 3L5HA 4U7TB 5AFSA 2DR3A 2Z09A 3SQNA 1NAIA 1JT9A 4EY4A 4PJEF 1PVOA 3E9ZA 1E8YA 3QJTB 1HYSD 2QV0A 2DQEH 5EGNA 1GT6A 1JMVA 3E53A 3DROB 2FJPA 1AK9A 2JIMA 1JQDA 1Q1JH 3O03A 3CSDA 4HK3N 5KQLA 5ETJA 2AJ3B 4US0R 1EUQA 3A8TA 1RZKH 3WGHA 1HE8B 4DR7B 5DUBB 4LNUB 1XBTA 4FP9A 4FIDA 2CJTA 3TLBA 4NP9A 4PBSA 1JDZA 1JZ8A 4N41A 5JSUA 1QQDA 4BH8B 1IAMA 3B38A 2A5JA 4ZT5A 2ZUVA 2Z9CA 2DQTH 2P48B 2O72A 4FQIL 2QT1A 2Y69B 3LP6A 4M83A 2WKLA 4UIMA 2VMFA 3BEDA 5REQA 4W6WB 2IXTA 1M9SA 2QAGA 3IUYA 2BVNA 4JLAA 4IBUA 5IFJA 2WQVA 2FECL 5F7KC 1RP7A 4GRWH 5DD3H 1D2HA 3SHWA 4IOIB 5TF0A 1TEHA 5DSCB 2P68A 1L7VC 3CFMA 1VGEH 4PYIA 4XAWH 4CETA 3PYCA 4PG6A 3U7JA 1G9ML 3QG7H 4PWGA 3B7WA 2OSWA 4ALIA 4KE8A 4TWBA 2WA1A 2O5ZL 5TE4H 3ZHLA 2PKDA 25C8L 2G08A 1ZIYA 2KJQA 1ZN8A 5LD2B 2MJLA 3MMSA 1AH1A 1HH4A 3E5MA 4NHCL 2PPVA 3H6JA 1I1YB 1G9EA 5BWCA 1J0XO 2LDBA 5FFLA 2AOXA 2IDKA 2Q7NA 4GKZA 1NJ6A 1U6IA 1Q72H 1NOKA 2Y1OA 5K8UA 3VVVA 5LBUA 4XMLH 5EU6B 5K9QI 4N85A 3QJGA 5DIZA 3NHPA 5D6DA 3C8UA 1PCSA 4FYSA 1QIKA 3O0LA 1FPMA 1MXFA 4EDXA 2BSSB 2PZKA 3IGFA 4GPD1 3FUCA 4WLNA 2XJ4A 1X1CA 1GW6A 5KKCA 1PUIA 2ZATA 3V0AC 2ZJZA 3ECSA 5FGCB 2VN8A 3HMKA 5DDHA 5L0QC 2VDRH 4S2UA 4KAJA 2E5EA 3HLAB 2KZBA 3IRZA 1L4BA 5EZJA 3KWFA 3MTXA 3E7XA 1P2DA 1CDDA 1MAML 3B2UD 5E6ZA 3NMEA 1Z6YA 5ITZB 3OMNB 4DCOA 3KQUA 3OJDA 3BXXA 4QU5A 3FTWA 1MJ7H 3DWTA 1YTUA 2X4TB 2H26B 4OGXL 4RMIA 4PCTA 1GIGH 4MUMA 1ULHA 4DLXA 2H45A 4D3ZA 4GW5B 3BWDD 3OFKA 1G0YR 4GYJA 2EP7A 2C3PA 1LO0H 4GLRH 2K8MA 4G7YH 3E5RA 5I28A 3OXSA 4CEIB 2PWYA 5CFZA 2H0RA 1PL3A 2CWRA 3LRGA 3S2SA 4HRVA 9LDTA 2CVOA 2NTSP 3E1GA 3CX2A 4FFOA 2NXZB 4TX1A 1HZKA 3A27A 3T99A 4K81B 1Z3GL 2VZSA 2JFWA 5FBWB 2A9KA 2IA5A 4RLSA 1NUAA 2QTGA 1FHNA 3QNZB 1IT9H 2IU3A 4HNHA 1NE2A 4QPZA 2JI3A 1NRWA 5B1SA 1UJ4A 1MB2A 1TGVA 1HL4A 4JEIA 5IEKA 3N0RA 3FJOA 3OM8A 1CDEA 3G2LA 5GRYA 4I18B 1GRVA 1V1MB 4F4UA 2X8BA 1J9ZA 4HN4B 1RLTA 3IALA 1MFDH 2BS9A 2IUTA 1K4DB 1QHFA 4RZIA 2R9HC 3U83A 2QRUA 4HHAB 2ZT8A 3F8WA 3ORFA 3W78A 5EE3A 3CBJB 3LEYH 4OW6A 3GTTA 1SPBS 3LQ2A 3K1AB 3L8FA 5JS7A 4Y9CA 2C61A 3KJIA 2P3OA 2V8BA 1JIKA 4AYSA 3FHCB 1T9AA 4YR7A 3WIOA 1AQNA 5EHZA 5IT4A 4FXOA 2WMOB 3MV11 1OOWA 3MIZA 1AGFA 1YDPA 3QUXA 5HCIA 4IEFA 4PRPB 2OTWA 1SSLA 1N2RB 5I5MA 3DPIA 3UTZA 1Z13A 2XMGA 1DAEA 1FNSH 3HHPA 3LSOB 2KW5A 3FTDA 5LQRA 3A10A 2EEDA 2V59A 3ZXXA 3E9RA 4N3GA 2BVPB 1S2EA 2AHRA 3CSPA 3MRFB 3EUFA 2QSCH 1MCFA 2WNHA 3SVTA 3B9BA 4WW2A 4D9EA 1A6TB 5EU5B 1CFTB 1V3UA 2LFEA 2R1XA 5ETUB 3TIXB 5HGHA 1VG8A 2QYOA 2IPAB 4FDUA 4NQVB 1FCJA 2QUHA 2CHVA 5IAEA 3SXUA 12E8H 4AQ1C 3UEZA 3PUKA 3RQIA 2ADFH 1YUBA 5ITWA 2R5WA 1I3CA 3TF5A 1TPXC 4XUCA 2P9RA 4EG4A 3RTEA 4ZVRA 5INDA 2P2ZA 4HUXB 1YCDA 2BFOA 4N2FA 4FEYA 4HS8L 3QE9Y 1UWLA 4NJMA 3RK4A 3LD9A 1HQ4A 2QP3A 5J2TF 2ZTMA 2EIDA 1GP2A 4FQLL 4JQOA 4AJPA 2QD3A 3G6AB 3BMOA 3IKCB 1JGTA 4EATA 4Q21A 2EUZA 4BV8A 2FFJA 5AOIA 3QPCA 1IEBB 3HJUA 4JFEE 4OM1L 1OBOA 3QULB 5L7YA 5DVPA 4ESOA 4CGTA 3L3JB 2WZPD 5EQDA 3ZHYA 4JNCA 4MJ5A 4XM2A 3UCRA 1KORA 5ENZA 4Y6GB 3ABSB 4OXIA 2QR0B 4FN0A 4GSLA 2AC0A 1J99A 4P08A 2CJXA 1Q0UA 2X4NB 4FI8A 4B9FA 2GAZB 4FE9A 5C0JB 4NJEB 3TESA 3DHYA 2AXGB 2A6IB 1C81A 4HWGA 3EAGA 1BF2A 4K9EL 2XR1A 1GUAA 3WDJA 2CUKA 5TMBA 3DARA 1U9JA 4KI5C 3DX8B 5F76A 3LXAA 2IPMA 4DQXA 5AHRA 4NZYA 3D6JA 1W16A 4HUUA 4F58L 2DYPD 4XZUA 1DTWA 4F9LA 3P94A 4F2PA 2EATA 3CVXA 2IOFA 1HMYA 1JOIA 3PNSA 3GFUA 2V4UA 4F9EA 1ZIBA 3DTNA 1HSZA 3G85A 2FJUA 2NQ3A 3KB1A 2ZRQA 3U1TA 1NFAA 1ZUD1 2NV6A 3T4PA 2BKVA 5IHLB 5HBRA 2CPUA 5CIYA 5KNDD 1WT5A 2APTA 4P4KC 1T8TA 4EENA 1NVAA 5EINA 4HJXA 5ICGA 1Y6JA 3A1NA 2YIHA 2HFFA 1VCIA 4DO4A 4R41A 2EWMA 1B2YA 3GIZL 4MULA 2OCFD 4NZUH 3CXDH 5HBBA 3X12B 1DBBH 4ISBA 1WDTA 3E2HB 4NUPA 1DTEA 3ETSA 2QMOA 5EU7C 1FBTA 4KRPB 4JQCA 1JXJA 5IHUH 1R3KB 4JLNA 2CJWB 2QB5A 5K3CA 3NEPX 4TTTS 4CV2A 1C0LA 3CZNA 2VTDA 4L8YA 3OKAA 3O4LB 3MWDB 2F1JA 1C3XA 4LSDA 3ZE2B 4LT7A 1A21A 3DOHA 4TUYF 2D1RA 1EIBA 2EKPA 4N5IX 2WJPA 2G4GA 1G7RA 5DMJB 2QAGC 2HFEA 4J7CA 2H0QA 2VDOH 3ZDQA 1YEIH 1FQJA 4HGNA 4XCFH 1I2DA 3O73A 3IP5A 2NVOA 1DBIA 1XTRA 3WDMA 2PGNA 1ECLA 3L93A 1IXZA 3F7TA 3O2DA 4DCPA 3A3OA 1INDL 1X7QA 3BD4A 4B3FX 3BGAA 4ZTEA 3S88H 2FETA 3KVNA 3LPLA 4TRRA 5JPCA 3GMIA 3IP7A 3Q2CA 1YZZA 2FQDA 1GV0A 5BYKA 1DQLL 3BRDA 4MJHA 3CFIC 4G71B 1HE5A 3PXUA 5LHDA 2BIPA 2DM3A 1QNZH 2GB2A 4WZAA 5ICCA 4HNAB 3B85A 1XPUA 5I5RA 3BPCA 2R8YA 4X45A 4EHFA 3IOYA 1UP6A 4G5QA 3UHJA 3VXSB 1G4HA 3VA7A 2C78A 3N05A 4WXYB 2FKNA 5EJIA 4HJUA 1RT9A 2R25B 2VSCA 1CQJB 2BWIA 1VE9A 1G21A 2FX8L 5KJ6A 3HHMA 4JQVA 3BJIC 4UASA 3QEKA 4O2FB 1X6NA 3SC2A 5TTRA 4FFMA 4RNDB 4JPQA 2GJAA 5BT8A 2NXYC 4LSTH 4JRXE 4PRID 4HDKB 1KBKA 2HSGA 4XIGS 4PJGF 4AMKH 2BEVB 2DTEA 3QPXL 3LVEA 1I7UB 1FCGA 4WUUD 1P0IA 3EJRA 5IB1B 1P60A 2NU7B 1U2TA 3ZGVA 4A55A 4LSZA 1XQ1A 1V9LA 3LYRA 1A1MB 1PR9A 1YHPA 3M5DA 1MENA 1FFQA 1SCUA 2YD2A 1R75A 1EJOL 2J1XA 3O3CA 3DL2A 4DUVA 3UJ3X 4PV7A 1KBOA 4Z95L 1HZLA 1E3DA 5DRNA 3SD2A 1A0OA 1KCUL 2AYYA 5JALA 3D02A 4UV4L 3V1NA 2PGLA 4F3FA 3HLKA 3ARBB 4G1CA 2B8NA 3BKCH 3AREA 2APSA 3HNPA 1G63A 2Z6VA 2BMEA 4YFLF 4O4HB 3PL1A 3SX0A 4K9DA 3JQRA 2XCSB 2V0CA 3DOUA 2QT6A 3MLUH 4NOKA 1WV7T 4OB5H 3KAAA 1A7RH 4HC1H 5IF9A 4JG1H 3KL4A 2F1OA 3CF6R 4B8YA 4B50A 3WAJA 1AMYA 2QGCA 4WHYG 5I1EL 2O0JA 4YWHA 5IROA 3GMRB 1SKUA 5T4HA 4XMPL 1R0RE 3FC8A 3JWDL 1J5OH 4O59O 4P07A 3O47A 4H5SA 3OC8A 5DZJA 4GM1A 5IT9A 4R9VA 1ZGHA 2FSUA 1BSIA 5KW9L 4MYTA 3IGUA 3W6NA 5CCHE 2CPCA 4X60A 2ACEA 1Z4JA 2AJUL 1Z8NA 3IIJA 5CD5C 2HL6A 1XHFA 3H9QA 3G0BA 3I01M 1PRYA 2R8PA 2DULA 1R4XA 2KS6A 3KWVA 2ZYDA 4GQ9L 5FPIA 2LVBA 3KSUA 3UH1A 3S3BB 3KR0A 3UHAA 4Y1RA 3MV7E 2NNWB 4E94A 3PLYA 3FCSB 4NKDB 2UY6B 4M61B 1Z4KA 1FGNL 2IGTA 1GXEA 2D7DA 1DE4A 2P1ZA 3DLAA 1H5QA 1KR5A 4P80A 1I9GA 1XD9A 4F4CA 3ILDA 2OVBA 3UZVA 3W06A 5FR2A 2A9FA 3TEJA 4WW2C 3COYA 2DBRA 2Z4QA 4CLHA 1PFCA 2A9DA 4XN8A 4J1UB 1Q1BA 1GY8A 4K8RH 2JWYA 7FABH 2VLIA 4A10A 2Y07H 4Y8DC 4Z7AA 3LHPH 3Q7JA 1SHMA 2V1UA 4Y2YA 1T5SA 4ZYKB 2IEZA 2ZR0A 1KJMA 2X6VA 4OLJA 5AKTA 4E30A 1XLWA 4ZSOA 1W4BA 4Q4HA 1OH5A 4ZYZA 5KN5B 4EW6A 2MFNA 1S3GA 3A0UA 1LNZA 2G60L 1VFAA 4CMMB 4WI7A 4F80A 2W6QA 4K3HA 5GGQL 3S3SA 3S5UA 2Y0SA 5KJ1A 3O4FA 4PPQA 1PEDA 3UV6A 3MCYA 2H16A 1TJGH 2IBSA 4NOLA 1NHGA 2XAAA 3LPMA 2YN5A 4UMSA 1RBMA 1CTMA 5TSDA 4ALJA 4BU0A 4V1CI 1U99A 1JQKA 4I55A 5JJ5A 4Z7OB 3MJDA 4IRSA 1QVOB 3BT0A 4F2FA 2XMCA 2EEPA 2IS6A 3VR6A 4Q3CA 1ZEJA 3KBOA 2IBZY 2QVTA 4AK1A 4F8LA 3UKJA 1LFAA 3HM9A 2GTIA 4FYYA 3OJWA 2YARA 1HKHA 3DZGA 2P2GA 1RVDA 1SG6A 3ABIA 1INQB 4MNQA 4OFVA 1JNHA 5IHXA 1O2DA 1G3UA 1IHDA 5GV8A 3LKNA 1AZVA 1ZMXA 4FKBA 5EFIB 4TULL 1IY9A 5SWQB 4E07A 1BDIA 1SUIA 3DO7B 1CDZA 4CKEA 4CM4B 2BPOA 5FYJE 1KYOK 5SZKB 3AGWA 4CVZA 3SLKA 4JFAA 3NHBA 3O75A 4DM7A 3QVGB 4UMVA 1A2YA 1ID5I 1KFKB 3BE5A 4ZTZB 3WIUA 1HG0A 2E76C 2AJXH 2HLFD 1MWAH 3KVOA 1L5MA 4NHUA 4F9LC 2F53A 5T5NG 2XGSA 5D85A 3FTQA 2FQGA 5LB1A 2PCLA 1O96A 1IUZA 1J00A 4B40A 4FQQA 2FW1A 3BWXA 3CW9A 1G4UR 5DXAA 3LE8A 4UBJA 3RA7H 1BWRA 4PG7A 1RHKA 2ZSHA 4PJCA 4ZFFA 4JB3A 2NCMA 2OZEA 2HRZA 4BO6A 3LKBA 3VR4H 3DV4B 5DX0A 1NYRA 4PCKA 2V7QD 5LLSA 2XY1A 3SPHA 1EK1A 3EXAA 3ARFD 5CLYA 5BY2A 5KTNA 4S1VA 3NWOA 5G3ZA 3BGOS 1YNOA 1ZI8A 1IBHA 4BO8A 3PX2A 5K4GA 1U3GA 1LNUA 4JJKA 1PL7A 1IAKA 5EZIL 3G13A 4P9HH 5GTDA 3AU8A 2WINI 2YRBA 2OBGA 3H6HA 4OMUA 4Q7JB 3P2IA 3CJRA 5JNUA 1IBMB 2ADJA 5AM5A 3GLIA 3A6LA 4Z49A 4RENA 3L48A 4RGND 1IB5A 1OI4A 3RY4A 3BVNB 5FKPA 1MUUA 2A5DA 3QMVA 5ALMA 2G9NA 3UERA 4KV7A 4M8LA 3ZE1B 3U2SA 1TLLA 1TQTA 3CZJA 1Y7PA 2IH9A 5K9ZA 5IVZA 1FSSA 4LFHD 3EEYA 3OKKA 1W2HA 2CU9A 1OC2A 4JT8A 5D9SB 2HV8A 3D7MA 4KKLC 2NLJB 2VPTA 4NQXA 1G8AA 4EVSA 3LH9A 4M7ZC 1QZTA 2MMCA 1FIGH 4HUQA 4LSWA 1USQA 2MR6A 5CT4A 3TJEL 3ILVA 4GHWA 1C3OB 2UZIH 4M9PA 2Q28A 2UWEF 5IDXA 2VZEA 3QXAB 1KGXA 2VCHA 4ZOBA 4LDRA 4JO2H 5SWSE 3E03A 2BGTA 3R3SA 4L0MA 4NKMA 4DLUA 4JLMA 4QJBA 1VLVA 4ZQBA 3FTVA 5K93A 4RGYA 3GLFB 3V2GA 1T80A 2P1YA 1YQUA 4GSUA 2NQDA 1GPUA 3BQUB 2E4AA 4PG2A 1WUHS 2L8AA 4HW6A 3MFGB 4PZYA 5CCKH 3A6EA 2PY6A 3MJ9H 1DELA 5CFHA 1A4CA 4F21A 3WNOA 1JYWA 3QU7A 3M33A 1MI5A 4UNVA 1IAOB 2YUTA 1Y9DA 2LE9A 3IV6A 1IRXA 4C2AA 2FIKA 3C3JA 3HKCA 2WZDA 4GO8A 3M5PA 1N2ZA 4Q9QH 2BE9A 3CHOA 2FNBA 4RVCA 4BWGA 1S1CA 1SMOA 5HHOB 1E8XA 3W0WE 3DO8A 4MI1A 1ZLUH 2AABL 2BOVA 2ENPA 4KTEL 3MRNB 2FQXA 5EDSA 3X3FH 1UXIA 3AL8B 1U8CB 2JKVA 4KU4A 3OIWA 4XCYB 3PQ5A 5A3SA 3GSRA 4ZVVA 4XP6L 5EHQA 2PZGA 3ACBA 3X2QB 2QNRA 1RMQA 1QSEB 2XA2A 5C3UA 1DS6A 4DGUA 3X1GA 4URFA 4QG7A 1TO5A 1BNCA 4N8VG 3SE6A 5AVVA 2JASA 4J1TA 3UYLA 4IIEA 4TYPA 4R26L 1QS0B 1UBFA 2OBFA 3KOUA 4P3CH 1T5WB 1IOWA 1JIXA 5JD5A 1K8ZB 1AO0A 3E2PA 3IQZA 3C4VA 1WWAX 2RH8A 4QGSA 4R96A 1ZOSA 3FPBA 5JR1H 3VCLB 5KAMA 3R3JA 1GQQA 1IO4C 3PABB 5KVGE 1Z0MA 3OKLA 4AJHA 1VB9A 1QTSA 1K2DA 1DIHA 2AHIA 4J7XA 1FFNB 2IYAA 4FOTA 4L9AA 3SQXA 4ABQA 1Z2AA 3MTBA 4E4YA 2IH8A 3HHSA 4LCEA 2OYMA 3CIOA 1OAOC 1WWKA 5A0VA 1CFSB 5F64A 3F7VB 4IYRA 3L6EA 2O1SA 3EJYD 1Y89A 4KFSA 2QTBA 4J6IA 4CXMA 3VPHA 4GKLA 3I50L 2Z56A 3DKRA 2ZJ3A 2RIKA 3FO9B 2ZWZA 5D2LA 5IROC 1OSEA 2NUTB 1N6RA 4DLVA 4QRUA 3RV4A 2Q7AA 4ETIA 5CS7A 1BGXT 3I0ZA 2VLJA 2PV0A 1H85A 4WV1C 1CCWA 3UBFA 4KAFA 1DP0A 4RISH 5FBVB 1QHPA 5CX1A 4MRSA 2YBRB 4X7CC 2CL7X 1P6QA 5JFOA 1ZVQA 2VR6A 3FTYA 3WENA 4NVRA 4F4IA 2F2TA 4JFSA 4BN4A 5K3FB 1YN6A 1IM9A 1HRKA 1RZPA 3L4TA 1NCTA 1UZ8B 2E2WA 3QKRB 1QYDA 3FUJA 1Z0ZA 2VH5R 4RX4D 4N0DA 2INGX 5LUBA 5CJXA 2D3LA 4V0ME 3SKUD 1GZHA 1E4VA 3ARXA 2VHUA 5FCDA 1V10A 2UX6A 4E2FA 2IHYA 3KWUA 2IAAC 5KSAB 1LE9A 5DNVA 2DUMA 1T6NA 4PZ9A 1H0RA 1ZRSA 3CLEH 1Y81A 3B48A 2G77B 4U7HA 5FOXA 3ZE8A 1F97A 4OLZH 1UKYA 4V39A 3GNLA 1S2GA 2ZF9A 1QHNA 2KZWA 2WLZA 4CT0A 5B1CA 4NPYB 2ZBVA 4OFYA 1SBQA 1ZNQO 3R5FA 1I3OA 3BB1A 1WF5A 1PDOA 5IMOA 1H9AA 1J39A 2ES4A 4JSTA 4CVUA 1CP3A 2F6RA 4MW9A 3RVRA 1WMFA 3KDAA 2EIZB 4ETYA 3DC7A 1PL8A 4H2DA 4H1TA 5T1LB 4O9HH 2EF0A 2J6BA 3B83A 5AYTA 3H6GA 4WX2B 2XYVA 3QWQB 4QCIB 3K35A 2LU4A 4IRSC 2RAMA 4KSBA 4PJFE 2D13A 5AI9A 1N0UA 3QIUB 3UJJH 1QNFA 1YZTA 3GEFA 2Q6LA 3IJYB 1GS6X 3BCUA 1RSZA 2X8WA 3K9LA 4FZ8H 4LXHA 2LAAA 3GB9A 1AR1C 2GPBA 2BD0A 3D8SA 3DD1A 4RMWA 2KWIA 2VXVL 2YIMA 3DECA 4P0PB 3OT4A 3BVDB 3ENKA 3JTTB 4LWQA 2WHQA 3E22A 1O6FA 4D44A 4IQ4A 4MB4A 1IXSB 3WB0A 3EVAA 4NBSA 4I81A 1VL6A 3I01A 2IZOA 2CXTA 2ZS8A 3UMJA 3U7YL 1G9NC 5LBSL 4OSOA 1ZW1A 3H9ZA 2ZCUA 2H3XC 5CIWA 3VC7A 3BUBA 4KX8A 3MNVA 1VJ5A 4RPIA 2Q1SA 3LBFA 2H1SA 1MO6A 3REOA 4NZ9A 2N1KA 3U13A 3LK6A 1L7NA 4OFPA 3PPYA 4O1MA 3QF4A 4TVPD 5AOCA 5TLSA 4NU5A 3VU9B 2X1VA 4LAFA 3LLUA 4R51A 4UXHA 3UZQA 1FFWA 2EERA 1HEIA 5DNYB 4WV3A 5HW0A 3ADKA 5MENA 3O8XB 5DJ0A 2PCJA 5AYUH 3OA0A 4TKMA 5I9MA 5ECYA 2PHZA 4W9DC 1MIEH 3N1QC 3TH2T 2H31A 1J2RA 3BH0A 1GL9B 2EJVA 1JXDA 1FFEA 5HRAA 1KEGH 1PJTA 4I0PC 4FQ2H 5I15H 1IMJA 4AYFB 4G8IA 5I6KA 3UXHA 3SBQA 5CZVL 4LLYA 1T6BX 1IE5A 1WRBA 1O6ZA 1XB3A 1YOBA 2ED6A 3SDDB 2BM8A 4G8GD 3D6HA 4GKAA 1B73A 2DH2A 1M2OB 2BZCA 1RJEA 2CUNA 3P54A 2N1MA 5EEXA 1V7PC 2J8OA 1UANA 4AS3A 4XCNB 1U0GA 2MDTA 2VT2A 2QX6A 1YA5A 1HKFA 3PP3H 4CN8A 4MBRA 4RD0A 3DE7X 1ZT7A 1EGJH 3VI4B 3VH4A 5JIBA 3WXVL 4IU3A 4CV3A 1FDTA 3AP2A 5EXEA 1WEJL 3EJTA 2DQJH 4XO5A 2VXYA 1ZMRA 3GX1A 2J3IA 3VX0A 1J8VA 2TMYA 3S5YA 5EESA 5FKAA 2D5BA 2J72A 4BNTA 2B14A 2BFBB 2CGRH 1KLGB 2RHBA 4EVNA 4G9DA 4YLYA 3U09A 2Y22A 4YO7A 2NXYB 2HPAA 3QRBA 4YBZA 3IJ8A 2IJGX 4IBVA 1BD4A 4H1LG 2FHFA 2B0SL 1KMGA 4ODWA 4Q15A 3K15A 1X5KA 2WV7A 4KFTA 5HHQB 2LIVA 4A8JB 5JMWA 1RSFA 5DSXA 1X92A 4E09A 1WL8A 4FKZA 1NY6A 4E2ZA 3AK4A 1NBMA 4RL4A 2BUBA 3S81A 4I1UA 4LY0A 1G9SA 2Z8YA 3O93A 1HNYA 1JECA 1X1BA 3H5WA 4BOYA 2COKA 3RWGB 1JDAA 2MCPH 4YLQT 5DNAA 4E5NA 1QHOA 3PWNA 5GQSA 4PYNA 2F1RA 3NRJA 3EO1B 2KM1A 4N2GA 2FIRT 2WU1A 5DMIH 2X5JO 3D4NA 3FQNA 2H6EA 1VE6A 3F8TA 2W22A 1U0FA 1VIMA 1GY2A 5C18A 3T5WA 4GM4A 3UT5B 3DROA 1R74A 1N33B 5CGTA 5C71A 3H5NA 2AJ3A 3O3DA 3NATA 4J1TC 5HBGA 2AFIE 5KWEA 1PJRA 4HUKB 1HE8A 1AJ7L 3SHQA 4C2UA 4D0RA 3PXJA 2ICWA 4AVIA 3EW7A 3L77A 2HPVA 5E03A 1JF5A 4JBLA 1II9A 1NXSA 1IONA 5IBCA 1PGNA 5A02A 4ISVB 2UVQA 4ZAWA 4BH8A 3QGVA 4KXFB 2CXKA 1OR8A 2WRZA 1XZPA 1DQMH 2A4KA 2VP0A 3KYJB 1IM5A 4HL6A 2Y1GA 3OTQA 1QBLL 1RI4A 1Z5UA 2WG1A 1B2WH 4PS3A 5IDQA 1EJ8A 1GD1O 3DBOB 1XT6A 5H37H 4IOIA 4ELMA 3L5OA 4OXXA 3HJTA 5DSCA 3ZLBA 1FJ1B 5HRUA 5D96C 4AE1A 5DI9A 3VWJC 3UX9B 4N8VB 1U8NB 4NQDD 3VXTB 4GFDA 4ODUB 1QH0A 2DTDA 3ZD7A 4UHKA 3WE6A 5KSPA 5EZPA 2OCYC 4YRTA 1YYLH 3WYEA 2H59A 2AQSA 5A16A 3D4IA 1VKRA 3AYXB 3TO2B 2PUTA 2MJWA 1CF9A 3T52A 4W8GA 4IRJA 1CUOA 1AS3A 1IQDA 2DG2A 2P3YA 5F72S 1XTLA 2D03L 5GS1B 1X7DA 2NSDA 1K8IB 4UV7L 1I1YA 4DY6A 2V9QA 3PJSA 2WWXA 3HZOA 2DR0A 1W0WB 3WWZA 3C8MA 1WE2A 3O2QB 1NGYB 2WCSA 3UZUA 1K8XB 5BQOA 2GPAA 3RL1B 3WSWA 5CBEB 4PQYA 2E4ZA 5GJBA 4WNSA 3HCAA 1EAOA 1RUML 2FUG6 4I4TB 5MI0C 2NZVG 2ZBRA 1MHPL 3MA7B 4WI5A 3WHXA 4C47A 3C6XA 3QTTA 3SVLA 3L7JA 5EU6A 1UQUA 1OT1A 2NDGA 1SXGA 3FD8A 1IGCL 3V6OE 2J4WH 1HK7A 2PKRA 1DDIA 1TQ6A 4C4UA 2BSSA 2DIEA 2G0TA 2XQYG 1URIA 2IYYA 3SVZA 1VA9A 2DSNA 1BZ7B 4B95C 4DABA 4IR7A 1N3NB 5A3IC 2AQ8A 3T8YA 1KV3A 2ZXFA 1B0GB 2N9UA 1X2EA 3ISVA 4C7VA 2Q4OA 3HLAA 1G8KA 1S5IL 1IAII 4GINA 2AQIA 1JDBB 1OTUD 1KCBA 4BLTA 1S7SB 3DCNA 4XA8A 5AIBA 5DYWA 1CFBA 4WL0A 2D8MA 3NJNA 3VVMA 4QTIH 4LEOB 1Q50A 1WBYB 1NPUA 4LCWE 5C92A 4NS4A 2X6MA 2X4TA 1SWVA 3EQ7A 1HGXA 4OQXA 3LC1O 2H26A 2P24A 4P05A 4LPSA 4F3TA 4NI6A 5BCAA 4DSNA 5L8LB 1LV7A 1DJXA 2WVVB 1N78A 1TF7A 3VYUB 4R7VA 4CEIA 5FGSA 2V4MA 2YWZA 1P9WA 3DULA 2JQAA 3B9KB 4RSVA 2ZSWB 4TLKA 2BLNA 1DAGA 3SJVB 4QHLB 3R6TA 3LBAA 4FMCB 2JLUA 3FQTB 5F7EH 2ESVB 5B37A 2YXDA 1NDGA 4X6CF 2P9HA 4AM0Q 1WAPA 2O5YH 1IE4A 1Z36A 4JX8A 2VTKA 3OFND 5I1HL 3OJ0A 4W5QA 1V1MA 3I1FA 1GR7A 3G0DA 3QHZH 3DQPA 1K4DA 4AMGA 1G64A 5FPQA 4GD3Q 4HHAA 2QD5A 1A7PL 2PEZA 1TETL 4EI6A 1WCWA 2HGZA 5DO2C 1E5CA 1T03H 5A6IA 5IM5A 3TN0B 1ESNA 5LA6A 3LUAA 2J6EA 5HYSG 3KPPA 2HKFL 1UIMA 3APMA 1P4BL 5K51A 1S7RB 2JAQA 2WQRA 1SPDA 4NCJA 1ZCRA 1N2RA 1LSSA 4PQRA 5HI3D 4JRYD 4OI4A 3WHE0 5FBRB 3IE9A 3WCYA 2Q2QA 4MAAA 1XVAA 3IMGA 4B8ZA 4AZ0B 1KTRL 4Q3BA 4UTXA 2BVPA 3PGJA 3WRYA 3MRFA 3GXTA 2DQMA 3FPSA 2Z7UA 2VMJA 1HXYA 2FNWA 1A6TA 1PJAA 5ETUA 4B9JA 1Y7TA 4R54A 4NQVA 5CM1A 4H6WA 5DO9A 3M8KA 4DARA 3QS2A 3HPJB 3RUAA 1PWYE 1RWMA 1XGKA 1ADJA 1QD0A 1RHHB 1E9CA 1ZANH 2ALJA 3OQPA 1QLEL 1UDCA 2RIPA 4BK5C 1AS6A 1UBUS 1IZ8A 3KPNA 4ELKB 3ZV7A 3IKCA 2ZCJA 4Z4CA 4CBZA 3RE0A 2CKMA 3R0NA 1IEBA 4NJ9H 2VZVA 3ZCRA 3QULA 5KWVA 5I0ZA 2ZJYA 1CGSL 4NCDA 4NZPA 1VYHA 2J3MA 2VJOA 5BN3A 4KO8A 5FDYA 1K0FA 2LLGA 1CY0A 2QR0A 4MV0A 4Y5VB 2WSLA 2C4HA 3M2TA 3GSWA 3GM0A 4GLFA 1SOVA 2VPQA 1MQ9A 3BC9A 1N6HA 1IHPA 2GAZA 1W9XA 3ELUA 5ADOL 4Y2XA 4WENB 2AXGA 1SEQH 2A6IA 2Q3EA 4R9HA 4MGYR 1WV1A 2YASA 1FVEA 1ZGLB 2AOWA 1HIML 4O3FA 5JCJA 3DX8A 1F86A 2J0UB 5SWZB 4G37A 3V0DA 1A4BA 5AM2A 3MJ8B 1E5TA 5HUQA 3DUSB 3WGLA 2CK0L 3PNMA 2GVDC 5EJGA 1J0JA 3FWNA 3P0VH 1SCDA 2C2ZA 1MHTA 3KFVA 3MUUA 1T1SA 3P2DA 1EUCB 3TT3L 4PP2B 5EGSA 4KQCA 1NBOA 4M7JL 3JVEA 3DLCA 4OQFA 3A9RA 4G4GA 1AGNA 4ILDA 1OGAB 4OGLA 3W5BA 3ECAA 2NY6D 1SU7A 5HPMA 3DHJA 2A84A 2DHCA 4ZXBD 1FC0A 2F3PA 3DV6B 4PIVA 3GI9L 1KDJA 1UD8A 1EPFA 2HMUA 1T3LA 5D1XB 1U8HA 3DHNA 4H1LB 4ZTOL 4BYHA 3FAXA 4FDMA 3KBEA 4PCYA 1JLMA 2JK1A 5EC2B 3X12A 3COVA 4E6PA 2FDBP 1L5GB 2XMRA 4V1CB 4I9NA 4DQOL 2JV6A 1A4KA 2BF4A 4H20L 5MEPB 3PF2A 2QX8A 4RYDA 4YV2A 3DTUB 2GZ1A 3A6PC 1NAHA 1D2CA 2VITB 5T3ZL 1D0SA 3URMA 4DBLC 1WVZA 5IVXE 5IJAA 5TR9A 2C4VA 1LDPL 2DH3A 2CJWA 4UHFA 5A2JH 4GKVA 1ZLXA 3B2VH 4JOBA 4C2BA 4Q16A 1YFJA 3B6SB 5CVEA 2PQ6A 4I66A 1C12B 3MRLA 1HMPA 1X9QA 3CFBA 3O4LA 4YJKA 1A69A 3DEHA 2BHFA 3FDXA 5KX5B 4N0FA 3QW9A 3MBOA 3V7WA 1HCYA 3B2EA 3ZY6A 1UA6L 2X6AA 4F1WA 2PWFA 4WK2B 1DVFB 4YOKA 1IFXA 4OD3L 3I9AA 1F41A 1VE7A 4F46A 2E5FA 2JARA 1Z34A 3AEXA 3PFWO 4P3KA 2GHIA 1ZFNA 4YP1A 2GMWA 1XDSA 1F4WH 4NZJA 4HSEA 4Z7QE 2F5BL 3DK2A 1HHJB 1IL1B 5FM5M 4NC0B 2MSWA 3IVRA 1AKPA 1DE0A 3HBNA 4UPVA 5L3VA 4B5LA 2CG9X 2PXHA 1JG4A 4CVNA 1OAZL 5CEFA 4LAJH 4M1DH 1EVQA 3RVWD 3UG3A 2BZGA 1Y6NR 2W2TA 2A0YA 5IW6B 4FFVD 2XXAB 1ZISA 5ICSA 3VFNB 1Q3KA 5LD2C 2EE9A 5E23A 3H5RA 1W5SA 3B56A 4HNAA 1EXHA 1EXUB 2ADGA 1M7IB 3VXSA 5DD5L 2UV8A 1CXLA 3FFCB 4BX2A 1DQJB 5HIMA 3C5WP 4GG6B 4Z3EA 1CQJA 4JFPB 5D3QA 5SZIA 4YRRA 2YPVL 2AZTA 3EGWA 4RE5A 1WHSB 3H75A 3ZLUA 2BIIA 1JIVA 4BMZA 4O2FA 1M72A 3ILQC 4G42B 3JV0A 5JUWA 3SKJL 5ITBL 3Q8AA 4XVQA 4MQEB 3X13A 5DURD 2CR6A 3ZHTA 2D1FA 5IU6A 1PKQB 3FNIA 1JNYA 3VNYA 3LV3B 2JA1A 1EVTC 2AYZA 1ZH8A 4JUIA 1I7UA 5I75B 2VP3A 1NYLA 5DVLA 2EYSB 2NU7A 4KRFA 5DF1A 1T9CA 3LVQE 1C9SA 2HNKA 3DV0B 3AWFA 1BN7A 1TK3A 5ABPA 1RIHL 3T9EA 3QCVH 1A1MA 1J0AA 5FCSH 5JTUA 4Y2HA 2IFGA 2JXMB 5LG1A 3KR2A 3QWIA 3OFSA 2PFGA 5CUSH 3DGGB 3SDBA 3JD1A 3IBYA 2FECI 1GAFH 2GKIA 5CDSA 3HB3B 4HIHB 1PR5A 2AG8A 4JI3B 1ZSDA 2ODAA 5E0QA 1MFCL 3NANA 3OTGA 3ARBA 2PWPA 1OFIA 4IHJF 5PNTA 3NBAA 1G6KA 1YZVA 4PGAA 3FFBA 4DDUA 1O3YA 2HT3C 2MNUA 4QXUL 2W9XA 2NXZC 4O4HA 3LZCA 1FRGH 3BRSA 2P2NA 1CGVA 1U3HB 5C1OA 1F90H 2YJ5A 1EWHA 1RFDH 3CPEA 1P5UB 5HVWA 4QM6A 5JVDA 2OP4L 3TBVA 3VDRA 4ENTA 1YB7A 3FVTA 2WG0A 1BF5A 3REVA 1QP0A 3WD5L 5EMHA 3GMRA 3W7BA 4EYOA 3PS9A 2WM3A 4K15A 4XN2A 2G1UA 3D43A 3CR7A 3SE4A 4I18C 1ADBA 3ID6C 2W90A 4KJXA 1E2BA 1T21B 4UTCA 4MW0A 1IFHH 3TJHC 3T1TA 1OI2A 2WBJC 3W5IA 1MFVA 1JN6A 4ZW5A 3U4KA 2IYLD 1C16A 4U6HA 4NJOA 5JJBA 3K1YA 2IS2A 2BNRD 3IBOA 3RVTC 4NBNA 3K6SB 3GEMA 3ZTDC 2FGWL 3E9EA 5BV7A 2GI0A 3G9AB 4W9ZA 3AP3A 4UZUA 1VMDA 2R4QA 4HDRB 1JW9B 3KPVA 3ATBA 3MLBA 4CNIB 1MQSA 4KN9S 1EFXB 3H55A 2D7OA 5IK3A 2GLXA 2YQ5A 4NKDA 2V0GA 4M61A 2GZMA 3PDOB 1WQ1R 1KL7A 4PBWD 5CSGA 5CEEA 3WRYC 5J2UF 3ZTJG 1DCEA 1ZSVA 1K5DA 1L5SA 4D8VA 5JDSA 2QJFA 4TLMB 1LI7A 1Q5PA 5F8RC 5ICFA 3P9NA 1UEYA 3LN9A 5CM2Z 5E1BA 2VUSA 4MR7A 3EA0A 5KUMA 4NRDA 4X97A 3RS2A 2A6PA 3OLXA 4EVIA 1GL7A 4ZYKA 1ZLSH 5EYPB 3SGKA 2J8UF 2YPLD 3RFZB 1XLTA 5HYSB 5LBTA 2P26A 5H7XA 4D8UA 1HQRA 3MJ7B 3BMNA 4HP8A 3GBLA 4RDHA 2BGGA 1CNFA 2FYYB 2A8YA 4HMDA 3ZZQA 3OU2A 1QLEB 3VFSB 2IGFH 4P86A 2XIBA 2BI8A 4KGZA 3STBA 1KJQA 1FNHA 2SHKA 3HBJA 2BTQB 4NWIA 2BIHA 1MJUH 5E2WL 3MVEA 5H9WA 4HXAL 3TKYA 1QEXA 1QVOA 1RPTA 2R29L 3BFVA 4BRSA 4WQMA 1I01A 2OR9L 1TO6A 1XEWY 1SEPA 1D5RA 2H0FA 3EOTH 3AROA 1K89A 1RH8A 3DGEC 1PG5A 1INQA 2QUAA 4J2HA 2DWTA 1QQTA 5C8YB 1DWPA 1XALA 4NUJB 3PEVA 4WVRA 4P59L 2OA0A 1UWVA 4YY3B 2H32B 3PREA 2QMHA 5B1JA 4KBYA 5HDQL 1LC0A 1EHYA 1P1JA 5SWQA 1POXA 2OBNA 5F1KA 3H8JA 5JRZA 3RYFB 3NFRA 3DO7A 1I7NA 1TEXA 4CCYB 1G3MA 4AZTA 4CM4A 5E99L 1MVFA 1PJ9A 2OL4A 1OHZA 2VFAA 3QVGA 1OAQH 4ZIRB 4PF1A 1OXSC 5J4HA 3CF4A 4Z4HA 2PX5A 4CFSA 4OGZA 3R5KA 1EK5A 2ZKIA 4IJ6A 5I17A 4RBPK 1R34A 4TV9A 1RHUA 1H1DA 1ZUIA 1NPJA 2R6R1 4WO4D 4UBNA 2BBTA 4YHHB 2ZIWB 5IV2B 1B0WA 1VDMA 1QAOA 3O1IC 1CLYH 4JLJA 4HZLB 4DUPA 1HYBA 3CH6A 4N5NA 1R8XA 4WFKA 3OZXA 4ZV4A 5C6TH 4KMMA 4U1HA 4WBNF 2R1YB 3ZGLA 1T04B 4D8WA 1BMGA 2I4MA 2BM0A 2PN1A 3WXBA 2BL4A 5I3ZA 3MU3A 4Z2AA 5AOVA 2LR0A 1WBBA 4L5YA 2OBYA 3SDAD 1ISSA 4BJLA 2HC9A 4P06A 4KMOA 5ALYA 3ETCA 2QQKH 1FZJB 2JVKA 1KLUB 3ASYA 3E2HC 1H3XA 1PR1A 3KPSD 4M1KA 5EZ6B 2NYZA 4DREA 2J1WA 4NL4H 2P28A 2EZ0D 2B94A 3IVCA 4KRPC 1HXMA 3JV7A 4LVCA 4P9MH 5LZ2A 3T3NA 3BVNA 5LAXA 1A3ZA 3SKMA 3PB3A 3E9CA 2FQ1A 4URWR 1UZUA 1MNQA 1ICEA 1RZFH 3GJ6A 2QJRA 1WD9A 4DWVA 1LTXA 3QQNA 3H2JA 3VTAA 1C1YA 3E35A 3X1BA 5D9SA 3EXFB 3OQ1A 2OCCB 3RVXC 2NLJA 4Y2NA 1QJ4A 4AZ3A 2HRLA 4LXYA 3AG1B 1T1WB 5HVNA 2F48A 5L8JB 1HOCA 1VB3A 4R2GD 1ODCA 1FV1B 4KK5C 1IDOA 2JL1A 4LO9A 4C4BA 3PWSA 4Z3KA 1T0NB 3R0QA 1A88A 5CINL 1WM1A 4WFGD 4ZHQB 5M3BA 2ZCHH 1G9MC 1RJZB 4P38A 1QONA 3PFCA 2LW7A 2R48A 1DAHA 1GGCH 1TIPA 4CQLA 4MYSA 5KJRL 3GLFA 3ZR6A 3IRVA 2J2ZB 4QTFA 1JYNA 3F4LA 4NZOA 3PE4A 1DSFL 1E65A 5DU7A 1WF3A 2F9MA 3F05A 5BOJA 4L8DB 3IXLA 2VMCA 4ASUA 2QYTA 1QP1A 2FH6A 1SOMA 4ZALA 1Y4UA 2NY5L 2FSVA 5DGIA 1R5JA 3LNFA 4CF4A 3FOCA 5FTLA 3FLEA 2W93A 3Q40A 4NBUA 5FI3A 5C09D 2XCMC 3BDVA 5HHOA 3RVNA 2W42A 3PAVA 2Q8AH 3OT1B 1BXVA 3MRNA 3W2DL 4JANB 2A38A 3IP6A 4RA6A 2XDQA 4IIVA 4KYVA 3KKQA 3WTVA 1DKRA 4NCBA 3AL8A 4OJDH 1U8CA 1Y3BE 5AB2A 1WVMA 5DXJA 4YNYB 4PHCA 1NSNL 4HDQB 3QX8A 5LMCA 4JM4L 1JDUA 1YEJL 1HFJA 3UYPA 2FN9A 1THCA 3IH5A 2AS0A 4ZS7H 4FG6C 1QSEA 2VHVA 4ELMF 1JKFA 1BXAA 3RC1A 5KS9E 4AMYA 4O58L 3RPBA 4Y6RA 4QBIA 4ZRMA 2JFXA 3W9EB 1QS0A 1ACYL 4RCVA 2EE6A 1JHDA 1T5WA 5DS1A 3HYSA 1Q9OB 2AJVL 3GBML 5LXTB 5A62A 4ECNA 3IDOA 4YONB 3G2MA 2PNDA 3IFOB 1I14A 4RZSA 1U3FA 2Q5LA 3HA2A 1M42A 3BHBA 2DI8A 3QKSA 4L15A 3HZVB 4BNDA 2FEJA 1UINA 3ARBC 4GO6B 1FFNA 1VDGA 4HP5A 1TZ2A 2X6RA 4I46A 1L9OA 4M88A 2WSBA 1AQIA 2RGYA 1Q0PA 5K0LA 5AVTB 1SDYA 1A72A 1BE1A 3DVIA 3GKZA 5CXXA 3PWJA 3MBEB 3F7VA 1H3UA 1UOLA 1HKLL 2BNUB 4AJ2A 4LWPA 1X5FA 5LQMA 1EJBA 4XQGA 2SKEA 4V2BA 2DMHA 2AN1A 2I6SA 2CKNA 4G80B 1RC1A 5AJZA 2EH8L 1NUGA 5KOVC 3GKWL 1PZ5B 4MRNA 3FO9A 1W4AA 3DEKA 4QUHA 3TM4A 4EEZA 2IU0A 4JPWH 2NUTA 1CE8A 3FPXA 3IQGX 3KD4A 1ZTXL 2XMSA 4MV5A 5E7QA 1TSHA 2Y68A 3DWIA 4BO4A 4ZQEA 5DD6B 3OZTA 3GM8A 1QRUA 1JLLB 5CLZA 4QAQA 3N6VA 3FCUB 2OV4A 1CEYA 2HUPA 1DDHA 1FE8L 1PX3A 5ACZA 2WTNA 4AQ1A 5K3FA 1QO7A 3QFRA 2Q6KA 3GD7A 2WJYA 4NG5A 1UZ8A 3QKRA 3D3WB 1RK1A 4KUCD 3IYLW 1QV7A 1CFVH 2QGNA 4Q4CA 4KMTL 1X0VA 3WL6A 3RH0A 2GBGA 4DVRH 4KXUA 3ZLJA 2C5DC 3UCEA 2QTLA 4XVUD 1WDLA 2WLIB 5IMKB 1CUXA 2Z04A 3JD0A 1PT9A 3PG2A 4KL8S 4MWFA 1AY1H 4MVBC 2H7VA 1R9JA 3GDWA 2G0KA 1GHFL 2DBLH 2QPDB 1LLUA 3ZEIA 3BKJH 4MPJA 2PTUA 5GADl 1TXKA 5FR3A 4MH0R 4ND6A 2H3KA 3IERA 1K1EA 4RGNE 3O0RH 2JFVA 1QHIA 4EWLA 1CUIA 2GY5A 3QP3A 3SGKC 4FS8A 1RKQA 4J8RB 2YV2A 4NPYA 3DE2X 1SZNA 1MCHA 3TBYB 1EFCA 3ZV4A 2V7VA 4W9JC 1X9HA 3DMGA 3KL5A 2Q86B 4BIMA 3R1GL 1YMUA 2OTUB 4FOOA 3GJQA 1I4OA 2ZT7A 2X2OA 3ALXA 2NYAA 2ZG3A 3GJ4A 1XTJA 4KW7A 2FBJL 4WE3A 2WDZA 1WUTA 4DJEC 3M1CA 5T1LA 4KQ3H 2HJRA 4MGZR 2DUUA 4QCIA 2IBMA 5C7LO 5ANME 2EZTA 2CGZA 4HLCA 3UAJD 1GCYA 3QF7A 2XN9B 4AC9A 5LA6F 2PCPB 2E7LC 2W9LA 3O8QB 1ZN9A 4PEEA 1DEKA 4MCNA 5DJ5A 1EFHA 5AOLA 3LHKA 4WNIA 3GYGA 2AANA 4Y9FA 1V26A 1FZMB 4AWAA 3LKQB 3AUFA 4EAAA 5EWLA 3PIQB 5F1KC 1M2FA 2V6GA 4UUNA 3IFPB 4HWNA 4LISA 2R2GA 4P4KA 4R90H 3DXFA 3NRBA 4K9EC 3TL2A 1ZK4A 2IAMD 1J42A 3Q1KA 4OCLC 4XOIA 2CFSA 4TQEL 1A9RA 1NJ9B 1R3DA 1YR8A 5CCJA 3ZUNC 5IYZF 4PJ5B 1KC5H 4EUPB 3TPUB 5LDGA 4N2MA 1KK0A 4OLXL 2CBPA 3AQZA 4DTIA 2C34A 1ECFA 3P9XA 1UEJA 3AV3A 3MWJA 3VU9A 1FDLH 1QF7A 3FBWA 5IDYA 1YIOA 4KNUA 2UKDA 4CLOA 1KGUA 3HG1A 4IKNA 2FUG1 1PY4A 3ZK8A 5JORA 3UPCA 3O8XA 1XQVA 1HOEA 2PZLA 3PWZA 1EFPB 2RGRA 1JBJA 3MJTA 1YY8A 3EZ8A 2GJKA 3LVTA 2OZ4L 1J1OH 2Q2OA 5CLTA 1JYFA 3P9IA 3UYKA 4M4RB 3EXEB 4FJ6A 4FQCL 2NNRA 1SRDA 4RK0A 4JNKA 1QH8B 4GKBA 4UQOA 1E7VA 4K7JA 3DPDA 4YCDA 1OGJA 1OGSA 1FNNA 5I9SA 1DPGA 4TN5A 1NICA 3I52A 1S78C 2PR4L 3GXFA 4OZHA 2AV6A 1BQRA 3B1ZA 1JZ2A 3BX1A 3U7GA 5TGZA 3VB8A 5K2MA 3P2EA 4PG4A 2LCFA 1Y63A 5EL0A 1UEMA 3I9NA 3ZZUA 3SS8A 1OAAA 1A02N 4UULA 3GMDA 1RADA 3T0EB 3MJVA 1I8KB 4UUOA 3IGAB 4XCNA 5BQDA 2DTMH 1U65A 4BXOA 2Q46A 1AOXA 4XN5A 3NBFA 2QEJA 1IGIH 1N2SA 4FDWA 3ON5A 3E9DA 4LK2A 4HJGA 2W0FB 1YBVA 2V7BA 3TI7A 4D3CL 1Z7WA 4M0PA 1AN9A 2RFLA 5BVPL 1CXKA 2LVEA 1UB5A 2WXLA 2BFBA 1YS4A 5DYTA 1U0SY 5G1NA 2J1ZA 1I4FA 4ARAA 1DT5A 2C4FT 3BQUC 3CN7A 2PFKA 4B9ZA 1O08A 5C8ZA 2O57A 1AK1A 1PF3A 3KKEA 1CBUA 3PJFA 7CGTA 1QQ6A 4MI3A 3WYFA 2VDLL 2OBXA 4A8JA 4UNSA 3ND6A 4JELA 2FSVC 1A27A 3W9BA 1VMAA 4D56A 5FOUA 1QBML 4XO8A 3HGMA 4ZMTA 2B92A 4NERA 3ZMNA 3NUQA 4GT1A 2GITA 1GNLA 2PLNA 3KTFA 2QTCA 2E82A 3MKKA 5KTSA 2VRKA 1Q1QA 4RCZA 4MS4B 3T4AB 2ARWA 3OMIB 3SEFA 4XWGL 3CFEB 1BJTA 2IP4A 1GZSA 3LY7A 1W72L 5KO2A 2ARJQ 2ZUDA 4CIAA 3UWPA 3EO1A 3BN3A 1MXGA 1NBIA 4HKTA 1HDMB 3BQMB 3UB3A 5JY6A 3QQ9D 35C8L 3LUDA 1QBKC 4NR0A 4MP3A 1TA9A 4Q9CA 3WXWL 1MFEL 4KO3S 5CSBA 1JPTL 4A27A 1QWOA 3KLQA 3MO1A 5IOPB 1GU7A 1A6UH 1MB3A 3BFOA 4ZMQA 1AT1A 5SZHB 3K1DA 3BKWA 1Z4MA 4AYXA 4NH0A 4CL7A 3G79A 3GLDA 1NANH 3W38A 4OBXA 4OJNA 5JIDA 4M8QB 4KLNA 3MSCA 3LCRA 3NTOA 2FPIA 3HFGA 1NW4A 3C3CA 3BDYL 4Q1VA 3WO4B 1YZ3A 2O05A 2PPFA 4TGLA 1CYXA 1YZFA 3K4PA 3U19A 1JD9A 1LRJA 4XPTL 2WBJB 4GLJA 4F3KA 4V24A 3EH2A 5B7QA 5JAUA 3TF7C 1U8UA 4QUIA 3MRKB 3ZQJA 2I60H 3U9PL 2QS9A 3RI5K 2R4TA 1FJ1A 2ICES 2YH2A 2AV1B 4YDNA 3PC8A 4ZU6X 1U8NA 3TXXA 1ATIA 1VECA 3QE0A 4ZEMA 2Y06H 3CY6A 1DBJH 3OKCA 4QBGB 2ESRA 3RU8H 4JIGA 4C7JA 3A4NA 4GYKA 3RIYA 4ENED 2VDNL 1KDYA 4Q01A 1PLAA 1UWKA 3TO2A 3JWDC 1V5IA 4WN9B 1KB5H 3DJSA 1C2YA 2PO5A 3FMGA 2Z6UA 2NPOA 2Q45A 2O3UA 3QZBA 3CSBA 1ZLWK 4TVPE 1K8IA 3NWBA 2MPAH 4H25B 1ENYA 1NGYA 4J8PA 1WBXB 3RL1A 4EY8A 5CBEA 5I7RA 3GA5A 5BMOA 4GT0A 5E8DH 3L1FA 1MGPA 1HL7A 1YONA 4I4TA 4Z5RB 5C70A 3MA7A 3PLRA 4YEFA 2QMUA 3H83A 3L2NA 1P0PA 4S1PA 4N39A 4GY4A 1MU0A 3OWRA 3N55A 5KSAC 1GRQA 2YGVA 5LXVA 4KNQA 4JBXA 2BIOA 3ZHRA 4L9SA 2IV3A 1H05A 3B3BA 3D34A 5EPMB 1N3NA 4Y6OA 1XCWA 2ROXA 3R6WA 2D6FA 1LV8A 4GQAA 5JHLH 4INJA 5GRUL 3IOMA 1QHHB 2VLBA 4G8GE 4JKPH 2V9ZA 4L50A 4XWAA 1H6EA 1JQEA 5JW4M 3W5HA 3G2OA 4X9GA 3THYB 2VM4A 2WLLB 5JVDF 2Q5HA 1XSEA 3IT3A 4LEOA 1XMOB 5DMGC 5AG8A 4KN6A 1Y6FA 2WSPA 3TAXA 1KOFA 1UF9A 2XE6A 3RVKA 4ZUVA 2EEBA 4F5CE 2CC2A 4S2SB 1ZWIA 3LBYA 2UYOA 5HIKA 5U4QA 2JAWA 5EOCJ 3ZCSA 2BZDA 3STZA 2H7YA 2WYVA 4WZBB 3GS0A 5EXXA 3GK8H 3IPCA 3KAKA 3LMJH 5ALKA 4G5ZH 2GKOA 3QIUC 4FONA 2ZSWA 1RAMA 2C58A 4DA9A 1SIWA 2BCJQ 3SJVA 1FMFA 3BB4A 5L6MB 2VP2A 4UQ9A 4HAWA 4ZWNA 1MMFB 2ESVA 2YIVX 2QW0X 4GX5A 1L0BA 1MW1A 4L8CB 3I5AA 1J5DA 1A5FH 4LP8A 1WCV1 1WW3A 2AEMA 2G88A 4K7FB 5DZNA 4PZZA 2XB6A 3PFFA 1R0AL 4CCAA 2VIRB 3ZNQA 1T4MA 5LBSA 4NC1C 3F8UB 2UUOA 1ENPA 1FYFA 4LVEA 4OA5A 5B1IA 4GUQA 4RMTA 4OLWL 5I26A 3TN0A 4IH9A 4KYUA 3I6BA 2OHJA 4BUCA 1EMTH 2YQ3A 4L8VA 4KHZA 5K8CA 2HWUA 1VYTA 2I99A 4OZIF 3AUYA 2XEXA 2UVEA 1S7RA 5EO0B 3HYTA 4TV3A 1MFPA 2A0LD 3W79A 4TZ6A 4XI5C 4YXHL 4WKGA 4AXWB 3O8XC 4NS0A 4D2IA 4KVNH 1ZY2A 2C2KA 4P2YA 5F1IB 1WS7A 4EF4A 1Q19A 4M0KA 3H18A 5C5IA 5C5DA 3WX0A 4H7VA 3UW3A 3GT4A 1DAIA 3TDMA 3OAAD 4MXQC 3RWIB 5I0XA 3KHTA 1NPDA 4BS9A 1NOLA 4H4CA 1BROA 1IC1A 4RSMA 4RKYA 3N44B 4CTKA 3DT8A 2NQTA 3HPJA 1G5HA 1GOGA 1ONBA 2JD2A 721PA 2GILA 5KVEH 3F7RA 2VDKL 3QEUA 3U3OA 4DKFL 3H9YA 3NZHL 2F64A 1RHHA 1CDOA 1P5ZB 1ZPUA 2HYMA 4MMYB 3SDDC 3OR7B 2Y93A 4CM3A 1GCOA 2XOKA 1OANA 2ZSFA 1U0EA 4IBZA 4ELKA 4RKWA 3UJ6A 4EQ6B 3I0MA 1EXDA 1J0YA 2G3XA 3ZVRA 5BR4A 1ECYA 1P77A 1O7JA 1ZUNB 4PCSA 5AVXB 3UAVA 3LZNA 5HFJA 3UF0A 2HQ1A 4TV9F 1ZBDA 4C4OA 1OARH 3ISTA 1MJ8L 2HG0A 1K7FB 2DPKA 1T4CB 4OAPA 2R0LL 4HB0A 5HWSA 4PS8A 5K9JL 2WUWE 3DPBB 3ULUH 4X7DC 4F7EB 3H85A 5SX4I 3GELA 1QVRA 3M1LA 3KIPA 3D39B 3QUHA 1G8JA 1TZKA 4MWDA 2IIVA 3JZ7A 5B3LA 2FG7C 4MDIA 3ZR4B 3GJ8A 2X38A 3FPAA 3QEBZ 4JY5H 3WGIA 4DW2L 5DHXB 3GXOA 3I61A 5C52B 1RLWA 3RFUA 2J67A 1QDLB 1VI6A 2J0UA 4KI0A 5SWZA 3VGFA 3UJTL 3H7AA 1FUUA 4NZNA 4ZEWA 4DMLA 4CF3A 2VDLB 4A8JC 2EW2A 3OE7D 1I1OA 3DUSA 2Y1AA 4WAUA 3L16A 4RQAA 4F7TB 2DOKA 4JFWA 3TFQA 3L05A 3T0BA 3A7EA 1C0IA 4QPEA 3SYCA 2QORA 4X92A 4UINL 3ZWYA