2VDPL

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpL01
4R4BB 4U1SB 1IC4H 3IETB 2WUBH 4BH7B 4UUJB 3MJ7B 4MXVF 2LAGB 2IQ9L 4AH2B 1JTOA 1IKFL 4H1LA 2XPGB 2F58H 4KUCD 3AMLA 5J12C 4NQVB 1QOKA 1EFQA 2YD6A 3FCTA 2MTPA 4OCLC 4P2OD 4L3CB 4YBQD 1YEIL 3T2NH 5C0EB 4R4FL 1BQLL 2P49B 5CP7B 2FWOB 4X7TA 2VXQL 3WLWD 3OXRB 4HEPG 4Z7UA 4ENEC 3RWHB 1EUTA 4DFIA 1G7HA 3L3JA 4M6NH 5A16B 2DLHA 5BW7A 4LKXB 4JR9H 3EO0A 5MERB 1NGWB 5DI8A 5L8JB 3D9AH 4HUMB 4ODHL 5DTFB 2X1QA 5DRNB 1JPFA 1QSFA 1XF4A 1AR2A 3N85H 4JFQB 2IEPA 4XPBH 5EOCL 1Z6JT 1HHGA 5F72S 5ESVB 3LMJH 3STLA 5IVOA 4XCEB 1YEIH 1RZKH 2CUMA 5HI4C 3CX2A 2ADJB 5CWSA 1Q0YH 4LSUL 1ZHLB 2YRLA 3FQXB 4H20L 4ODTH 1A3QA 4QRPD 3SGKC 4IBLT 1TTFA 3ZDXE 5GGTL 2MOVA 2PO6B 1DQQA 4KDVA 1AXTH 4U05A 4IS6B 3PWNA 4AH2A 4MJ5B 1HH6B 3SY0A 4LIQE 1E6OL 4NZDA 1QLRA 4LCWA 3MUJA 4WY7L 2XY1A 2EE6A 3JBG7 2AGJL 2VSCA 5DUBB 4DN4L 4X4XA 3LSOB 3MRMB 3ALXA 5F1OB 4P46C 4PGBA 1MWAL 4S1SL 2YK1H 1NLDL 2FBJH 4JVPA 4DKDC 4QT5B 3LQAC 1FO0H 3T0EA 4XAWL 4ONFH 1B88A 3SDCD 1HEZB 1R0AH 3CNKA 1YMMB 4P2RA 3Q6FA 2O61B 4LCYB 5IBTH 4EI5D 4LLVA 5I76B 3V6ZA 3OKDB 5CSGA 5SX4I 2R2EB 1FN4B 1UVQB 5KVFH 1JPFB 4M61A 4HKBA 2B7DT 3PGCB 3VI3F 5FYJL 5FV2A 3S36L 4M1CC 4BUHA 3WFEH 1Z9MA 4LLQB 3WFHB 5E6IB 1KXQE 3DPBA 4EQ2A 3U9PL 2V2XB 4WWKB 5KVDL 2W0LA 3CJJA 4Z7NF 3ZT6A 3GMNA 1MQKH 5D1QB 4LQ1A 2H32A 1RIHL 4LF3B 2HT2D 3H7BA 1XIWD 3V7MA 1MLCA 4KKCD 1DVFC 4TUJB 3V6OA 1I9JL 5EZLB 1HSAB 2EE2A 5FV1L 2X89D 1DQQB 1EIBA 3SN6N 1SEQL 5D96B 1XGRB 2QHRL 1JPSH 3X3GL 3BESR 1X9QA 3IDMB 3KWWB 3BEWA 5JR1L 15C8L 1S7RA 2DQHH 3H0TA 5FHAL 4PBXA 4MD0A 1LEGB 2G2RB 2IALB 5F3BA 4DEPB 3ME0A 2H2PD 4KQ4H 2DMBA 4R96B 4LRIC 5E2VH 3SGDI 5HGAB 3SKNB 1QSEE 2O5ZL 3DV4A 5FO7B 3MODH 2EDLA 1AGDB 5T1MA 4DN3L 4I0CC 4WU7B 5TE7L 1LDSA 5CINL 1M7DA 3RPIB 4QTHA 3VD5A 4CGTA 4MVBD 2XYCA 3UTTA 3PWUB 5J9PA 2COQA 3HNSH 4E41D 4L4JA 5D93C 1LK2B 3M45A 2QTEA 4TSAL 1T1ZB 5JMRA 1BBDL 1Y18B 3CPLA 2ZKHH 4XP9L 1J88A 1UENA 3PQYA 3MA7A 2YXMA 3FB5A 2E9IA 2E6JA 3B9EA 1UH4A 3CX5K 5DDHB 2XNAA 3O8XB 4PRPD 4XWOC 4M8QA 3L3GB 2DWEB 4Y1AA 3VJ6B 4CN4A 1DQLL 12E8L 1EEYA 1QBLL 2OP4H 3QUXD 5GJSL 3SDAB 4P2QA 4Z7NE 4XPGL 5K9JH 1GXEA 4FMKA 4EUPA 4YHIB 4KRPC 3LPFA 4MQTB 1KGCE 1CE1H 4F3FA 5KG9B 1YNLL 3P3YA 3WEXB 2EH8H 3IDMA 4LEOB 5I8OH 4YDKH 5GSRA 3QRGL 4X6CB 4L8SA 3CZJA 5GJSH 4B53A 4I3SL 5FHAH 1ES0B 5I1JH 1KCSH 2W9EL 4C56D 3T09A 1A1OB 4MD0B 1WEJH 3V7AG 1FYTA 4RGNE 3VFMB 2LU4A 4ZQKB 2F8OA 2VDRL 5FK9B 2KUTA 4WO4A 1KN4H 2FH8A 1M7XA 3BP7B 1BZ7A 3H3BC 2IAMB 4KK6C 4AEIL 1K9TA 4MD5B 3EO9L 3CVHL 4PP1C 5IF0B 4YGAB 3LD8B 4YX2L 3CVIH 2OL3H 3E2HC 1KJMA 4NRXA 4HK3J 3T77B 4L4TD 4DQOL 5IB2B 3ILQC 5IBTL 3T1WA 4JKMA 3BI9X 4QHKI 1FLRL 3D39E 3Q0HA 3I3BA 1F3RB 4JO1H 3VXNA 3MXVL 1Y6NR 3HAEH 5JW4R 2BFVH 4G7VH 4KKAD 2OSLA 2LAAA 5FUOH 1J5OH 4ZTOH 5CEZE 3JWOH 3QUYC 2NYYC 3ZL4L 2XZQL 1DQLH 5HJ3A 3TA3A 5DO2C 3GEWB 2DMKA 1MY5A 4RMSA 3BW9B 1QFWL 4DK3A 5FGSA 5LGJA 1J8HB 5F1IA 3OB0H 4UIKH 1MFNA 3IDJB 3S37X 2EIBA 1G7QB 3NFSH 2J1KA 4DZBB 2DM2A 4NIKB 3LRSA 4U0RB 1BHGA 1CXEA 5CEXB 2MSPA 4HQQH 5C0NC 1XGPB 4ELKB 5TDPA 4LOUC 4M6ML 3T65A 1MCHA 4AENA 3DYOA 4WI6A 3V6OE 4PJ7E 5E8PB 3MQIA 4TOYL 4KXZH 3ZLQC 5DJCA 1Q0YL 4Z18A 2WBKA 3S35L 4FQXC 1I9EA 4R0LA 4IDJH 1XF1A 4X7SH 3SGEH 5FDWB 4OFYA 1CYGA 5T5NG 2QBWA 5JUEH 5GS0D 4JJHA 4L4VA 1B0GA 4PJAE 4LCCB 4RGNC 4ZAKB 4M43H 4ERSH 3WLWC 3RVTD 3MCKA 3KHQA 1I1FA 3LKSB 4N8CL 4LVEA 3SE4A 1NMCC 1RIVL 3TIDA 4HUVB 5JOEA 4N0FB 3B4NA 1CD8A 1SY6A 4F7TA 3V6FB 1CWVA 4JY4A 5EZJA 4Y19E 4X4MA 2Q6WB 3GM0A 5ALCL 1ZHNA 3QDAA 2GEEA 4U31A 3JV6A 5TPWH 1RZKL 3QWRA 4OGYL 4WI7A 4R8WH 3FQTB 4X5LA 1I7UB 4PRDA 4XHJC 3QFJE 5C3TA 3QIUD 3GSXB 2CRMA 3H9SD 1S78D 3TM6A 4WCYL 4LLWA 1KBGL 1KXTB 2VRAA 1G7PA 1T7VA 4PJ7F 4D8PB 3KYOA 1G6VK 4XVUD 4WTWA 5BZDA 1A6ZB 5D1QC 3OJ2C 1JBJA 2BHZA 3A0OA 3WKNA 1B4JH 1BQHB 1UM4L 3GJFB 5EU6D 3MOAH 4FQHB 5E0QA 5D93B 1FVDB 3WO4B 4PJ9D 4JY6A 4Y5YC 3FFCD 3IYLW 4PGCA 2OJEB 3QXWA 5HHQA 4RWYH 5ADPH 3QIBB 5KTEL 4OV5A 3UTTD 4AMKH 5A2JH 1I3UA 5ICYB 2IANE 1K6QL 3WE6B 1I3GH 1EZVX 5C92A 3KNBA 1RIVH 4X80H 1S9YB 3O8XC 4PJAF 3DX7A 1HHGB 4ZO8A 4JFYA 2AV1B 1HIML 4KKLC 4Z7VB 2W0FB 2QADD 1F6FB 5E8OA 3O41B 3ZKSD 3PHQA 5BXFA 4P57B 2WAHA 4JY4B 4MHHI 4H25B 2P7TB 1EK3A 3QA3B 1X5IA 4FABH 4Y16A 2WBJA 3GKZA 3QULA 2CSPA 1I8MB 4IDJL 1F8TH 4BSWA 2CO6B 5A3ID 3EIFA 3C5JB 5HHXL 2DAVA 3TBWB 1RZ7H 3AXLB 1MVUA 5ACMA 4Q9CA 4CBPA 4Y4FD 5EOQL 4TQEH 3JUZA 2BMKA 3OGOE 4FXKA 2DYPD 3VI4F 3BT2L 4G7YL 4PGBB 5KSAD 2DOCA 4M62L 4M6OH 3QUKB 1P53A 4NZTL 4XI5C 3MGTA 4P5TA 4OZHA 5HGDA 2H32H 4OBSA 1NCWH 2CDFA 2XQYK 4N0YH 4GBXB 4N90D 3A6CH 3MRRA 5JW3L 2YD4A 4MJIB 2V2TA 1D5ZA 4XH2A 4HWUA 2ARWA 2B8OT 3V95A 2EC9U 4LGRB 3P9WB 2V6HA 5J3HD 1BBJB 1JUFB 5DYOB 1MCDA 2VDMH 2D7NA 3M8OH 2XTJE 1NANH 4QKXB 1DBJH 4XPFL 1UGNA 4MAYD 4G6KH 1YEHL 3IDGB 1RJLA 2XZCH 4JPKL 1OP9A 4XPAL 1JTPA 1JI2A 1U8MA 4HCRL 1TVDA 1JN6A 3D85A 1YEJH 1JFQL 3JTSA 2R2BB 4MAYB 1MJ8L 5EU3A 1FNAA 1JMXA 1P5UA 2YD1A 3KS0J 3K74B 1FDLL 3VXRA 4LVNC 5L7XL 4Y89A 3ZE0E 4FABL 4H8WH 1RZIB 3EOBB 5MI0C 3LOWA 2G9HB 4N9GB 5D6DA 5EH1A 3HMXH 2EECA 4KTEH 4FFYH 2HFGL 4GXUM 4U1LB 3QJFB 3SGDH 4R96A 2LU3A 5CP7A 3M17A 1A02N 1MI5E 1LO0H 3V5DA 1D3CA 3TT3H 1KIPA 2HH0H 5JQHC 4FTVD 1X5AA 2BNUA 2NY6D 1E28B 4WU7A 1UXSB 4LHUA 1WEJL 2QHLA 4K7PX 5MENA 5FYJE 3V4VL 3WFDL 5D5MB 4A6YL 1G0XA 1VDGA 1NGWA 2VXSH 3MYJB 2CH8A 3NABL 3DX8A 1UJTA 4IRJD 1IAIH 1AO7E 2C26A 4XPHH 3CUPB 1Y0LB 1T03L 3BJ91 1LDPH 2XV6B 3NZHH 4D9QD 1U8PA 2IH1A 5AZ2H 1RJLB 1WT5A 4HC1A 1V7NH 1K8DA 2ICWB 1OT2A 4AIZA 4MLIA 1N6QH 1CGWA 5IQ9B 1HWHB 3TBSA 2DQDH 1MCFA 3PUCA 4J3WA 1YY9D 3X14B 1NMBL 5HY9A 3IDNA 4AG4L 4Y4HD 4P59H 3PJSB 3RDTC 2J7LA 5IB5A 4U7KA 2I25N 5F9AC 3LB6D 3PABA 2BVEA 4NUGL 1SHMA 5AZEL 2R1WB 3MLUL 5B4MC 3P11L 5HHPB 3VFOB 3FFCB 2AJYL 4LLDA 5FO9B 3HI5L 4RSVA 2P44B 4YO0B 1SBBA 3MLVL 5DO2D 1RUKL 2ESVB 2RQ8A 2ZUUA 4ODVL 1VFUA 1P69B 3SDCC 1QR1B 3H9SA 3VG0L 1NCAH 2VXVL 4S0TD 4BQ6A 4KI5E 4GG6B 1NLBH 2UYLB 2VIRA 3HZMA 5ACLA 3KPSE 1DE4B 4OGZA 4ZOAA 3MRIA 5IW1B 5IJVB 1PY9A 1D5BB 2R56L 3HC3L 2A1WH 4TVPD 4KJWD 5C0ND 1X6NA 4HKBB 2WM0A 2BSED 1S9WA 3DWTA 1IVLA 5M7QA 3AAZB 1GC1H 4HIEA 1QLFA 1MJUH 3F6IA 4M00A 1ZVSA 2V5RA 5FKAB 5E08H 1UZ6E 3MJ9L 1NGQL 4P46A 3I84A 3CFJA 2UWEE 4RZCB 5F3HA 1OHQA 5HPOA 1NFDA 4WI5A 4TUJA 3U0WL 3OR7B 2O5YH 1ZHKA 3WFZA 4GMSH 1FORL 5AYUH 2PCPB 2BHUA 4G43B 3DX9A 4PJ5B 3G9AB 1H3PH 5BW7C 1CFSB 1WISA 2A9NH 1K8IA 3P4MB 4PJEE 4PLOB 4FQPA 2BJMH 3SCMB 1L7IH 4IJ3B 4U6TA 3C6LC 4KTDL 3G6AB 4G3YL 1GZQA 4WIQA 3BP5A 2EIDA 2ARJA 2I5YH 3FMGH 4ONGH 4Y16D 2AXGB 5FUCC 3K3QA 1C1EH 5TGBA 1K4CA 1I7TA 4PR5B 3EHBC 4HKJB 3RGVC 5DEZA 1UM5H 3GBLA 1F5WA 1KEML 3RZWA 2LV4A 5MEPB 3B9KD 4XXDB 1OCWH 4JHWH 3T4YA 2C1PB 4I4WA 1ACYH 3SJVE 3TZVC 3BGFC 3NCJL 4Y4FA 1WBXA 4UILL 4HG4J 3H2WA 1SVCP 1ONQA 4ZTOL 4MA8H 4ZYKB 3I6GB 4W4OA 5TF1L 3VXOA 4Z76B 5C7XH 3GHEH 4M4PA 1DL7L 1K5NB 1J1OH 5I30H 1N2RA 3HC0B 3QO0A 4LDLB 5AYQA 1KSRA 2MHAA 3RX8A 2DLFH 5D70L 2VWEC 3U0WH 5DJ2B 1J05A 5DQJA 2PCPA 4U1MB 4PRHD 2OR9L 3ZDYF 1FNEB 5HHNA 4Q7DA 1RIUL 5CLTA 1EBPA 2H8PB 5E5MB 1OY3B 4ZFOB 4YDLB 3WSQL 4I3SH 3D85D 2VQ1B 3RGHA 4XGZA 3G6AA 5C0BE 1AH1A 5GRYA 5HSFA 5E6YA 2DLEA 4Y4KA 4LVNB 1FYTB 1S9VA 3C8KA 2DI9A 1DBAL 5J13B 3CFBB 2E7HA 3GSXA 4R4FH 1RZFH 1H3XA 3WJLA 5IBLD 1BVKA 1LEIA 5JXAH 4NQCD 5J56B 5AAMA 4NM8H 1GGIH 1HILB 4WUUA 3MOBL 4J8RA 2F54D 5B38B 1ZGLB 1MELA 3DX6B 2YPLB 4PD4K 1ETZA 4CUCA 3SEPA 2Q87A 4OLXH 1BQHG 4M8VA 1TQCC 3O3EB 3P30H 3WYRA 2A0LD 2F5AL 3HNSL 1DANU 3QDMD 2Y6SC 4LLMB 5DJ8B 3RAJL 2MCPH 4P2YA 5HPMA 3OR6A 4R3SA 1X44A 5DC0A 1ZHBA 2ESVE 4RBPH 4WDIB 3BWUC 1NCDH 4O2CA 1N6VA 2APTA 3OKNB 2X9YA 2ITCA 3DSFL 5GRZA 3TBYA 1ND0A 1A14L 5ANME 1FGNL 4IRSC 4WW2C 4YR6A 5KSVB 4KMTH 1CBVH 2PTTA 5KSAB 2J8HA 4JM2B 1PSKL 3V0WL 4B50A 3P2TA 3FFDA 3GGWB 3L3KA 4JCMA 4K2UL 3SBWC 2VE6B 1UACH 3I6LE 1RZ7L 4U1SA 1YEDA 2PN5A 2VISA 2WUCH 1DBML 4PB9L 1TZGH 2AQ2A 2IG2L 2V7NA 1JHKH 5E99H 1MVFA 2PW1A 5J6GB 3RWCA 4LVHB 1FL6A 1RK0A 3GSRB 2A6JB 2RFXB 5C2BL 1YPZB 2VO5A 3FAXA 2NNAB 3BX7C 4X7EC 5GS2H 1BWMA 2QHRH 3MRCA 4QRSB 3LIZL 4L9DA 4XNXL 2LFGA 1AO7B 5C6WH 5CJ5A 1GYAA 2DIBA 1FFQA 1JRHH 5HHOA 1LEKB 3P77B 1NMBH 4F9PC 4P5TB 1XIWA 2ZG3A 5LQBH 2C4FT 5DJDB 2D9QB 4QRTA 4KI5C 1LK3L 4TVPH 4BYHA 5GS0C 5TQ0L 5H2BB 2GW5A 3FFCE 1UJ3C 4HT1L 1FHGA 2FD6H 4HF5H 5BV7L 5DSCA 4WO4C 2RJMA 3U46B 5IB4A 1TJIL 1U93A 4H26A 1JGUH 3MGOB 3QIUB 4MJ4A 4JFED 3STLB 4K3DH 3W5NA 1WICA 3ARGB 5DWUH 1F97A 2BCKA 1H8NA 1WWCA 1E4WH 2PF6A 4JG1H 5T5NF 5E8EB 1U8NB 3EBAA 2IAMC 1CICC 5GZND 4PJBE 3THMH 1NLDH 4I77L 2RHEA 4XNUL 2VISB 4G42A 3U0TA 5JW3H 1P4BH 5KSUA 3WNNA 1PLGL 4HBCL 3HMWL 4MWFA 4A2MA 5F7UA 3W0WE 1NCWL 3Q5TA 4XZUA 4KU1A 4LCWB 5I8CA 2FGZA 2IBZX 1WZ1L 2C3VA 4LARL 5CBEA 3SDDD 5D7LD 4QRSA 4V2BA 1UH2A 4TRPL 2VZUA 4P49A 1K2DA 1P84K 5C0BD 1KTRL 2NZ9C 4HWNA 2RCSL 4RMUA 3RIFF 4KKBC 3DVIA 1I85C 5D5ME 2IANB 4JY6B 5J1SC 5HHXH 2KQMA 3DIFB 4P2QD 2GQHA 2F9BT 3LV3B 5DK2A 4GW1A 3NBNA 3QIBA 1BX2A 2R8SL 3O3BB 4PRHB 1OAZL 1UVQA 1BAFL 1MAJA 5K59F 4U1JA 4LCWE 1T21B 3EYSL 4WHYH 5FUCE 1FL5B 1A3RL 1NUFA 3CFDB 4W4NA 1Q9OB 1MH5B 5IHZA 4QRPB 2Y23A 3PV7A 1KBGH 2OQJB 3HE7B 2ERJB 3OKOA 1BREA 2HN7A 4XXCA 4YQXH 2HVJB 5E8OB 4KV5E 4YBQC 3A6CL 2I26N 2AVGA 3RI5F 3W0WA 2XQBL 4FFZH 3VCLB 4FQXA 4XCNB 4JEGB 3HN3A 2FWOA 1OTTD 4ODTL 1RUMH 5GS1C 1YY9C 5ICXB 1W0VA 4MWFB 1VFMA 3TBVA 4H1LB 4OCRH 3ZKND 3CCHA 2RAMA 3O3AA 2DICA 3Q1SL 4LPXA 4KZDL 3CC5A 3EO1A 1S7RB 1BEYH 2G75B 4NKIL 1MRCH 3UBXI 2OXGA 5F6HJ 3QPXH 1I3RB 2X9WA 4Y4KD 5ID1A 1B6UA 4M3JA 4JKPH 4QHMB 1R5IB 1DN0B 4N8VB 1CDYA 1M4KA 4XC1H 5BRZB 2ORBL 1NBQA 1QR1A 4K94C 1KJ3H 1EAPA 3NAAL 3GRWH 1JNLH 4Y16C 5D5MF 3L7FA 2B4CL 4P9HC 2EKJA 1S3KL 5TJWK 4Z77A 4Y5XA 5I16A 3ARVA 3GMLB 4O51A 5A1AA 5T1KD 3FQUA 4OLYH 3HZYA 3INUH 4JQIH 4XC3L 2GY5A 1FL5A 3PWPE 5L6YL 1ZLVH 5I1EH 3C5ZD 3FB7B 1BFOA 3GI8L 2ZJSH 1C12A 3P0YL 4K9EH 1NAML 3UYOD 2PYED 1TPXB 3ZKQD 4GBXD 4WW2B 4EKXA 43CAB 5CGTA 5F44A 3RU8H 4Q58C 4XWGH 2VDRH 3SDYL 1A7PH 3QQ9C 3WIFB 1YNKH 1NC4A 1F4YH 2YZ1A 1RAMA 1BJMA 5D7IB 1SYSA 2F19H 3SCMA 1Z0MA 2R2EA 4LPYA 5IFJA 1X7QA 2IG2H 4OZFG 1JNJA 2IQAA 1WFNA 2AXGA 5AUMA 5SWQB 2VDPH 3FB6B 2ZZUT 5FYKD 4UINH 2W38A 5I71B 3ARBC 1ZE3C 1NGXB 1EHLL 3GM8A 2XZAH 4WO4B 4YC2B 4XXDA 1TCRA 1T1WA 2C1PA 5M95B 4PJCA 3R8BB 4LARH 2HRPL 4LF3A 3G08A 3B2UC 5B39A 4P23A 4AEHH 3N0PB 4OZGE 2NZIA 2PETA 4G6AD 5K33A 5C0DB 1CF8H 4TVPL 4LKCA 4TVPE 4NQTA 1RU9H 5FM5M 4TSBL 4LBEA 5IVXE 4HW6A 3MLWL 4NRXB 1QACA 5DJAA 3OKEA 1VKXA 1MRFL 1CGSH 5D6DC 4LFHG 1P9MA 1P84J 3R0NA 1XCQA 2LU7A 5I15H 3QO1A 3QWRD 3IFNH 3TT1H 1HHIB 1L9MA 2XRAH 3R4DA 2AJSH 3S88L 5HHMB 5BRZD 5DWUL 1AD0B 5F1NB 1DP0A 5IB1A 3NIFF 5ABDE 5EBGA 3SKNA 2Q20A 1MJ7L 2I60L 4JFEA 1G0DA 1M7DB 3QCVH 4MVBC 4X6CE 4KJYB 2XN9A 1HYSD 5E03A 1CICB 4Z7VF 3C60C 5LXGH 1A6TA 5GGSA 1A7QL 1CTOA 3FFCA 1JNHA 1Y6KR 5BVJA 1P4LB 3TFKC 4ZS6C 3FL7A 2FX9H 3RUGB 2R0WH 4O2FA 4XP9H 1XGPA 3LZFH 4ELKA 3HPJA 3PIQB 3H9SB 3K2UH 4F2MB 2FEDD 1KT2A 4OGAC 3VFNA 1P6AB 5HHME 3OZ9L 5E8PA 3RL1B 3RPIA 1H3GA 2CKBA 4ODXB 1H0DB 4MX7A 3SPVB 3ARGC 4WV1A 3REVA 2A6KA 5CEYB 5FOBB 2ATKA 3TYFB 3QCTL 2V9TA 4NQEE 2GJ6D 1GGTA 2MPAH 3IFLH 4OF3A 4PY8J 5EWIL 3EDJA 5E6ID 5KBNC 4JPVL 4YIQA 5EU5B 2WBJD 5EOTA 4NFCA 4G7VL 4DN3H 3QIWC 5I1IH 3BZDA 5B3JF 1MUJB 2NY2B 1UM6H 2P5EB 3KJ6H 4JGMA 4NO5B 4RIRB 3PXHA 4WW1B 5T3ZE 4ZO9A 4J6RL 2YUXA 4QRUA 1U8KA 2AABL 5JXEA 5FK9A 2EDXA 3IFLL 4ELMA 4HJ0D 4HKZB 4NNXB 4XAWH 1J1PH 4KI5D 5T1LB 1LNUA 2VLME 1V3LA 5HGHB 2PO6D 3RBSA 4HUVA 4PP1D 5EBLA 4E0RB 5KSAA 1S7SB 2IF7A 4Y2DB 1ACYL 4JM2A 1CXKA 4NGHH 4AEIH 2VH5L 3SO3C 2MFNA 5IKCB 3P30L 4YPGA 1BMGA 4YHNA 3OPZL 3WJLC 3WIHA 3LEVL 4XP6L 5K9KB 1OB1A 1N5AA 3BIAX 2P5EE 1IE5A 4KJWC 3WLBA 4L9LC 1I1AA 4KVNH 1VB9A 4KKAC 4RQQA 4NO3B 3GBNL 2WWMD 4WI4A 2XTJD 4WRLA 3QHZH 4QXTB 3T0XA 3BO8A 3LQAH 2J6EA 4X98A 5IVZA 3BZFB 3RDTA 2EDYA 3MFFB 2JCCF 1MEXL 2VAAB 1NL0H 1X5KA 2ITDA 3BE1L 1IGTB 1X5FA 5D1XA 3ULUH 2CK0H 4ZS7H 1SEQH 1P9MC 1XGYH 4JQXA 3GSQB 4RIRA 1F4XL 2W9LA 2Q8BL 5ICYA 5T1KA 4QRRB 3DURB 5DSCB 2JK5B 2IBZY 2ESVD 3PDOB 4Z8FL 4EDXB 3HC3H 1DBBH 3P40A 1KLUB 4TSBH 1CZ8H 1NAMH 1MNUH 2PYEE 5CP3A 3C5ZA 4GAGH 4IRZH 3DGGB 3T0EC 5DJCB 3QI9D 4GMSL 5HVHC 1I1CA 3I50H 5EBWB 4FTVA 4MXWH 5F8RC 1W8NA 3V52L 2Q7YA 5TE7H 3HE6D 4OUUB 4NQEB 2BXYA 3ZTNH 1ADQA 5JOPE 4XX1E 4LCUB 4FNLH 1L6XA 2KZ1B 5KSUB 1FGVH 2HKHL 4OTXH 5FDWA 2LQRA 1KJ2B 3OG4B 2HLAB 1Q94B 1JGEB 4KUCF 5F9OL 3RVUD 3UJIH 3ZZ1A 4NYLB 1G0YR 3ROOA 5JW4M 5L8LB 2Y06L 5D7JC 2GTWA 4C59B 2J8UF 1XGQB 3FN3A 4M48H 2AJVL 3FCTB 5BQ7B 4CN6A 3FO0H 4KDTC 1KEMH 1PKQB 2ARJQ 5GS2D 5EZOH 4XBPB 1AD9A 4M7LT 1OAZH 4K9EL 1MAKA 1P7KB 5DFTA 4NO2B 2EO9A 1V3JA 3DIFA 2YKLH 2PW2B 4LEXH 4KWUA 1MCIA 3TO4C 2A83A 4AQOA 3V6OC 2XXCB 3K80A 5D7KD 5DJ8A 3EO0B 5MERA 4OCWL 3FB8A 4Y4HA 5I1KL 4OAWB 3MRPA 4L4VB 4OIAA 2A9NL 4JQVC 3EFFA 4OKVA 4R7NA 1BQLH 2KPNA 3NIGE 2VXTL 5DFVD 5CKAA 4KXZI 1UJ3A 3O6FB 1XCTA 2X6MA 5D7IE 2EYSB 4JFXA 4M1DL 3RWJB 1E4KA 2A73A 4P59L 3WN5A 4LSSH 4OM1L 1A6ZA 1KC5L 43C9B 3PWPA 1EO5A 1FNGA 2I9LB 2CLVB 2PXYA 1WCBB 4K94H 3RWIB 2HFGH 3IAQA 1MCQA 5DLMH 3D3VA 4O02H 3OMZA 5IW6A 1OPGH 2ZUTA 3C60B 1NQBA 3RTQD 1IEBA 4HS6A 4F37K 4ALAH 3TYGH 3QDGD 5J11B 5IM7A 3CFIC 4FXGB 3D69A 3B5GA 1H8SA 4MXQD 4OUOA 2G75A 5GGSY 1MJJB 2DQCH 4WHTA 4D8PA 1CGUA 1RUAL 2H9GA 3TV3L 5DJYB 2E7LC 1MHEA 3P0VL 3QQ9D 3MMEB 4N8VA 1DTUA 4P46D 2FBOJ 1LDPL 3VFUA 5ERWB 3CDYA 2N4IA 5IHUH 2H45A 1NSNH 3V4PL 1I4FA 1UQSA 1XIWB 4OI8A 1MI5B 3FN0L 2OJEA 3PP4L 2P24B 4IIQC 2AJUH 4JAMA 2YOCA 1WZ1H 3BIKB 1F3JA 3KLAB 2Y07L 5KOVC 1Q0XH 4X6FA 4ZUSA 1JNNH 1I8MA 4GXVL 4PJ8B 1RFDL 2GYSA 4FG6C 1UA6H 3ORJA 1HHKB 2H2SC 1U2HA 4HGWA 5E6IA 5FYJU 5AD0B 1I8LA 5HYQB 1MFEH 3I9GH 5L88L 4U1HB 3RWJA 1YJDC 3LPGA 1SJEB 1YMHA 1MHPH 2Q3AA 5KOMC 3W39A 4KY1H 4GRWF 4P2CG 1N4XL 5TQ2H 4PY7A 1ZT1A 2XZZA 5JXED 1NANI 5C07E 1YECH 3QULB 4RAVA 3DYPA 1FZMB 4FZEH 3BD4A 1LD9A 2C9AA 4Y19B 4UT6L 5EORH 1AHWB 3V0WH 1OAUL 4Z6AT 5DC4B 1BJ1H 4PJAA 1GOFA 1SYSB 3O4LD 3VWKB 4DEPC 3QI9B 3VE0A 4QO1A 1DANT 3D69B 3GMPA 1CIDA 4DW2H 4UT9H 1ITBB 5CBEB 5DD3L 4EOWH 1AR1D 2C4FU 1BBJA 3RKDD 1JUFA 2CDGB 1N26A 4LSRL 4IRSA 1T1YB 4XNUH 5C08E 4NPYB 5JPMB 3QXVA 2XWBA 2G5RA 2ZUWA 1IC4L 3CLEH 2VL4A 5DQ9B 2CDFB 2BC4A 3AS1A 3AS2A 1U41A 2P24A 3F58L 4X6EB 4P48A 4GSDH 4PRHA 1OP3K 4DGIH 5T33L 3R1GH 3TVMB 3IU3A 4JZOB 1LMKA 2P8LB 4GRWH 4QLRA 3IRPX 3FN0H 4LBEB 3U48A 4Q9RH 1R5VB 4PJBA 2VN7A 3AY4A 3V4UL 5GRUL 3SGJC 3O8XA 2G5BA 3UCRA 1CN4A 4A2LA 1MOEA 3V0VA 1T0NA 2IH3A 4HT1H 2XTLA 3SQBA 3DVGA 2B0SL 4L9LB 2FCBA 2H41A 1F4AA 2OXHA 4RZCA 2Z8VC 1BIHA 5GIRA 3QHFL 5IB1B 2X44D 3GMRA 3HNVH 4KZEH 3UBXG 4GAJH 3LKRB 2QQKH 3VA6A 2FB4L 4XCCL 3DMMA 2BRQA 3GRWA 5T3ZH 1EH9A 5BMFL 5IEHA 4OLXL 4I18B 2BDNL 3QI9A 4YHOH 1S7UA 5GGUB 1MHCB 4EOWL 3QUYD 1EEZA 2ZCKL 3MX0A 4OT1L 1QUNA 1AFVL 1Y0LA 1I7TB 4QGTA 2NY4C 5DJ6A 5SWZA 4OJFL 4AMKL 1JWUA 4JB9L 1QP1A 3V5DB 3VRLE 1IC5L 2XWBB 2HJKA 3AREC 1MCKA 2BZDA 2PKDA 3H6JA 4AIZB 5DQ9A 5JZ7C 3FONB 5FYLE 4OGAD 4KJPD 5IMMA 4Z77B 5FGCE 2ZUVA 1QYGL 2DM7A 1B90A 5I18H 3X14A 1FO0A 2GK2A 4PJ8D 3KYMB 3VRIA 4QRQA 1CG9B 2SEBB 3O11A 3T08A 1GZPB 3FHAA 4PLJD 3VFPA 4PJBB 4N1HB 4WJ5A 2QKIA 3LN4B 1VFBA 4IMLB 5HHPA 3UMTA 1NDMB 3D2UA 4BK5A 2Z8WC 3BAEH 32C2B 2MCPL 5IK3A 2VR4A 4PRIA 5A2FA 4MA7L 2OSLB 2Y7QA 5T1DL 1CT8A 2JB5H 5EULV 1YY8A 1J05B 5FB8A 4HKZA 3UO1L 3MV7E 3H3PL 5JIIA 5A2IH 3RGVA 4OGYH 5AG9A 4E0RA 1F6AB 2IADA 5ESQB 1B2WH 3KPQA 5IJVA 5IW1A 3NACL 1QEWA 2X4RB 3C5SB 1FC2D 2DBLL 2YPKA 3RVTC 5CIPA 1EVUA 1YEFH 4YPGB 1W72B 2D4DA 3ALPA 3QEQB 4YFLI 4TUKL 2BNQA 2WV3A 1V5JA 5ACZA 1GGCH 2QV2A 1T7ZA 4FP8L 1OL0A 1S5HA 2VLLB 4IMKA 2NXZB 3CFJB 3QZWB 4RMRA 3BO8B 3LN5B 5DD0H 2Y4SA 4Z78A 5HDQL 3UZVB 4G8GB 3ULUL 4PJFE 2P47B 3GIZL 1CFQB 2NXYC 1G6RL 3ZYJA 1XIWC 3H7LA 5HHVL 4FP8H 4GXUN 2QQNH 1CDGA 4X6CA 2ED8A 3PHSA 5DMKA 3MPCA 3QUMA 1VFBB 1G7MA 1H3PL 4JPWH 1NCCH 1VENA 4LMQE 1OGAA 1NCAL 5DHVA 2RR3A 3IGAA 2AI0L 2VLJD 1VERA 3EYFA 5TGBB 2P46B 4KVNL 2CXGA 3IFOA 4ZDHB 2XFXA 4MCZA 5DMIL 1A2YB 5J57B 4MNGE 5FB8B 3TZVD 5TFSL 1PZ5B 1IGYA 4PTTB 4JPWL 3LQZB 2QLVB 2WINA 2QJDA 3N1PC 1WQVT 1T04A 3C9NB 1G1CA 2P4AB 1U36A 1D6EA 1JRHI 4BKLB 2FLBT 4Q74A 3QI9C 3TH2T 1AGCA 3RWDB 3LKOB 3O4OB 4LSPH 5LGHH 3N9GL 1QRND 2IPKA 4PB0H 1GHFH 3I6GA 5LWYH 3ILPA 1AHWC 1J1PL 4HUWA 3B3IA 1J0KA 5EC1A 5B21A 1N2RB 1Q9LA 4HWBA 2VZOA 5FUOL 1CDUA 3EFDH 4D3CH 2EH8L 4X5WB 2P8PA 2DM4A 1IGJA 2DMCA 5C6PB 4XWOD 5I1IL 2FX7L 2BJML 3FOLA 4OLZH 5JOFB 1MCRA 2J8UB 1GAFH 4I48B 3WHXB 1PKQA 2ADGB 3LQAL 5DR5H 5E4EC 3BPOC 5HHOB 3W0WD 2OP4L 4OF6A 5K93A 4BFBD 3U30B 3U82B 4KROD 2VUYA 1VFAB 3UO1H 3BKJH 4LCIH 3OAZH 1X4YA 4XNMA 5GJTH 1GC1L 4L1DA 4K71C 3LZFL 2BOCA 2OZ4L 4HH9B 1DUYA 3JVGC 2OYPA 1VSCA 3IU4L 1UB6B 2VYRE 4KHTH 4LQFH 3H3KA 3O8XD 4DTGL 4MDIB 2A6DB 3ARGA 4G9FA 4DWHA 3D39B 4P99A 2QADC 1JPGA 1NMAH 3QZWG 1TQBB 1IAIL 4XPHL 4J8RB 3D87B 3MRDA 1A47A 1MY7A 4N5UA 2N7AA 3VD3A 1W2KT 3O45A 4I9WE 1OB1B 4Z0BH 2NX5D 3NPZB 4P4KB 3RTQB 4GAYA 1UWEH 5KAQG 5IVXA 3GNMH 1BM3H 1KENH 2V2WA 2BNRE 4HX1B 5MEQB 2CDEA 1BGXL 4YFEA 5JOFA 2UWEF 1AIFA 2ITCB 5IVZB 4RWHA 4JFDB 3FT2B 4ZUTB 25C8H 1NAKH 1LO0L 4G5ZL 3TO2B 2AEPL 3NN8B 1RU9L 3DYMA 5HGDB 2NY0B 1XGUB 5EB9A 3PL6D 2DJ4A 1ZS8B 1G7HB 3L3JB 5KVMC 4WFFD 4GBXA 2PO6C 1UB5A 4OZFA 4X6BB 5GISL 3OR6B 4PJ8A 2XG5A 4YXLH 1FDLH 3SDXA 3DXAA 1FNSL 1FC1A 4OF7A 4ZODA 5I1HH 2YA1A 4ODUB 5T33H 5IJKC 1ROWA 1YECL 1CGYA 2HN7B 1JPSL 2YN3A 3X3GH 5EDXA 3LKQA 5C07B 4Q9QH 1KTKE 2HT3D 4PRID 1A1MB 3IXAB 3FQWA 1F4YL 5L0QC 4FTVB 4Z7QF 4GRMA 1OM3H 4DGVL 3MLSH 1I8IB 3QEGL 3T8XB 3WFCH 1T1XB 4FXLA 1XT5A 2EIZB 4FOMA 1F00I 1RIHH 3HS0B 2VAJA 4OFKA 4P23D 3SQOH 2JKXA 4PGCB 4FFWC 4JGUA 3UX9B 3KYNB 5FGCB 5E9DA 3TBVB 2W0KA 3K2MC 5D7JD 1CGSL 2V5YA 3CH1A 1OAKL 3HAEA 4HIXH 2A6JA 2RFXA 3F12A 4HUUB 2Y07H 4I2XB 1YC7A 4M62H 3BT2H 4G7YH 3EJYD 5C08B 3CFCH 5CJQH 1I7RA 4MQSB 4WEBH 5L6YH 1FE8L 2HKFL 2BVOA 2AV1A 2HFFA 5BRZA 5L8KB 3H42H 3SO5A 5I73C 2CQVA 1MFDL 2K1MA 1KXVC 1H8OA 4LHUB 1ZLSH 3QPQD 4G9DB 5F7EL 1HXMA 2DQCL 3MLYL 3FB8B 4OCYL 3H9HB 4Y4HB 2WBWB 2NXYB 4MXVE 5H94B 4OKVB 2NTFA 2CPCA 1IKNA 1AXSA 3L6FB 1DBJL 3IKCB 4XPFH 3L95A 3CFKB 3TN0D 5EZIL 3DXAB 5DLML 2R69L 1RURH 2F19L 1NAMB 4XMKH 1RZJL 4N68A 4KJPC 5SWSA 5I8CB 2B5IC 2XTJB 4BFGA 2HG5B 3LRHA 1IBGL 3HB3C 4J3SA 5D7KE 1INEL 43C9A 5ALBH 3TESA 1RFDH 5E8NB 4F9LA 4ZUUB 5I75C 3L7EA 5SX4H 4XC3H 2DKMA 4OSUH 2UUDH 3GHBL 3IFPA 4PJDB 4RGOL 4XP5L 3MA9H 3OJMB 1RUML 1WBYA 3MV9A 3UC0H 1WBZA 2YC1B 4YZFE 3BEWB 5IFJB 4ZOEA 1KELH 2XA8H 4XPBL 1S7UB 1F58H 1G7LB 2Z9TA 4H0HB 2A2QT 4RMQA 2G2RA 5F6HI 1O7VA 1ZEAL 3EJZD 4UTAH 2VLJE 4Z7OF 1N64H 1YDPB 5EC2A 2PR4L 4XCEA 4LK4A 3KPMB 5E4EB 4PRNA 4I0PC 3EDKA 2AJ3A 3C6LD 1D7FA 4W68A 5EO9B 3SDAC 4LU5H 1PW3A 2BRRH 4G9DA 1YPZE 2XWJB 1Z9OA 5C0RH 1DE4A 2OLDA 3HCVB 2J3SA 4UB0H 5H8DA 1MLBB 1X5LA 4UOW0 2PO6A 3HI1A 3QDJD 3S35H 2ZSVB 3ZKNC 2Y36H 1AGFA 2FATL 4KUZH 4TPRH 4AIOA 3LKPA 5IHUL 3VGHA 3HE7A 5I1KH 3O3UN 2VC2L 1J0JA 4FZ8H 4OZIB 1NKRA 2E7LA 1HH9B 3UTSD 5A2KH 4XBGA 3TV3H 3MNZB 1O0VA 5HVGB 1I1AD 1CT8B 5D9SB 3MOAL 4JE4B 3S96B 2JELL 4U3XA 5DS8A 3U36A 3RIFK 3UTZB 1IGIL 2X4PB 1BPVA 1E28A 2X41A 4YUEL 4G9FD 4FQJH 3KG5A 4NZJA 1FZJA 3VWKA 1PD6A 1U8OB 2YD3A 3TO4B 2EH7H 4JFDE 1MIEL 2ZG1A 4K7PL 5HDBE 5GGSB 1PGRB 4U0QB 3BP5B 3IDUA 4KC3B 5FM5O 5I8KL 3WUWB 2R4SL 5JW4Q 3LS4H 3ZKMD 2MKLC 4FHBD 3KPRB 1CVRA 4MNQB 2NX5A 3HPJB 5J7CC 4EBQL 4EIGB 1KJ2L 4Z7WE 1G7IB 2FD6L 3JVGA 1QO3A 3BKCH 5F8QC 1JGDB 3BDYL 1MPAL 4WI2A 1ZVYA 3CVHB 3NIDE 1FE8H 2HKFH 3RHWK 4RNRB 1GL4B 3CX5J 4PFEA 4Y7MA 2BVTA 5DHYA 1CFQA 3I50L 5TE4L 5C8JB 5HHMD 1KJMB 1DLFL 2VZVA 5HYIA 4GG8B 4V1DA 3PL6A 4R0LC 1GIGH 2AJXH 5HDOA 1P4BL 5D1ZC 1HH9A 3FB7A 4RAUA 2EDFA 2D7QA 5DJ2A 3MLYH 4YLQT 5HGAA 4QRRE 4F8TA 5JHLL 5JW5A 4L5FH 3MRKB 5T1LA 4YEEA 1M1SA 2B1HH 1NKOA 2WUCL 4J7RA 3HA0A 4N5EC 5EUOE 3TA3B 4P0DA 1PDKA 4LFHD 5SX5K 4I18A 4F57H 5E5MA 2DLGA 4XP4H 1B0RB 3EOAA 3KJ6L 4ZO7A 3FO1B 4P3DA 3NPSC 4FFVC 3T0VA 1VACA 4LDEB 4OZFH 3N06B 4YHNB 3OF6D 4IHOA 5K59E 5MP6L 2HT4D 3HKFA 4RRPA 1A5FH 4LHQB 1BJ8A 4QHKJ 5E9DD 5LCVH 4XNXH 5TDPB 3ROLA 1F2XK 3LIZH 5IQ7H 1A4KA 1MFCL 4PLKC 4O5LL 2H3NB 1AY1L 4LRIA 3SDAA 4A6YA 1MI5D 2B5IB 1X5HA 3JTTB 5EPMB 2ZPKL 3P9LA 1IAII 3MRGA 2DWDA 1ADQL 4JFHE 2ITDB 3VFTA 3ZL4H 5DJAB 3WFCL 2AV7B 4FMFA 3M07A 4Q6IC 4Y4HC 4MZ2A 2FECL 1IGMH 4PG9A 4RGNB 1KCSL 2W9EH 3D2UB 3SKJH 1GGIL 4LLMA 2FGWL 3KLHC 5F6IC 5C0CD 4PJCF 2OZ4A 1P4LA 4X9BA 4QF1B 5KJRL 4JANB 1UACL 3Q5OA 1WIPA 5D2LE 3QDGA 3TN0A 2V7HA 1S7TA 5IMKB 2I07B 4I4WB 1FRGH 1MCJA 4NKMA 2YRZA 2VLRD 3GDBA 3D39A 1M7IA 1F6AA 1FGNH 3VGDA 3RAJH 4ZXBA 5IT2L 3KPQB 4JDZA 5EZJB 4QOKB 5FOBA 5CEYA 1HYRC 4HS3B 1PKQE 3IFNL 2QSCL 2C4XA 1IRAY 2GKIA 4PJFB 4OGXL 4XHQA 5IROA 3JV6B 4S11A 3T77A 4LCUA 1IM9B 5JLZB 3O45B 3EW3B 4MJ6B 2VXUH 3CK0L 5EU5A 1A6WH 4PJ8C 2ICWJ 1MFAL 4KK8D 3P73B 4QY8B 2DLFL 5F9WB 5DHXB 2P8MA 3RWCB 2GJZB 5F21B 2GAZA 4NKOB 1BZ9B 4ETQA 4D9RD 4HJ0C 1G7PB 3MUGA 1UM6L 1FRGL 2P42B 3OX8B 3VXMA 4P23C 1F3DJ 1FFOA 1U92B 5MEOA 4I0PB 5KVFL 2DQIH 5K9JL 4YNYB 2R2CA 4ZAKD 3GJFH 1A1NA 1UWXH 5EOTB 2X09A 2HFEB 5DHVB 2NMSA 4F80A 2VUOA 3LRSB 3G5YB 3NCJH 4J1UA 3QDJA 5SV3A 3P4OB 3C8KB 4LSPL 3GB7B 4ZTPL 4XVSL 4M7KH 3QDGB 4KGJA 2Z93A 8FABA 3O2WH 1ZV5A 2JCCB 4HEME 5DF0A 4Z7VA 2EYSA 4JFXB 4XB8A 5E2TH 3W81A 1C1EL 3MNVB 3TJEL 2BCKB 2CGRH 5MP6H 4NJAL 5F88A 1E4XL 4QNPF 5ADOH 1I85A 3OG6B 2UY6A 1OARL 4ZFGL 1N3NA 4H25A 4P4KD 5I30L 2YD7A 1RZGB 2X1OA 2WBJB 2Z35A 2D3VA 2D7TL 3ARDB 3KPPA 4GUPB 1MCOL 3BXNA 5ENWB 3U0TB 4UUJA 5HD8C 5CJOH 4LSUH 3C6SA 4OFDA 2ZNWA 2AJZB 1J86A 2BY0A 4X6DE 2QQLL 1IEAA 3AXLA 1T5WB 1CDCA 1KPRA 2OMBA 1IGJB 2LTQB 1S9XB 1MAMH 1A7PL 4L8DB 4O58L 4MAUH 5E95B 3VXMB 2DIJA 3TVMD 3F7VA 4HD9A 4P5KA 5GGVL 3VH8A 5ERWA 1SBSH 3PV6B 3O3DB 4R2GB 1OP5K 3HNTH 1TZHA 2FL5A 4F7MB 2AQ3A 3GUTB 3ARWA 2HMIC 1GIGL 4WWKD 4D9QE 3U9UA 1CK0L 3WNKA 1F90H 4GRLC 1U8QA 4JQIL 4B0MM 3QUXB 1NCCL 2BSTA 1Q9OA 2PW1B 4P9MH 3K4AA 4NYLA 2JCCA 3WFBH 3WD5L 1U3JA 4LPUA 5JA9A 1KV3A 4WU5A 3MNVA 2ADJA 5DUBA 4Y2DD 2AS5M 1A4JB 3MRCB 1ODAA 4LASH 1T3FB 4I3RH 5IOPB 2IBGA 4HC1L 3MCLH 1SMOA 2HWZL 5E8NA 4CVZB 4HLZG 2R4RL 3QAZB 3S97C 2X89A 4NO2A 1FIEA 3NPSB 2W65B 3BAEL 3IFPB 5B4MD 3HZKA 3RUGE 1BD2A 2APVA 5E7FA 3DHJA 5DHVH 5H2BA 3MRNA 2YC1A 3OKDA 5B39G 4PPTA 4XTRC 3UYRH 4KVCL 4Z0XB 3T0EE 3WIIL 4N9GA 4JR9L 3Q1SH 2IJ0C 2E6QA 2VXVH 3FMGL 4ONGL 4OZHF 3OF6A 1HSBB 1UH3A 1MRCL 4OFVA 4PGEB 3UTTE 4Q9RL 1C5BH 5I66A 5ITBH 3HLAA 1Q72H 2PTUA 4CN1A 2Z91A 4H20H 5E00B 5EO9A 4HBQA 4M1GL 1BJ1J 1X5ZA 4S1QH 4X6EA 3SDAD 4OSUL 6CGTA 1RUKH 2KDGA 4NC1E 2DLTA 1YEGL 3RWIA 4E41A 3V4VH 3WFDH 1IT9H 3FQUB 2X5PA 1JK8A 2AAVA 2WLZA 1NEZA 2ZUSA 4Y5VC 1ZA6A 5E8DH 3WNPA 3WV0A 1U8HB 4ODUA 1XCTB 2Z4QB 4XPTL 3V0VB 3WXWH 3B6SB 1RURL 3C09B 1G6RB 2GY7B 4H8WL 3PE9A 1JHTB 2ZUXA 1T3FA 3O81A 3T04D 3BPNC 4F9PA 3GFUA 2LVCA 1EBAA 2D0GA 4YGVB 2CLZB 1MWAB 4Z7UB 3HS0A 3WKML 3A6BL 3SDXF 6FABL 3DUHA 3EOYG 1B2WL 4XPAH 2V2TB 5I71C 2XG4A 5DEGA 1HDMA 3UC0L 4WEBL 3U1SL 2V5SA 3FB6A 3OAYK 5H35A 2R15A 2XI9A 3TNMA 4NQUA 4TVSa 4YC2C 5DJYA 4ZPVA 2XZCL 3L9RA 2NY3B 1H3UA 5EBMB 1MH5A 5CCKL 3KPRA 5IHZB 1HYSC 1G9ML 1M6OB 5HYQA 4WNQA 3C2SA 5M94B 5T3ZL 1AGDA 1OAXL 3EAKA 2R69H 5JMOC 4J3OC 1EEUA 4PJCB 2GTZB 3W39B 3QH3B 3FONA 1PLGH 3HZMB 4P2QB 3TZVA 2B1AL 1QBMH 1Y6MR 4EUPB 3QEGH 2XWTB 3E3QE 5IQ7L 1FZMA 3FO2B 4OZIE 4F3FB 1NBZB 3VD7A 1S7WB 3OTTA 1T1ZA 4D2NA 1HZHH 3DRTA 1XFPA 1ZA6B 3DXAE 4AEFA 4KMLB 1VKXB 4XNZC 3PXJA 4L8SB 1FAIH 5DDHA 3B9DA 3VE0B 1U91B 4X4YA 4HCRH 3VXSE 3B5TA 4G6JL 4WVRA 5C6TH 2ICWI 3AM8A 1NGPL 3DVNA 2ZCLL 5SV4A 5DQDH 5DZLA 5D71H 4ZUUA 4XNQA 4CL7A 1HZHL 3KPRE 4MQXC 3CXDH 5GGVY 2W1NA 3SCMC 1CXLA 2WBJC 4NJ9L 3QUYB 1BQSA 1WUNT 5GSRB 2ADFL 1HOCA 4FQIL 3O9WB 3EYQD 2WIIA 4ZD3L 4ZFZB 5BMFH 5DEGB 3GMPB 1N8ZB 1BOGA 5FCUL 1IT9L 1NFIB 2A6IB 4NFDA 1JMZA 4OCSH 4WUKH 5H35B 3GK8L 2FHCA 4U49A 5FOJA 5CCKH 4U2YA 4YBLB 4HIIA 4WNQB 3DSNA 3MLSL 5F96H 5KS9E 4GRLB 3KPNA 3BDXA 4PIRF 3WNMA 2E7MA 1R3LA 2IAMA 3RL2A 1QBAA 5TE6L 3CXDL 1AKJD 3P0VH 2C1OA 4JFOA 5I74B 4G8GA 3QEHA 2YUVA 1TIUA 3BOVA 3TVMA 5ETUB 3ARGD 1A6VH 3LB6C 4PJ9B 3NCYP 2NY2C 1J8HA 1K5NA 1U0QA 2R0LL 5ILTL 4OFYD 3L1OH 2AKRB 4NNPL 3IDJA 1A14H 3ZHDA 2HYMA 3TPUB 4NRZB 4O02L 1QVOB 1I1AC 1WZKA 3QIWD 2F53D 4DKFH 2EDDA 4WW1A 4JVUA 3ARED 1II4E 1JWUB 4GKNA 3UP1A 4KI5F 4LCCC 3RZCA 3QSKB 1DJSA 2HJKB 1T1WB 5T5FH 5KANI 3D48R 3PDGA 4LPCA 4M93B 9CGTA 1OWRM 4PGJA 4JHAH 4Y2DA 4UZGA 3T2PA 1D5BA 4MD4A 4ODSL 4DAGH 4I2XE 2H1PH 3X17A 3B43A 2IPTH 3IVKA 3RWGB 4WFHD 2Y36L 1W0WA 1EX0A 5JLZA 1K4DB 4X7DC 4MJ6A 1FAIL 3S37L 1BD2D 1CXIA 4WGVB 4GRLA 3BN9C 2RBLA 3T65B 3L3GA 3VJ6A 2GJZA 3PF2A 1KTDB 3L5IA 3OKKB 5GJTL 2E27H 4PJHB 5C86A 2CD0A 3N9GH 1EFXB 4NSKB 5C3LD 5C71A 1FFOB 1A8JH 3MFFA 3RVWC 1MEXH 4PJ9A 3W9DA 4DVRL 4CVXA 5DD5H 5EUOA 2IMMA 3U2SA 4WI3A 2FR4B 1F11A 1GGBH 1N7ML 1JZ6A 1TTGA 5IMLB 1FBIH 4WENB 1ZHNB 3GI9L 1AI1L 1FFPA 1Z3GL 3GSNA 3QRFM 3CMGA 4Y8DC 1WWWX 3ZHKA 3OKMB 1I7UA 4OZ4A 4O2FB 5D7JA 2HVKA 4GKNB 1PYWA 2BOCB 4HH9A 5CSZA 3B9AA 4LVHC 5C9JA 4JFPA 3TO4D 2Y5TA 4XP6H 1BZ7B 1XR9B 1J1OL 4XP1H 1CDJA 2A6DA 4OLZL 2BVQB 3VFGL 1WFTA 5L2KE 4F7TB 4DCQA 2W9DH 3DGGA 5FUZH 3GMQB 4MNQD 3C5SA 1IZKA 1QFWH 2FJGB 1RZGA 1J87A 5E56A 2BSRA 2X70B 5DA4A 4PREB 1W0WB 4IIQA 3KPOB 1T5XA 3GJFK 1M05A 4Z7WA 4MYWB 5CILL 5D7SH 4XNZB 5FUZL 3REWB 3ARXA 4M1DH 4NN6C 4EDWH 1T7YA 1BZQK 3UTPE 1A2YA 3C09C 1MRDH 1AIFB 4RX4D 4HMCA 4PS4H 4QTIH 1KGCD 4D0CB 2VXTH 4JFYB 1A3LH 4DQOH 4G8EA 1FNEA 5HHNB 5F7HA 3OQ3B 3FJTA 3MLVH 4EXPX 4L8CA 5BXFB 1NBYA 2ZOKB 3KLHD 1ZSDA 1OGAB 2E7BA 4NJAH 5C0BB 3LEVH 4N5ED 1T4KA 3OPZH 4LVOB 4KQ3L 4Y0GA 1B6DA 3BN3B 1VPOL 2WK2A 2PUQT 5DD0L 5BZWA 4GS7B 4H26B 3WHE0 3CFBA 1JCKA 3SDXB 4ZFFB 1OCWL 3VXME 4NT6B 2H6PA 3MV8A 4XVSH 2YA0A 1D9KC 1EFXD 4W81A 2D9CA 1CR9H 3VRLF 2HLFD 4YBLC 1SM3L 3C2AH 1P1ZB 1A4JA 5B3NA 3MJ8B 4LNRB 1S7VA 4M5YL 5B38A 3O0RH 4QYOB 1ZGLA 3QA3A 4X8XA 4AJ0A 1FGVL 2CLVA 2HKHH 2PXYB 3C6LA 4FS0A 4OTXL 3GSWB 4U1GB 3IS1X 3TNNB 1T1XA 5GRVL 2ICEA 5HYJE 4KROC 4GG6E 2QSVA 2ENYA 1YQVL 2EC9T 1HI6B 1FLRH 1JF1A 3J7HA 1DCLA 3K1KC 3O2VL 1KB9J 2MPAL 4MA7H 1MJJA 1QPXA 3DURA 4ETQB 2CMRH 3MROA 2V17H 5L9DH 4Y5YA 1DBBL 3UYPA 3BH8A 4P4RB 3B9KB 3QDGE 3FO9B 3HFML 4OF0A 3ARRA 4LHUD 1BBDH 2YRPA 5JIHA 1L0YA 1SMAA 3LV3A 5DK2B 2ZOKA 5DUMH 1TJGL 4C58B 1WJ3A 1JVKA 3LHPH 1KB5B 5GHWH 2QR0B 5DRWA 2DD8L 3BE1H 3ARDD 4AYFA 1T66C 4NBXB 1OQXA 3JSSA 1T22B 4KQ4L 4O4YL 2H2SD 3NFPA 5E2UL 4HMEA 4Y2OA 4ODVH 5IVXB 1DVFD 1A6AA 2NW2B 1PG7X 4M93C 4N1EA 5I0DA 4HJGB 5C0AA 1VGEL 2OTPA 4F58H 1V3MA 5DJ0B 4DGIL 3G5ZA 5I19L 1TJGH 1TLKA 5DK0B 5ENWA 2W92A 1RVFL 1UFUA 4X9HA 4TSAH 3MFGB 3N1FC 1GVIA 4AY0A 4BSJA 4UV7L 1C8PA 4FN0A 1YN7B 3RA7H 3MREB 3RFZC 4HMDA 1I1RA 1EO8H 4YXHL 2E3VA 4UI2A 3KHOA 3JWDL 2VLKA 4LSQL 3KPSB 1TFHA 3WL9B 1QSEB 3LEXB 1S9XA 5CJXA 3QEQE 3QQ4B 5DJZA 4V1DD 2D03L 3BEVA 4IOIA 2DQFB 1RI8A 2XKUA 1LE9B 4HK3N 4D0DB 1H3WM 2X4OB 3TO2A 3VFRB 1ED3B 4YDVA 3KPMA 4ZO6A 1KTLA 2FX7H 4FQLL 3NCCB 3MRQA 4J3VA 4NUJA 2C3GA 4WWKC 1R6VA 2HT2C 3N1GC 4WGWB 4JZJB 1WCBA 3MLRL 5T1LD 5EZLA 2BVPB 3T8XA 3IETA 2C3XA 4OCMC 3OXSB 5K9OB 1T22A 4F7CA 4YAQA 3WJJA 1QKZH 1RJZA 1T6WA 5IBUG 4MS8C 3TBWA 3VDBA 4I8DA 4TSCH 1JPTH 1S5IL 5HI3C 3OGCA 2Y1VA 4CDHA 3SDDB 2DTML 3MNZA 5I1CH 1WFOA 2NZ9D 5I0ZA 2J8OA 4K7FB 1X6LA 1CL7H 1OAXH 5IT2H 4WFGE 2YUZA 5DJ0A 1C5CL 4LSRH 1MI5A 1TNNA 3VXTB 2DDQH 1S8DB 5GGTH 3Q5YA 5DT1L 3MODL 4YWGH 1XF3A 4HJJL 1K3ZA 4JAMB 5IEHB 5EOQH 1A64A 4DW2L 4JFHD 1A5FL 4MB3A 5D2NE 1CDHA 3KPSA 3WFEL 1MHCA 1ZLWK 3WUWA 2GK0B 3L95B 4LMQI 5BS0A 2BERA 2NW3A 1ZWIA 1I7RB 1BIIA 2OBGA 3TEUA 4OD1L 5JDSB 4TULL 3NA4A 2NX5B 3GRWL 1ZGLM 1NC2D 3D3VE 2YN5A 2YZ8A 1DFBH 5E00A 2X4SB 4MA1B 3ZDXF 4KY1L 3AB0C 3G08B 1R3HB 3W0WB 1G84A 5D72L 2R8SH 5DMYA 2G60H 1L6ZA 1AO7D 4E9LA 2L0DA 5H94A 4RX4A 4OQTA 4O00A 3CSYA 3WS6C 1QBML 1FO0B 4LVOC 3D39D 4MSWA 4YPJA 4WEMB 5ICXA 3WEXA 5FA3B 2JIXD 3VFSB 3PWNB 3JV4B 4F7CB 3ULVF 4NKQB 3E2HB 4YHLH 4KKBD 1U8HA 4BQBA 3EO1B 3O6ML 3VMPA 2DRUA 5KN5B 4MB4A 3EKCA 2GIYA 32C2A 2R0ZL 1F42A 1EVTC 3EYOB 1UKSA 5EFIB 3E1F1 2LTQC 4QHUA 3L7EB 4QT5A 1EERB 5BVPL 1JNLL 3BP6B 5C0IB 1MWAA 4U1GC 2JB5L 3JWNC 4PY8I 1RMFL 3WKMH 3O6MH 2FZ3A 3RHWF 2XN9B 4U1KA 3IF1A 5FF6B 4XCYB 4YHML 4MJID 3E0GA 4JO4L 3CLFL 3DX8B 3MXWH 4HKXB 3T3PF 3QEQA 4GH7B 5BS0B 2ORBH 3L9RB 3VXOB 5HGBB 4N8VG 4XC1L 1TJHL 1U8PB 2IH1B 2APBA 1RMFH 3ROLB 3PIQA 2ZJSL 1IAOB 1NCBL 4GQ9L 3F5WA 5L2JA 1QRNB 2EDQA 2D31B 5D8JL 3SKOA 4R7DA 3TZVB 2KZWA 3DETD 4WV1B 3S96A 2FEEI 3TBTB 1QD0A 2F54A 1TNMA 2FIRT 5K9QI 5ALCH 4Z7QE 2W07A 2X05A 3MC0A 3MJ9A 4JHAL 3F62A 4NQCB 4D0BA 3LQMA 4CVXB 1OW0C 2BP3A 3BPCA 5CMAA 1IM3B 3PABB 3I6KB 5BOZG 5GS0L 3LH2L 1R5WA 1X7QB 5D8JH 4E42B 5GGUA 5JUEL 1FFPB 4DK6A 3VGEA 1IILE 3ARBD 5F3BB 1QFOA 4N8PA 1MIEH 1GPOL 4K7PH 5J13C 5DJ6B 3IFOB 3P0GB 4ZDHA 4RFEB 4NJ9H 1KPUB 3MLTA 4OQ1A 3UJTL 2VR5A 5T1MB 4NKMB 4OF8A 4XMLH 2QEJA 5CZXC 3EDEA 1X5JA 3V5HA 4QRRD 3B8YA 5EO0B 2H8PA 4YHMH 4OCYH 5CJBA 4JN1H 5C0DA 5HI5D 4XHJD 3UJIL 3DX6A 5C0AD 1YNTB 1JWMB 4EI6A 3ULUE 1CQYA 3CDGB 4JRXD 4Z9KB 4N0UB 1ZT4A 3OKEB 4GAGL 4NO0D 4WI8A 4HJJH 2QKIB 3LN4A 3DRQB 2EDKA 1ZLUK 1DUZA 5L2KA 4POZD 4BFIB 3QO1B 4WFHE 4HG4K 3QUXC 2CK2A 4K07A 5D1QD 3L3IA 4NO3A 4HFUL 2WUBL 4R3SB 4X4ME 4EVNB 1R24A 3FOLB 4YHIA 1ZMYA 3LS5H 3OX8A 3MV01 4WTXA 4X6CF 4G8IB 1ND0B 4LU5L 4Z7VE 2YPLA 3VWJA 4JRYD 5C2BH 4UIKL 3C60D 5FHBH 4ODWB 4MQXD 2IADB 5ESQA 2G60L 4NQDE 2NPLX 4JZJC 5E7BA 1EO7A 3GGWA 4OFIA 4XAKE 3NCFB 4ZS7L 2VDOH 4ZXBC 3H42L 1KPVA 3QRGH 3EYQC 4DUWA 3BRDA 3MLTB 1KPUA 1L7TH 2FEDC 5F7EH 1X3DA 4GQPH 2APWA 1KLGB 2BVYA 3MV8B 4PGDB 5A43C 4X9GA 1IQDB 3F7PC 1NUNB 2YPLE 3NGBC 2NLJA 3RL1A 4KHTL 2PTTB 2KL6A 4PJIA 4YDJA 4Z78B 1YYML 3D25A 4MA1C 1YUHA 4LLUA 3S36X 3QWOB 2Q1EA 3RTQC 2Z35B 4NQEA 1FH5L 3CK0H 2B2XL 1HHHB 2EDRA 2AEPH 2ICEB 1V7MH 2FO4A 1K4DA 4CDGC 3QUMB 1LO5B 4JKLA 4PG9B 4GT7A 5BV7B 4JY5L 3SJVB 1AP2A 3W11C 1CLOL 1KPRB 1J12A 4YDKL 2KQNA 1MQ8A 4X0KB 5D7LA 4U4BA 2NY5H 2NYYD 4L8DA 3KNBB 4DOHE 3RVWD 3W82A 3Q3GB 5TF1H 1LNUB 4N90E 4NHCH 2W0FA 5ANMB 1LHZA 3MTRA 4NWUH 3O0RL 5CD5C 2AXFB 1H3TA 2B4CC 2OL3A 3NH7L 1QTYT 3ZT7A 4HS3A 1OAYL 1TZHB 3QCTH 1U3HA 4TUOB 4L1HA 1OTUD 1ULVA 5HDBF 3QYCA 3IU4H 4BH7A 5I9QC 2VABB 4LQFL 4JY5H 1QLEH 4DGYL 2Y5TB 5I6XC 4U6VL 4JN2B 1MVUB 1RIUH 5I19H 5I1LA 2JF1A 1HILA 2YPVH 3U79A 3IXTA 2L7JA 4GO6B 4TYUA 4FQXD 2V17L 4M7JL 2X4NA 3Q48A 2NY1D 2CO7B 4I0PA 3JV5A 2E5EA 1CU4H 4RA0C 4HHAB 3BQUC 4IIQB 1KYOK 2OJZL 5IVXF 1UWEL 4RDQF 1MREH 3RY4A 3GSUB 2I24N 3RX7A 5IMOB 1Q9KA 3O3BA 1U8JA 4MJIA 2B39A 5IWLA 3IDYB 4QTIL 5GHWL 1NPUA 5E2UH 5E9DE 1R0AL 1JYWA 1HSBA 1SBSL 5ITFB 3HMXA 4WV1C 2FIKA 1FIGL 1NMAL 3RNQB 4U6XA 3HLAB 3UEZA 3MV7B 1GHFL 2PNDA 2YD2A 1HNGA 5ICZA 2P5WA 5GS3A 1C7TA 1OGAE 2PYFB 3L3KB 2WWMC 4RMTA 4XCNA 4OM0L 4JZJA 2IFGA 5KVDH 4PV9A 4Y1AE 4PJEB 4J1UB 5I1GH 3VG0H 3O9WC 4IS6A 3ET9F 4KTDH 1GAFL 1MFCH 3O3AB 2J8UE 3PGFH 2VZ1A 2C7UB 3EOBA 3B6SA 1UCTA 4HX1A 3U7WL 4GLRH 2W0PA 2XT1B 4OZGB 4TTDD 1N3NB 5BZDB 5GSVB 2R1XA 3VCLA 4ZOCA 4G8GE 5JR1H 2QQNL 2HRLA 4ZUWB 1AKJA 5IEKA 2D7MA 1EAPB 3VDCA 1KCUL 4KJQD 4G8GD 1JYXA 3QJHB 5F7YC 1XGYL 3NIGF 1XAUA 1T5WA 1YEEH 3MRPB 3P0YH 3T0ED 2VZTA 3FRPG 5KZCD 3PGCA 3ULVL 2JJSA 3MROB 1U8QB 5GZOC 4XWGL 5ITFA 1AXTL 2Z0BA 1GGCL 5D2LF 2M8XA 3QFDA 3LS5L 4U6XB 3EZJB 5JPMA 5L2KD 3F7YA 3O3DA 1VADB 5DURB 4LP5A 2UZXB 3VGGA 2AJ3B 5D1QA 2X4SA 5HYSG 3DO7A 1ZGLP 4IMKC 2VJXA 1MRDL 2FL5B 3VDAA 4PRAA 2EE9A 3VRJA 4GRMB 1FNFA 5C0FB 4PV9B 3UZQA 5HY9B 1D5MA 4OI9A 3S8WA 1G7JB 1PBYA 1Z3GH 4MSWB 3VWJD 3HZYB 3MACL 2IQ9H 4P2OA 1FSKB 1R5VA 3C60A 4BZ1L 1R3KA 4ONFL 2XPGA 3KWWA 1FO0L 3QNYB 3WDIA 4F9LC 5J4MA 1EZVY 2C3VB 4ZTPH 4CVWA 1QPPA 1IGFH 3LEYL 2R4SH 3DVNB 3B2VH 2BHYA 2OI9C 1FIGH 3QG7H 2E27L 2HFFB 5IFHH 3S3SA 1IFHL 1QSFD 3U0PB 4M6NL 2CLRA 3RWHA 4ZSOE 3GSVB 2XN9D 1XF2A 4FQ1H 1F58L 3WDJA 4H0GA 3MREA 3IF1B 5FF6A 5LGKA 3CZFB 3S37H 4HWBL 4X6FB 4G80A 5TE6H 4IJ3C 4OKDA 4KZDH 1EEZB 3R1GL 4NQED 2E9WA 1CLOH 5KS9F 1BF2A 1WAAF 4U1NB 5D1ZA 4NC1C 4QRPA 4M7JH 2XNAB 3ZKMC 5FDYA 5I66B 4GRWE 2IMNA 2D2OA 2KH2B 4M8QB 1XZ0A 5ALBL 3F5WB 2Z92B 3MJ9H 3PQYD 3A6OA 5F3HB 3P11H 3TT3L 3LAFA 3VW3H 4PJ7A 4MXQC 3GK8H 2FJHA 4LCWD 3L5JA 1KB9K 4K23H 4HPOL 5E2WL 4B7LA 1MCPL 5IHBA 3HNVL 1GZPA 4P2OB 4FQIH 1SEBA 3WBDA 2J6EL 2FLRT 2W59A 3MXWL 1DFBL 4XI5D 4M7LL 4UT7H 4MCYB 3MZTA 4UNTA 5C9KA 3DMMC 1QSFE 1U6AH 1DLHB 3SDCA 3NCYS 5BV7C 4M5ZL 4PRIB 4BZ2H 4E41E 3VFMA 2RCSH 3RWEA 1M71A 1B3JA 2CLZA 1RPQA 4PRBB 3UROR 3BVNA 5BRZE 5CLWA 2O93L 1HEZA 5DT1H 3B9KC 4TRPH 3RGVB 3QH3A 5AZEH 1CLZL 3UDWA 1IC7H 3UPCA 3DHMA 2K7PA 1JWSB 3HI1B 4H8WC 4YBHA 3PHOB 4V2CB 1MRFH 2VMFA 3SO3B 3HMWH 1VEMA 4JG1L 4X9IA 4CW1A 4FFVD 1ZA3A 4LLAA 2E9BA 4KH2A 3DRQA 3F7QA 4URTB 2YMXL 4K8RD 1KUMA 1N0XL 2P1YA 4R6UA 1T0NB 2IH3B 5LCVL 1A6PA 4UT9L 1K6QH 8CGTA 1TJIH 4L3AA 4KZEL 4M6OL 4PB9H 5IV2A 1MLCB 1J0IA 3MV8D 3AS3A 1DQDH 2Z31B 3GMRB 1EFXA 2ZCLH 1FZKB 1H15A 4JFFB 3P9LB 2A0LC 3NFNB 2VL5A 4K9EC 3KLDA 3RDTD 4C54A 4UDTB 4UT6H 2GT9A 4G8FA 1IC5H 3W9DB 2EEBA 2C3HA 1LWRA 2VSDA 4L5FL 5C1MB 2DKUA 1TQCB 2BY3A 3BQUB 3VGFA 3MBEC 1R3IH 4ELME 3VI3E 3ES6B 4MJIE 2NY4D 3L5XH 4YO0A 3WIHH 1N0XH 1YA5A 2B1AH 3R8QA 3EYOA 2ESVA 4Q2ZB 1RHHB 5T3XE 3UZEA 2GUOA 5GGRY 1A7OL 1XR8A 1UA6L 3LQZA 1SYVA 2DTMH 2EXYC 4OQTL 4WWID 1OTUC 4PJIB 4YDJB 3WS6A 5TE4H 1IAKB 4PRPA 5E1AA 4UQ3B 1D6EB 5ETUA 3GIVA 5C8JA 1JJUA 1Y18A 3CPLB 5DD1H 4KAQL 2XQYG 1ACZA 1JYVA 5SWZE 4Z7UE 5AAWA 1UZ6F 4KMTL 1CBVL 3QFJB 1QSZA 5GRUH 5DQDL 4HIIB 1QLFB 1RUAH 4GW5B 3MLRH 1UEYA 3MRHA 1CFNB 1LO4H 4OD3L 4JQVA 1BVZA 3RL2B 3UPAA 4FQ1L 1BZ9A 3BPOB 1YJDH 1NUDA 3HRZA 4MDJA 5D7LB 2J8UA 5ESAA 3TBYB 1DVFA 1A0QH 2J5LB 4JG0L 3UJJL 4KVCH 2F5AH 4K94L 1I8KB 2ZNXA 1CFSA 4GXVH 5T3ZD 3HG1E 1FYTD 1IM3A 2DQTH 1PG7L 2ZSWB 4MD4B 1KELL 2XA8L 4WO4D 4TOYH 2EYRA 1ES0A 3RA7L 1EMTH 5F89A 3O2DA 3T0DA 3QDJB 2R2HA 4OFPA 4ZQKA 1LQSR 2V5TA 4LASL 3RZCB 3HPLA 1DUYB 2F8VA 5F71A 8FABB 3C8HA 1DR9A 4APQC 4JN2A 3GSRA 4WFGD 3WD5H 3MOBH 4PJGB 4S2SA 4Y4FB 1NSNL 3NIFE 2Y25A 4D3CL 3G9VA 1RJYB 4KMQA 2ATPA 4C83B 2PXYD 4CAGA 4M43L 1BQHA 3NZ8A 3WSQH 3RWGA 1DBAH 3TNNA 3WXWL 2EDBA 4QHNB 4J23A 2XICA 5CIPH 2PW2A 3EYSH 2YWZA 1F6LL 1UG9A 3HNTL 4FTVE 4QRTB 3RTQA 4JO4H 4LSSL 1Q94A 4OM1H 4P2OC 3WO4C 5F7DB 5FCSH 4OV5B 2F5BL 3CMOL 4JKKA 4OD1H 1P7QD 2C3WA 3BGMA 3GSNB 1HE7A 3TA3D 4H1LH 2E8ZA 1NCNA 4YFDB 1WV7T 2IFFL 4JLRA 2EDHA 1PYWB 3VI4E 5INCA 2N56A 4I3RL 5D1XC 5F9JB 5D1ZD 1UJ3B 4G3YH 5FYLL 4BZYA 3VWJB 3O6FA 2VERN 1A7RL 3X12A 3HE6B 2WINB 4GFTB 2Z8SA 5HGGS 4CU6A 4OCWH 1A3LL 1DQJB 2E8YA 4U7SA 2D7PA 2O5XL 4IRZL 2P7TA 5GZOD 4QEGA 4ERSL 3I02B 1VGKA 4HQQL 4Y4KB 3O2WL 4R7NB 1B4JL 1UM4H 4BSWB 1ORSA 3IJYA 5HI5C 5IIEB 5IW6B 2E7CA 2NXYD 1XMWA 3TCLA 5JNYA 2CGRL 4AENB 2UVFA 3SJVD 4PJGA 2YUWA 1D6VH 2VKXA 1BLNB 4LAQL 3MMEA 3FO0L 5KANG 4CVZA 3FHQA 2DQIL 3MXVH 2X70A 4L4VD 3H9SE 5DK0A 1I75A 2BY2A 3HZKB 2AEIT 3QFJD 4ENED 2GSIB 2X7LB 3DTXB 1RHFA 3QJHA 1WC7B 4HS6B 3O4LA 2VNCA 3MRRB 1TETH 2J4WH 1P2CB 3HAEB 1U42A 2VLKB 3F12B 4HUUA 3VWKC 1JHLH 3PGFL 4M7ZC 1G9NC 1FYHB 2BSSA 4M9OA 4WDIA 3E6HA 1SQ2N 1PX3A 1PFCA 2BVUA 5F9JA 2FO1A 5FYLH 1IAMA 2OJZH 3IJSA 3UTQA 2Z31C 4LRNL 4NRYA 4EI5C 3OZ9H 3TJEH 4G8EB 4YR6B 4G9FB 1BFSA 2Z91B 5F88B 2AXFA 2M2DA 3MJ8A 3NTCL 1S5IH 5EIVA 3JWOL 3FQXA 5CILH 5JQ6L 4NC0B 5EBWA 2R2BA 4MAYA 3Q6GL 2Q7YB 1XEDA 1T4KB 2Q8BH 4U6YB 1AQDA 2VR9A 4X8JA 2ED7A 3VXUB 3PDDA 2VABA 1N6QL 4BA8A 4HK0B 5DMJB 2JJWA 1JF1B 1CDBA 4HGWB 2EIEA 1JZ2A 2VDLL 3QNYA 4JHZA 4UU9A 3ULSA 1UZ8B 2P5ED 5EU6A 4JFFD 3GKWH 1MJ7H 3QCUL 1XGQA 1MCBA 3VXRD 4Y5YB 3M1BA 4C4KT 4PY7B 1A21A 3PG2A 3CVHH 3ZSTA 1E27A 5JHDE 3BQUD 5GGTA 3QHZL 2XRAL 4ONHB 2F74A 1PQZA 4DOHB 3DMMD 1AQKL 5MENE 3C8DA 3CSPA 4LCIL 2QSTA 1FH5H 2QR0A 3AC0A 3GMLA 4M4RA 5E2TL 4KKNA 2GK0A 5C0AE 2OTWB 5MEND 2F53B 4LLQA 1J5OL 3B2UD 5D2LB 3K1DA 1KFAL 1LP9B 1IQWH 1MCCA 3S5LA 4F15C 1XZ0B 1T89A 3QNXA 2GTZA 2HTLD 3OJVC 4JRYE 1A6VL 1BFOB 3C5ZC 1V7NL 3FT3B 5ID0A 4HGKC 4Y16B 5KSBA 4R4BA 1OQOA 3ULVE 1NBZA 2OX5A 4HZAA 4HXBL 1PX4A 5DD1L 3WIFA 3JV0A 1IQWL 1AGFB 1MCWW 1O5DT 4X99A 1JV5A 2VN4A 1TPXC 3MRNB 5CUSH 5GRJL 3QDHA 4LSVL 3G04B 2GFBB 3HC4H 4P5TD 4TTDC 3M8OL 4KRPD 1CD9B 4U33A 4WHTB 5C0CB 4XBGB 3M1BB 4PG2C 3BEVB 5IW3A 2DTSA 1ZT7B 2MQ0A 4LRNH 1JYNA 3BKJL 1CD1A 2H2PC 2CR3A 5KVEL 5FO7A 3LKRA 3QPQC 4N0YL 3EDDA 5I1DA 5E5RB 4PJHF 5D7LE 2VDNH 1RQ5A 2EDOA 4P3CL 4ZNCD 3OAZK 5A2LH 1WCQA 1U8OA 5J9PB 3TFKD 3IDXH 1ZTXL 3TJHC 4AT6B 1T7WA 4I3GA 3WL9A 4XVJH 5GGRB 1FVEB 5JW4N 4W4OC 1S9WB 3KLSA 1BWWA 1GCFA 3KPLB 4R97C 3LMJL 3PQYB 3CFKA 4QXUH 5D6CA 1OAYH 4YAQB 15C8H 5FM8A 5IROC 4K3JH 1WTGT 2JB6B 4BSVA 5ESVA 4D0DA 2OQJA 3BKML 1LP9A 4YDVB 1IGCH 5HYSB 4FFWD 1F2QA 1ZVSB 3CDFA 3KR3L 1JFQH 1R3LB 4P46B 1P7QA 2AJSL 3L5WB 5I15L 4RGMC 2HAZA 5FHBL 4DKEL 4K7PY 1ZT1B 4RNRA 3VWJC 4W6XB 3VXPA 2I9TB 2VL5B 3GSOA 3KYMA 4NQDB 3VRIB 1CXFA 1G7JA 2EKSA 3BUTA 2JELH 4JKWA 1KN2L 4PLJC 2VITB 3ALWA 4GG6F 3DV6A 3V8OA 1OGAD 3BDBA 1A6TB 3GI8H 1IC7L 1HHJA 3EZ8A 2ADFH 3ES6A 4Y4KC 3W9EB 4JREB 2P43B 3MRMA 2WIMA 5I1EL 5CHNA 2XZAL 3QJFA 2X9XA 1T1YA 1M6OA 2QQQA 5EC2B 1NGYB 3X13A 1OAQL 3SE8H 1I9RL 3ZDYE 1S8DA 3O4LE 4UB0L 3Q6FB 5C0RL 3QZWA 1U8LB 3CZFA 4F57L 5I16B 5I17B 1CLYH 2P8LA 4J3TA 5IFAH 1ONQB 3ZYIA 5C0JA 4JJ5B 1FJ1B 2GSGA 2LE9A 3U83A 1ZWIB 3BRFA 4PJXA 4UTAL 5FO8B 4K23L 4OCXL 3QFJA 3BWAA 1CXHA 4YIQB 1DUZB 2BRRL 5L2KB 5KN5A 4FQJL 3LKNA 2VLLA 4DN4H 4L9LA 1XGTA 4YE4L 3SHSA 4NO5A 1A7NH 1ZEAH 4H5SB 4OCRL 4XBEH 4C56E 1QFUL 4P9HH 5DJXB 4ELMB 3H8NA 3K8LA 3BP6A 3WXVL 4B7IA 5C0IA 2P5WE 3PWJA 4ORGA 1PZ5A 3PJSA 4PTTA 4KFZC 4UV4H 3TC9A 3CU1A 3HUJA 3JV4A 1IKNC 1G9MC 1A7BA 1WAAA 2AV7A 1RV6X 5F1KC 5GGQL 2R23B 5EU4A 5FGRA 1AJ7H 4I0PD 4O9HL 4YE4H 3O4OC 1MPAH 1IARB 1MCEA 1FG2A 3TGXA 1GGBL 1N7MH 3B8SA 3SDCB 5F89B 3SE3C 1QFUH 4P9HL 4YDLC 4HUWB 4XNYL 3DECA 4MCZB 3V5KA 4QHUB 1NGXA 4GAJL 5J1AB 1NGYA 5FYKU 3X13B 1IAOA 4M1CD 4YHYC 3H9YA 2F54E 3OBAA 1OD7A 1YJDL 4UBDC 4CJ1A 4H0IA 3ZE1F 5FECB 3C9NA 4EI5B 5IMMB 1TCMA 3UJJH 1N64L 1RULH 1TQBC 5AZ2L 1SJHA 2ATPB 4QRQB 1J0YA 3GMOA 4NQCA 2P5WD 2YHGA 2YWYA 2DQJL 1XCQB 1QHOA 1WVZA 5C09E 1A22B 3ECBA 4KRPB 5D2NB 1XGTB 1JRHL 1RUQL 4XBEL 2D31A 4UOW1 4D94A 4NC2B 4X4ZA 1CL7L 1EMTL 5T5FL 2HTKD 4HBCH 2DF3A 3KJ4C 4YEFA 5EUOF 4ZD3H 2APFA 3QDMA 2Y5EA 1OT1A 3U4BH 3ZMRA 3UDWC 3JWDH 5CZVH 4DGVH 3WNOA 1QSVA 1L0QA 3ULVH 4KTYA 4U6HB 1NBYB 3S4SB 4KHXH 1A1NB 2AEWA 3FO1A 1R5WB 4YXKH 1JGLL 5FKPB 3MRDB 2OTUA 4YZFF 1QFWM 1JNHB 4OLEA 4JM2C 5DVKA 1OAUH 2F15A 4UTBL 3EYVB 3DXAD 1JGUL 3T2NL 5FA4A 3TH3T 2HWZH 2X4QA 1EDQA 1S5HB 4NT6A 5GISH 3ROOB 5F1SA 2CKBB 4IDLA 2FECI 3ARDC 4PJHA 1OP5H 5EIIA 2A6KB 3ZTNL 3RVXC 2OL3L 3JTTA 4N0CC 2AERT 4G8IA 4P9ML 4JFDA 5D4QA 2IGFL 4HDIA 4XBPA 4LSQH 1N59B 3IDXL 3QNZB 1FVDA 1ZT4B 3F58H 4R97B 3X3FH 4PRPE 2FR4A 5B3JE 1FYTE 2AK1L 3ZTJH 4BH8A 3IGAB 5F7LB 3MJ6A 1QRKA 1IEAB 5GRJH 1OM3L 2OR7A 3WIHL 3OJDA 5E99L 3HRZB 1KF9B 2YBRB 3U1SH 5MEQA 5D7JB 5CZKA 5L9DL 2V7HB 2A77H 3G6JE 4NM8L 3UTQB 5GGVH 3WS3A 1IGYB 4MAUL 5C0CE 5DFWH 5HGHA 4R4ND 4M5ZH 4KKLD 3WDHA 4GKSA 2EYTA 3S4SA 3EYUL 4PJFF 1CE6B 1LO3L 3O6FC 1RJCA 3CVIL 1KOAA 1H5BC 5CS7A 1MREL 5CEXA 2ZCHL 3ABZA 3PWLB 4XPGH 1S9VB 4WUUD 3MRFB 1T66D 2FNBA 1LO5A 4Q0XL 2D03H 4APQD 3F6LA 3W11D 3VXQB 2YA2A 3ILQD 3ZHLA 4WUUE 2NLJB 4FXGA 4WU5B 5LBSL 2Z8RA 3LHPL 4HULB 4YXHH 5FFLA 1EJ6A 4K8RL 5EIIB 2XA3A 3R06A 1NMCB 4DZ8A 2QSCH 1KN4L 3NIDF 3PQYE 5I73B 1E27B 2BVOB 5C0AB 2J12B 2NY6B 1JIBA 1X4XA 1VGEH 4F58L 4LNVA 5J89A 5FGBC 2J88H 4Y5XC 1IM9D 2VDQH 2N1KA 1TXKA 1YQ2A 5C0BA 1CE1L 3D18A 1T80A 1PEZA 5DI8B 4YXLL 4TUOA 2GCYB 1AP2B 3GSQA 2VDLH 1XF4B 3QT2A 4JCLA 1QSEA 3LEXA 4Y5VB 4CU7A 3V7AE 4OIBA 3PDOA 3MCKB 5DYOA 2Z93B 2EDTA 3QDME 4WFED 2ID5A 3C2AL 4IM8A 2Q8AH 3SKJL 5EA0L 3QFDB 3F7YB 4XVJL 4AL8H 4GAFB 3CSBA 3QP3A 4LOUD 1DDHB 4KK8C 1MCLA 2OL3B 3S34H 1CE6A 3UTOA 3DSFH 4WTZG 5BO1L 3B83A 3A67H 3ULUC 4AM0B 3IAPA 3H9HA 4HFWA 3WUZA 3OAUH 3QXUA 3WN5C 1TVHA 4NBYB 5I8EA 1AQKH 1QHPA 2WLYA 4QXGH 1OF2A 2CKNA 1NEZB 1R3KB 4GAYB 1WBZB 3V52H 3CDCA 5E2VL 1V8HA 2G9HA 4ZAKC 5IGXH 2NNAA 4L4TE 1FLTX 1NFDF 4P5TC 5HI3D 4CMMA 4HUXB 3MNWB 1AR1C 4K7FA 3RKDC 2F53E 5HHOE 4YHYB 4Z0BL 2CR6A 1AD9B 3EFDL 3D5OF 4S0SD 5JXAL 5I1AA 1P7HL 1T0MB 1DEEB 2AK4B 4L4TB 4WFEE 3MRBA 1YEEL 2HMID 4LCYA 1KCVH 3VWKD 3BHBA 4ZSOA 5KW9L 1IMHC 3MYJA 3I3DA 1FCCA 2GCYA 4TNVK 5EU7E 5HHVH 1I9JH 3B2VL 5TH2B 1WAAE 3TJHD 1MAML 3Q6GH 4NCC1 4X7SL 2YR3A 4LGPB 3TNMB 2JJUA 1INQB 1YN6B 5HYJA 4X5XB 1TENA 2CUIA 1VEOA 2DQEH 4IOFD 4NRYB 3KXFA 4XP1L 4OZIA 1T2QH