2VDPL

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpL01
3PGDB 3U0WH 3VFOA 4XP9L 1Q8MA 4UQ3A 4RAVB 1QSFA 2VAJA 3QIUA 2VLJE 3MV11 5LCVL 4V2BA 3M8OH 1JI1A 4ODVL 1T80A 2SEBA 2GK0A 4JN1H 2XNAA 2BNUA 2ATKB 2EXYC 4OTXH 4PTUB 4KAQL 5DQ9A 1P4BH 1BLNB 4GOSA 4RSVA 4Z95H 4XX1E 1DVFA 5FUZH 1PG7L 3FOLB 4JG1L 3BKYL 3K4AA 1EMTL 4RAVA 5F9OH 2F53A 1QEWA 3D39B 1KLGA 5JHDB 4OBSA 4ONFL 4XVSH 4LLYB 5D7LD 2EKSA 4DKDC 4OCRL 3LEXA 3NCYP 3RU8H 3E3QE 3QI9C 3VGEA 3BUYB 1LO2H 4U1GC 3VH8B 4Z5RB 5E4EB 4WWKB 4YFLI 1FORH 4R26L 3B8SA 1INQB 3B3IA 3BZDA 3QDJE 3ZTJH 4L4TE 4JO1L 2P5ED 3QEGL 4POZC 1SJEB 3SDXB 4HAGA 4XWGL 4Z7UF 4XHJD 4NN6C 1X5AA 2Z4QB 5HHNB 1C5DB 4Z7OE 1TQCB 2IG2L 3PABB 5EO1B 1HSBA 3RWEA 3J8F7 3KYMA 5SWSD 3ARDC 5ANME 4ONGH 3NCFB 3MREA 2Q8AH 5CGMA 5CD3B 4FQXD 2IMNA 1YEGH 1D6EB 5KS9B 4JRYB 1F6AB 5JLZA 4WEBH 4UB0L 2BRQA 4XXDB 3WS6C 3U7YH 2YBRB 4CDHA 2NYYC 4OZGB 5HD8C 4OF5A 1CFVH 5IMMB 1RIVL 1IRAY 2ZCLH 2AJSH 1VGEH 1CLYH 1U6AL 2AS5M 1TCRA 1C8PA 4ZSOA 1E6JL 2VZ1A 4UOJA 2DWDA 2UWEB 4LSQL 3H42L 3ARFB 3P0YL 2IGFH 1QEWB 3D39A 2KH2B 5DMIH 2Q7NA 1A6TA 4YBLB 4YXLL 4QOKE 1H15A 4PLOB 2ZCKL 1DE4A 1O5DT 3VD4A 4PP1D 5T1LB 4QWWD 2HA1A 2YPLD 3GSOA 1A7OH 4IHOB 4TRPH 2X4OA 3ALPA 3SPVA 5JW4M 3BP4A 2ZWLT 4JHWL 4YE4H 3Q5TA 1LP9A 4N90E 2Z31C 2VIRB 3DO7B 3KLSA 5DJDA 4E0RB 3LEYL 3V8CA 2ZUTA 2QL1A 3MNZB 5HDBE 2B39A 4IIQA 1GOHA 3QUMA 5HD8D 2DLFL 2F8VA 5B4MD 4Y2DC 2Q8BL 4KKAD 1AQDB 2YXMA 3REVA 5FGBA 2AJZA 4S0SD 3Q6FA 3U2SA 3QNYA 1OF2B 4WO4C 4TVPL 4UT7H 1KF9B 2YD1A 3HFML 3MJ9A 3NIDF 2FB4H 1EA9C 3QJFB 3WJLA 2XQBL 4AEIL 2DBLL 5KVFL 1I4FB 4HJJL 5AD0A 4QY8B 5DT1L 5KSBF 4FQQA 4GBXC 5J7CC 4Y0GA 5FHAL 4NQCE 5I1GL 5FYJH 4JZJB 2F58H 5D2LE 1RZJH 1JGLH 2DLIA 3IAQA 4N9GB 4POZD 3T4YA 1QBMH 4XNYL 2B8OT 5E8EB 2MPAL 3CPLB 2XTJC 1DSFH 1LVEA 3I50H 2IG2H 4FFYH 4X7FC 4OIIH 4JY4A 5TF1H 4YGAB 2X1QA 2R9HC 3CFCL 1NMAL 5D7IF 2IBZX 3KYNA 5HHVL 5C8JA 3LRHA 1FO0L 1M71A 1NDGA 1ZAGA 3BIBX 3RWGA 4NN5B 5EN2B 2R4SL 5DRWA 3I75A 3CFBB 5ABDE 1JNHA 2FL5A 1EGJA 4G8EB 4XMKH 5C0BE 4RFEB 1NUFA 3I9GL 2XOTA 2R9HD 4JZJA 3ZDXE 5MENA 5EZIL 5D7IA 4EDWH 2V5YA 3QQ3B 1FVDB 2Y25A 3P9WB 35C8H 5I1JL 2X4UB 1XGYL 4P9ML 1ZLUK 5T33H 3TGXA 1VEPA 5FYJD 4UDTA 4YHZH 1NAMB 3WLBA 4HUUB 5DMYA 1VKXA 3DMMB 2ZJSH 5F9OL 3WS3A 3CZFB 1U91B 4L29A 3H3PH 4Q7DA 4Z95L 1WBZB 3K1KC 4HIXL 5IWLC 3DV6B 2LTQC 1S7RA 4WDIB 4POYA 5DJDB 4E0RA 2R1XB 2ITDB 2ZUQB 1YN6B 3QSKB 5FXCH 4L29B 3U0WL 2GIYA 4AH2B 5B4MC 1MCIA 4R2GD 1NAMA 5DVNA 4L3CB 1K2DB 2ADIB 4KUCD 5FF6B 4YX2L 4M1DL 3RWJA 3MRLB 1QKZH 3U0TA 3PIQB 3TO2A 4W68A 3V6ZA 2OR9L 4KQ3L 4MDJA 3O2WH 4OSUH 1UM5L 4GKNB 1VFMA 3TNMA 2EDQA 3U6RA 3RVVC 1JPTL 1QHOA 3NIGF 4JANA 2VDOL 4DQOL 2PTTB 4HDIB 5DJ0A 3ULSA 3H9YA 1M4KA 4PB0L 3EYSL 1BFOB 1I8IA 3VFVB 3G6JB 4XCCH 2CIKA 3MMEA 1TTFA 3MXWH 1QRNA 2IANA 4PP2B 1C7TA 5I75C 1MAML 1KPRB 1WT5A 4U4BA 4DTGH 3BDYH 4GRLB 3CX5J 5HI3C 5AAWA 3U9PL 1GAFH 2L4OA 1F6AA 2AJYH 1FAIL 1S7TA 3KHQA 1RURH 5E8EA 4G7VL 2IADA 1A6AB 5CJBA 2WMPA 4LLMA 1MCOL 1J12A 5F9JA 4JHAL 1NFIA 2DJUA 1H5BA 2NY6B 3FFCD 1NCWL 5BZWB 5A2IH 4LKXA 3CGTA 3L3IA 3F7YB 4DKFL 2CIIA 3MV8E 3MLUL 2WUCL 5KTEH 3C60B 4OZHA 4PGZA 1RMFH 3NPSB 1E4KC 3QUXA 5BQ7B 3MYZA 2CLVA 2ESVD 4KUCF 3QP3A 2I60H 1OAYL 4UAOC 2IALB 1UA6L 3JWOL 1G6RA 3STBA 2R69H 1F97A 4OQTH 1Q72L 2VXQL 3EYFA 5A16B 4EI6A 3BP7B 2R0LH 3X3FL 2FGZA 2IH1B 3BT2L 3LZFL 3DSFL 1S8DA 2D3VA 4DGVH 4KV5E 5K9JL 5K9JH 1U3HB 4HGWB 5GGUB 1T6VN 4PJDE 5EZLA 2HH0H 1EEZA 1JWMA 3X3FH 2FJGA 3D69A 3V6OE 1MCLA 4S1DD 5GRWA 5HVHC 1OLZA 1Z9MA 2F53B 2VLMD 3DX8B 1P7HL 4YHLH 4XP1L 5ADOL 1B6DA 2J3SA 2C3WA 4ORZC 2WUCH 5KTEL 5AZEL 1FNHA 4M6OL 4OFIA 1F11B 3ARGC 1XIWC 3Q0HA 3GSWA 3W5NA 1CS6A 4Y4FA 3QPXL 5E99H 2HJKB 1CYGA 3DX9B 4K3DL 4OCYH 1F3RB 4YEFA 4IOFC 4X8JA 1E6OH 5JDJA 5ISZE 2OMBA 4PJXA 4JPWH 3FMGL 1SEQH 1NKOA 1J7VR 2AJ3A 5ACZB 3O8XC 3ZKND 1IM9B 3IDXH 3Q3GA 1XCTA 3GJFK 1KIPA 5GRUL 2FEEL 5HXMA 1EO5A 1A6WH 2IPUG 3RWFA 4KZEL 3OR6A 4QHKJ 3IDNB 4PJIA 4ODSH 3PJSB 4R96B 4X99A 4Y5XC 3UTSB 4DQOH 12E8L 2XRAL 4J4PC 1T1ZA 1YPZF 2F54E 3O2DH 3DXAE 3D85A 4X7EC 2XQYK 2EIBA 3LRSA 1YMME 5EC2B 4PGEB 2F19H 5L8KB 3LDBC 2BNRD 2VWEC 4MJ5A 4EUPB 4U1GB 5B3JF 4RZCA 3N06B 1V3KA 1OP5K 2HT2D 1NCDH 2WIIA 2VITA 1FRGL 4DWHA 5C6PB 3RQ3A 1WEJH 4HWEL 5DS8B 4MJID 4O9HH 3GBLA 5DUMH 3BD3A 5T1MB 2QADD 5DRXB 1CI5A 5GS0H 3LH2L 4GQPH 3CXDL 4NZTL 5K59F 4MAUL 1I8MA 2DQGL 3C9NA 5EUOA 1W2KT 4Q2ZB 5L7XL 5GGTL 4LVOC 4MXVF 3LKNA 5DRZB 2R56L 1I8KB 3VFVA 4N0CC 3CSYB 3OKOA 1BIIA 1FDLH 4Y4KC 3ULSB 5JHDA 3AXLB 3FB8A 4HKJB 1GPOH 3VXUA 4A2MA 5EU5B 5TPWL 3QCUH 4P46C 4EXPX 1SM3L 1DQDH 3KLAA 4MA3A 2NW3B 4EDWL 1A0QH 4HH8A 4HZLA 1WWCA 1YDPB 2HJLA 1R24B 4M1GH 4GG6A 3MLRH 3IDUA 2GJ6A 4XPBL 2EIEA 1KCKA 4ERSH 4QRRD 3GMMB 4WFGD 2CLZA 2XQYG 4LPCA 3A6CH 2C1PB 5GGRY 4HS6B 3TLRA 5HHVH 1BJMA 5TF0A 2EYTA 1OAKH 3PGDA 1IEBB 1MCBA 5SV4A 3FCTB 1UZ8B 4WDIA 3LS5L 1A7OL 4W81A 5L88H 4YQXL 3EJJX 3BRFA 2H2PC 1HQ4A 2JKXA 3FB5B 3FJTA 4ZPVB 4ELME 4LSTH 2FHBA 3ULUH 3FHAA 3QAZC 2BJMH 2CLZB 3CK0H 2BY1A 2Z93B 1IBGH 5FDYA 2NX5E 4H26A 1U8OA 1G7IB 1FH5H 1PQZA 3KXFD 4MD5A 4NQVB 5E5RB 3NCEB 1A6WL 1FVDA 4U1KA 3CFKA 1A7NH 5FKAA 3GO1L 3GBNH 4UTAH 3KPNA 2DQEH 2R2HB 4X5WA 4JLRA 1GRWA 1KLFA 2HT3C 1LE5A 1SHMA 4D9QD 4CGTA 4NHCH 1JNHB 2FL5B 4XBPB 2D4FA 1FGNH 1TJHH 2XIDA 4JKLA 2FNBA 2J8UA 5GS0D 5DEGA 3DVNB 3VXRB 5IJVB 3MUY1 3QIUD 5E56A 1JYVA 1CIDA 3HE7C 1OD9A 4WFEE 4NYLB 2VC2L 3GBMH 3FFCA 4LF3B 3LKRB 1VFBA 5HHQB 3WJJC 1PX4A 4JFXB 5DK0A 1BREA 4WW2F 1KB5B 2OZ4A 1AXSA 2C3VB 4RX4A 4F8QA 4H5SA 4HKZA 4J1UA 1JNLL 2ADFH 1R5VA 4XXCC 3F7VA 4Q6IA 4MWFA 4JY5L 3HPJB 4BK4A 3QUXD 5DJAA 1DL7L 4MB5A 3CDGB 2J4WL 3O3UN 3QJFA 3TIEB 3C2SA 3BE1L 4KI1A 5D1QC 4DAGL 3QCUL 3OF6D 3ARUA 5TPWH 5DRNA 4HC1A 4X6CF 1GPOL 5GS2H 1AO7D 1TZGH 2I60L 2ZCLL 1DQQA 4MQTB 4H0IA 1YECL 4MAYD 1IGFH 1OGTA 1B4JH 2Z35A 3X13A 5EB9A 4KRMB 4Q9RL 4KRPC 2ADGB 3MLPA 1GIGL 3DIFA 4MLSA 4JM2D 4GSDL 4MQXD 1UZ8A 4KAQH 3TV3H 4QHUB 5BVJB 2MHAA 4Y7MA 5ACZA 1UB5A 2BVOB 4LNVA 4FQXA 4LARH 4GG6E 1RJLB 5DUML 4PTTA 1IAIM 2XZQL 3NZHH 1AY1L 5C07E 5IGXH 3GSNH 4PJXE 4U1HB 3LKQA 2PYFB 3QXAA 1TJIL 1MCDA 3EYQD 2BRRH 3ARED 4NQDE 5F72S 4AMKH 3JWDH 4ODUB 5T3ZD 4OJFL 4Y1AB 4O51A 5LGHH 5EORH 4EZMA 3L3GA 1JWSB 5D7LB 5I15L 3UTTE 1KNOA 3P2TA 4M9OA 1F4XL 2W9LA 5CCKL 4JDZA 3OF6A 4HAFA 4PB9L 4PV9B 4LCYA 4R26H 4S1RL 5E94B 5D71H 1A14L 2HYMA 3VRJB 1IAII 1VSCA 4NWUH 3MUZ1 1AGDB 5IQ9A 3BZEA 2Z92A 2OBGA 5LAXA 1DEEB 4HGWA 5IP4A 1MJ7H 2IH1A 4JCMA 1FVEB 3S34H 3WEXB 3IT8D 5DGQA 4YFDB 2EDWA 5ADPL 1Q0YL 3ESUF 5T1MA 3ARFD 1KJ2A 3ARGA 3T2NL 4NO5B 3ZDXF 2K1MA 3EO9L 4K9EH 2JF1A 1NC2D 4U1MB 3SBWC 3VE0A 4X4YA 5CMAA 1A1OA 4YO0B 3MRNB 3O9WA 3P9MB 4LKXB 1IGCL 4Y2DA 5DYOA 1U8LA 2A83B 2X4QB 1BD2E 5EZJA 2EEAA 4HMDA 5FA4A 5GSVA 4BZ1H 5LCVH 2ZUYA 3LD8B 2DQTH 5C9KA 4QF1B 5D9SB 4Y89A 2E7LC 2GAZB 1TIUA 2AJXH 1CF8L 3GMRB 2AEWA 3BRDA 5CHNA 2AXGA 1WBYA 2JTDA 1Q0YH 3DURB 5JHLH 4HUVA 1KEML 3D2UB 3KPSA 4WFFD 4H1LG 3NIFE 5KBNC 4B41A 4WWKC 3TH4T 2GUOA 4OIBA 2LTQB 3T3MF 4I4WB 3TBWB 1I8IB 3LKSB 5D2LA 1EO8H 1FP5A 4HDIA 3CLFL 1KIRA 1Q72H 3P30H 5DJ0B 3UJJH 4NRYB 1IAMA 3ELAT 1T2XA 2WBJA 3HNSL 4TN9A 3CD4A 5BZDA 1KCSL 4ETYA 2OYPA 1XGPB 3L3GB 2X89A 3QEQB 1ZKAA 2OR8A 1CL7H 4PY8I 5D2LF 1NCTA 3NBNA 3RL2B 3ALXA 5L2KB 5E2VH 2MQ0A 4Z8FH 4JHAH 2X70A 3FO0H 4HEME 3MLVH 1N6QH 1EUUA 5IVNA 1E4XI 4HLZH 3K4ZA 2Y6SC 4HIIB 3F8UB 4K94C 5E5MB 5SX4I 1DBKH 1QSEA 3ZTNH 2NMSA 4JFQA 1HH6B 4WHTB 1HHIA 4KK8D 1MUJA 2CRMA 4Y4KA 4Z7UB 3LD8C 2WIMA 4JRXD 4UOW1 5C08D 1ROWA 4X0KA 3BDYL 1CL7I 3KHOA 4X9GA 5D2NB 4XMPL 2DQHH 5BO1L 1YNKH 1MH5B 4HJJH 4B0MM 1PYWB 3KXFE 3ARFC 3VFTA 1NUNB 3MXWL 1KC5H 4I0KA 4NKOB 4RDQF 5HJ3A 4K7PL 1KTKE 3RY4A 4G43A 1TVDA 5FOJA 1ZEAH 3NIFF 1KC5L 4AM0A 1FNSH 3SQOL 3OX8B 3X12A 5IHBA 5E24E 2ATPA 5C0AE 1FVCA 1INEL 4NUJA 3QUYA 5D5ME 3S96A 1NMBH 2DKSA 2DLFH 1DQTA 1FFPB 1KPUB 2Y9RT 4P4KC 3AC0A 4S2SB 5J4MA 5MERB 4OFVA 4M9PA 5IR1A 5FCUL 3RX7A 1OQOA 2Z9TA 2ADFL 2MQ3A 4RA3A 4F3FB 3PP4H 5BS0B 1Q9OA 3QNZA 3RVXD 2DI8A 5HGAB 1A3RH 2JK5A 4OCNC 1IEAA 1S7TB 2DTSA 1HCVA 1V3JA 1OPGL 1OTUD 3V52H 4D0DA 2VMFA 3OKNB 4K3JH 4UMGA 5CEXA 5JIPA 1KIQA 1LDSA 2AQ1A 3T8XB 4B7IA 2CK0H 1FIGH 3KYOA 4L3ED 4P2RE 1AFVH 1GZPB 1YQVH 3PGFH 4BFBD 2CUMA 1RIUL 1R0AL 5IMLA 5F7DA 5JPMB 3ULUC 4OLWL 2HKHL 1B0GA 1FGVH 3FO2B 4PJBF 4XC3L 4LCUA 5GS1A 4PLJC 4AIZA 3OQ3B 5J57B 2IGFL 4U0RB 3ZE0E 5DJ8A 2FECL 4XH2A 5BMFL 5DMKA 1YUHA 1MEXL 5KG9B 1YEJH 2G5RA 4HEPG 1FBIL 3MRLA 5F89A 4LBEA 3OKKB 1G7JA 3ZDYF 3CH8A 5GGSB 5AG8A 4I0PC 2AK4A 3VMNA 2F8XC 3M17B 1MFEH 2Q7YB 4WEBL 3ZYOA 4DKEH 4Y16A 1OF2A 2C5DC 3O8XB 2D7TL 2VUYA 4AG4L 1H3GA 3VDBA 1HQ4B 3FB5A 1OAZH 1G7QA 5H35B 1OT1A 4FTVB 3QXTA 3CJJA 3NTCL 4C83B 3NPSC 3LN4A 4LVHC 3FOMB 4WV1C 4YUEL 3HCVA 3QUXC 5C0IA 5F8QC 1J0IA 5I9QC 5BW7C 2UZIH 2DI7A 2EYTB 4CADA 4ZYKB 4K9EL 3A6CL 3RZCB 2DIBA 4ERSL 5T3XH 4NNPH 1IGJB 5D1QA 5AUMA 1MWAH 2V17L 5GS0C 3DRTB 3CX5K 4OBRA 1RUQL 1CVSC 3PWNB 1AJ7L 3QRFM 2GJZB 5DT1H 2NXZB 1VFUA 1JWUA 5BZDB 4PREB 1GGCH 4YHKL 3EDKA 3NCMA 3V6FB 3O6FC 3V4VL 4XPAH 1J05B 1O0VA 4WIQA 2I5YL 1I1YA 3JVGA 5JIIA 3LMJL 1NLDH 2I26N 3UP1A 2OL3A 5JW5B 1CDGA 3TP4A 1I8KA 2DQIL 1RI8A 4KH2A 1TNMA 1CFNA 3KYNB 3QHTC 1YEKH 3KYOB 2VSCA 1HHKB 1ACZA 2VB5A 3ARDA 3IKCA 25C8L 5IB4B 3QHZL 4FQJH 4UIMA 1WV7T 5JO5B 1CTOA 2DICA 3G04A 3L7FA 3F7RA 1IEAB 3P0VH 1OPGH 1KCRH 3BPNC 3ROLB 4NFDA 1J1XH 4ZFFA 5CEYB 1E28B 2A9MH 4LSUH 1OM3H 5EZJB 2VXUL 3G9AB 5HYFA 1F00I 3VGAB 3SDDD 2VLKE 2VDML 3IFOB 3KJ6H 5M95B 2Z8WC 4R97C 1RULH 1Z0MA 1R5WA 1H3TA 5DI8A 4BFIB 2WQRA 1J5OL 1QFOA 3S88L 3WKMH 4JFHD 3QPQC 4L4JA 1NFDB 4OUUA 4GMTL 2YD9A 4LSQH 1QQDA 1RZKL 2YRZA 2I9TA 3BOVA 2AJZB 4OGYH 1T83A 1U8PA 3U2SB 1MRCH 1P5VA 5EPMA 4TUKH 2EC8A 1D5ZA 1NGXB 3KNBB 5EOTB 3VGDA 1CN4A 3P4MB 2P7TB 2F74A 2X4SB 3QHFH 3SKMB 2JJUA 1NGYA 5KVMC 1KLGB 2CUHA 5EBWA 2PCPA 4JM4H 4NKIH 4JFEB 1DTUA 2A2QT 3FOLA 4LCIL 5E2TL 2PW2A 3IB4A 2VC2H 3GBML 4QTHA 3UDWA 4L4VB 1AO7E 2VDKL 4TNVK 2QR0A 4UAOB 2JB6A 2DBJA 5CBAA 3ARRA 3ZE0F 2RCSH 3BPLB 4FFZH 4YHYB 5ADOH 4EI5C 4ELMF 4JB9L 4YHLL 3FONA 1JFQH 4JDTL 4UTAL 3QUML 4U7SA 4ZUTB 4FQ2L 2P7TA 1R5IB 5CP3A 4OAWA 1F4WL 1C5BH 3GMPB 3GHBL 3WNMA 2ZOKB 1KXQE 5GGUA 3KPMB 1ADQA 4M1CC 3I6LD 4MNGA 2GITB 4Q74A 4JQVC 3GJFA 4MA8H 1JTPA 2O5ZL 2E27L 3KR3H 4YZFE 3LQMA 1N64L 5FM8A 4JFYA 1CCZA 4LSTL 4URTB 5CD3A 2EDDA 1AGEA 3GMNB 4S1DC 4QGYA 2FZ3B 5TQ0H 4OZHB 3MLZL 3N1QC 1JZ7A 4I9WD 1MHCB 3T4AA 2FIKB 4XI5C 5IEKB 1FG2B 4U05A 1MCOH 4G9DB 3M8OL 4DVBA 4HWBL 5I73C 5B8CC 4ZFZA 3K8MA 1IILE 1YMMD 5HHQA 1T0MB 5FCUH 4B50A 4MNGE 3VFSB 1TZHB 4X7SL 4I1NB 4Y2DD 4Z5RA 3KYAA 3RY5A 1QA9B 5I1AB 2ERJC 1J8HA 3ARVA 3MRKA 1KJVA 3BZEB 4TNWF 3LMJH 3EOYG 4X7TB 2CMRH 5DURB 2YPKB 4NWUL 4FABH 3INUL 5IOPA 5D71L 1UACH 1IC4H 2EC9U 3PWPE 5I1KL 1F4HA 5HPMA 2M8XA 1NBZB 1OLLA 1B9ZA 5BRZE 4NCC2 3B83A 4U1KB 1Q0XL 2HLFD 3FAWA 4XMPH 5F70A 5CGYC 5L7XH 1UM5H 4JGUA 3K1DA 3MYJB 2OSLB 3P4NA 1KPVA 4CJ0A 4FXKA 1FO0B 1LEGB 1TJGL 4OZFB 3HC3L 2GK0B 5DFVD 1OOAA 2P49B 2PO6A 5DJZA 4Z7QE 1OB1B 1FAKT 4RX4D 3VXSB 1CTNA 4ISVB 2YD5A 3BKMH 1MI5E 1XCQA 3BKJL 3C08L 4KKBC 3CFEB 1UB5B 2BVOA 3L7EB 2FHCA 1KN2H 4MNQE 4XC1H 3WIFA 1EAJA 1WCBB 1A6VL 2PNDA 3MRQA 4YDJB 3FQNA 1TMCB 4D9RE 5HYJB 1T22B 2LU3A 3GK8L 2XG5A 2AJUH 1I3GH 2H8PB 3MLYL 3MNVA 2Q6WA 4QCIA 3KYKH 1T3FB 4KJQD 2B4CC 4HSQA 4Y16B 1NFDA 4HUKB 1J87A 2PXYB 4NGHL 4N5ED 1J9CT 3ZSSA 2D7NA 4GAYA 1VACB 4F7MA 4NRZA 4P2OA 4M5YH 4RGND 1K8DA 2RQ8A 2VZVA 5ELIA 5E2WH 3KS0J 5E4IA 2RR3A 3WIHA 4P23A 5IKCB 2VDQL 4OCSL 5DMKB 2EE9A 3SCMC 2V5TA 3VWJD 1RZFL 1FZOA 5GIRA 5MEOB 4JPWL 1HWHB 1MFAH 3LRGA 4G8EA 4EOWL 4H5SB 3H9ZA 3CFBA 1QO3B 3I6GA 5IB5A 3MLYH 4MCZB 5SWZD 3L7FB 3RWGB 3SE3C 3NAAH 3OJ2C 2XN9A 3SOBL 3S98A 3D39E 2HMIC 5T3ZH 4KVNL 4BQ9A 2ILLA 1CDCA 2OZ4H 1IKFL 2UWEF 1SY6A 4FFYL 4JFED 4ZFGH 4XB8A 3SDCC 2AV1A 3SE4A 4NQDD 2YD8A 1NL0L 4R2GC 1CXFA 4LFHD 1TJHL 3BGFB 5CEZL 2GY5A 2LE9A 3V95A 3OJDB 5C0FB 3MRHA 5I0ZA 1HNFA 5HHME 3TBYA 2IBGA 2NY5H 3FQXA 3QDME 2RGSA 2L7UA 3L3OA 1WCQA 3MJ9H 4NQXB 2AI0L 1I4FA 3DSFH 1MFDL 3E2HC 3DXAA 4Z77B 1PQZB 2AP2A 2W60A 1FH5L 3SDXF 5I75B 4JO2L 5T1DL 4MA7L 1PZUB 3P73A 5A3ID 3FQRA 5K33A 5LBSH 4QRTB 3T0VA 2IJ0C 2A73A 1J0ZA 3O9WC 1WWWX 2NY4C 1MCNA 2QQQA 3ZE2F 3Q48A 43CAB 3HS0A 1JF5A 4DKFH 1FFNB 3MGTB 3PGCB 2GTZB 2ZSVB 3JWDL 3MNZA 4NNXA 2VLRB 3MRJB 4M03A 5L88L 5D7JD 1SMOA 1T1WB 5J3HD 4O5LH 5DJ6B 4G8FA 5KSUB 5I1CH 3AVEA 3O8XA 4WO4D 2BNRB 5I30H 2M26A 4HIIA 4Y5YC 3GMOA 4PJ9B 5TH2A 3BJ91 3PWJB 4F37K 3FN3A 4KROC 4Q9RH 1F11A 2HJLB 1ONQB 1KJ3L 1L0XA 1HXMB 1UCTA 3NACH 5KG9A 5HHXL 4PJAB 3BH9A 3PQYB 3RDTA 4OLYH 3X11A 5I6XB 2NR6D 5CZXC 43C9B 2V6HA 3ZZ1A 4GBXA 4Z7WB 2WBJC 1KOAA 1AHWA 3KS0H 4NT6B 3KJ4B 5CWSA 2GCYA 5T3XE 3DWTA 3IFLL 2A38A 3D3VE 2BFVL 5C0DA 1JPST 4U6HA 3I2CL 1FLRH 2FEDC 4PJBE 3TNNB 4GRWH 3U46B 1TZHA 4XXDA 2EDJA 1CU4L 1MVUA 3STLB 4D0CA 1T0MA 1QSED 5I16B 1N0LA 2O5YL 1H8SA 4ZTOH 4OFYA 4JRYD 5L9DL 4O9HL 3RJDA 2Y4SA 3BPOC 3ARTA 4PJ9D 2YWYA 4PR5B 2FIKA 2VL4A 4J7RA 3ILPA 2YPVL 1OSPH 1UM4L 4APQA 5FOBA 1FFPA 4FA8A 3EO1B 1FL5B 2FJHA 4JN2A 4LU5L 1ZT7A 1BQHG 5DEFB 1ES0A 1MNUL 2B2XH 3CMOH 5IVXF 3DRQB 4CW1B 1FGNL 3JWNC 5F7WC 4KY1L 4JFYB 4R0LA 2Z31D 4OCMC 4CVZB 3U1SL 3QHFL 5IW3A 2YA1A 3WCYA 5BVPL 3C6LB 4RISH 4Z7VF 3QUYC 3LKPA 4PJ5E 1OP3H 3O4LA 4M48L 1TDQA 1JN6B 35C8L 3VH8A 4UT9L 5JORB 3LKOA 3O6ML 1U92B 1P1ZB 3SKUD 1LO2L 3VG9B 4WFGE 1BAFL 2Q87A 3OAYH 3ARXA 1H8NA 4M48H 2CGRH 3EOTH 2R2EB 1TITA 2AJ3B 5A2LH 4P2QB 3BZFB 1JTTA 2EDNA 2YUVA 1I3RA 3DHMA 5EC1B 1UGNA 3AS1A 3CFCH 3MZGB 2JB6B 4KZDH 3S36H 3RVTC 5F1IB 2FYYA 1BX2A 3G6AA 4OIIL 4XP6L 2W9EL 5DQ9B 3RWJB 1R6VA 4XCEB 4KJWD 2DIJA 2BRRL 4JM2B 1J1XL 2SEBB 5KSVB 2V5MA 2YPLE 5GGQH 1MCFA 4XHQA 3RP1A 2WUBH 4EVNB 4P4RB 3TYFB 1YPZE 4UQ3B 4YC2B 1G0YR 1NAKH 5C2BH 5FYJL 4HD9A 4X6FA 5FUCC 1KTRL 5F1NB 4XP5L 4AYFA 4WU7B 4WGWB 2GUOB 1W72L 4P46B 4YDVB 3DROA 4P3DB 2ERJB 1BGXH 3WN5A 4F7PB 3TPKA 2BHYA 4XNUH 4EN3B 5IV2B 3DVGA 5J06A 3WS3B 5EBMA 5H94A 5JOPE 3JSSA 2XKUA 4G80B 4DZ8A 3EGSA 4P59L 3B9EA 1A6ZA 1UA6H 4X9FA 5LWYL 5CSGA 5CLWA 3MOBL 4UDTB 5DI8B 3CVHA 5K9OA 1FNEA 5IVXB 3TJHC 3L3DB 3WHXB 1TETL 4AEFA 3VFWB 4ODWB 5GZNC 4BSVA 4APQB 2DQFA 3HI5L 3MBEB 1FFOA 3OAUH 3CMGA 3IDMA 4U2YA 1YEIH 4HWEH 1BVKB 2X2YA 3PP3H 3I75B 3NFPB 3BGMB 1IT9L 4XWOD 1OARL 4F33A 4EI5D 3HR5B 3PNWA 1FN4A 3WFHB 1OGAE 3T2OA 3C8HA 5C7XH 4HH9B 1I9EA 1DEEA 4YXLH 1LNUA 3L1OL 3BHBB 4CDGC 4UI2A 5FYJU 3DX7A 4R8WL 5CSZA 5JA8B 5E2UH 1CT8A 1UJ3C 2KZ1B 4GKZB 3V9FA 3NCBB 1I1CA 1D7FA 1RZ8A 1QRNE 2IANE 4LHQB 1BOGB 3DHJA 2ICEA 3BP5B 3R1GL 1JWUB 4G6KL 4PRHB 1LK2B 3IFPB 3CCHB 5FM5M 1JWSA 4M61A 5D7KE 3O2WL 2EYSB 3VXMB 4PGDA 3BEWA 3NGBB 2XZAH 3QIBD 3EFFA 3SKOB 1BQHB 1U42A 3CNKA 3UTQB 4BA8A 2XACC 5SWQA 4WUUB 1KV3A 3RNQB 1A7QH 4XCYA 4ZPVA 1EZVX 5HYIA 1KJ2L 5F71A 4G7YH 1Y18B 5DWUH 3O6KH 4I2XB 3TO4D 1T22A 5C0IB 4ZFGL 3GJEA 4HJ0D 4PJGA 2CO6B 4NQSA 3V7AG 5HGHB 4OZIE 5DD1H 4M3JA 1UWEH 3FT2A 3UZVB 4TSBL 2E8ZA 4XRCB 4ZO8A 3AY4C 1Y18A 4UT6L 3RHWF 5C3TA 5C9JB 5KSBB 4KQ4H 2J2ZA 2GSIB 1QRKA 2YOCA 4WHDA 1YJDC 3MRMB 3F6IA 3WO4C 3P73B 5BRZA 1KTLA 4EOWH 4WU5B 1AGFA 1PZ5A 1M7XA 3ARBB 3QQ4B 4GRMB 3TBTB 1I75A 1OCWH 3DETC 5D1ZC 4NQXA 2WINA 3CVHL 1YA5A 2C1OA 1B6UA 4JRXE 4ONFH 4KJQC 2RFXB 2VE6B 3ARFA 4BKLB 1OAYH 4HKZB 1B0GB 3FO2A 1EHXA 2P5WA 4LDEB 4H8WL 1A22B 4XX1G 2DYPA 4LVHB 3GUTB 2XKNB 2YN3A 4YAQB 3FFCB 4LF3A 4R3SB 1H3XA 4Y8AA 4KKBD 3T77A 4HH9A 4NC0B 4E9LA 4YDIL 4L8BA 4CL7A 2COQA 3WFHA 4ODHL 1CFQB 4JRYA 3HZYB 4RAUA 1F6FB 3IXAA 4G42B 3TCXA 1VEOA 1JHKH 3MLVL 1N6QL 3RUGE 1Q9OB 3QNZB 2AJYL 4J3UA 2X9YA 3T4YB 1NCDL 1X5GA 4IRZH 4D94A 1I9IL 4ZUSA 1CL7L 3UJTH 5IR1B 1F45A 4EUPA 4K3GA 2LV4A 3TFKC 3DUHA 3CXHK 1UXWB 4PLKD 4K94H 5HGDA 5C0CB 4G3YH 3DMMD 1D5IH 3EGSB 2FB4L 12E8H 2XRAH 1OP9A 3WKNA 3TVMB 1X9QA 3NZ8B 1PKQA 2GITA 1T2QH 2OR9H 4KQ3H 4YH6A 3VD9A 1OQXA 4M1DH 1CFSB 2X40A 4D8PA 3ROOA 2EKSB 2W91A 5LQBL 3WUWG 1LHZA 4X6FB 1AXTH 1PVHA 1XZ0B 4QHKI 1OAQL 3TN0A 4GRWF 3S4SG 3VXSA 1IE5A 1YPZA 5HDOA 4Y4FB 4NO0B 1VHPA 4N0YL 5KW9L 1QUNA 3W11D 1XGPA 5C07D 4LHUD 5I1HL 4I48A 5GGVY 4O2FB 4FQ1H 4KTDH 1MCHA 4LQFH 1BEYL 1N64H 4K2UH 3QJHB 4XPHL 4MDIB 1A7BA 1OTUC 1G9NL 4XBEH 1L9NA 4HUNB 5FAAA 5C09D 2E9IA 2YS4A 4GXVH 5EO9A 1WLHA 5C0EB 1BGXL 2NY5C 4PYGA 3B9KB 5DJ2A 1D5ZB 1PJ9A 3BDXA 5I1AA 5CINL 1HEZA 4XMLL 5CZXD 3EYUL 2PO6C 4NO3B 2G9HB 4PJ7A 4OM1L 3JWOH 3RJQB 4E42B 3LY6A 4ODXB 4R0LB 2PR4H 4JB9H 3LQZB 1R5WB 3WHE0 1FV1A 5CS7A 4HG4K 3RTQA 2P5WE 2QHRL 4I18A 1DLFH 3O3EA 1ZT7B 3RI5F 4MHHG 4X4XA 4XCFL 3PQYD 2BY2A 4MJ5B 3BUTA 4ZUVB 4BQ6A 4EXKA 3T3ME 4H0GA 2NLJA 3SBWA 3OMZA 4QRRB 4NC2B 5C09E 1MHHA 3UPCA 3ZE2E 3GRWL 4MQ7B 5E03A 1RK0B 3MR9A 5KVDL 5I8OH 4IS6B 2NX5A 1UVQA 1NFDF 2HFGH 3SGDH 1XGRB 3HMXL 2VTFA 3IJYB 1MJJA 4PJ7B 4JRYE 5HSFA 4PBWD 2YC1B 3OR7B 5FB8A 2H26B 4PRIA 5CZVL 4G6AC 2GCYB 15C8H 4FFVD 2OJEB 3MV9B 1FIEA 1BFOA 4L9LC 1KELL 2PTTA 1AP2A 1JRHH 2A77H 2G2RA 4L8SA 2F5AH 1IFHH 5EU6E 2P46B 1A1MA 4IDLA 4TVSa 4XPHH 1QBLL 4IDJL 5CBAB 5JUEL 4LPVA 1F42A 3PUCA 4WI6A 3MV7D 3FB6B 5F96L 3R0MA 5CBEA 2E9WA 1UKTA 3NIGE 3WJLC 3BN9C 2WWMD 3PWJA 1IGJA 3ZO0A 3QNXB 2QJDA 4X98B 4G9FB 1MLBA 5EU7E 4X6EB 1F90L 3VWJC 4Q9BA 3P0VL 1SJHA 3HN3A 2B1HH 5H2BB 1QPPA 2Q20A 4G6FD 3PV6B 4Q9QL 4G8GD 5HHOA 3IFLH 5MEPA 4XCYB 3JVGC 3S7GA 2X7LB 4QO1A 1R3LB 3BMVA 3B9AA 3UYRL 5JW4Q 1CGTA 3VXQA 3MRGA 4XPAL 5J6HB 4U3CA 2AJVL 2X4RA 5DLML 1CFVL 4FZEH 1HI6B 5ITFA 1KXTB 2E9JA 4U6YB 3NH7L 4Y8DC 2X42A 4IRJC 2ICEB 5EDXA 1RU9L 5FV1L 4R4BB 5FYLH 4AT6A 1AO7A 5DA0B 5DFTA 2Q3AA 2EYRB 3KPRE 1EFXA 2EZ0C 4OKVA 2R4SH 3DX7B 5CSZB 1NEZB 5L0QC 4X7DC 4EUPH 1TTUA 2I9LB 1YMHA 3IXAB 4G42A 4JJ5A 3OKLB 4NKMB 3CDFA 1EVTC 1DLHB 1SY6L 2DQCH 5HYSG 4YXHL 1VPOH 2CUIA 5H37H 3V6BR 2EEBA 3QDJB 3IETB 2P43B 2D7TH 2BOBB 4X6BB 2XKSA 2D7PA 2ZP0T 1HINL 2DLHA 1NEZA 4N9GA 4DN4H 4M02A 4PRPB 1CK0H 4FNLL 3U6RB 3O6FB 5C0BB 1EAPB 3GMQA 3RWDA 4PRNB 1P2CA 1MEXH 4YHNA 1CD1A 4RNRB 3ECBA 5HVFB 3F12B 4PJHF 3N85H 2G5BB 4HZAA 4N8CH 3UJIH 4LSRL 5GS1C 5TDOB 5BMFH 4HPYH 4DZ8B 1ZGLM 2EICA 3JXAA 1ZA3A 1H8OA 1U0QA 1C5CL 1RIUH 3MRCA 3Q2CA 1YN6A 2IC2A 4RDQG 4UUJB 2X7LA 1ZHBB 1FGVL 3OAZH 4X4ME 5F88B 1S7SA 1Y0LB 3N0PB 5E8NA 1I7RA 2EDHA 1FIGL 2YK1L 2NW2B 3FT2B 1P4BL 3LPGA 2Z8VC 8CGTA 4HBCH 4IOIB 3WMSA 2BVQB 4Y4KB 3FCTA 4XI5D 7FABH 1DANT 1ZANH 4M43H 3MLXH 4OF6A 4PJ7F 2NY1C 1EJ6A 2CJUH 1BECA 3SOBH 3C6LC 4WTZA 4K3EL 4PGJA 5GJSH 5C0RL 5JXEA 1WC7B 5ERWB 3TO4A 3ZTJG 2DQUL 1BFVH 1KPVB 3FAXA 2VDLL 1H5BC 4AENA 2NY2D 4TUJB 3PDOA 3FB6A 4HK3N 2AXJA 4MZ3A 5I2IA 4XBGA 2HVKB 4X6DB 3R1GH 1ZEAL 4NFCA 1U93A 2ZSWA 4RMRA 2V7NA 3B43A 5JZ7C 4NRYA 4JVUA 5DHVH 4BH7A 5BRZD 1T0NA 3ZT7A 1P69B 3PWPD 4U1JA 4ETQA 4QRSB 5EG6C 4PIRF 3QIWC 3SO5A 3TCLA 1L9MA 2OJZL 3IETA 2BOCA 1I7TA 1JN6A 5D72H 1ZGLP 1MJJB 2HFGL 1BZ7B 2EDBA 2ZCHH 1W0VA 3MRFB 3LV3B 5JOFB 5KS9A 5GRJH 2XWBB 2GAZA 3TWCL 1A7RH 3IAPA 3GSUA 5F7EL 1KG0B 1MHHB 2MKWA 2XXCB 5DQJA 1T66C 5DEFA 4WFED 4MJIA 4BZYA 5D7SL 3KGRA 5IHUH 2X4QA 4RZCB 2DM4A 1KB5H 4ONHA 2DQJH 1KPUA 1YYLH 4BSVB 3EUUA 3HNVL 1TETH 3AFLA 4JKKA 1G6RL 4JO1H 3WE6A 5C6TH 1KCSH 3O45A 1Z0NA 3G5YB 4J3TA 1K4CA 4LVEA 4FFVC 1INQA 1FNFA 3BZ4A 4OLVH 1BZQK 1DZBA 4O02L 4S1QL 4G6AD 4KRNA 2FECI 5HHPA 3OR6B 1U8MA 1WWAX 5EIIA 4XNMB 3K8KA 4MNHB 2Y06L 1N0XL 4HT1H 4P46D 4PY8J 3MUHL 1T1XB 5DD6A 2V7HA 5F1NA 4TVPE 5DD3L 3QI9B 4Z7UA 1FG9C 3T1FA 1H0DA 4M00A 5EO0A 3QJHA 2IH3B 4ZXBC 2VISA 3VFUB 1JK8A 2KQMA 6FABH 1I85C 5DR5H 4XTRD 3WFCL 2N56A 5CJXC 1G84A 3GSNB 3CLEH 2ZOLB 4FZ8H 2E5EA 1T7YA 2V9QA 5DWUL 3RGVC 1LK3L 1NEZG 1PLGL 5TQ0L 4R90H 4JFFE 3QO1A 1SBSL 2G60L 2VSDA 4U3HA 4G8IA 3V5HB 3GI9L 3JTTB 1AI1H 3T2NH 1MIEL 1HDMB 5JQ6L 1E4WL 4R4FH 1RAMA 4HIEB 4OLXL 5L8LB 3HS0B 3O0RL 2Y5EA 4P2QD 5FYKH 2DAVA 3KPSB 4LSDA 4XPGL 1UFUA 1X4YA 1QQDB 1WBYB 3CAFA 1ZHKB 1A5FL 1V8HA 1G6VK 1D5IL 5DRNB 3HAEA 3FQUB 5DTFA 5A1AA 3AGVA 4BFIA 2EDLA 5BQ7A 1KTDB 2UV3A 3DXAB 4Z77A 4C4KT 4EQ2A 5DHXB 5DVOA 3B2VH 2CIIB 2AABL 1D5MB 1UADC 3WDIA 1S7XB 4CU8A 4LCWD 3AS2A 1C5DA 1G0DA 5MI0C 2GHWB 4ZUSB 5C7XL 4MXQD 5F3BA 1CIUA 3QEUA 4AMKL 1YNTB 4U1MA 4WCYL 1KCVL 5F7UA 5IGXL 5GPRA 3B3IB 3I85A 2VLRD 5IMKA 1CFQA 5JZ7D 1NH6A 1J88A 4KTYA 5B39B 4P5KA 2APXA 3LS4L 1ZTXH 4R3SA 4L9DA 1IGFL 5BV7C 2ZUXA 2FRGP 2LAAA 1AXIB 1UQSA 3C8KA 5GRXG 5TE7L 2J8UB 1QNZH 3VFGH 2O61B 2LVCA 3UEZA 1TZGL 2GT9B 3MV7B 2BDNL 2P5WD 4WVRA 3B9DA 1D9KA 4GMTH 2GEEA 4PLKC 5TDPA 2K7PA 1W72A 3MV8B 3WKML 3NFNB 4WI9A 1DUZB 2P48B 2NY2B 4CN6A 3D0VB 4H25A 4KPHL 4Y5VA 1MQKL 5FGSA 5CJ8A 4OLYL 1HXMA 4LSVH 4PGCB 3L6FA 4M7ZC 1PZ5B 1U8OB 1NSNH 4JKWA 4KJPD 4QRUB 4JM2F 4JAMA 1T03L 5E8DH 2BVEA 2X05A 3EYVA 3SGEI 1NC4A 3RWCB 3TJEL 4UT6H 1QFWI 5IESL 1HKFA 2BZDA 4R7NA 2QKIA 4NOBA 2E7LA 3B2UD 4J3WA 4BJLA 5FCSH 3B8YA 2BVQA 3FQNB 1YY9C 3DX6A 1NFDE 2ARJA 4U1IB 3ROOB 2F53E 3OKDA 1FFNA 1I1AC 1S7VB 4PPTA 2WAHA 2DWEA 4CMHC 4XPFH 2V5RA 5E9DB 4AL8H 1NUDA 1NMCB 3GSQA 3GMMA 3CZFA 3HZVB 2GK2A 4JREC 3O41A 3UTZA 1P53A 5FYLD 3QXWA 2NPLX 3BVNA 3SE8H 3SJVB 3H9SB 1J1OL 1X44A 2QLVB 3IDJA 4KK8C 4XCNB 4IOSD 3V5DB 4Z6AT 2R1YA 4Z78A 4Y16D 3VXOA 2ESVE 3Q1SL 1YEFL 3ULUL 2OK0H 3D1MC 3PWPA 3QFDA 3WFDH 3H0TA 4TSAL 2HG5A 1KJMA 3FT4A 3IS0X 3C6SB 3HZKB 2W92A 2AK1L 4Y19D 3LKRA 4LU5H 2OZ4L 3UMTA 3I02A 2YPVH 1WT5C 3LSOB 4FFWD 3DLQR 1Z2KA 4ZFZB 4NC1E 3GUTA 4JHWH 2GSGB 1LGVA 4MCZA 5EUOF 4LDOB 1X4ZA 3BAEH 4NJAL 4OCXL 3T0EA 1X7QB 1XF3B 2W0FB 2YMXH 2WIIB 3KDMA 5FA3A 4LCCB 4HX1B 1WGOA 2C4FU 2BVTA 3BQUB 1L7TH 3K4DA 1S7XA 1TXKA 1Z9LA 4FQQB 4YR6B 5A2JH 3QDGE 4OZHE 1CFTA 1AGCA 1G7IA 2YEZA 5I1IL 3EFDL 3L95B 2APFA 2OM5A 1FL6B 2LU7A 1SM3H 2EXWC 4HPOH 4I3GA 3MRGB 2ORBL 5HVHB 2Z93A 1E4KA 4WI8A 3STZB 1ZHKA 4NKDB 1XF2A 1E4XL 5MEPB 1QLRB 1ETZA 2H8PA 2R56H 3VGFA 4RCAA 5EFIA 4HWZB 5I66A 4OLUL 1EVUA 2Y5TB 2QADC 5D70H 3H7BB 4XB7A 2HRPH 5FYKD 2HAZA 4YHPA 2F5BH 3W9EB 5FYKE 3CFEA 3IVKB 2WUBL 1NGPH 4KKCC 3P4OB 3C08H 3V52L 4P2RD 1SVZA 4G6ML 3O3AB 2X1OA 5D5MF 3MNWA 1TLKA 1CDHA 2P47B 1FRGH 4QEGA 3A67L 2ID5A 1CGXA 2AGJH 4K23L 4ODHH 3S8WA 2AABH 2AK1H 4YDIH 3WBDA 2N7BA 3AREB 2YUXA 4L9LA 1NMBL 2KPNA 3QG6A 3R4DA 4Y5YA 1MWAB 3VFPB 3RDTD 5KVEH 3BSZL 3OGCB 5TDPB 5IOPB 2WW8A 4GBXD 4HF5L 4ODSL 1INDH 3MV7A 4UV4H 4PJ8A 1A3QA 1Z6JT 3O0RH 1MREH 1BBDL 1FQ9C 3LKNB 5AWNH 3AROA 5HVGB 3IKKA 3O4LE 1B2WH 4PRIB 3EZJB 3D2UD 3NA9L 3T04D 3D5OF 3L3HB 4RGOH 3U4AA 1KFAH 2EIDA 4IJ3B 5EUOB 5EBLA 1WUNT 5F7MC 4QRPA 3VFSA 1TTGA 4MQSB 2Q86B 3PDDA 2NX5B 1V7NL 1NEUA 5L8JB 4LPUA 4R90L 4QOKD 5DQDH 2XA8L 1JNNL 1BQLL 4X7CC 2A6IA 5D2NC 3SE4C 3S3JA 1DBML 4FZ8L 3JTSA 3RKDC 5ESAA 1LQSR 3ZKQD 1FL5A 2PO6D 4PY7A 4CMMB 4H1LA 4M6OH 4NBXB 4LSSL 7CGTA 4GRLD 3MUGA 3ARPA 3O3EB 4PGEA 1PSKL 4KMTL 4QHNA 1BD2D 4U31A 1Y6KR 4U49A 2R4RH 3VXRE 5DURD 3TH3T 4NUGH 3S37H 3DVGB 1CGSL 1U8IA 2AAVA 3U46A 3GJFB 1FLRL 1NCAL 2BHUA 3BPCB 5T5NF 5C0JA 1T4KA 5IT2L 4GS7B 3BO8A 5F7HA 5I8KH 5I8KL 4QXGL 3L5XL 5IQ9B 4HIEA 5I8CB 2FX7L 2I25N 3GHEL 5IIEB 3VG9C 1T0NB 5JW5A 1AHWB 4OLEA 3MRPA 4OLZH 5C0CD 4BH7B 1I1YB 2X1WL 4K2UL 1S7WB 3VU2A 1FZKB 2ED7A 4ZOBA 1YY8B 3K3QA 3X11B 3MLUH 2DTMH 2KDGA 1U8KA 5FGRA 5M7QA 2ICES 1BIHA 4JM2A 1NCWH 1AC0A 1LEIA 1N7ML 2P44B 4PTUA 5GGVL 1CLOH 4LEOA 1IGCH 4NBYB 5TH2B 5I1EL 5FUOH 1SQ2N 3DUSB 1I3UA 1YEEL 4G7VH 4DVRL 1DQLL 1DQLH 1RFDH 1RFDL 2VISB 3VFUA 4CBPA 1V3MA 5HI3D 5FUOL 1RJLA 2PCPB 4JFHE 3HLAA 2FR4A 1IQDB 5DQDL 1GAFL 3U9PH 1AXTL 2I24N 3HCVB 1IGYA 3OAUL 3ES6B 4KWUA 2IPKA 3HTLX 2VXTL 3MFFB 4JE4B 2D7MA 2UUDK 3ULUE 1ETZB 2EO9A 2BMKB 4PJDA 3UPRB 4TUKL 5HHPB 2I9TB 2R1WB 3I6KA 4RMQA 1JUFA 2V5SA 1RZKH 3EYSH 4MA7H 4UV4L 5SWZB 1XGUB 1UACL 3P9LB 2AK4B 3WNPA 5ILTH 2VDOH 1G7JB 4S1RH 2ICCA 2W60B 3BSZH 3CC5B 5DDHA 5KN5B 2X44D 1ES0B 2BNRE 4HC1H 3G5XB 3QXDA 5HDQH 1ZT1B 4OLXH 4ENED 4DFHA 4LCCC 3F7VB 4Q6IB 5D5MB 1KT2B 1WAAE 1F58H 1YEDB 3HB3D 4OJFH 3IDYC 5SWSA 4RGNB 2W0FA 3KDMB 4PJIE 5C2BL 1KG0A 3QDMD 1MCCA 3TO4C 2GSGA 3MLXL 3W5MA 5JOFA 3CLEL 3PWVA 3QDJA 1EFQA 4LSSH 4AY0A 4EI5A 1FL3B 3PWUB 1I7TB 25C8H 3TA3B 2QEJA 2UVFA 1ACYH 3RGHA 2A74B 5DK2B 4KUZH 2DYPB 3C5SA 3H3PL 2JK5B 2DMCA 2XFXB 4LASH 3OJMB 3CSPA 3CUPB 5D8JH 3G9VA 3V4PL 5GGSY 3MXVH 1N5YH 5JDSB 1KT2A 1YEDA 2ZJSL 5FGCB 4MA8L 3NMEA 3BMWA 4BQCA 3PDOB 4WY7H 4LKCB 1SEBA 2OL3L 3H9SA 4P9MH 1NBVL 3OKMB 1HI6A 2MNUA 2ATPB 3AS0A 4JGJA 4XWOC 2PETA 4NDMB 4OKDA 4S10A 1P84J 1OY3B 4FQ2H 5K9QG 1JNLH 1QLFA 4ZFOB 3HKFA 2D31B 1PW3A 3QDJD 4P23C 3QUKB 2GFBA 2B2XL 2NY3B 3CMOL 2IFFL 1S7RB 4P9HH 2XTJD 2X10A 4RQQB 4U1IA 3H3KA 3PDGA 1ND0A 3D87B 2HT2C 4FTVD 3QUKA 5D93B 5E2TH 1S9XA 3HUJB 3BWAB 5T5FL 3TYGH 4BK5A 1ZHBA 1TQBC 4NQEB 1QBML 1CE6A 4XP4L 1BQHA 2NXZD 4F2MA 5FHAH 5GJTH 3VXMA 4F9LA 1D5XB 3CFJA 4CKVX 3QQ3A 4N5EC 32C2B 1YEJL 2BSSB 1YY8A 4DOHE 3MOQA 2NW3A 3CU1A 5DJ8B 3O4LD 1EHLL 4YHMH 1WFOA 3Q5OA 1G7LA 2GI7A 4AIZB 4UU9A 5ALCL 2IAMC 1QYGH 3HFMH 5FIEA 1J8HE 4AL8L 3GZKA 5CJOH 1HZHH 3BHBA 5F7NC 1E27B 4O58L 1VENA 5TE6H 2WBWB 2VLLA 1G7PB 3LEYH 2VDMH 3PWUA 2YWZA 5EIVA 5HBBA 3TZVA 4L8DB 3C5ZD 4EI5B 1FN4B 5EU4A 5IEHA 4V1DB 4C56A 2IF7A 3TM6A 1IT9H 3OGOE 3ZKXB 1YMHB 3MREB 4ZS6C 5CEZD 2BC4B 2W07A 5DVLA 4PD4K 4Z7OF 3ZHLA 1A4JB 5IFHH 3MROA 4HBCL 3VFRA 3HMWH 2ED9A 3QHZH 4I8DA 5HHNA 3MV01 1BD2A 2W0LA 5HYQA 3RX5A 4KDTA 3MRNA 3PF2A 5IVXA 4Y5XA 1A1OB 3JUYA 2FZ3A 2ESVA 4KPHH 4LAQL 3GSVA 5FFLA 1WZLA 4HPYL 4G80A 3VMPA 3MJ8A 4XNZB 1K4DB 4IMKC 1JUFB 4LSRH 15C8L 3QUYD 1E6JH 3WN5B 4UOW0 1MY5A 1GZQB 3VFGL 1MCJA 2AJSL 3LQAC 4XNQA 2OTUB 5D2NA 3QG7L 2VN7A 4JFDA 5J9PB 2AI0H 3S36X 2JCCE 2B0SL 2DB8A 3HRZA 1DEDA 2KKQA 2IMMA 5B8CB 3VRJA 4ZUTA 1JF6A 4CVUA 2JJSC 1JRHI 3LH2H 4G8IB 3V5HA 5KVDH 1NDMA 1RHHA 4PV9A 2V2WA 1WBXB 4A6YA 2CR6A 1KNOB 3V7MA 2ZOLA 3RPIA 4DK3A 2R8SL 2ZPKH 1JPSH 3NFSL 5TE4H 4F9PA 3MCLL 4MXWH 1I1RA 4IBLT 4OB5L 3WXWH 3QFJB 4JPIB 2F19L 4PRHE 2IFFH 1QFWL 2NXYD 4X6DF 3L5WA 1C08A 1NCCL 3BD5A 5JPNA 1FORL 5E8DL 1HHJA 5EBWB 2A6JA 2EH7H 2YPKA 2BVUA 1J0YA 5B8CA 4C4KO 3U30B 1RZ7L 4NN7C 4X6CE 4NRXB 3WLWC 5C08B 4S1SL 5EFIB 5I66B 3BO8B 1U3HA 1R3JB 1YC7A 4PJEE 1T4KB 5CD5C 3WDJA 2EE3A 2CDFB 5SWSE 3O4OC 4XVSL 2RIKA 3QUZA 5HGBA 4P3CL 5J3HC 5D8JL 5ICYA 1RK0A 3MR9B 3V6OC 5FECA 4OGXL 3L95A 1PKQE 3BKYH 3D9AL 4MJIE 4NP4H 3DBXA 2OLDA 4HFUL 1IC7L 2PW1B 2XN9D 1FNLA 5HYQB 1FZMB 1RJYB 5I18L 2JIXB 4Z7VB 4S0TD 3S35X 4X9IA 4YO0A 3L3KA 2VYRE 1OTTD 3MGOB 5KOVC 4NNYA 4OQ1A 4GAFB 5DA4A 3BKML 4KI5D 4QXTA 2XWBA 5ICYB 1P7QD 4X5XA 5ADPH 2G9HA 1S9YB 4YPGA 3B2VL 3T77B 2BOCB 1EIBA 2FGWH 2ZKHL 3QIBB 2ZG1A 4LEXH 1AGDA 3HI6H 1N0XH 3MLTB 4P48A 4BH8A 3CVIL 2NY6C 2FO4A 5E94A 1HHJB 2OI9C 2Z91A 3VXTA 3LDBB 4N0UA 2H9GA 5IBUB 4TUJA 4TULH 2X1XR 4LGPB 1MHEB 3DRTA 2XTJB 3FQWA 5I8EB 3RPIB 2E7CA 5DD5L 5I8OL 1OTTC 4LIQE 3A6BL 3T0AA 4YK4B 4R6UA 1TJIH 5JXEC 3CFDB 4EBQH 3BWAA 4UBDD 3TWCH 1NGYB 3PHOA 3GGWA 4MS8C 4XCFH 3SE3A 4AK1A 3JV6B 5I1EH 1GC1L 3HC0B 1RHFA 4OI8A 1MI5A 5MEQB 4IJ3C 2Z35B 1OAXL 2FJFA 5D1XD 1AKJB 3VWKC 2JJVA 3O3BB 3HB3C 4PJCE 1GGYA 3D9AH 2EDYA 3JZ7A 2CXGA 4I3RH 4JFZL 1K4DA 1GH7A 4M6NL 4NKDA 3SQBA 4JO2H 1T5WA 1ZS8A 5T1DH 3BEWB 5F89B 1P4LB 1VGKB 3QZWB 1CICA 1YDPA 3MJ9L 2PYEA 2VZUA 4GXVL 4U7MA 1KN4H 2A0LC 3RVTD 4I18C 3ULVL 1UJ3A 2HMID 1KEMH 3MRHB 1QSZA 2AKRB 3V5KB 3WIHL 5J12B 3K46A 5IFAH 1XF1A 4KXZH 4QYOB 3MJ7A 5D6DC 1AC6A 5I74C 5HI5C 1UQSB 3U0PB 4YDKH 5L6YL 3E8UL 4YBQD 3VJ6A 2DQJL 5SX5K 1LO5A 4M4PA 5IHZB 5IHUL 1GGTA 3ZYIA 4GAJL 4Z7NF 4ALAH 3FTGB 3EAKA 2HN7A 3WUZA 3OKNA 5IJVA 1FJ1A 5IF0B 2GKIA 4QWWC 2APTA 5E6ID 4N1CA 5CP7B 5I19H 1AD9B 4JFPB 4J3VA 5BS0A 1JMXA 1VB9A 2CKNA 3UZEA 5T1KB 1G7LB 2EYRA 2L0DA 5GIRB 5MEOA 5DJYA 4U2ZA 4Y19E 2YKLL 3LN5A 4P5MA 2DDQH 3N85L 1F6LL 4KHXH 1AIFB 3LRSB 4NM4H 5EU3A 3V4UL 4HV8B 1MLCB 4KDVA 5EU7C 3ULUD 4NGHH 5AUMB 1QRND 2IAND 2R23A 3KAAA 1IGTA 8FABB 1VFAA 3VXUD 2EH7L 3UTSA 1YJDL 4UV7H 4PJGE 2NCMA 4K8RD 2BMKA 3JUZA 4M93C 4PB9H 4N1EA 1UC6A 4KVCH 1S9KC 2FSEB 3IAGC 3QWOB 3CXHJ 3EJYD 5HYJA 5I1LB 4KJPC 4H20H 5C07B 2FD6H 4M7LL 4C83A 4IRZL 4Y1AD 1FYHB 4PJHA 3KPPA 3BKJH 3I50L 3HC4L 2E7MA 1HHIB 4OD1H 1N8ZB 4KK9C 3JWDC 4Y4HD 3G5VA 3GSNL 2FH6A 3RWCA 1KCRL 4K7PX 5T5NG 3D18A 2NR6C 4ZQKA 1DCLA 5EULV 4GW4B 4Z7NE 4DK6A 3HI5H 4NSKA 3LPWA 5I8EA 4PJDF 4K7FB 4L5FH 1B88A 3L6FB 3UDWC 2APWA 1X5LA 2BXYA 3QG7H 2W1NA 3WL9B 4HUMB 4P49A 3NPZB 3HNSH 1I1AA 3RKDD 1S9WA 1TQBB 1IMHC 3VXUB 1T0PB 1A9BA 3L3JA 2R2EA 4XVTH 5IK3A 4LHUB 5D7JC 4UNTA 3RBGA 4QXUH 4XGZA 2FJGB 2FGWL 2ZKHH 4EUPG 3RL1A 1PD6A 5DXWA 3RIAF 5E4EC 5JHLL 4MNHA 5C0JB 4JY5H 4P0DA 4OF7A 4HKBB 1F13A 1NJ9A 3CXDH 2AJXL 3UYPA 1UVQB 1G6RB 1QG3A 1K4CB 4DVBB 2EXWD 3WSQH 4LVOB 2OQJB 5GGQL 3O45B 4W70A 3RZCD 5F1KC 1KENH 2FBOJ 4TRPL 2FJHB 4JN2B 3MBXH 4KGJA 2ZNXA 1U8LB 2A83A 4ZUVA 5I18H 5I17A 3A6OA 1HH9B 3O6LH 3ILPB 3P4LA 4MD0B 4H20L 3NTCH 3S96B 4NP4L 1LO0H 4OT1L 5F96H 4D2NA 2BXZA 2ITCB 4UINL 5I16A 3D3VD 1YZZA 4HG4J 4J6RL 3N1PC 5C71A 4FFWC 5E1AA 3UTOA 4PJFB 5IG7B 1EHLH 3SDDC 1BOYA 1BM3L 1MSPA 3VGAC 1MH5A 4NN7B 5DHVA 5ESVB 3G6DL 3TCLB 3TT3L 3MFFA 3RY6A 3D85D 3MPCA 2EIZB 4KHXL 3SE8L 3ES6A 1XCTB 3IU4L 1IM9D 5IB3B 1JFQL 4JDTH 1MCPH 1D6VL 4CUCA 5HHOE 3F62A 4U6VL 1X5XA 4P4RA 3SGKA 1QFWH 3VFPA 2HJKA 3SDYL 5AZ2H 3DUSA 3TYGL 1P7KB 3PQYA 2VDKH 1YQVL 4JFFA 3U36B 3QPXH 4LK4A 1UWGH 4WENB 3PIQA 3TO2B 2QQNL 1K3IA 1WZMA 4KK5C 4L4VA 3P11L 1LMKA 2Y7QA 4NSKB 3EOBB 1P7KA 2XZQH 1OAKL 3MNWB 3TN0B 3BZFA 1M05A 1RQ5A 3V0AC 3GSRA 4PJHB 1QFWM 1XF5A 2XZCH 2V7HB 3I6LE 1NSNL 1DQML 5E08L 1YECH 2NW2A 1U3HD 4OIAA 5IBUG 5HDQL 3X3GH 1CDJA 3LB6D 1JPFA 1JYXA 3LZFH 4DN3L 3LKPB 5JMOC 4HXAH 1DQDL 3V0VA 1JRHL 2A77L 3W0WE 1ZA3B 3LHPH 3RUGF 5JA9A 1BWWA 4DN3H 1BZ9A 3KPLA 3TESA 2OTWB 1RULL 4QNPF 3MV9D 4CW1A 1UYWL 2XN9E 2AQ2A 1W72H 1QFUH 4ZAKA 1CFTB 1L0QA 5CZVH 5MP6H 4QHNB 4PUBH 4XP5H 4KUZL 4P2OC 3ULVE 2HLFC 3RIFK 5GGTH 1H5BB 4L8SC 4X9BA 4PRPA 4RFOH 1E28A 4J23A 1T5XB 4NQCA 5GS0L 4U33A 4OM0L 2OQJA 2D4DA 4JG0L 3ZTNL 2Q76B 4O5LL 3SDAB 2J8OA 4IRSD 2V9RA 2CLRB 1HOCA 2B4CH 1VFBB 1YEEH 3VFNB 4PRBB 4G9FD 2B5IC 3VGBA 1UWGL 2VLLB 5GGVH 5E6IA 3KJ4C 1P5UA 2Y07H 4FQHA 1CICC 1WITA 1DQJB 1U8NB 3CDYA 2IPTL 4PS4L 4Y4FD 2E6PA 2H2SC 3BPNB 5KSAB 3RGVB 4PB0H 1WTLA 4DUXA 4OLZL 4AT6B 5CINH 5ISZA 3G6DH 3GHEH 3RDTB 2HTLC 4N8VG 5DFVC 2VLJB 4LEXL 4RA0C 1MWAL 1VGKA 2CRYA 4H26B 2EE6A 4QRQB 5D7KD 1Q9LB 5D1ZA 4ZAKD 5BVPH 4GAYB 1NCAH 4F7TB 2H32A 3LCYA 5F97E 1TVHA 1U58B 1F3JB 4GW4A 3SKJL 3WXVH 2XV6B 1SYVA 2J6EL 3QH3B 4H88H 4KTDL 3I3BA 2BNRA 5AYQA 4HXBH 5EBGA 1MNUH 4YBLC 1AQDA 1ZSDB 4LLWB 1T20B 4ONOA 4DVRH 4QHMB 4K3DH 4OCYL 3PP3K 4WUUE 2MHAB 3S5LB 5MEQA 2WBKA 1IQWL 3K81A 3S3PA 2BNQD 4F57L 3TT1H 4QHMA 1N3NB 4HCRL 1XGQB 2A6KA 1LP9B 4RIRA 4X9HA 4LIQH 1CZ8H 1MLBB 3RGVD 4XPBH 1F3JA 4P3CH 2GJ6B 4N0UE 1FFQA 3GMLA 5FKPB 5T1LA 3OKKA 2ADJB 3S34L 1FCGA 1PBYA 2X4UA 1U95A 1SEBB 3OKYA 3BP5A 4DGVL 4CVWA 4XAKE 1MREL 1SVCP 2R0LL 4ZXBD 4NM8H 1RZ7H 3RDTC 1A14H 4BSWB 4XMKL 4OLVL 1PDKA 3CSYA 1MHPL 1RUML 5JHDD 4ZNEA 1NCUA 1JV5B 1QD0A 5DK0B 3QIWB 5HHXH 3C8KB 1KJVB 2CXKA 2Y36L 3T3PF 4DGYL 4WTZG 1RMFL 2UYLA 5JQHC 1P6FA 5GQBA 5J13B 5IHZA 1I9IH 3T8XA 1SYSA 4GW1B 5E0QA 2ZPKL 4KKCD 4JVPA 1KYOK 3ZMRA 4BUGA 4M7ZB 4GMSH 4IIQC 4OZGE 1QSVA 4LSPH 3IDIA 1BJ1H 2HG5B 4G9DA 3MA7B 3PP4L 3QDGA 4XVUD 1SBBA 1QFHA 4GMSL 4G6MH 4QRRA 5DJXB 1F58L 1W8OA 4JLRB 3FB7B 1RZJL 4Z78B 3GIZH 2JIXA 4XCNA 1FNEB 4PRDB 5ICXA 2GY7B 4ZAKB 1K8DB 1MHPH 1RUMH 4GO6B 4FXLA 1F8TH 1JGUL 1Q9WB 3L5IA 3MACL 1T5WB 1ZS8B 3C2AH 4CMHB 1A9EB 4HJGB 2KBGA 4J12A 1F8TL 4D3CH 4HF5H 2FX9L 2CK2A 4NO3A 4HPOL 3UPRA 2VXTH 3DROB 1IC5L 5BXFA 1WISA 3QA3B 3B9KA 3L1OH 3F7QA 4WU7A 2ZG3A 4JFFD 2ARJB 1MFBL 1UXSB 2NTSP 4RGMB 3VD3A 3FMGH 1SJHB 3RVWD 4QT5A 1B90A 3X14A 2H45A 3UTTA 3MCKA 2JELL 5CAYB 3UTPD 3EYVB 3QNXA 4X98A 2D0GA 4GAJH 1IQWH 2F5BL 4GG6B 2P4AB 3FO9A 1LEIB 1PY9A 3QQ9D 2H41A 1HHHB 4WJ5B 2ZCKH 1ZLVK 5CIPA 4WI2A 4XNZC 2YD7A 5AEAA 5CJOL 5EOCJ 3RY6C 4M7KL 4QT5B 4JPVH 4TTGA 5DC0A 2FDBP 4U6VH 2XZAL 5D7LE 3MRPB 4YWGL 4X7TA 4MNQA 2VQ1B 3QZWG 3QIWD 3TBWA 4PJ8D 1N26A 1I9JH 5IMMA 5DHVB 1C5BL 4XPTH 2VXQH 4I9WE 2WLYA 1NGQL 3D2UA 3C9NB 4NWTL 3UAJC 4DEPC 3HE7A 5IMKB 4MQ7A 3NVQA 4JFDD 4R4ND 1EFXD 2BJML 4OF0A 1HINH 5EIQA 3NA4A 2RBLA 3SDAD 2IAMA 5J6GB 1NGWA 3MGOA 1VDGA 3KYMB 4U6XA 4IRSA 3RUGA 3MUGB 4XC1L 1HH9A 4JPKH 3QCVH 4U0RC 4YQXH 5ANMB 5CFHA 4GRWE 1BVZA 4N0RA 1F3DJ 1JZ8A 3GSUB 2YA2A 3QDMA 5AAMA 3FFCE 4EQ3A 4KFZC 2AW2A 3GRWA 4GW1A 4L8DA 4QRPB 1T03H 2J88L 2MCG1 3WEXA 3H7LA 4PRAB 1YQ2A 4UILL 2VXVL 4OZHF 5FO7B 1JI2A 4PUBL 4HHAB 2CR3A 2W65B 4YAQA 5F7FA 4PP2A 3LEXB 1EBAA 3QIWA 1XEDA 4NRXA 5EO9B 1IGML 4KV5F 4UT9H 2VDPL 1IC4L 1YN7A 4BQBA 2WP3T 4C59B 4BSWA 3L3JB 3FN9A 1G9ML 1HN1A 2V7NB 4LCYB 1RZGB 3HZMB 4JANB 1OHQA 3HI6L 2MWCA 1N5AB 4BQ8A 3BP6A 3HE7D 2BSSA 5E08H 5J56B 2IBBA 1HHGB 5LGHL 1M7DB 3H9SD 4GRMA 3TBTA 3V6ZB 3PWNA 1ACYL 4O2CB 2ADIA 5FF6A 3GMLB 5FKPA 4D9LL 1BBJA 1BQSA 4KTEL 4CN1A 4PJ9A 5J0BA 2X1PA 3HE6C 4IRJA 4OI7A 3RVUD 2D03H 3MCKB 2GSIA 2DS4A 3IU3A 3C09B 2GJJA 3K0WA 5KANG 5D7JB 4ZTOL 2YSSA 3SDAC 4D9LH 4XP9H 1L7IL 3TIDA 4RQQA 4TUOA 5C07A 2ADGA 4KJYB 4QLRA 1JTOA 4HWZA 4KK6C 1QFUL 4FTVA 3G6JE 2VLKD 3IFNL 5EOCH 2DQIH 4NN6B 1IZKA 1GCFA 2Z8RA 3QAZB 4FRWA 2VAAA 5GS3A 2FLBT 3STZA 4JDVA 1IGIH 5D2NE 1U58A 1Z9OA 3IU4H 4WW2C 5KSAC 1DL7H 3GSVB 1AJ7H 2E8YA 3GHBH 3GB7A 1I85A 1CD0A 3OJVC 5D7IB 4LLQB 4IRJD 4NJ9L 2A6DB 5T3XL 1D9KC 1F5WA 3LS4H 3MUJA 3VFRB 4N0FA 4Y4HA 1UENA 3CUPA 4UB0H 1T89C 4LLMB 2QSCH 1PEZA 1RSFA 3ZKMD 1A6AA 1TVBB 3KPRB 4OT1H 1F4YL 3QUZC 2ZUUA 3FZUD 1XFPA 3RX8A 3SDDB 3P11H 2VH5H 2HN7B 2WM0A 4JPKL 4PBXA 3TA3A 4KDTC 4HWBA 2DLGA 1G7PA 3I3DA 4ELKB 5AG9A 4AEEA 2JIXD 1ZHLB 2XPGB 3E8UH 4P2YA 4NKMA 4KK5D 4ETQB 3CPLA 4Y4KD 2Q76A 2FWOB 2I9LA 1RUKL 2P5WB 4JQIH 1MFEL 1M7IB 1JGLL 4MJ6B 3P40A 1FYTE 1WFUA 5D1XA 4BSJA 3SGJC 1HKLL 4FQCH 3M1BA 3N1MC 4KI5E 4BELD 3DXAD 4QKXB 2YUWA 1K9TA 4FQLH 4QXUL 2N1KA 3I84A 3VRLF 1CICB 1WZKA 2DOCA 4LCWE 3BFOA 5DJCB 5D1QB 3PL6A 1WK0A 3EOAA 1T2JA 1MIEH 3CK0L 4JPVL 4U1SA 2HKHH 4XT1C 2PYEE 1W0WA 5GRVL 5CP3H 1P9MC 2C7UA 1FC1A 1N3NA 1AKJA 2XY2A 3MV9E 4L5FL 1ND0B 1PG7X 2DQDL 1IKFH 5CKAA 1OM3L 1S7UA 5JOEA 2DRUA 4K71C 1I7ZB 3BRGC 5KW9H 1KB5L 4HLZG 3MQIA 4I2XA 1CLCA 1IQDA 4YE4L 3WSQL 1M05B 5I1CL 3IDYB 4I5BA 1DN2A 1BQLH 4JZJC 1T66D 2X4OB 3MBED 2UY6A 3A6BH 3MLRL 4U1SB 1K6QL 4WV1A 1JYNA 1BBJB 1NBYB 2EC9T 3RL2A 1ZVYA 4LBEB 1CGVA 2DL2A 2AQ3A 2EYSA 4G9FE 5DMIL 1EAPA 3GMQB 4NQTA 3RWDB 4MA3B 3UBXA 1QYGL 4P2QA 3Q6GL 2W9DH 4MCYB 1ZLUH 3ABZA 4M4RA 1U8JB 4MJ6A 3ZT5A 2YA0A 1P6AB 2GT9A 4XVUC 4GG8B 5DRWB 4PJ5A 2FWOA 5IWLA 3ARSA 3NABH 5JXAL 1JP5A 2R39A 2X4TA 4UNVA 4G3YL 1MF2H 4L4VD 5ETUB 3GIZL 2H26A 1QA9A 5GJTL 3OWEA 2VDLH 4PRAA 1FL3A 1I8MB 5JNYA 3PWVB 1EX0A 4LLDA 2ENYA 2NNAA 4XNXL 2OTPA 2PKDA 5D9SA 3HI1B 2W59A 4JFOA 3R8QA 4NQCB 2IQ9H 2OXGA 5MERA 7FABL 3OXSB 1CGWA 3FT3B 3RTQC 2B7DT 2M1KA 2Z4QA 1R3KB 1ZT1A 1UH2A 4LLUB 5C0AB 4ZFOL 1U8HA 3ISWA 3MJGX 3QISA 4M62L 1Q0XH 5L2KD 5FM4A 3O2DL 3D85B 3NABL 4H8WH 5JXAH 1BZ9B 3PE9A 4KXZI 1QHPA 4GLRH 1UWXK 5C92A 5IM7A 4PJDB 1N4XL 5CZKA 5LG1A 1A8JH 1NKRA 5CJQH 3REVB 2OL3H 4N8CL 3BUYA 1Y6MR 5I1IH 5ID1B 2Z92B 1JHLH 2X4PB 1EEYA 5D96C 4TUOB 2IPUK 3GMPA 4DJMA 1R3HB 3KPQA 1HIMH 3VFMA 1LO3H 4XC3H 2YSSB 1CZ8L 4HWUA 5EOQH 1R0AH 2OCFD 4RMTA 3KYKL 3QO1B 5CSBA 1AGBB 5FUZL 4IMLA 1PFCA 3PGFL 3RZWA 3DX9A 3SPVB 5HI4D 1MFCL 5A40E 1OP5H 4YBQC 1ZANL 3DETD 4M43L 4O51B 5A2KH 4Y2OA 5ITBH 1T04A 2PUQT 1BX2B 4JFEE 1DP0A 1VPOL 4QTHB 4XXCA 1ZA6A 1XR9B 4U1HA 3W39B 3O3AA 3F6LA 5F6HI 4L1DA 5GRZA 5DHYB 5CGTA 3SKJH 3WXVL 2JJTA 3IVKA 4LVNB 2VZ3A 1TJGH 1C1EL 2H2PD 3Q1SH 5SV3A 3QQ9C 2VLJD 3GI8H 4ORGA 5CKGA 2W65A 4HFWA 3VGHA 3CSBA 4PJFA 2GYSA 4GT7A 5IG7A 1XF2B 4M7JL 4L3EE 5E2JA 4MB4A 4QTIH 5TQ2L 1F4XH 3U79A 1OAXH 5BO1H 4GXUM 3AS3A 1GL4B 3LOWA 2VQUA 3HUJF 1VADA 4LNRA 3NIDE 2P8MA 3TA3D 5B39G 5F9JB 2XWTB 1A4JA 1SY6H 2DQCL 3FN0L 3VCLA 1RUAH 3O3DA 4Z0XB 3UC0L 3RNKA 5ENWB 5E2VL 1M6OA 3TV3L 5DK3A 5IB4A 4IMKA 1HEZB 5LGJA 1RU9H 1DFBL 4OGAD 1E27A 2WWMC 2X4TB 4TSCL 3GJFH 2I07A 1J1PH 1QBLH 4IDJH 2D7OA 1NFKA 1LDPL 2WSKA 3SCMB 3LEVH 5ALCH 3V5KA 3KLHD 1MELA 2XZZA 3AAZB 43C9A 3TNMB 4NZRH 5IT2H 3BVNB 3SJVA 3U30C 5K9KB 1FSKB 4L3CA 2ATKA 1NBYA 2LQRA 4POUB 3BESR 4FFZL 1QLEH 5GRYA 2WP3O 4PJEA 1KSRA 3O11B 4PJFF 1NUGA 3O3BA 5C9JA 5KSBA 3N9GL 4HW6A 4U1NA 3TC9A 3DOSA 3W9EA 1T1WA 1BF8A 3LIZH 5BVJA 3RA7L 3OKDB 2FH8A 5FDWA 4PGBB 4N9OB 4KTEH 4UQ2B 2AEPL 3QDHA 4NQSB 4XP6H 3P77A 4JQXA 4HFUH 4JREB 5GGRB 3G5ZB 1T20A 2QKIB 1I7RB 2QHRH 3U4EA 4UUJA 3Q5YA 1I7UA 3OB0H 4JQVA 4ZG1A 2Q7YA 3VWJB 2I27N 1X6LA 4JAMB 5GGSA 2B0SH 1IAOB 4FXKB 4RGOL 2IFGA 3E6HB 3MA9H 3GIVB 4XPGH 5ICXB 1KYOJ 3HPLA 3MRBA 4FXGB 2DKMA 1YUHB 1DBJL 5ISZB 1UH3A 3KLAB 4DN4L 3NFNA 4L4VE 3F58L 5C0FA 3GEWB 4G8GB 1EK3A 2NXYC 4OD3L 4NNPL 5GS1B 1CT8B 4HIHA 3GI9H 4XZUA 4JFPA 1CXLA 1EMTH 4KY1H 5EU6D 1JL8A 3MOAH 1DQJA 1ZVSA 2VJXA 3AM8A 4M8QA 4FOMA 3WXWL 4OV6F 3O6LL 3I02B 2A9ML 4LSUL 4ZD3L 2F54B 4JR9L 2CKBL 5JW3H 4MD4B 1ZVSB 1HOCB 5C08E 2F9BT 3ZKXC 3NN8A 1TVBA 3KPRA 2B20A 3H0TB 3BYTA 1OAQH 1DJSA 1FZOB 3IDMB 4ZOCA 5JIHA 3DARA 3T4AB 2C1OB 4HCRA 4Z7VA 1NMCC 3ZE1F 5LQBH 1AR2A 3VXNB 4R97B 1MRDH 1KTDA 3K2MC 3IS1X 3O41B 2C3HA 3SGEH 4P4KA 3DMMC 1ADQH 4TVPH 4UT7L 5MI0B 3BXNB 3VWKB 5DMJB 2CDFA 4EN3A 5IV2A 4YHKH 3QNYB 4NKOA 1UT9A 4Q9QH 3TFKD 1BEYH 3RWFB 1J1PL 3PV6A 2FEDD 2EECA 2EH8H 3ZLQC 4LPXA 4P2OD 2NY7H 4IIQB 4NZTH 4UQ2A 3GGWB 4HS8L 3ULVF 4OUOA 2CPCA 4JZNB 3TPUA 3TYFA 4X6EA 3C5ZC 3MO1B 2EDTA 2UZIL 3QH3A 1NC4B 4JO4L 1EDQA 1WZ1L 3VI4E 3RFZC 1AKJD 4H8WC 4O4YH 5IW1B 4G5ZH 1Q1JL 1WAAF 3OHXA 1MHEA 2FYYB 2OSLA 3DI3B 3G6AB 3P4NB 5JIKA 1T6WA 2YD2A 2ZNWA 2VLJA 1H15B 1J10A 1A7PL 3T0WA 4J3OC 1YJDH 4UV7L 4PRHD 1N2RA 4U1LB 4JFEA 3BPLC 4CU7A 4DGIL 3WUWA 3SCMA 3VWKD 1FNSL 4NWTH 1FPTL 4NQDA 1UZ6E 3PWLA 5KZCD 2OJEA 3MV9A 2WV3A 5BS0E 3S35L 5EOTA 5ID0A 1OSZA 2MFNA 4ELMB 4GFTB 4UTBL 2NQCA 2WBJD 1OVZA 1U8IB 1RD6A 1MCWM 4M7KH 4I3SH 1D6EA 1KXVC 3G5YA 1OWWA 3ZKNC 4ZMAT 4MS8D 3H9SE 4K3EH 3SDCA 1U8HB 1YMMA 2XWTA 3L3KB 1BD2B 4MD0A 3BDBA 2BNQE 1FFOB 4WUUD 3FT3A 4I0PB 1QSFD 4H1LB 5ACLA 4ONHB 2JJSA 4ODWA 5KS9E 1ZT4B 1ODAA 3NCJH 4PR5A 4I18B 3KLHC 3ZT6A 4N90D 3SDXA 3ROLA 5CMAB 4XP1H 1NLBL 4YNYA 1J86A 3T0ED 2IADB 1A6ZB 1JNNH 2EEDA 4LPYA 1G1YA 1NCBL 4ZUWB 4M1GL 1MFAL 1HXYA 1YNLL 1NJ9B 3IKCB 1EO8L 4U0QB 1LO4L 1IC5H 1X6NA 3JV4B 4EIGB 4MVBC 1B2WL 1XF5B 3ARYA 4R0LC 3RZCC 3MXVL 1N5YL 4PJ5B 2R69L 5IK3B 4M5YL 4OI9A 1HKLH 4FQCL 4OCLC 4OF3A 3WUWB 4LQFL 5E00B 4Z7WA 3U48A 4CRPA 4Z7QF 3UBXB 2O5XH 4Y5YB 3U4BH 3TA3C 5FO9B 2DMBA 1QSEE 2ICWA 4EDXB 1AQKH 1A7PH 3BIKB 3DUUB 5L2KE 3U0TB 5E6YA 1BQUA 2VXSH 4GQ9H 4FHBD 4W6WB 3GSXB 1WFTA 3BD4A 1FC2D 4JO3H 4LP4A 1IL1A 2YR3A 1LEKA 4MAYB 1CE6B 2IQ9L 3SGKC 3S9DB 2UZYB 2PYFA 3QXAB 4L1HA 4IEFB 4I5BB 3BISA 3BI9X 3DO3A 1WBXA 1WZ1H 4F15B 4F80A 2IH3A 1NDMB 4CADB 5GZND 4YHPB 2EDXA 4YJZL 3CH1A 2YPLB 5IB3A 1ZLVH 2BSTB 2R29H 2ZSVA 5DD6B 3KXFB 1EEZB 1JWMB 1SJVA 1T2QL 3UZQA 5BXFB 5ESVA 4WUKL 2C4XA 1DN0A 4RBPK 3IJHB 5E8NB 4XNMA 5EPMB 1IM3A 5CEZE 4JCLA 3RI5K 2FHFA 2MCPL 3MJ8B 3BZ4B 1KGCE 1NC2B 2QSQA 1XF4A 4P4KB 3TIEA 2CLVB 2ORBH 3UYRH 4NDMA 4HV8A 2G5BA 3CDGA 3QUXB 1T7ZA 4PP1C 1NGZA 4RGNC 4W4NA 1CVRA 3ECBB 1DBBL 1X5YA 1EERB 2AK4D 1B4RA 5D93C 3EO1A 2R29L 4YX2H 2VR9A 2CD0A 3FQXB 4YZFF 1R5VB 1NFIB 5BZWA 3VW3H 3D48R 2V9TA 4P2RA 4APQC 3AU1B 1AD9A 3HI1A 1G9MC 2AEQH 3DJ9A 4YGVA 1AR1C 4HWBH 1UCBL 3M45A 2NNAB 1FJ1B 4C56B 5F7LB 1KBGH 1CLOL 4QHLA 1CG9A 3S97C 2DI9A 4GRLA 2H6PB 2P5EE 5IW6A 2UYLB 3HMXA 3RL1B 1WIOA 6FABL 1KGCD 4YDLB 1EGJL 1KULA 1WJ3A 4BZ2H 5E1HB 5DC9B 2XA8H 4LRIC 1T7VA 3QDGD 1OGAD 1M1SA 3AU1A 3WFDL 1A9BB 2MTPA 2UUDH 2ZZUT 3ZYJA 1S9WB 2PYED 1A3LL 1UJ3B 3CVHH 2CGRL 3L5XH 3R0NA 4XNUL 5B38B 5IKCA 2GJZA 1JHTB 2YN5A 1BBDH 3CFJB 4Z76A 3E6HA 1QSFE 1HE7A 1JBJA 1K2DA 1JCKA 1EXUA 2VXVH 3S37L 4LDLB 2FEEI 3S5LG 2J88H 2P42B 3V8OA 3P9LA 3NGBC 3QUMH 4AH2A 1S7QB 4PS4H 2ARWA 1VESA 5AYUH 2CDEB 1J18A 2Q6WB 4ZYKA 1OW0A 1HILA 4YIQB 5M94B 3VG0L 3G08A 1YYLL 3TH2T 2V2XA 1NCNA 4FTVE 2KQNA 3A67H 5HGHA 4N8VB 1CGYA 1IKNC 5H35A 2H32H 1WBZA 3VG0H 3MRDA 4KZDL 2VL5B 4EKXA 2B1AH 4HS6A 1Y6NR 3HE6A 3UTTD 4OZIB 1O7SA 3UPAA 2E6QA 3UTQA 2F15A 3FQRB 1J8KA 1TVHB 1IGTB 5B3NA 2YD3A 3DMMA 4RMUA 1ITBB 5D6CA 4PGDB 1D6VH 2WQ8A 4O2CA 1MAMH 3T2QA 3T0EE 4G6KH 2HTKD 2R2CA 2DL9A 2C4FT 3LN5B 4P5MB 5EWIL 5MENB 4NZRL 3AAZA 2WBJB 3E1F1 5KOMC 2F53D 5HYEA 4MMZC 5C70A 4HXAL 1C16A 4XBEL 4M1CD 4X4ZA 1M7IA 3ZHDA 3X3GL 5JPMA 2NXZC 3SN6N 3UBXI 3QO0B 2I07B 4UINH 3C5SB 5CJ5A 1U8NA 1U36A 3QIBA 1LNUB 4TSCH 1G0XA 1QKZL 1EGJH 2NY0C 3IFNH 5EOCL 3KJ6L 2YD4A 4Q2ZA 3DI2B 4O4YL 4LLVA 5IFHL 4ZUWA 3BAEL 4NJAH 3HG1D 4KROD 4ZOAA 2HWZL 1NGPL 4V1DE 4F7CB 4YNYB